F494784

General Info

Members Datasets Scaffolds Average Seq Length
1563 500 1400 562

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0000102|Ga0466972_0000102_31162_32991
Length 609
Sequence LPFVPSLRKINLLRVKQTFNKRKLPSKKTIAMPGDSLHVNNKAVAQNSYDAIVIGSGISGGWAAKELTEKGLKVLMLERGRNVEHIKDYKTANLNPWDLPHRGQETNKQRNDFPVASRDWAGGTIAYEQLMNYWTNEKDCPYVEKKPFTWWRSYQVGGRSLLWGRQSYRWSDFDFEANARDGYGVDWPIRYRDLAPWYDHVERFAGISGSKEGLPQLPDGQFLPPMDLNCVEKDVSDRIKAHYKNQRHLFIGRVANLTAPIEGRTQCQFRNRCWEGCPFGGYFSTQSSTLPAAMKTGNLTVRPWSIVTKLIYDAAAKRAKGVEVLDAETNKTYEFYAKIVFVNASALNSTWVLMNSATDVWPGGLGSSSGELGHNLMDHHYMLGAKGTVEGFEDKYYYGRRANGFYIPRFANLFGDKRNFLRGYGYQGSASRGDWHRDVAELNVGIGAELKEALTEPGAWTIGATGFGEILPYHENKISLDPTVKDKWGLPVLAMDAELKENEWNMRKDIIQELVAMYEAAGVKNIKTWDSKGYAIGQGIHEMGTARMGRDAKTSVLNAHNQVWDAPNVFVTDGACMTSSACQNPSLTYMALTARAADFAVSELKKGNL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
3 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
4 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
5 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
6 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
7 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
8 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
9 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
10 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
11 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
12 2643221582 Rhizobium sp. Root651 Isolate Unclassified
13 2643221593 Lysobacter sp. Root690 Isolate Unclassified
14 2643221693 Rhizobium sp. Root491 Isolate Unclassified
15 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
16 2738541278 Niastella sp. CF465 Isolate Unclassified
17 2738541283 Pedobacter sp. OK701 Isolate Unclassified
18 2738541284 Pedobacter sp. YR016 Isolate Unclassified
19 2738541302 Pedobacter sp. CF074 Isolate Unclassified
20 2738543023 Pedobacter sp. OK628 Isolate Unclassified
21 2739367656 Pedobacter sp. CF523 Isolate Unclassified
22 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
23 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
24 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
25 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
26 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
27 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
28 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
29 2818991457 Xanthomonas translucens 569 Isolate Unclassified
30 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
31 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
32 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
33 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
34 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
35 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
36 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
37 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
38 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
39 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
40 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
41 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
42 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
43 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
44 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
45 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
46 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
47 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
48 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
49 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
50 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
51 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
52 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
53 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
54 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
55 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
56 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
57 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
58 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
59 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
60 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
61 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
62 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
63 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
64 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
65 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
66 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
67 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
68 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
69 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
70 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
71 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
72 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
73 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
74 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
75 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
76 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
77 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
78 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
79 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
80 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
81 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
82 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
83 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
84 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
85 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
86 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
87 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
88 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
89 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
90 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
91 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
92 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
93 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
94 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
95 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
96 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
97 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
98 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
99 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
100 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
101 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
102 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
103 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
104 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
105 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
106 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
107 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
108 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
109 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
110 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
111 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
112 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
113 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
114 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
115 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
116 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
117 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
118 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
119 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
120 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
121 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
122 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
123 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
124 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
125 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
126 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
127 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
128 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
129 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
130 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
131 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
132 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
135 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
136 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
137 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
138 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
139 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
140 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
141 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
142 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
143 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
144 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
145 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
146 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
147 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
148 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
149 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
150 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
151 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
152 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
153 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
154 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
155 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
156 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
157 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
158 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
159 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
160 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
161 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
162 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
163 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
164 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
165 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
166 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
167 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
168 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
169 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
170 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
171 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
172 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
173 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
174 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
175 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
176 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
177 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
178 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
179 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
180 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
181 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
182 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
183 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
184 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
185 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
186 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
187 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
188 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
189 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
190 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
191 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
192 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
193 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
194 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
195 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
196 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
197 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
198 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
199 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
200 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
201 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
202 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
203 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
204 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
205 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
206 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
207 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
208 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
209 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
210 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
211 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
212 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
213 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
214 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
215 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
216 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
217 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
218 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
219 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
220 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
221 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
222 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
223 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
224 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
225 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
226 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
227 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
228 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
229 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
230 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
231 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
232 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
233 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
234 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
235 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
236 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
237 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
238 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
239 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
240 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
241 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
242 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
243 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
244 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
245 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
246 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
247 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
248 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
249 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
250 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
251 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
252 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
253 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
254 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
255 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
256 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
257 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
258 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
259 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
260 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
261 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
262 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
263 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
265 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
266 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
268 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
269 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
270 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
271 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
272 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
273 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
275 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
333 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
334 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
338 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
339 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
340 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
341 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
342 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
343 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
344 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
345 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
346 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
347 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
348 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
349 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
350 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
351 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
352 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
353 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
354 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
355 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
356 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
357 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
358 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
359 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
360 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
361 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
362 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
363 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
364 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
365 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
366 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
367 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
368 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
369 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
370 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
371 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
372 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
373 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
374 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
375 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
376 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
377 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
378 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
379 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
380 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
381 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
382 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
383 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
384 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
385 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
386 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
387 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
388 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
389 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
390 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
391 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
392 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
393 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
394 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
395 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
396 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
397 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
398 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
399 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
400 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
401 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
402 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
403 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
404 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
405 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
406 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
407 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
408 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
409 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
410 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
411 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
412 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
413 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
414 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
415 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
416 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
417 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
418 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
419 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
420 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
421 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
422 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
423 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
424 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
425 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
426 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
427 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
428 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
429 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
430 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
431 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
432 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
433 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
434 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
435 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
436 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
437 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
438 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
439 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
440 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
441 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
442 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
443 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
448 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
449 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
450 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
451 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
452 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
453 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
454 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
455 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
456 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
457 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
458 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
459 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
460 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
461 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
462 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
463 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
465 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
466 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
467 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
468 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
469 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
470 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
471 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
472 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
473 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
474 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
475 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
476 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
477 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
478 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
479 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
480 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
481 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
482 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
483 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
484 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
485 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
486 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
487 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
488 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
489 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
490 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
491 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
492 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
493 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
494 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
495 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
496 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
497 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
498 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
499 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
500 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.75
Metatranscriptomes 0.32
Isolates 7.93

Biome Distribution

Category Percentage (%)
Aerial Root 0.32
Bulb 0
Endosphere 7.81
Nodule 1.34
Rhizoplane 0.83
Rhizosphere 79.65
Stem 0
Stem Tuber 0
Unclassified 10.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_12447 2162886007 Bacteria 3387
2 SwRhRL2b_contig_2612864 2162886007 Bacteria 20804
3 SwRhRL2b_contig_2634945 2162886007 Bacteria 11530
4 SwRhRL2b_contig_2665035 2162886007 Bacteria 21834
5 SwRhRL2b_contig_55046 2162886007 Bacteria 3163
6 JGI24740J21852_10010037 3300001979 Bacteria 3668
7 JGI24739J22299_10006142 3300001989 Bacteria 4537
8 JGI24737J22298_10000041 3300001990 Bacteria 37211
9 JGI24737J22298_10008344 3300001990 Bacteria 3472
10 JGI24735J21928_10000001 3300002067 Bacteria 650042
11 JGI24744J21845_10001354 3300002077 Bacteria 4844
12 JGI24744J21845_10006117 3300002077 Bacteria 2495
13 JGI25162J39368_1000024 3300002737 Bacteria 229507
14 JGI25162J39368_1000055 3300002737 Bacteria 147236
15 JGI25162J39368_1000121 3300002737 Bacteria 85899
16 JGI25162J39368_1004071 3300002737 Bacteria 3641
17 JGI25152J39213_1000112 3300002773 Bacteria 57349
18 JGI25150J39212_1000458 3300002774 Bacteria 17923
19 JGI25151J46595_10000016 3300003187 Bacteria 249712
20 JGI25151J46595_10000057 3300003187 Bacteria 151052
21 JGI25406J46586_10021001 3300003203 Bacteria 2628
22 JGI25165J46597_1001182 3300003214 Bacteria 15943
23 JGI25153J46596_10000041 3300003215 Bacteria 162103
24 rootH1_10003753 3300003316 Bacteria 18562
25 rootH1_10038419 3300003316 Bacteria 20328
26 rootH2_10001101 3300003320 Bacteria 45863
27 rootH2_10002858 3300003320 Bacteria 54174
28 rootH2_10008234 3300003320 Bacteria 5443
29 rootH2_10023917 3300003320 Bacteria 7262
30 rootH2_10057849 3300003320 Bacteria 28142
31 rootH2_10069618 3300003320 Bacteria 6933
32 rootH2_10165063 3300003320 Bacteria 5877
33 rootL2_10012957 3300003322 Bacteria 12025
34 rootL2_10087003 3300003322 Bacteria 7280
35 rootL2_10314874 3300003322 Bacteria 2300
36 rootH1_10000227 3300003323 Bacteria 8492
37 rootH1_10001370 3300003323 Bacteria 113238
38 rootH1_10002176 3300003316 Bacteria 3895
39 rootH1_10002176 3300003323 Bacteria 75595
40 rootH1_10004675 3300003323 Bacteria 50805
41 rootH1_10122177 3300003323 Bacteria 9385
42 JGI25160J50197_1002036 3300003354 Bacteria 9640
43 JGI25160J50197_1002186 3300003354 Bacteria 9209
44 JGI25160J50197_1005029 3300003354 Bacteria 5593
45 Ga0055526_1000006 3300003771 Bacteria 330857
46 Ga0055526_1000627 3300003771 Bacteria 27441
47 Ga0055537_1000003 3300003773 Bacteria 220933
48 Ga0055537_1000018 3300003773 Bacteria 123452
49 Ga0055537_1000925 3300003773 Bacteria 13724
50 Ga0055524_1000009 3300003775 Bacteria 295254
51 Ga0055536_1004732 3300003781 Bacteria 6842
52 Ga0055534_1000004 3300003784 Bacteria 295251
53 Ga0055534_1001119 3300003784 Bacteria 11371
54 Ga0055528_1000003 3300003790 Bacteria 330875
55 Ga0055528_1000417 3300003790 Bacteria 34138
56 Ga0055528_1000990 3300003790 Bacteria 18873
57 Ga0055528_1002063 3300003790 Bacteria 11222
58 Ga0055530_10000301 3300003791 Bacteria 44944
59 Ga0055530_10000566 3300003791 Bacteria 32028
60 Ga0055531_10011268 3300003794 Bacteria 4338
61 Ga0058692_1000015 3300003856 Bacteria 295729
62 Ga0058692_1000022 3300003856 Bacteria 237321
63 Ga0058692_1000532 3300003856 Bacteria 16486
64 Ga0058863_10091895 3300004799 Bacteria 12700
65 Ga0058863_10768226 3300004799 Bacteria 2192
66 Ga0058863_11840617 3300004799 Bacteria 3068
67 Ga0058862_10000476 3300004803 Bacteria 3005
68 Ga0065165_1000036 3300005262 Bacteria 212900
69 Ga0065714_10002519 3300005288 Bacteria 28238
70 Ga0065714_10008043 3300005288 Bacteria 3470
71 Ga0065714_10067144 3300005288 Bacteria 5839
72 Ga0065714_10075158 3300005288 Bacteria 2938
73 Ga0065704_10000253 3300005289 Bacteria 50631
74 Ga0065704_10000363 3300005289 Bacteria 43914
75 Ga0065704_10005488 3300005289 Bacteria 4321
76 Ga0065704_10070190 3300005289 Bacteria 113837
77 Ga0065704_10088577 3300005289 Bacteria 2915
78 Ga0065715_10003413 3300005293 Bacteria 4722
79 Ga0070658_10000011 3300005327 Bacteria 294396
80 Ga0070658_10000018 3300005327 Bacteria 200558
81 Ga0070658_10000019 3300005327 Bacteria 194742
82 Ga0070658_10005453 3300005327 Bacteria 10313
83 Ga0070658_10036214 3300005327 Bacteria 3977
84 Ga0070658_10055255 3300005327 Bacteria 3225
85 Ga0070658_10102930 3300005327 Unclassified 2362
86 Ga0070658_10145991 3300005327 Bacteria 1978
87 Ga0070676_10000193 3300005328 Bacteria 25377
88 Ga0070676_10000375 3300005328 Bacteria 20682
89 Ga0070676_10000984 3300005328 Bacteria 14163
90 Ga0070676_10004933 3300005328 Bacteria 7069
91 Ga0070676_10006242 3300005328 Bacteria 6364
92 Ga0070676_10019786 3300005328 Bacteria 3750
93 Ga0070683_100002450 3300005329 Bacteria 14760
94 Ga0070683_100028466 3300005329 Bacteria 5050
95 Ga0070683_100037997 3300005329 Bacteria 4411
96 Ga0070670_100010980 3300005331 Bacteria 7736
97 Ga0070670_100026104 3300005331 Bacteria 5028
98 Ga0070670_100030729 3300005331 Bacteria 4625
99 Ga0070670_100178680 3300005331 Bacteria 1842
100 Ga0070677_10010189 3300005333 Bacteria 3208
101 Ga0068869_100022163 3300005334 Bacteria 4374
102 Ga0068869_100026646 3300005334 Bacteria 4024
103 Ga0068869_100032765 3300005334 Bacteria 3664
104 Ga0070666_10000132 3300005335 Bacteria 52718
105 Ga0070666_10000637 3300005335 Bacteria 21149
106 Ga0070666_10006184 3300005335 Bacteria 7363
107 Ga0070666_10010136 3300005335 Bacteria 5886
108 Ga0070666_10034846 3300005335 Bacteria 3336
109 Ga0070680_100002384 3300005336 Bacteria 13903
110 Ga0070680_100005853 3300005336 Bacteria 9329
111 Ga0070680_100033472 3300005336 Bacteria 4143
112 Ga0070682_100002553 3300005337 Bacteria 10052
113 Ga0068868_100000075 3300005338 Bacteria 58452
114 Ga0068868_100000428 3300005338 Bacteria 28195
115 Ga0068868_100009407 3300005338 Bacteria 7028
116 Ga0068868_100010284 3300005338 Bacteria 6767
117 Ga0068868_100020561 3300005338 Bacteria 4963
118 Ga0068868_100022890 3300005338 Bacteria 4723
119 Ga0068868_100082703 3300005338 Bacteria 2575
120 Ga0070660_100000589 3300005339 Bacteria 24352
121 Ga0070660_100000820 3300005339 Bacteria 20620
122 Ga0070660_100005390 3300005339 Bacteria 8854
123 Ga0070660_100009554 3300005339 Bacteria 6829
124 Ga0070660_100027073 3300005339 Bacteria 4277
125 Ga0070689_100026159 3300005340 Bacteria 4391
126 Ga0070661_100000520 3300005344 Bacteria 29559
127 Ga0070661_100009905 3300005344 Bacteria 6611
128 Ga0070692_10045970 3300005345 Bacteria 2254
129 Ga0070668_100000859 3300005347 Bacteria 21121
130 Ga0070668_100009543 3300005347 Bacteria 7201
131 Ga0070668_100040950 3300005347 Bacteria 3547
132 Ga0070668_100072862 3300005347 Bacteria 2677
133 Ga0070669_100003023 3300005353 Bacteria 12102
134 Ga0070669_100015356 3300005353 Bacteria 5457
135 Ga0070669_100023776 3300005353 Bacteria 4391
136 Ga0070669_100113323 3300005353 Bacteria 2060
137 Ga0070675_100009919 3300005354 Bacteria 7426
138 Ga0070675_100122264 3300005354 Bacteria 2212
139 Ga0070671_100020821 3300005355 Bacteria 5350
140 Ga0070671_100035443 3300005355 Bacteria 4134
141 Ga0070671_100052161 3300005355 Bacteria 3401
142 Ga0070671_100073936 3300005355 Bacteria 2847
143 Ga0070671_100137014 3300005355 Bacteria 2064
144 Ga0070674_100010260 3300005356 Bacteria 5652
145 Ga0070673_100000448 3300005364 Bacteria 21839
146 Ga0070673_100000498 3300005364 Bacteria 20956
147 Ga0070673_100001702 3300005364 Bacteria 13067
148 Ga0070673_100002543 3300005364 Bacteria 11136
149 Ga0070673_100004629 3300005364 Bacteria 8723
150 Ga0070673_100012309 3300005364 Bacteria 5871
151 Ga0070673_100050694 3300005364 Bacteria 3246
152 Ga0070673_100059400 3300005364 Bacteria 3026
153 Ga0070673_100061208 3300005364 Bacteria 2986
154 Ga0070688_100001777 3300005365 Bacteria 10788
155 Ga0070688_100009847 3300005365 Bacteria 5251
156 Ga0070688_100024266 3300005365 Bacteria 3575
157 Ga0070659_100018570 3300005366 Bacteria 5248
158 Ga0070659_100025545 3300005366 Bacteria 4538
159 Ga0070659_100046417 3300005366 Bacteria 3405
160 Ga0070659_100057403 3300005366 Bacteria 3070
161 Ga0070659_100063497 3300005366 Bacteria 2922
162 Ga0070667_100000376 3300005367 Bacteria 48890
163 Ga0070667_100000482 3300005367 Bacteria 40557
164 Ga0070667_100013528 3300005367 Bacteria 6743
165 Ga0070667_100015237 3300005367 Bacteria 6354
166 Ga0070667_100019189 3300005367 Bacteria 5670
167 Ga0070667_100038040 3300005367 Bacteria 4035
168 Ga0070667_100048415 3300005367 Bacteria 3578
169 Ga0070667_100197158 3300005367 Bacteria 1785
170 Ga0070705_100000282 3300005440 Bacteria 30278
171 Ga0070700_100003565 3300005441 Bacteria 8042
172 Ga0070694_100003101 3300005444 Bacteria 9895
173 Ga0070694_100027248 3300005444 Bacteria 3710
174 Ga0070708_100034806 3300005445 Bacteria 4384
175 Ga0070708_100035287 3300005445 Bacteria 4356
176 Ga0070663_100000935 3300005455 Bacteria 15875
177 Ga0070678_100016851 3300005456 Bacteria 4686
178 Ga0070678_100018850 3300005456 Bacteria 4481
179 Ga0070678_100027004 3300005456 Bacteria 3890
180 Ga0070678_100081249 3300005456 Bacteria 2457
181 Ga0070678_100132911 3300005456 Bacteria 1980
182 Ga0070662_100000032 3300005457 Bacteria 78824
183 Ga0070662_100000081 3300005457 Bacteria 53265
184 Ga0070662_100000102 3300005457 Bacteria 47055
185 Ga0070662_100002814 3300005457 Bacteria 10787
186 Ga0070662_100007733 3300005457 Bacteria 6978
187 Ga0070662_100009485 3300005457 Bacteria 6368
188 Ga0070662_100014194 3300005457 Bacteria 5316
189 Ga0070662_100023035 3300005457 Bacteria 4274
190 Ga0070662_100038949 3300005457 Bacteria 3380
191 Ga0070681_10001937 3300005458 Bacteria 18677
192 Ga0070681_10004961 3300005458 Bacteria 12797
193 Ga0070681_10009928 3300005458 Bacteria 9381
194 Ga0070681_10088789 3300005458 Bacteria 3043
195 Ga0070681_10106717 3300005458 Bacteria 2742
196 Ga0068867_100003913 3300005459 Bacteria 10475
197 Ga0068867_100005707 3300005459 Bacteria 8824
198 Ga0068867_100006982 3300005459 Bacteria 7982
199 Ga0068867_100008205 3300005459 Bacteria 7377
200 Ga0068867_100017005 3300005459 Bacteria 5167
201 Ga0068867_100034168 3300005459 Bacteria 3685
202 Ga0068867_100127198 3300005459 Bacteria 1976
203 Ga0070685_10002021 3300005466 Bacteria 10504
204 Ga0070707_100058130 3300005468 Bacteria 3709
205 Ga0070698_100005763 3300005471 Bacteria 13543
206 Ga0070698_100142303 3300005471 Bacteria 2349
207 Ga0070699_100133611 3300005518 Bacteria 2188
208 Ga0070679_100003498 3300005530 Bacteria 14381
209 Ga0070679_100004034 3300005530 Bacteria 13534
210 Ga0070679_100012356 3300005530 Bacteria 8156
211 Ga0070679_100018717 3300005530 Bacteria 6723
212 Ga0070679_100064616 3300005530 Bacteria 3647
213 Ga0070679_100083925 3300005530 Bacteria 3174
214 Ga0070679_100093675 3300005530 Bacteria 2991
215 Ga0070679_100114325 3300005530 Bacteria 2684
216 Ga0070684_100007769 3300005535 Bacteria 8360
217 Ga0070684_100045143 3300005535 Bacteria 3815
218 Ga0070684_100083619 3300005535 Bacteria 2828
219 Ga0070684_100093689 3300005535 Bacteria 2674
220 Ga0070697_100063537 3300005536 Bacteria 3014
221 Ga0068853_100007384 3300005539 Bacteria 8793
222 Ga0068853_100015769 3300005539 Bacteria 6206
223 Ga0068853_100030503 3300005539 Bacteria 4554
224 Ga0068853_100037346 3300005539 Bacteria 4132
225 Ga0068853_100043469 3300005539 Bacteria 3843
226 Ga0068853_100061441 3300005539 Bacteria 3250
227 Ga0070672_100000053 3300005543 Bacteria 51215
228 Ga0070672_100000361 3300005543 Bacteria 26202
229 Ga0070672_100014615 3300005543 Bacteria 5567
230 Ga0070672_100023920 3300005543 Bacteria 4506
231 Ga0070686_100021274 3300005544 Bacteria 3853
232 Ga0070686_100036629 3300005544 Bacteria 3039
233 Ga0070695_100001818 3300005545 Bacteria 12037
234 Ga0070695_100067977 3300005545 Bacteria 2325
235 Ga0070696_100025773 3300005546 Bacteria 3999
236 Ga0070693_100013364 3300005547 Bacteria 4180
237 Ga0070665_100000001 3300005548 Bacteria 1083363
238 Ga0070665_100000003 3300005548 Bacteria 811857
239 Ga0070665_100000013 3300005548 Bacteria 484927
240 Ga0070665_100000072 3300005548 Bacteria 198575
241 Ga0070665_100002163 3300005548 Bacteria 21925
242 Ga0070665_100023188 3300005548 Bacteria 6252
243 Ga0070665_100045031 3300005548 Bacteria 4430
244 Ga0070665_100154022 3300005548 Bacteria 2300
245 Ga0070665_100207792 3300005548 Bacteria 1958
246 Ga0070704_100004160 3300005549 Bacteria 8349
247 Ga0070704_100017759 3300005549 Bacteria 4533
248 Ga0068855_100000089 3300005563 Bacteria 110845
249 Ga0068855_100000090 3300005563 Bacteria 110528
250 Ga0068855_100000218 3300005563 Bacteria 73075
251 Ga0068855_100000240 3300005563 Bacteria 69408
252 Ga0068855_100000508 3300005563 Bacteria 48055
253 Ga0068855_100000961 3300005563 Bacteria 35803
254 Ga0068855_100001522 3300005563 Bacteria 29051
255 Ga0068855_100002978 3300005563 Bacteria 20697
256 Ga0068855_100005612 3300005563 Bacteria 15308
257 Ga0068855_100006152 3300005563 Bacteria 14633
258 Ga0068855_100011716 3300005563 Bacteria 10598
259 Ga0068855_100012595 3300005563 Bacteria 10206
260 Ga0068855_100016361 3300005563 Bacteria 8919
261 Ga0068855_100016685 3300005563 Bacteria 8831
262 Ga0068855_100026716 3300005563 Bacteria 6908
263 Ga0068855_100038985 3300005563 Bacteria 5641
264 Ga0068855_100181186 3300005563 Bacteria 2381
265 Ga0068855_100183500 3300005563 Bacteria 2365
266 Ga0070664_100000840 3300005564 Bacteria 23691
267 Ga0070664_100010256 3300005564 Bacteria 7598
268 Ga0070664_100187919 3300005564 Bacteria 1840
269 Ga0068857_100000072 3300005577 Bacteria 57896
270 Ga0068857_100003552 3300005577 Bacteria 13042
271 Ga0068857_100006566 3300005577 Bacteria 9983
272 Ga0068857_100066782 3300005577 Bacteria 3201
273 Ga0068854_100048329 3300005578 Bacteria 3035
274 Ga0068854_100053909 3300005578 Bacteria 2890
275 Ga0068856_100000129 3300005614 Bacteria 76536
276 Ga0068856_100000794 3300005614 Bacteria 34105
277 Ga0068856_100000825 3300005614 Bacteria 33467
278 Ga0068856_100001554 3300005614 Bacteria 24032
279 Ga0068856_100002718 3300005614 Bacteria 18127
280 Ga0068856_100010926 3300005614 Bacteria 8810
281 Ga0068856_100012116 3300005614 Bacteria 8350
282 Ga0068856_100040865 3300005614 Bacteria 4556
283 Ga0068856_100045016 3300005614 Bacteria 4344
284 Ga0068856_100045873 3300005614 Bacteria 4304
285 Ga0068852_100000242 3300005616 Bacteria 37066
286 Ga0068852_100002816 3300005616 Bacteria 12048
287 Ga0068852_100005191 3300005616 Bacteria 9287
288 Ga0068852_100008342 3300005616 Bacteria 7629
289 Ga0068852_100011204 3300005616 Bacteria 6737
290 Ga0068852_100022519 3300005616 Bacteria 5054
291 Ga0068852_100031708 3300005616 Bacteria 4367
292 Ga0068852_100154318 3300005616 Bacteria 2137
293 Ga0068852_100176224 3300005616 Bacteria 2008
294 Ga0068859_100000003 3300005617 Bacteria 479218
295 Ga0068859_100000029 3300005617 Bacteria 178422
296 Ga0068859_100014762 3300005617 Bacteria 7848
297 Ga0068859_100016078 3300005617 Bacteria 7517
298 Ga0068859_100037042 3300005617 Bacteria 4896
299 Ga0068859_100040381 3300005617 Bacteria 4684
300 Ga0068864_100000785 3300005618 Bacteria 26636
301 Ga0068864_100001685 3300005618 Bacteria 18165
302 Ga0068864_100010772 3300005618 Bacteria 7556
303 Ga0068864_100010956 3300005618 Bacteria 7496
304 Ga0068864_100039616 3300005618 Bacteria 4027
305 Ga0068864_100065706 3300005618 Unclassified 3147
306 Ga0068864_100149468 3300005618 Bacteria 2115
307 Ga0068866_10000449 3300005718 Bacteria 18965
308 Ga0068861_100013993 3300005719 Bacteria 5625
309 Ga0068861_100025846 3300005719 Bacteria 4263
310 Ga0068861_100053430 3300005719 Bacteria 3073
311 Ga0068861_100109905 3300005719 Bacteria 2207
312 Ga0068851_10008931 3300005834 Bacteria 4648
313 Ga0068851_10010820 3300005834 Bacteria 4263
314 Ga0068851_10015833 3300005834 Bacteria 3599
315 Ga0068870_10000222 3300005840 Bacteria 20754
316 Ga0068863_100000394 3300005841 Bacteria 44355
317 Ga0068863_100002832 3300005841 Bacteria 17171
318 Ga0068863_100026806 3300005841 Bacteria 5496
319 Ga0068863_100056546 3300005841 Bacteria 3714
320 Ga0068863_100066866 3300005841 Bacteria 3400
321 Ga0068863_100099700 3300005841 Bacteria 2760
322 Ga0068863_100139021 3300005841 Unclassified 2321
323 Ga0068858_100003697 3300005842 Bacteria 15153
324 Ga0068858_100020680 3300005842 Bacteria 6147
325 Ga0068858_100030635 3300005842 Bacteria 4996
326 Ga0068858_100042626 3300005842 Bacteria 4207
327 Ga0068860_100000097 3300005843 Bacteria 146573
328 Ga0068860_100001069 3300005843 Bacteria 30180
329 Ga0068860_100001074 3300005843 Bacteria 30126
330 Ga0068860_100002493 3300005843 Bacteria 19315
331 Ga0068860_100003262 3300005843 Bacteria 16704
332 Ga0068860_100005227 3300005843 Bacteria 13184
333 Ga0068860_100007318 3300005843 Bacteria 11037
334 Ga0068860_100014033 3300005843 Bacteria 7858
335 Ga0068860_100021645 3300005843 Bacteria 6225
336 Ga0068860_100023333 3300005843 Bacteria 5980
337 Ga0068860_100038549 3300005843 Bacteria 4572
338 Ga0068860_100052463 3300005843 Bacteria 3879
339 Ga0068862_100004418 3300005844 Bacteria 11866
340 Ga0068862_100021209 3300005844 Bacteria 5430
341 Ga0068862_100027700 3300005844 Bacteria 4770
342 Ga0081540_1000030 3300005983 Bacteria 148780
343 Ga0081540_1000093 3300005983 Bacteria 93710
344 Ga0081540_1011231 3300005983 Bacteria 6003
345 Ga0081539_10000366 3300005985 Bacteria 98762
346 Ga0075368_10001587 3300006042 Bacteria 7296
347 Ga0075364_10011781 3300006051 Bacteria 5324
348 Ga0075369_10008470 3300006186 Bacteria 3957
349 Ga0075366_10000185 3300006195 Bacteria 27369
350 Ga0075366_10001480 3300006195 Bacteria 11712
351 Ga0097621_100000020 3300006237 Bacteria 86226
352 Ga0097621_100000039 3300006237 Bacteria 67231
353 Ga0097621_100000827 3300006237 Bacteria 21866
354 Ga0097621_100005142 3300006237 Bacteria 9193
355 Ga0097621_100034350 3300006237 Bacteria 4045
356 Ga0097621_100048531 3300006237 Bacteria 3445
357 Ga0097621_100108884 3300006237 Bacteria 2339
358 Ga0097621_100135111 3300006237 Bacteria 2103
359 Ga0068871_100000088 3300006358 Bacteria 52878
360 Ga0068871_100000130 3300006358 Bacteria 47875
361 Ga0068871_100000416 3300006358 Bacteria 29438
362 Ga0068871_100001193 3300006358 Bacteria 17357
363 Ga0068871_100032347 3300006358 Bacteria 4132
364 Ga0068871_100041136 3300006358 Bacteria 3705
365 Ga0068871_100047266 3300006358 Bacteria 3470
366 Ga0068871_100048965 3300006358 Bacteria 3414
367 Ga0068871_100108532 3300006358 Bacteria 2333
368 Ga0068871_100115973 3300006358 Bacteria 2257
369 Ga0068871_100136884 3300006358 Bacteria 2080
370 Ga0068871_100145915 3300006358 Bacteria 2015
371 Ga0068871_100169107 3300006358 Bacteria 1873
372 Ga0075428_100097153 3300006844 Bacteria 3211
373 Ga0075430_100008206 3300006846 Bacteria 8819
374 Ga0075431_100089778 3300006847 Bacteria 3171
375 Ga0075433_10028456 3300006852 Bacteria 4751
376 Ga0075433_10143054 3300006852 Bacteria 2126
377 Ga0075434_100014408 3300006871 Bacteria 7556
378 Ga0075434_100125131 3300006871 Bacteria 2588
379 Ga0068865_100000050 3300006881 Bacteria 65632
380 Ga0068865_100000180 3300006881 Bacteria 35127
381 Ga0068865_100000208 3300006881 Bacteria 32611
382 Ga0068865_100002647 3300006881 Bacteria 10637
383 Ga0068865_100007029 3300006881 Bacteria 6908
384 Ga0068865_100080477 3300006881 Bacteria 2336
385 Ga0075436_100061795 3300006914 Bacteria 2588
386 Ga0097620_100000003 3300006931 Bacteria 479218
387 Ga0097620_100000029 3300006931 Bacteria 178422
388 Ga0097620_100014762 3300006931 Bacteria 7848
389 Ga0097620_100016078 3300006931 Bacteria 7517
390 Ga0097620_100037046 3300006931 Bacteria 4896
391 Ga0097620_100040381 3300006931 Bacteria 4684
392 Ga0099826_10000045 3300006948 Bacteria 75912
393 Ga0099826_10015717 3300006948 Bacteria 5719
394 Ga0075435_100061270 3300007076 Bacteria 3052
395 Ga0105251_10000013 3300009011 Bacteria 163226
396 Ga0105251_10000376 3300009011 Bacteria 43779
397 Ga0105240_10000058 3300009093 Bacteria 220830
398 Ga0105240_10000074 3300009093 Bacteria 199611
399 Ga0105240_10001009 3300009093 Bacteria 50206
400 Ga0105240_10001179 3300009093 Bacteria 45780
401 Ga0105240_10002072 3300009093 Bacteria 32853
402 Ga0105240_10003320 3300009093 Bacteria 25129
403 Ga0105240_10004216 3300009093 Bacteria 21991
404 Ga0105240_10005356 3300009093 Bacteria 19140
405 Ga0105240_10014243 3300009093 Bacteria 10863
406 Ga0105240_10018086 3300009093 Bacteria 9476
407 Ga0105240_10023926 3300009093 Bacteria 8069
408 Ga0105240_10027258 3300009093 Bacteria 7482
409 Ga0105240_10033244 3300009093 Bacteria 6667
410 Ga0105240_10067069 3300009093 Bacteria 4449
411 Ga0105240_10083506 3300009093 Bacteria 3919
412 Ga0105240_10083538 3300009093 Bacteria 3918
413 Ga0105240_10097290 3300009093 Bacteria 3586
414 Ga0105240_10122828 3300009093 Bacteria 3125
415 Ga0105240_10125426 3300009093 Bacteria 3086
416 Ga0105240_10206190 3300009093 Bacteria 2301
417 Ga0111539_10005429 3300009094 Bacteria 16497
418 Ga0111539_10281246 3300009094 Bacteria 1936
419 Ga0105245_10006259 3300009098 Bacteria 10473
420 Ga0105245_10043754 3300009098 Bacteria 3994
421 Ga0105245_10077748 3300009098 Bacteria 3026
422 Ga0105247_10000674 3300009101 Bacteria 26924
423 Ga0105247_10001444 3300009101 Bacteria 17174
424 Ga0105247_10003817 3300009101 Bacteria 9750
425 Ga0114129_10000267 3300009147 Bacteria 59005
426 Ga0105243_10000078 3300009148 Bacteria 110329
427 Ga0105243_10005620 3300009148 Bacteria 9766
428 Ga0105243_10018319 3300009148 Bacteria 5302
429 Ga0105243_10032248 3300009148 Bacteria 4046
430 Ga0105241_10000398 3300009174 Bacteria 32826
431 Ga0105241_10000514 3300009174 Bacteria 29151
432 Ga0105241_10001671 3300009174 Bacteria 16896
433 Ga0105241_10002132 3300009174 Bacteria 14966
434 Ga0105241_10003450 3300009174 Bacteria 11759
435 Ga0105241_10005205 3300009174 Bacteria 9601
436 Ga0105241_10007032 3300009174 Bacteria 8280
437 Ga0105241_10011813 3300009174 Bacteria 6414
438 Ga0105241_10015295 3300009174 Bacteria 5619
439 Ga0105241_10026236 3300009174 Bacteria 4333
440 Ga0105241_10073664 3300009174 Bacteria 2657
441 Ga0105242_10004407 3300009176 Bacteria 10948
442 Ga0105242_10020147 3300009176 Bacteria 5228
443 Ga0105242_10051028 3300009176 Bacteria 3370
444 Ga0105242_10053548 3300009176 Bacteria 3296
445 Ga0105242_10053850 3300009176 Bacteria 3287
446 Ga0105242_10071794 3300009176 Bacteria 2874
447 Ga0105242_10134238 3300009176 Bacteria 2140
448 Ga0105242_10138849 3300009176 Bacteria 2107
449 Ga0105248_10000751 3300009177 Bacteria 36400
450 Ga0105248_10090763 3300009177 Bacteria 3440
451 Ga0105248_10096093 3300009177 Bacteria 3337
452 Ga0105248_10102356 3300009177 Bacteria 3228
453 Ga0105237_10000356 3300009545 Bacteria 64629
454 Ga0105237_10000526 3300009545 Bacteria 53917
455 Ga0105237_10001393 3300009545 Bacteria 31945
456 Ga0105237_10001999 3300009545 Bacteria 25943
457 Ga0105237_10003774 3300009545 Bacteria 17832
458 Ga0105237_10004900 3300009545 Bacteria 15325
459 Ga0105237_10004955 3300009545 Bacteria 15202
460 Ga0105237_10005749 3300009545 Bacteria 13934
461 Ga0105237_10008998 3300009545 Bacteria 10741
462 Ga0105237_10010635 3300009545 Bacteria 9776
463 Ga0105237_10011200 3300009545 Bacteria 9506
464 Ga0105237_10013542 3300009545 Bacteria 8546
465 Ga0105237_10013638 3300009545 Bacteria 8510
466 Ga0105237_10016081 3300009545 Bacteria 7782
467 Ga0105237_10016676 3300009545 Bacteria 7627
468 Ga0105237_10018295 3300009545 Bacteria 7251
469 Ga0105237_10022259 3300009545 Bacteria 6502
470 Ga0105237_10027908 3300009545 Bacteria 5753
471 Ga0105237_10032659 3300009545 Bacteria 5270
472 Ga0105237_10094975 3300009545 Bacteria 2971
473 Ga0105237_10123980 3300009545 Bacteria 2578
474 Ga0105238_10001248 3300009551 Bacteria 25605
475 Ga0105238_10001582 3300009551 Bacteria 22794
476 Ga0105238_10002044 3300009551 Bacteria 20361
477 Ga0105238_10013194 3300009551 Bacteria 8339
478 Ga0105238_10023197 3300009551 Bacteria 6327
479 Ga0105238_10069474 3300009551 Bacteria 3523
480 Ga0105238_10091880 3300009551 Bacteria 3022
481 Ga0105238_10105228 3300009551 Bacteria 2803
482 Ga0105249_10002476 3300009553 Bacteria 15993
483 Ga0105249_10002967 3300009553 Bacteria 14640
484 Ga0105249_10012803 3300009553 Bacteria 7399
485 Ga0105249_10014303 3300009553 Bacteria 7018
486 Ga0105249_10015028 3300009553 Bacteria 6849
487 Ga0105249_10019812 3300009553 Bacteria 6005
488 Ga0105249_10037959 3300009553 Bacteria 4371
489 Ga0105249_10043391 3300009553 Bacteria 4089
490 Ga0105249_10075019 3300009553 Bacteria 3132
491 Ga0105028_100994 3300009993 Bacteria 2978
492 Ga0105239_10000005 3300010375 Bacteria 496066
493 Ga0105239_10000021 3300010375 Bacteria 259369
494 Ga0105239_10000126 3300010375 Bacteria 107921
495 Ga0105239_10000132 3300010375 Bacteria 105380
496 Ga0105239_10000255 3300010375 Bacteria 79421
497 Ga0105239_10000327 3300010375 Bacteria 70423
498 Ga0105239_10000529 3300010375 Bacteria 55233
499 Ga0105239_10001365 3300010375 Bacteria 32795
500 Ga0105239_10006154 3300010375 Bacteria 13964
501 Ga0105239_10006696 3300010375 Bacteria 13312
502 Ga0105239_10009088 3300010375 Bacteria 11244
503 Ga0105239_10010481 3300010375 Bacteria 10361
504 Ga0105239_10012522 3300010375 Bacteria 9447
505 Ga0105239_10019080 3300010375 Bacteria 7579
506 Ga0105239_10021183 3300010375 Bacteria 7168
507 Ga0105239_10021884 3300010375 Bacteria 7049
508 Ga0105239_10022581 3300010375 Bacteria 6937
509 Ga0105239_10022957 3300010375 Bacteria 6878
510 Ga0105239_10038077 3300010375 Bacteria 5269
511 Ga0105239_10041908 3300010375 Bacteria 5016
512 Ga0105239_10042699 3300010375 Bacteria 4968
513 Ga0105239_10045632 3300010375 Bacteria 4803
514 Ga0105239_10107592 3300010375 Bacteria 3089
515 Ga0105239_10122793 3300010375 Bacteria 2886
516 Ga0105246_10008903 3300011119 Bacteria 6178
517 Ga0105246_10017045 3300011119 Bacteria 4614
518 Ga0105246_10032666 3300011119 Bacteria 3452
519 Ga0157373_10001087 3300013100 Bacteria 20959
520 Ga0157373_10001162 3300013100 Bacteria 20171
521 Ga0157373_10001710 3300013100 Bacteria 16689
522 Ga0157373_10004902 3300013100 Bacteria 10077
523 Ga0157373_10015649 3300013100 Bacteria 5541
524 Ga0157373_10020440 3300013100 Bacteria 4812
525 Ga0157371_10000864 3300013102 Bacteria 34437
526 Ga0157371_10000978 3300013102 Bacteria 31762
527 Ga0157371_10001061 3300013102 Bacteria 30053
528 Ga0157371_10001161 3300013102 Bacteria 28350
529 Ga0157371_10003077 3300013102 Bacteria 15475
530 Ga0157371_10007327 3300013102 Bacteria 8951
531 Ga0157371_10009645 3300013102 Bacteria 7591
532 Ga0157371_10010482 3300013102 Bacteria 7213
533 Ga0157371_10023127 3300013102 Bacteria 4545
534 Ga0157371_10023728 3300013102 Bacteria 4484
535 Ga0157371_10024970 3300013102 Bacteria 4361
536 Ga0157371_10027184 3300013102 Bacteria 4151
537 Ga0157371_10028001 3300013102 Bacteria 4083
538 Ga0157371_10042556 3300013102 Bacteria 3237
539 Ga0157371_10077019 3300013102 Bacteria 2362
540 Ga0157370_10000408 3300013104 Bacteria 54355
541 Ga0157370_10001057 3300013104 Bacteria 34651
542 Ga0157370_10002239 3300013104 Bacteria 23528
543 Ga0157370_10002931 3300013104 Bacteria 20307
544 Ga0157370_10004952 3300013104 Bacteria 15076
545 Ga0157370_10011697 3300013104 Bacteria 9159
546 Ga0157370_10026998 3300013104 Bacteria 5664
547 Ga0157370_10047974 3300013104 Bacteria 4092
548 Ga0157370_10087792 3300013104 Bacteria 2921
549 Ga0157370_10103527 3300013104 Bacteria 2665
550 Ga0157370_10156219 3300013104 Bacteria 2122
551 Ga0157369_10009901 3300013105 Bacteria 10893
552 Ga0157369_10029198 3300013105 Bacteria 6096
553 Ga0157369_10046814 3300013105 Bacteria 4700
554 Ga0157369_10055337 3300013105 Bacteria 4283
555 Ga0157369_10056666 3300013105 Bacteria 4228
556 Ga0157369_10092129 3300013105 Bacteria 3235
557 Ga0157369_10110442 3300013105 Bacteria 2923
558 Ga0157369_10139870 3300013105 Bacteria 2562
559 Ga0157374_10000001 3300013296 Bacteria 1077351
560 Ga0157374_10000003 3300013296 Bacteria 854471
561 Ga0157374_10000004 3300013296 Bacteria 759774
562 Ga0157374_10000135 3300013296 Bacteria 67340
563 Ga0157374_10000723 3300013296 Bacteria 28842
564 Ga0157374_10001012 3300013296 Bacteria 24372
565 Ga0157374_10002589 3300013296 Bacteria 15240
566 Ga0157374_10002880 3300013296 Bacteria 14432
567 Ga0157374_10002930 3300013296 Bacteria 14295
568 Ga0157374_10003010 3300013296 Bacteria 14109
569 Ga0157374_10003387 3300013296 Bacteria 13399
570 Ga0157374_10003782 3300013296 Bacteria 12735
571 Ga0157374_10019983 3300013296 Bacteria 5938
572 Ga0157374_10067123 3300013296 Bacteria 3371
573 Ga0157378_10003886 3300013297 Bacteria 13230
574 Ga0157378_10009315 3300013297 Bacteria 8552
575 Ga0157378_10014774 3300013297 Bacteria 6838
576 Ga0157378_10017865 3300013297 Bacteria 6225
577 Ga0157378_10026601 3300013297 Bacteria 5099
578 Ga0157378_10029608 3300013297 Bacteria 4835
579 Ga0157378_10051170 3300013297 Bacteria 3675
580 Ga0157378_10057546 3300013297 Bacteria 3465
581 Ga0157378_10059399 3300013297 Bacteria 3412
582 Ga0157378_10098080 3300013297 Bacteria 2672
583 Ga0163162_10000031 3300013306 Bacteria 157666
584 Ga0163162_10000097 3300013306 Bacteria 79518
585 Ga0163162_10000117 3300013306 Bacteria 70736
586 Ga0163162_10000377 3300013306 Bacteria 40533
587 Ga0163162_10001952 3300013306 Bacteria 19367
588 Ga0163162_10002340 3300013306 Bacteria 17794
589 Ga0163162_10002723 3300013306 Bacteria 16760
590 Ga0163162_10003770 3300013306 Bacteria 14524
591 Ga0163162_10005204 3300013306 Bacteria 12542
592 Ga0163162_10006392 3300013306 Bacteria 11408
593 Ga0163162_10008568 3300013306 Bacteria 9969
594 Ga0163162_10008944 3300013306 Bacteria 9736
595 Ga0163162_10020868 3300013306 Bacteria 6442
596 Ga0163162_10021340 3300013306 Bacteria 6377
597 Ga0163162_10025992 3300013306 Bacteria 5786
598 Ga0163162_10122689 3300013306 Bacteria 2703
599 Ga0157372_10000988 3300013307 Bacteria 31100
600 Ga0157372_10001004 3300013307 Bacteria 30814
601 Ga0157372_10002383 3300013307 Bacteria 20341
602 Ga0157372_10004637 3300013307 Bacteria 14603
603 Ga0157372_10010244 3300013307 Bacteria 9955
604 Ga0157372_10016543 3300013307 Bacteria 7914
605 Ga0157372_10026913 3300013307 Bacteria 6260
606 Ga0157372_10027302 3300013307 Bacteria 6216
607 Ga0157372_10028875 3300013307 Bacteria 6053
608 Ga0157372_10034279 3300013307 Bacteria 5580
609 Ga0157372_10037755 3300013307 Bacteria 5328
610 Ga0157372_10041370 3300013307 Bacteria 5096
611 Ga0157372_10051539 3300013307 Bacteria 4581
612 Ga0157372_10064472 3300013307 Bacteria 4111
613 Ga0157372_10069637 3300013307 Bacteria 3957
614 Ga0157372_10077941 3300013307 Bacteria 3744
615 Ga0157372_10079965 3300013307 Bacteria 3698
616 Ga0157372_10110269 3300013307 Bacteria 3152
617 Ga0157372_10146134 3300013307 Bacteria 2726
618 Ga0157372_10150392 3300013307 Bacteria 2687
619 Ga0157372_10163020 3300013307 Bacteria 2577
620 Ga0157372_10170363 3300013307 Bacteria 2519
621 Ga0157372_10206152 3300013307 Bacteria 2278
622 Ga0157372_10234181 3300013307 Bacteria 2129
623 Ga0157375_10004745 3300013308 Bacteria 11813
624 Ga0157375_10007917 3300013308 Bacteria 9304
625 Ga0157375_10017919 3300013308 Bacteria 6407
626 Ga0157375_10024778 3300013308 Bacteria 5560
627 Ga0157375_10032230 3300013308 Bacteria 4969
628 Ga0157375_10036838 3300013308 Bacteria 4683
629 Ga0157375_10047336 3300013308 Bacteria 4199
630 Ga0157375_10087601 3300013308 Bacteria 3166
631 Ga0157375_10100249 3300013308 Bacteria 2976
632 Ga0157375_10112862 3300013308 Bacteria 2818
633 Ga0157375_10120913 3300013308 Bacteria 2728
634 Ga0163163_10000752 3300014325 Bacteria 27543
635 Ga0163163_10003148 3300014325 Bacteria 13992
636 Ga0163163_10016262 3300014325 Bacteria 6907
637 Ga0163163_10018483 3300014325 Bacteria 6527
638 Ga0163163_10032245 3300014325 Bacteria 5060
639 Ga0157380_10002665 3300014326 Bacteria 12104
640 Ga0157380_10003484 3300014326 Bacteria 10807
641 Ga0157380_10011917 3300014326 Bacteria 6290
642 Ga0157380_10115851 3300014326 Bacteria 2261
643 Ga0182008_10000021 3300014497 Bacteria 227140
644 Ga0182008_10000211 3300014497 Bacteria 46071
645 Ga0182008_10003888 3300014497 Bacteria 8860
646 Ga0182008_10004569 3300014497 Bacteria 8061
647 Ga0157377_10001155 3300014745 Bacteria 11202
648 Ga0157379_10000440 3300014968 Bacteria 33697
649 Ga0157379_10008259 3300014968 Bacteria 9046
650 Ga0157379_10018199 3300014968 Bacteria 6190
651 Ga0157379_10021550 3300014968 Bacteria 5706
652 Ga0157379_10025153 3300014968 Bacteria 5285
653 Ga0157379_10033021 3300014968 Bacteria 4616
654 Ga0157376_10000381 3300014969 Bacteria 28821
655 Ga0157376_10000690 3300014969 Bacteria 21813
656 Ga0157376_10002408 3300014969 Bacteria 12639
657 Ga0157376_10004479 3300014969 Bacteria 9727
658 Ga0157376_10005645 3300014969 Bacteria 8757
659 Ga0157376_10014177 3300014969 Bacteria 5972
660 Ga0157376_10016013 3300014969 Bacteria 5682
661 Ga0157376_10016954 3300014969 Bacteria 5545
662 Ga0157376_10019754 3300014969 Bacteria 5199
663 Ga0157376_10030198 3300014969 Bacteria 4325
664 Ga0157376_10047947 3300014969 Bacteria 3530
665 Ga0157376_10072578 3300014969 Bacteria 2928
666 Ga0157376_10186346 3300014969 Bacteria 1900
667 Ga0182006_1000134 3300015261 Bacteria 80259
668 Ga0182006_1001197 3300015261 Bacteria 16212
669 Ga0182006_1003188 3300015261 Bacteria 8548
670 Ga0182006_1012970 3300015261 Bacteria 3634
671 Ga0182006_1014856 3300015261 Bacteria 3348
672 Ga0182006_1036715 3300015261 Bacteria 1947
673 Ga0182007_10000099 3300015262 Bacteria 60975
674 Ga0182007_10002027 3300015262 Bacteria 10420
675 Ga0182005_1000442 3300015265 Bacteria 22007
676 Ga0183360_10001 3300015689 Bacteria 3943671
677 Ga0163161_10000465 3300017792 Bacteria 33670
678 Ga0163161_10000921 3300017792 Bacteria 22712
679 Ga0163161_10003332 3300017792 Bacteria 11264
680 Ga0163161_10005950 3300017792 Bacteria 8457
681 Ga0163161_10008635 3300017792 Bacteria 7044
682 Ga0163161_10015113 3300017792 Bacteria 5382
683 Ga0163161_10072584 3300017792 Bacteria 2520
684 Ga0206351_10926739 3300020077 Bacteria 3827
685 Ga0213876_10001379 3300021384 Bacteria 15168
686 Ga0213876_10003502 3300021384 Bacteria 8965
687 Ga0213876_10008761 3300021384 Bacteria 5464
688 Ga0213876_10022727 3300021384 Bacteria 3314
689 Ga0207427_100125 3300025231 Bacteria 96142
690 Ga0209437_100008 3300025233 Bacteria 921142
691 Ga0209437_100017 3300025233 Bacteria 694471
692 Ga0209437_100130 3300025233 Bacteria 183731
693 Ga0207425_1000044 3300025245 Bacteria 195202
694 Ga0207425_1000388 3300025245 Bacteria 29705
695 Ga0209129_1000044 3300025258 Bacteria 298971
696 Ga0209233_1000024 3300025261 Bacteria 695418
697 Ga0209233_1000705 3300025261 Bacteria 15603
698 Ga0209565_1000001 3300025263 Bacteria 2950419
699 Ga0209565_1000031 3300025263 Bacteria 320341
700 Ga0209455_1001208 3300025272 Bacteria 12329
701 Ga0209455_1005969 3300025272 Bacteria 3668
702 Ga0209673_1000001 3300025273 Bacteria 3176258
703 Ga0209673_1000674 3300025273 Bacteria 49444
704 Ga0209673_1000931 3300025273 Bacteria 36809
705 Ga0209675_1000001 3300025291 Bacteria 2950293
706 Ga0209675_1000015 3300025291 Bacteria 403517
707 Ga0209676_1000225 3300025292 Bacteria 124018
708 Ga0209676_1000570 3300025292 Bacteria 55557
709 Ga0209676_1000998 3300025292 Bacteria 33231
710 Ga0209025_1000006 3300025294 Bacteria 1153444
711 Ga0209025_1000012 3300025294 Bacteria 924362
712 Ga0209564_1000001 3300025295 Bacteria 3176258
713 Ga0209564_1000037 3300025295 Bacteria 414794
714 Ga0209564_1005562 3300025295 Bacteria 7129
715 Ga0209564_1006495 3300025295 Bacteria 6289
716 Ga0209758_1000018 3300025297 Bacteria 753320
717 Ga0209758_1004557 3300025297 Bacteria 11442
718 Ga0209758_1009146 3300025297 Bacteria 6235
719 Ga0209050_1000160 3300025298 Bacteria 157000
720 Ga0209050_1000201 3300025298 Bacteria 134028
721 Ga0209050_1000709 3300025298 Bacteria 49201
722 Ga0209256_1000002 3300025299 Bacteria 1906740
723 Ga0209256_1002877 3300025299 Bacteria 13057
724 Ga0207426_1000052 3300025302 Bacteria 389825
725 Ga0207426_1000258 3300025302 Bacteria 114759
726 Ga0207426_1000681 3300025302 Bacteria 41125
727 Ga0209051_1001496 3300025303 Bacteria 19555
728 Ga0209257_1000208 3300025304 Bacteria 141393
729 Ga0209257_1000273 3300025304 Bacteria 117663
730 Ga0209257_1001168 3300025304 Bacteria 33231
731 Ga0209257_1012484 3300025304 Bacteria 3915
732 Ga0207697_10000758 3300025315 Bacteria 18283
733 Ga0207697_10024262 3300025315 Bacteria 2484
734 Ga0207713_1000445 3300025735 Bacteria 43504
735 Ga0207713_1004188 3300025735 Bacteria 9457
736 Ga0207682_10020554 3300025893 Bacteria 2592
737 Ga0207642_10051885 3300025899 Bacteria 1858
738 Ga0207710_10000906 3300025900 Bacteria 15850
739 Ga0207688_10000491 3300025901 Bacteria 19010
740 Ga0207688_10025859 3300025901 Bacteria 3226
741 Ga0207680_10000014 3300025903 Bacteria 179035
742 Ga0207680_10000016 3300025903 Bacteria 134657
743 Ga0207680_10000593 3300025903 Bacteria 17084
744 Ga0207680_10116419 3300025903 Bacteria 1742
745 Ga0207647_10000058 3300025904 Bacteria 84631
746 Ga0207647_10000321 3300025904 Bacteria 39699
747 Ga0207647_10001351 3300025904 Bacteria 18835
748 Ga0207647_10002212 3300025904 Bacteria 14824
749 Ga0207647_10010020 3300025904 Bacteria 6710
750 Ga0207647_10081062 3300025904 Bacteria 1945
751 Ga0207645_10000017 3300025907 Bacteria 113872
752 Ga0207645_10000082 3300025907 Bacteria 68372
753 Ga0207645_10000413 3300025907 Bacteria 35446
754 Ga0207645_10000544 3300025907 Bacteria 31399
755 Ga0207645_10000863 3300025907 Bacteria 25194
756 Ga0207645_10000949 3300025907 Bacteria 24072
757 Ga0207645_10000957 3300025907 Bacteria 23915
758 Ga0207645_10003660 3300025907 Bacteria 11601
759 Ga0207645_10003750 3300025907 Bacteria 11423
760 Ga0207645_10009427 3300025907 Bacteria 6753
761 Ga0207645_10022717 3300025907 Bacteria 4077
762 Ga0207645_10043213 3300025907 Bacteria 2884
763 Ga0207643_10000337 3300025908 Bacteria 31988
764 Ga0207643_10020209 3300025908 Bacteria 3653
765 Ga0207705_10000015 3300025909 Bacteria 382901
766 Ga0207705_10000036 3300025909 Bacteria 200787
767 Ga0207705_10001474 3300025909 Bacteria 18740
768 Ga0207705_10003861 3300025909 Bacteria 11396
769 Ga0207705_10013309 3300025909 Bacteria 5936
770 Ga0207705_10014112 3300025909 Bacteria 5755
771 Ga0207705_10024290 3300025909 Bacteria 4327
772 Ga0207705_10072857 3300025909 Bacteria 2492
773 Ga0207684_10047180 3300025910 Bacteria 3654
774 Ga0207684_10065353 3300025910 Bacteria 3088
775 Ga0207654_10001111 3300025911 Bacteria 14539
776 Ga0207654_10001242 3300025911 Bacteria 13578
777 Ga0207654_10001903 3300025911 Bacteria 10831
778 Ga0207654_10002095 3300025911 Bacteria 10217
779 Ga0207654_10005208 3300025911 Bacteria 6563
780 Ga0207654_10007436 3300025911 Bacteria 5517
781 Ga0207654_10014434 3300025911 Bacteria 4082
782 Ga0207654_10053172 3300025911 Bacteria 2337
783 Ga0207707_10002312 3300025912 Bacteria 17183
784 Ga0207707_10004624 3300025912 Bacteria 12088
785 Ga0207707_10012635 3300025912 Bacteria 7338
786 Ga0207695_10000031 3300025913 Bacteria 526801
787 Ga0207695_10000071 3300025913 Bacteria 315568
788 Ga0207695_10000361 3300025913 Bacteria 104230
789 Ga0207695_10000431 3300025913 Bacteria 91965
790 Ga0207695_10000515 3300025913 Bacteria 82285
791 Ga0207695_10000812 3300025913 Bacteria 58133
792 Ga0207695_10001368 3300025913 Bacteria 41364
793 Ga0207695_10006104 3300025913 Bacteria 15721
794 Ga0207695_10006707 3300025913 Bacteria 14858
795 Ga0207695_10016282 3300025913 Bacteria 8709
796 Ga0207695_10024440 3300025913 Bacteria 6800
797 Ga0207695_10037641 3300025913 Bacteria 5218
798 Ga0207695_10042003 3300025913 Bacteria 4889
799 Ga0207695_10047145 3300025913 Bacteria 4563
800 Ga0207695_10055700 3300025913 Bacteria 4118
801 Ga0207695_10090681 3300025913 Bacteria 3071
802 Ga0207695_10132641 3300025913 Bacteria 2447
803 Ga0207695_10134358 3300025913 Bacteria 2428
804 Ga0207671_10000746 3300025914 Bacteria 41287
805 Ga0207671_10002546 3300025914 Bacteria 19385
806 Ga0207671_10003027 3300025914 Bacteria 17226
807 Ga0207671_10003348 3300025914 Bacteria 16085
808 Ga0207671_10003740 3300025914 Bacteria 14993
809 Ga0207671_10005981 3300025914 Bacteria 11010
810 Ga0207671_10006176 3300025914 Bacteria 10763
811 Ga0207671_10006648 3300025914 Bacteria 10249
812 Ga0207671_10008293 3300025914 Bacteria 8833
813 Ga0207671_10009363 3300025914 Bacteria 8191
814 Ga0207671_10010661 3300025914 Bacteria 7561
815 Ga0207671_10018861 3300025914 Bacteria 5286
816 Ga0207671_10041627 3300025914 Bacteria 3400
817 Ga0207671_10045965 3300025914 Bacteria 3229
818 Ga0207671_10078054 3300025914 Bacteria 2479
819 Ga0207671_10083505 3300025914 Bacteria 2398
820 Ga0207660_10003228 3300025917 Bacteria 10668
821 Ga0207660_10003846 3300025917 Bacteria 9785
822 Ga0207660_10016347 3300025917 Bacteria 4910
823 Ga0207660_10025881 3300025917 Bacteria 3989
824 Ga0207662_10000030 3300025918 Bacteria 64692
825 Ga0207662_10045414 3300025918 Bacteria 2596
826 Ga0207657_10000623 3300025919 Bacteria 37660
827 Ga0207657_10009410 3300025919 Bacteria 9821
828 Ga0207657_10024891 3300025919 Bacteria 5532
829 Ga0207657_10024962 3300025919 Bacteria 5523
830 Ga0207657_10084578 3300025919 Bacteria 2658
831 Ga0207657_10094444 3300025919 Bacteria 2490
832 Ga0207649_10003325 3300025920 Bacteria 8799
833 Ga0207649_10023744 3300025920 Bacteria 3555
834 Ga0207649_10039271 3300025920 Bacteria 2869
835 Ga0207652_10000160 3300025921 Bacteria 72867
836 Ga0207652_10001233 3300025921 Bacteria 22917
837 Ga0207652_10003157 3300025921 Bacteria 13733
838 Ga0207652_10130020 3300025921 Bacteria 2245
839 Ga0207646_10010305 3300025922 Bacteria 9142
840 Ga0207681_10008738 3300025923 Bacteria 6189
841 Ga0207681_10039265 3300025923 Bacteria 3142
842 Ga0207681_10092909 3300025923 Bacteria 2158
843 Ga0207681_10124345 3300025923 Bacteria 1897
844 Ga0207694_10010420 3300025924 Bacteria 7008
845 Ga0207694_10011115 3300025924 Bacteria 6799
846 Ga0207694_10018504 3300025924 Bacteria 5264
847 Ga0207694_10019150 3300025924 Bacteria 5175
848 Ga0207694_10022181 3300025924 Bacteria 4814
849 Ga0207650_10006867 3300025925 Bacteria 7763
850 Ga0207650_10008488 3300025925 Bacteria 7014
851 Ga0207650_10059137 3300025925 Bacteria 2856
852 Ga0207650_10100345 3300025925 Bacteria 2227
853 Ga0207659_10034688 3300025926 Bacteria 3482
854 Ga0207659_10049355 3300025926 Bacteria 2985
855 Ga0207659_10053691 3300025926 Bacteria 2875
856 Ga0207659_10096121 3300025926 Bacteria 2223
857 Ga0207644_10009732 3300025931 Bacteria 6321
858 Ga0207644_10049267 3300025931 Bacteria 3015
859 Ga0207644_10055850 3300025931 Bacteria 2847
860 Ga0207690_10010554 3300025932 Bacteria 5495
861 Ga0207690_10049667 3300025932 Bacteria 2798
862 Ga0207706_10000147 3300025933 Bacteria 76792
863 Ga0207706_10000191 3300025933 Bacteria 68535
864 Ga0207706_10000315 3300025933 Bacteria 52200
865 Ga0207706_10000998 3300025933 Bacteria 28808
866 Ga0207706_10001034 3300025933 Bacteria 28280
867 Ga0207706_10006573 3300025933 Bacteria 10766
868 Ga0207706_10010472 3300025933 Bacteria 8472
869 Ga0207706_10013212 3300025933 Bacteria 7512
870 Ga0207706_10031196 3300025933 Bacteria 4749
871 Ga0207706_10139324 3300025933 Bacteria 2134
872 Ga0207686_10056162 3300025934 Bacteria 2474
873 Ga0207686_10080759 3300025934 Bacteria 2120
874 Ga0207709_10000007 3300025935 Bacteria 752025
875 Ga0207709_10000550 3300025935 Bacteria 32109
876 Ga0207670_10000782 3300025936 Bacteria 16718
877 Ga0207704_10000076 3300025938 Bacteria 61793
878 Ga0207704_10000078 3300025938 Bacteria 59491
879 Ga0207704_10001285 3300025938 Bacteria 11229
880 Ga0207704_10003694 3300025938 Bacteria 6962
881 Ga0207704_10004208 3300025938 Bacteria 6576
882 Ga0207704_10055312 3300025938 Bacteria 2425
883 Ga0207691_10000012 3300025940 Bacteria 147942
884 Ga0207691_10000031 3300025940 Bacteria 118063
885 Ga0207691_10000037 3300025940 Bacteria 108385
886 Ga0207691_10000164 3300025940 Bacteria 61768
887 Ga0207691_10012211 3300025940 Bacteria 8233
888 Ga0207691_10029890 3300025940 Bacteria 5096
889 Ga0207691_10073733 3300025940 Bacteria 3079
890 Ga0207691_10138035 3300025940 Bacteria 2149
891 Ga0207711_10000763 3300025941 Bacteria 31632
892 Ga0207711_10121153 3300025941 Bacteria 2335
893 Ga0207689_10000015 3300025942 Bacteria 118820
894 Ga0207689_10000681 3300025942 Bacteria 32411
895 Ga0207689_10002471 3300025942 Bacteria 17199
896 Ga0207689_10003852 3300025942 Bacteria 13673
897 Ga0207689_10004825 3300025942 Bacteria 12161
898 Ga0207689_10008418 3300025942 Bacteria 8983
899 Ga0207689_10025654 3300025942 Bacteria 4938
900 Ga0207689_10036630 3300025942 Bacteria 4072
901 Ga0207689_10037273 3300025942 Bacteria 4033
902 Ga0207661_10011778 3300025944 Bacteria 6350
903 Ga0207661_10028736 3300025944 Bacteria 4262
904 Ga0207661_10037420 3300025944 Bacteria 3795
905 Ga0207661_10037793 3300025944 Bacteria 3778
906 Ga0207679_10001268 3300025945 Bacteria 16000
907 Ga0207679_10019108 3300025945 Bacteria 4599
908 Ga0207679_10021431 3300025945 Bacteria 4381
909 Ga0207667_10000009 3300025949 Bacteria 603135
910 Ga0207667_10000037 3300025949 Bacteria 297252
911 Ga0207667_10000209 3300025949 Bacteria 83277
912 Ga0207667_10000263 3300025949 Bacteria 73089
913 Ga0207667_10000630 3300025949 Bacteria 45583
914 Ga0207667_10001051 3300025949 Bacteria 35135
915 Ga0207667_10003724 3300025949 Bacteria 18797
916 Ga0207667_10016127 3300025949 Bacteria 8450
917 Ga0207667_10045579 3300025949 Bacteria 4643
918 Ga0207667_10059510 3300025949 Bacteria 4001
919 Ga0207667_10062738 3300025949 Bacteria 3885
920 Ga0207667_10064094 3300025949 Bacteria 3838
921 Ga0207667_10105103 3300025949 Bacteria 2913
922 Ga0207667_10143416 3300025949 Bacteria 2459
923 Ga0207651_10000229 3300025960 Bacteria 24106
924 Ga0207651_10000443 3300025960 Bacteria 17529
925 Ga0207651_10005071 3300025960 Bacteria 6719
926 Ga0207651_10012090 3300025960 Bacteria 4864
927 Ga0207651_10013034 3300025960 Bacteria 4737
928 Ga0207651_10087153 3300025960 Bacteria 2271
929 Ga0207712_10005099 3300025961 Bacteria 8310
930 Ga0207712_10014611 3300025961 Bacteria 5056
931 Ga0207712_10028762 3300025961 Bacteria 3720
932 Ga0207712_10058817 3300025961 Bacteria 2717
933 Ga0207668_10001307 3300025972 Bacteria 14792
934 Ga0207668_10014181 3300025972 Bacteria 4929
935 Ga0207668_10018643 3300025972 Bacteria 4373
936 Ga0207640_10024969 3300025981 Bacteria 3612
937 Ga0207640_10030159 3300025981 Bacteria 3337
938 Ga0207658_10000629 3300025986 Bacteria 31155
939 Ga0207658_10000954 3300025986 Bacteria 23879
940 Ga0207658_10018906 3300025986 Bacteria 4765
941 Ga0207658_10035097 3300025986 Bacteria 3590
942 Ga0207677_10000367 3300026023 Bacteria 31466
943 Ga0207677_10004743 3300026023 Bacteria 7330
944 Ga0207677_10004861 3300026023 Bacteria 7252
945 Ga0207677_10006126 3300026023 Bacteria 6568
946 Ga0207677_10015559 3300026023 Bacteria 4479
947 Ga0207677_10020762 3300026023 Bacteria 3997
948 Ga0207677_10047362 3300026023 Bacteria 2886
949 Ga0207677_10104620 3300026023 Bacteria 2093
950 Ga0207703_10000791 3300026035 Bacteria 31141
951 Ga0207703_10004145 3300026035 Bacteria 11957
952 Ga0207703_10006005 3300026035 Bacteria 9724
953 Ga0207703_10110443 3300026035 Bacteria 2345
954 Ga0207639_10005140 3300026041 Bacteria 8820
955 Ga0207639_10013975 3300026041 Bacteria 5634
956 Ga0207639_10016611 3300026041 Bacteria 5211
957 Ga0207639_10022141 3300026041 Bacteria 4576
958 Ga0207639_10025857 3300026041 Bacteria 4260
959 Ga0207639_10078246 3300026041 Bacteria 2610
960 Ga0207639_10095934 3300026041 Bacteria 2385
961 Ga0207678_10006569 3300026067 Bacteria 10308
962 Ga0207708_10040730 3300026075 Bacteria 3542
963 Ga0207702_10000106 3300026078 Bacteria 97204
964 Ga0207702_10000201 3300026078 Bacteria 70471
965 Ga0207702_10000300 3300026078 Bacteria 57198
966 Ga0207702_10021832 3300026078 Bacteria 5300
967 Ga0207702_10071933 3300026078 Bacteria 2979
968 Ga0207702_10118543 3300026078 Bacteria 2365
969 Ga0207641_10000015 3300026088 Bacteria 321332
970 Ga0207641_10002550 3300026088 Bacteria 16762
971 Ga0207641_10007808 3300026088 Bacteria 8888
972 Ga0207641_10044466 3300026088 Bacteria 3735
973 Ga0207641_10052991 3300026088 Bacteria 3437
974 Ga0207648_10000216 3300026089 Bacteria 62159
975 Ga0207648_10000472 3300026089 Bacteria 44933
976 Ga0207648_10000648 3300026089 Bacteria 39101
977 Ga0207648_10001276 3300026089 Bacteria 28144
978 Ga0207648_10003642 3300026089 Bacteria 16123
979 Ga0207648_10005359 3300026089 Bacteria 12930
980 Ga0207648_10029570 3300026089 Bacteria 4858
981 Ga0207648_10050199 3300026089 Bacteria 3649
982 Ga0207648_10059637 3300026089 Bacteria 3328
983 Ga0207676_10002535 3300026095 Bacteria 13033
984 Ga0207676_10005763 3300026095 Bacteria 8762
985 Ga0207676_10011694 3300026095 Bacteria 6278
986 Ga0207676_10033600 3300026095 Bacteria 3876
987 Ga0207676_10035730 3300026095 Bacteria 3774
988 Ga0207674_10000008 3300026116 Bacteria 225355
989 Ga0207674_10003731 3300026116 Bacteria 18592
990 Ga0207674_10005270 3300026116 Bacteria 15389
991 Ga0207674_10014068 3300026116 Bacteria 8840
992 Ga0207674_10017851 3300026116 Bacteria 7735
993 Ga0207674_10043172 3300026116 Bacteria 4650
994 Ga0207674_10058204 3300026116 Bacteria 3916
995 Ga0207675_100000001 3300026118 Bacteria 381356
996 Ga0207675_100000791 3300026118 Bacteria 31464
997 Ga0207675_100082228 3300026118 Bacteria 3020
998 Ga0207683_10000205 3300026121 Bacteria 51230
999 Ga0207683_10001161 3300026121 Bacteria 23877
1000 Ga0207683_10008614 3300026121 Bacteria 8726
1001 Ga0207683_10009360 3300026121 Bacteria 8343
1002 Ga0207683_10009842 3300026121 Bacteria 8155
1003 Ga0207683_10015783 3300026121 Bacteria 6428
1004 Ga0207683_10030930 3300026121 Bacteria 4643
1005 Ga0207683_10076193 3300026121 Bacteria 2970
1006 Ga0207698_10000781 3300026142 Bacteria 18499
1007 Ga0207698_10001356 3300026142 Bacteria 14268
1008 Ga0207698_10011065 3300026142 Bacteria 5832
1009 Ga0207698_10017220 3300026142 Bacteria 4896
1010 Ga0207698_10057517 3300026142 Bacteria 3009
1011 Ga0207698_10131047 3300026142 Bacteria 2142
1012 Ga0209371_1000003 3300027312 Bacteria 1122971
1013 Ga0209371_1000004 3300027312 Bacteria 1098197
1014 Ga0209371_1000011 3300027312 Bacteria 848456
1015 Ga0209371_1000918 3300027312 Bacteria 23250
1016 Ga0209282_1000196 3300027666 Bacteria 32188
1017 Ga0268266_10000024 3300028379 Bacteria 490820
1018 Ga0268266_10000038 3300028379 Bacteria 325729
1019 Ga0268266_10000052 3300028379 Bacteria 296230
1020 Ga0268266_10000089 3300028379 Bacteria 198566
1021 Ga0268266_10001035 3300028379 Bacteria 34953
1022 Ga0268266_10001883 3300028379 Bacteria 23702
1023 Ga0268266_10004818 3300028379 Bacteria 12818
1024 Ga0268266_10009498 3300028379 Bacteria 8556
1025 Ga0268266_10009526 3300028379 Bacteria 8548
1026 Ga0268265_10010874 3300028380 Bacteria 6146
1027 Ga0268265_10055712 3300028380 Bacteria 3005
1028 Ga0268265_10078688 3300028380 Bacteria 2594
1029 Ga0268264_10000064 3300028381 Bacteria 301274
1030 Ga0268264_10000167 3300028381 Bacteria 146190
1031 Ga0268264_10001958 3300028381 Bacteria 18506
1032 Ga0268264_10003119 3300028381 Bacteria 14362
1033 Ga0268264_10004239 3300028381 Bacteria 12238
1034 Ga0268264_10005092 3300028381 Bacteria 11137
1035 Ga0268264_10010880 3300028381 Bacteria 7518
1036 Ga0268264_10013618 3300028381 Bacteria 6694
1037 Ga0268264_10038206 3300028381 Bacteria 3961
1038 Ga0268264_10072542 3300028381 Bacteria 2920
1039 Ga0268264_10081223 3300028381 Bacteria 2770
1040 Ga0265319_1002981 3300028563 Bacteria 8997
1041 Ga0265318_10006483 3300028577 Bacteria 5386
1042 Ga0265336_10000823 3300028666 Bacteria 16271
1043 Ga0307517_10001280 3300028786 Bacteria 42200
1044 Ga0307517_10002284 3300028786 Bacteria 30925
1045 Ga0307517_10041986 3300028786 Bacteria 4921
1046 Ga0307515_10000001 3300028794 Bacteria 4259510
1047 Ga0307515_10000039 3300028794 Bacteria 323229
1048 Ga0307515_10000118 3300028794 Bacteria 190444
1049 Ga0307515_10000432 3300028794 Bacteria 100348
1050 Ga0307515_10000707 3300028794 Bacteria 76907
1051 Ga0307515_10000993 3300028794 Bacteria 64832
1052 Ga0307515_10001738 3300028794 Bacteria 48492
1053 Ga0265338_10004851 3300028800 Bacteria 17937
1054 Ga0265338_10020137 3300028800 Bacteria 7034
1055 Ga0265324_10000416 3300029957 Bacteria 30560
1056 Ga0268256_1000004 3300030500 Bacteria 1122967
1057 Ga0268256_1000005 3300030500 Bacteria 1082342
1058 Ga0268256_1000011 3300030500 Bacteria 848625
1059 Ga0307511_10000539 3300030521 Bacteria 40541
1060 Ga0307511_10007925 3300030521 Bacteria 10657
1061 Ga0316177_1077590 3300030731 Bacteria 19050
1062 Ga0316177_1206112 3300030731 Bacteria 11105
1063 Ga0316176_1032885 3300030732 Bacteria 20298
1064 Ga0316176_1116219 3300030732 Bacteria 2737
1065 Ga0316183_1115618 3300030742 Bacteria 53789
1066 Ga0316183_1192789 3300030742 Bacteria 8284
1067 Ga0316183_1214785 3300030742 Bacteria 3273
1068 Ga0316181_1044354 3300030744 Bacteria 13325
1069 Ga0316181_1293487 3300030744 Bacteria 2723
1070 Ga0265320_10000978 3300031240 Bacteria 21266
1071 Ga0265320_10001952 3300031240 Bacteria 14557
1072 Ga0265327_10000115 3300031251 Bacteria 173854
1073 Ga0265327_10001661 3300031251 Bacteria 26801
1074 Ga0265327_10001768 3300031251 Bacteria 25530
1075 Ga0265316_10002824 3300031344 Bacteria 17773
1076 Ga0307513_10081274 3300031456 Bacteria 3340
1077 Ga0307509_10015753 3300031507 Bacteria 8798
1078 Ga0307509_10021103 3300031507 Bacteria 7372
1079 Ga0307509_10034576 3300031507 Bacteria 5552
1080 Ga0307509_10059903 3300031507 Bacteria 4027
1081 Ga0307509_10089495 3300031507 Bacteria 3157
1082 Ga0307509_10100060 3300031507 Bacteria 2939
1083 Ga0307509_10115835 3300031507 Bacteria 2671
1084 Ga0307509_10158173 3300031507 Bacteria 2168
1085 Ga0307408_100000005 3300031548 Bacteria 529098
1086 Ga0307408_100000745 3300031548 Bacteria 26314
1087 Ga0265313_10043671 3300031595 Bacteria 2193
1088 Ga0307508_10000022 3300031616 Bacteria 180417
1089 Ga0307508_10039632 3300031616 Bacteria 4231
1090 Ga0265314_10001473 3300031711 Bacteria 26185
1091 Ga0265314_10022801 3300031711 Bacteria 4791
1092 Ga0307516_10000292 3300031730 Bacteria 65041
1093 Ga0307516_10000656 3300031730 Bacteria 46771
1094 Ga0307516_10039679 3300031730 Bacteria 4692
1095 Ga0307405_10000015 3300031731 Bacteria 206299
1096 Ga0307413_10039586 3300031824 Bacteria 2743
1097 Ga0307410_10053164 3300031852 Bacteria 2740
1098 Ga0307406_10008212 3300031901 Bacteria 5818
1099 Ga0307412_10000091 3300031911 Bacteria 78460
1100 Ga0307412_10000190 3300031911 Bacteria 42868
1101 Ga0307416_100025949 3300032002 Bacteria 4309
1102 Ga0307414_10001947 3300032004 Bacteria 10683
1103 Ga0307414_10012073 3300032004 Bacteria 5096
1104 Ga0307414_10101995 3300032004 Bacteria 2162
1105 Ga0307414_10144418 3300032004 Bacteria 1867
1106 Ga0307415_100014712 3300032126 Bacteria 4610
1107 Ga0307507_10001380 3300033179 Bacteria 54486
1108 Ga0307507_10002988 3300033179 Bacteria 33879
1109 Ga0307510_10003325 3300033180 Bacteria 18736
1110 Ga0307510_10003333 3300033180 Bacteria 18716
1111 Ga0307510_10087307 3300033180 Bacteria 2986
1112 Ga0307510_10096437 3300033180 Bacteria 2773
1113 Ga0373937_0050907 3300036401 Bacteria 3796
1114 Ga0395899_0000001 3300037312 Bacteria 1750322
1115 Ga0395899_0000312 3300037312 Bacteria 62304
1116 Ga0395899_0000608 3300037312 Bacteria 37382
1117 Ga0395899_0001724 3300037312 Bacteria 18183
1118 Ga0395899_0002489 3300037312 Bacteria 14953
1119 Ga0395899_0004925 3300037312 Bacteria 10387
1120 Ga0395899_0006074 3300037312 Bacteria 9377
1121 Ga0395899_0007101 3300037312 Bacteria 8668
1122 Ga0395899_0022778 3300037312 Bacteria 4746
1123 Ga0395899_0043169 3300037312 Bacteria 3364
1124 Ga0395900_0000014 3300037418 Bacteria 386513
1125 Ga0395900_0000128 3300037418 Bacteria 127446
1126 Ga0395900_0002996 3300037418 Bacteria 18376
1127 Ga0395900_0003776 3300037418 Bacteria 16226
1128 Ga0395900_0005426 3300037418 Bacteria 13362
1129 Ga0395900_0017374 3300037418 Bacteria 7343
1130 Ga0395900_0024025 3300037418 Bacteria 6236
1131 Ga0395900_0032543 3300037418 Bacteria 5362
1132 Ga0395900_0075306 3300037418 Bacteria 3470
1133 Ga0395900_0102300 3300037418 Bacteria 2943
1134 Ga0395898_0000738 3300037466 Bacteria 57155
1135 Ga0395898_0004221 3300037466 Bacteria 15748
1136 Ga0395898_0006085 3300037466 Bacteria 12948
1137 Ga0395898_0041215 3300037466 Bacteria 4561
1138 Ga0395898_0096548 3300037466 Bacteria 2839
1139 Ga0395905_0000037 3300037471 Bacteria 261808
1140 Ga0395905_0005293 3300037471 Bacteria 13196
1141 Ga0395905_0006237 3300037471 Bacteria 12038
1142 Ga0395905_0018067 3300037471 Bacteria 6695
1143 Ga0395905_0018342 3300037471 Bacteria 6642
1144 Ga0395905_0018721 3300037471 Bacteria 6569
1145 Ga0395905_0036317 3300037471 Bacteria 4627
1146 Ga0395905_0052273 3300037471 Bacteria 3825
1147 Ga0395905_0164600 3300037471 Bacteria 2084
1148 Ga0395905_0182422 3300037471 Bacteria 1971
1149 Ga0395905_0210173 3300037471 Bacteria 1823
1150 Ga0395901_0000166 3300038443 Bacteria 86352
1151 Ga0395901_0002864 3300038443 Bacteria 17425
1152 Ga0395901_0007998 3300038443 Bacteria 10674
1153 Ga0395901_0011134 3300038443 Bacteria 9118
1154 Ga0395901_0015733 3300038443 Bacteria 7707
1155 Ga0395901_0018348 3300038443 Bacteria 7143
1156 Ga0395901_0043422 3300038443 Bacteria 4663
1157 Ga0395901_0075146 3300038443 Bacteria 3525
1158 Ga0237819_00014 3300038705 Bacteria 59581
1159 Ga0436365_0265980 3300039437 Bacteria 5705
1160 Ga0436365_1041558 3300039437 Bacteria 15401
1161 Ga0436365_1179973 3300039437 Bacteria 33661
1162 Ga0436365_1313174 3300039437 Bacteria 18752
1163 Ga0436361_0049735 3300039447 Bacteria 3086
1164 Ga0436361_0458961 3300039447 Bacteria 22334
1165 Ga0439439_0003733 3300041406 Bacteria 3381
1166 Ga0439447_000932 3300041407 Bacteria 10686
1167 Ga0439448_0008981 3300042005 Bacteria 2937
1168 Ga0439448_0010150 3300042005 Bacteria 2786
1169 Ga0439457_000583 3300042014 Bacteria 10682
1170 Ga0466969_0000340 3300044656 Bacteria 25991
1171 Ga0466972_0000030 3300044658 Bacteria 161580
1172 Ga0466972_0000077 3300044658 Bacteria 91574
1173 Ga0466972_0000102 3300044658 Bacteria 75316
1174 Ga0466972_0000928 3300044658 Bacteria 14109
1175 Ga0466972_0001549 3300044658 Bacteria 11203
1176 Ga0466972_0011368 3300044658 Bacteria 4467
1177 Ga0466972_0034518 3300044658 Bacteria 2478
1178 Ga0466966_0000116 3300044684 Bacteria 49877
1179 Ga0466966_0000184 3300044684 Bacteria 41499
1180 Ga0466968_0022866 3300044735 Bacteria 2544
1181 Ga0466970_0001668 3300044765 Bacteria 10653
1182 Ga0466970_0064323 3300044765 Bacteria 1967
1183 Ga0466957_0003931 3300044842 Bacteria 8212
1184 Ga0466957_0023457 3300044842 Bacteria 3648
1185 Ga0466957_0054376 3300044842 Bacteria 2444
1186 Ga0466959_0000021 3300045049 Bacteria 132387
1187 Ga0466959_0000097 3300045049 Bacteria 55620
1188 Ga0466959_0001771 3300045049 Bacteria 13458
1189 Ga0466959_0001838 3300045049 Bacteria 13327
1190 Ga0466967_0004595 3300045976 Bacteria 9349
1191 Ga0466967_0020593 3300045976 Bacteria 5336
1192 Ga0495638_0051438 3300046460 Bacteria 2569
1193 Ga0495650_0000273 3300046471 Bacteria 98757
1194 Ga0495650_0025489 3300046471 Bacteria 2770
1195 Ga0495650_0037422 3300046471 Bacteria 2113
1196 Ga0495585_0000156 3300046492 Bacteria 72941
1197 Ga0495585_0000429 3300046492 Bacteria 40273
1198 Ga0495585_0000570 3300046492 Bacteria 34695
1199 Ga0495606_0000002 3300046507 Bacteria 554637
1200 Ga0495606_0000130 3300046507 Bacteria 127805
1201 Ga0495606_0016588 3300046507 Bacteria 5608
1202 Ga0495606_0017234 3300046507 Bacteria 5471
1203 Ga0495610_0000232 3300046512 Bacteria 59379
1204 Ga0495610_0007481 3300046512 Bacteria 7258
1205 Ga0495616_0004230 3300046513 Bacteria 9082
1206 Ga0495616_0009400 3300046513 Bacteria 5723
1207 Ga0495630_0039507 3300046517 Bacteria 3528
1208 Ga0495631_0011238 3300046518 Bacteria 4407
1209 Ga0495631_0023710 3300046518 Bacteria 2841
1210 Ga0495637_0009463 3300046520 Bacteria 4751
1211 Ga0495643_0007624 3300046522 Bacteria 6951
1212 Ga0495644_0011896 3300046523 Bacteria 3346
1213 Ga0495648_0010205 3300046524 Bacteria 7174
1214 Ga0495652_0040478 3300046529 Bacteria 4028
1215 Ga0495609_0007309 3300046538 Bacteria 5527
1216 Ga0495609_0011867 3300046538 Bacteria 4140
1217 Ga0495633_0000014 3300046558 Bacteria 261742
1218 Ga0495633_0000035 3300046558 Bacteria 185403
1219 Ga0495633_0003286 3300046558 Bacteria 10860
1220 Ga0495633_0003361 3300046558 Bacteria 10732
1221 Ga0495633_0007262 3300046558 Bacteria 6410
1222 Ga0495668_0000012 3300046616 Bacteria 458817
1223 Ga0495668_0000032 3300046616 Bacteria 254951
1224 Ga0495668_0086611 3300046616 Bacteria 1718
1225 Ga0495611_0000101 3300046648 Bacteria 59066
1226 Ga0495625_0000030 3300046660 Bacteria 241164
1227 Ga0495625_0000036 3300046660 Bacteria 221680
1228 Ga0495625_0000227 3300046660 Bacteria 88834
1229 Ga0495625_0002070 3300046660 Bacteria 22488
1230 Ga0495625_0002411 3300046660 Bacteria 20249
1231 Ga0495625_0007620 3300046660 Bacteria 9396
1232 Ga0495625_0011975 3300046660 Bacteria 7040
1233 Ga0495625_0057749 3300046660 Bacteria 2758
1234 Ga0495661_0036314 3300046665 Bacteria 3087
1235 Ga0495661_0041555 3300046665 Bacteria 2843
1236 Ga0495588_0001792 3300046674 Bacteria 9155
1237 Ga0495657_0055574 3300046675 Bacteria 2640
1238 Ga0495623_0027262 3300046679 Bacteria 3674
1239 Ga0495647_0022978 3300046681 Bacteria 2258
1240 Ga0495658_0007827 3300046683 Bacteria 5292
1241 Ga0495670_0056708 3300046691 Bacteria 1966
1242 Ga0495649_0000017 3300046694 Bacteria 221685
1243 Ga0495649_0000041 3300046694 Bacteria 125049
1244 Ga0495674_0096991 3300047319 Bacteria 2512
1245 Ga0495672_0006440 3300047320 Bacteria 9090
1246 Ga0495672_0008827 3300047320 Bacteria 7379
1247 Ga0495672_0010671 3300047320 Bacteria 6525
1248 Ga0495672_0013482 3300047320 Bacteria 5639
1249 Ga0495672_0035561 3300047320 Bacteria 3068
1250 Ga0495672_0046637 3300047320 Bacteria 2583
1251 Ga0495683_0006207 3300047323 Bacteria 6542
1252 Ga0495683_0016346 3300047323 Bacteria 3855
1253 Ga0495687_000001 3300047443 Bacteria 1215582
1254 Ga0495687_000527 3300047443 Bacteria 45682
1255 Ga0495687_001574 3300047443 Bacteria 20718
1256 Ga0495687_002393 3300047443 Bacteria 15128
1257 Ga0495687_007779 3300047443 Bacteria 6241
1258 Ga0495681_0004504 3300047470 Bacteria 9510
1259 Ga0495686_0000006 3300047472 Bacteria 770778
1260 Ga0495686_0000071 3300047472 Bacteria 216594
1261 Ga0495686_0000083 3300047472 Bacteria 198933
1262 Ga0495686_0000693 3300047472 Bacteria 45522
1263 Ga0495686_0010932 3300047472 Bacteria 6425
1264 Ga0495614_0016941 3300048089 Bacteria 3168
1265 Ga0496102_0005555 3300048905 Bacteria 10708
1266 Ga0496102_0107314 3300048905 Bacteria 2600
1267 Ga0496109_0002949 3300048912 Bacteria 14237
1268 Ga0496109_0028678 3300048912 Bacteria 4982
1269 Ga0496112_0026757 3300048915 Bacteria 5557
1270 Ga0496112_0214262 3300048915 Bacteria 1883
1271 Ga0496114_0004874 3300048917 Bacteria 10450
1272 Ga0496116_0000545 3300048919 Bacteria 50407
1273 Ga0496116_0001546 3300048919 Bacteria 25478
1274 Ga0496116_0036253 3300048919 Bacteria 3454
1275 Ga0496117_0000002 3300048920 Bacteria 2483758
1276 Ga0496117_0008674 3300048920 Bacteria 9607
1277 Ga0496117_0009998 3300048920 Bacteria 8721
1278 Ga0496117_0016227 3300048920 Bacteria 6294
1279 Ga0496117_0016283 3300048920 Bacteria 6282
1280 Ga0496118_0000707 3300048921 Bacteria 53851
1281 Ga0496118_0014548 3300048921 Bacteria 7356
1282 Ga0496118_0103733 3300048921 Bacteria 1911
1283 Ga0496119_0000596 3300048922 Bacteria 48957
1284 Ga0496119_0014387 3300048922 Bacteria 6198
1285 Ga0496119_0052600 3300048922 Bacteria 2493
1286 Ga0496120_0000358 3300048923 Bacteria 74781
1287 Ga0496120_0000879 3300048923 Bacteria 42390
1288 Ga0496120_0003894 3300048923 Bacteria 13069
1289 Ga0496120_0007570 3300048923 Bacteria 8056
1290 Ga0496121_0000005 3300048924 Bacteria 1034486
1291 Ga0496121_0000036 3300048924 Bacteria 362643
1292 Ga0496122_0000001 3300048925 Bacteria 1827766
1293 Ga0496122_0000395 3300048925 Bacteria 92779
1294 Ga0496122_0000662 3300048925 Bacteria 69323
1295 Ga0496122_0001285 3300048925 Bacteria 41682
1296 Ga0496122_0013400 3300048925 Bacteria 8029
1297 Ga0496122_0020421 3300048925 Bacteria 5985
1298 Ga0496123_0000001 3300048926 Bacteria 1831497
1299 Ga0496123_0000478 3300048926 Bacteria 69650
1300 Ga0496123_0001024 3300048926 Bacteria 42542
1301 Ga0496123_0003994 3300048926 Bacteria 15964
1302 Ga0496123_0004187 3300048926 Bacteria 15410
1303 Ga0496123_0016193 3300048926 Bacteria 6069
1304 Ga0496123_0019800 3300048926 Bacteria 5287
1305 Ga0496124_0000009 3300048927 Bacteria 734820
1306 Ga0496124_0000390 3300048927 Bacteria 79997
1307 Ga0496124_0003741 3300048927 Bacteria 18337
1308 Ga0496124_0028145 3300048927 Bacteria 5030
1309 Ga0496124_0052519 3300048927 Bacteria 3461
1310 Ga0496125_0008112 3300048928 Bacteria 11060
1311 Ga0496125_0016681 3300048928 Bacteria 7041
1312 Ga0496125_0021567 3300048928 Bacteria 6004
1313 Ga0496125_0026856 3300048928 Bacteria 5230
1314 Ga0495678_005842 3300049459 Bacteria 6668
1315 Ga0495682_0022511 3300049460 Bacteria 2357
1316 Ga0501290_000620 3300049513 Bacteria 5324
1317 Ga0501298_001313 3300049521 Bacteria 3641
1318 Ga0501299_000750 3300049522 Bacteria 3937
1319 Ga0501032_0001784 3300049569 Bacteria 16985
1320 Ga0501032_0121047 3300049569 Bacteria 1730
1321 Ga0501034_0024000 3300049571 Bacteria 6205
1322 Ga0501034_0147866 3300049571 Bacteria 2326
1323 Ga0501046_0019898 3300049580 Bacteria 5559
1324 Ga0501047_0001741 3300049581 Bacteria 21106
1325 Ga0501047_0079796 3300049581 Bacteria 3146
1326 Ga0501070_0052145 3300049586 Bacteria 3396
1327 Ga0501198_000624 3300049649 Bacteria 4393
1328 Ga0501201_000090 3300049651 Bacteria 6980
1329 Ga0501201_000660 3300049651 Bacteria 3226
1330 Ga0501202_002037 3300049652 Bacteria 3341
1331 Ga0501207_000817 3300049654 Bacteria 3683
1332 Ga0501217_000145 3300049661 Bacteria 9685
1333 Ga0501223_001768 3300049663 Bacteria 4898
1334 Ga0501223_005401 3300049663 Bacteria 2685
1335 Ga0501224_000130 3300049664 Bacteria 8202
1336 Ga0501235_000672 3300049669 Bacteria 6917
1337 Ga0501235_002446 3300049669 Bacteria 4005
1338 Ga0501242_001387 3300049674 Bacteria 2416
1339 Ga0501259_000174 3300049688 Bacteria 9765
1340 Ga0501260_001080 3300049689 Bacteria 2200
1341 Ga0501261_003418 3300049690 Bacteria 1950
1342 Ga0501225_0001324 3300049705 Bacteria 7694
1343 Ga0501234_000932 3300049707 Bacteria 4629
1344 Ga0501266_001020 3300049763 Bacteria 3616
1345 Ga0501035_0000410 3300049822 Bacteria 48698
1346 Ga0501035_0003164 3300049822 Bacteria 15809
1347 Ga0501035_0081338 3300049822 Bacteria 2859
1348 Ga0501044_0003320 3300049823 Bacteria 18122
1349 nmdc:mga03n38_4961_c1 3300050490 Bacteria 4474
1350 nmdc:mga00v17_2467_c1 3300050491 Bacteria 9471
1351 nmdc:mga00v17_6_c1 3300050491 Bacteria 179509
1352 nmdc:mga0yw44_52746_c1 3300050492 Bacteria 2467
1353 nmdc:mga0k408_16_c2 3300050493 Bacteria 101089
1354 nmdc:mga0k408_177_c3 3300050493 Bacteria 27094
1355 nmdc:mga0k408_2342_c1 3300050493 Bacteria 10077
1356 nmdc:mga06z11_12305_c1 3300050494 Bacteria 3718
1357 nmdc:mga05p37_1224_c1 3300050507 Bacteria 29706
1358 nmdc:mga08y16_101455_c1 3300050511 Bacteria 2996
1359 nmdc:mga08y16_110988_c1 3300050511 Bacteria 2855
1360 nmdc:mga0n895_6889_c1 3300050512 Bacteria 9708
1361 nmdc:mga0n895_8777_c1 3300050512 Bacteria 8790
1362 nmdc:mga08x19_14930_c1 3300050514 Bacteria 4718
1363 nmdc:mga08x19_15356_c1 3300050514 Bacteria 4659
1364 nmdc:mga08x19_7945_c1 3300050514 Bacteria 6304
1365 nmdc:mga0a205_85510_c1 3300050515 Bacteria 3046
1366 nmdc:mga0sz30_438_c1 3300050516 Bacteria 15709
1367 Ga0500635_0000855 3300053080 Bacteria 7475
1368 Ga0495619_0014565 3300053085 Bacteria 4967
1369 Ga0500578_0000026 3300053086 Bacteria 145328
1370 Ga0500644_0011703 3300053088 Bacteria 2406
1371 Ga0500583_0000022 3300053092 Bacteria 124636
1372 Ga0500583_0000078 3300053092 Bacteria 58451
1373 Ga0500583_0001571 3300053092 Bacteria 6613
1374 Ga0500583_0001982 3300053092 Bacteria 6024
1375 Ga0500560_000688 3300053107 Bacteria 5029
1376 Ga0500560_001879 3300053107 Bacteria 3825
1377 Ga0500562_000004 3300053108 Bacteria 270087
1378 Ga0500608_000174 3300053122 Bacteria 26422
1379 Ga0500608_000743 3300053122 Bacteria 11905
1380 Ga0500608_000986 3300053122 Bacteria 10227
1381 Ga0500608_003342 3300053122 Bacteria 5998
1382 Ga0500618_000001 3300053125 Bacteria 538477
1383 Ga0500618_000004 3300053125 Bacteria 293180
1384 Ga0500642_0022016 3300053130 Bacteria 2535
1385 Ga0500642_0023409 3300053130 Bacteria 2480
1386 Ga0500559_0005912 3300053136 Bacteria 5570
1387 Ga0500561_0000143 3300053137 Bacteria 13597
1388 Ga0500568_0000305 3300053139 Bacteria 39273
1389 Ga0500568_0011005 3300053139 Bacteria 4213
1390 Ga0500573_0000012 3300053140 Bacteria 208486
1391 Ga0500616_0006875 3300053153 Bacteria 7343
1392 Ga0500622_0001671 3300053156 Bacteria 17318
1393 Ga0500622_0003294 3300053156 Bacteria 10940
1394 Ga0500624_000356 3300053157 Bacteria 14836
1395 Ga0500624_000854 3300053157 Bacteria 6736
1396 Ga0500624_001118 3300053157 Bacteria 5000
1397 Ga0500634_0000167 3300053161 Bacteria 21979
1398 Ga0500634_0022165 3300053161 Bacteria 3444
1399 Ga0500634_0025601 3300053161 Bacteria 3211
1400 Ga0500645_012849 3300053730 Bacteria 2699

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049690 Ga0501261_003418 Ga0501261_003418_435_1934 441
2 3300049569 Ga0501032_0121047 Ga0501032_0121047_27_1469 454
3 3300046665 Ga0495661_0041555 Ga0495661_0041555_1318_2802 455
4 3300048915 Ga0496112_0214262 Ga0496112_0214262_364_1851 455
5 3300053161 Ga0500634_0022165 Ga0500634_0022165_20_1453 455
6 3300047472 Ga0495686_0010932 Ga0495686_0010932_28_1605 456
7 3300005339 Ga0070660_100000820 Ga0070660_1000008202 467
8 3300005340 Ga0070689_100026159 Ga0070689_1000261592 467
9 3300005344 Ga0070661_100000520 Ga0070661_10000052020 467
10 3300005353 Ga0070669_100023776 Ga0070669_1000237764 467
11 3300005365 Ga0070688_100001777 Ga0070688_1000017772 467
12 3300005366 Ga0070659_100025545 Ga0070659_1000255454 467
13 3300005440 Ga0070705_100000282 Ga0070705_10000028228 467
14 3300005441 Ga0070700_100003565 Ga0070700_1000035652 467
15 3300005466 Ga0070685_10002021 Ga0070685_1000202110 467
16 3300005539 Ga0068853_100030503 Ga0068853_1000305034 467
17 3300005544 Ga0070686_100021274 Ga0070686_1000212743 467
18 3300005563 Ga0068855_100001522 Ga0068855_10000152213 467
19 3300005577 Ga0068857_100000072 Ga0068857_1000000723 467
20 3300005616 Ga0068852_100022519 Ga0068852_1000225195 467
21 3300005718 Ga0068866_10000449 Ga0068866_100004492 467
22 3300005719 Ga0068861_100013993 Ga0068861_1000139932 467
23 3300005840 Ga0068870_10000222 Ga0068870_1000022214 467
24 3300005844 Ga0068862_100027700 Ga0068862_1000277002 467
25 3300005983 Ga0081540_1011231 Ga0081540_10112314 467
26 3300006358 Ga0068871_100047266 Ga0068871_1000472662 467
27 3300009093 Ga0105240_10004216 Ga0105240_1000421614 467
28 3300009098 Ga0105245_10006259 Ga0105245_100062593 467
29 3300009101 Ga0105247_10000674 Ga0105247_100006743 467
30 3300009174 Ga0105241_10011813 Ga0105241_100118131 467
31 3300009176 Ga0105242_10004407 Ga0105242_100044073 467
32 3300009177 Ga0105248_10000751 Ga0105248_100007513 467
33 3300009545 Ga0105237_10000526 Ga0105237_1000052637 467
34 3300009551 Ga0105238_10001248 Ga0105238_100012482 467
35 3300009553 Ga0105249_10002476 Ga0105249_100024763 467
36 3300011119 Ga0105246_10032666 Ga0105246_100326662 467
37 3300013102 Ga0157371_10000864 Ga0157371_1000086433 467
38 3300013105 Ga0157369_10029198 Ga0157369_100291985 467
39 3300013296 Ga0157374_10002930 Ga0157374_100029305 467
40 3300013297 Ga0157378_10051170 Ga0157378_100511703 467
41 3300013307 Ga0157372_10010244 Ga0157372_100102449 467
42 3300014325 Ga0163163_10016262 Ga0163163_100162626 467
43 3300014969 Ga0157376_10004479 Ga0157376_100044795 467
44 3300017792 Ga0163161_10008635 Ga0163161_100086353 467
45 3300025315 Ga0207697_10000758 Ga0207697_1000075818 467
46 3300025901 Ga0207688_10000491 Ga0207688_1000049115 467
47 3300025907 Ga0207645_10000017 Ga0207645_1000001759 467
48 3300025908 Ga0207643_10000337 Ga0207643_1000033714 467
49 3300025909 Ga0207705_10003861 Ga0207705_100038618 467
50 3300025918 Ga0207662_10000030 Ga0207662_1000003047 467
51 3300025919 Ga0207657_10000623 Ga0207657_1000062338 467
52 3300025923 Ga0207681_10008738 Ga0207681_100087385 467
53 3300025925 Ga0207650_10008488 Ga0207650_100084884 467
54 3300025933 Ga0207706_10000998 Ga0207706_1000099820 467
55 3300025936 Ga0207670_10000782 Ga0207670_100007825 467
56 3300025940 Ga0207691_10000031 Ga0207691_1000003188 467
57 3300025941 Ga0207711_10000763 Ga0207711_100007636 467
58 3300025942 Ga0207689_10000015 Ga0207689_1000001514 467
59 3300025945 Ga0207679_10021431 Ga0207679_100214313 467
60 3300025960 Ga0207651_10000229 Ga0207651_1000022915 467
61 3300025961 Ga0207712_10005099 Ga0207712_100050995 467
62 3300025981 Ga0207640_10030159 Ga0207640_100301592 467
63 3300026023 Ga0207677_10000367 Ga0207677_100003675 467
64 3300026035 Ga0207703_10000791 Ga0207703_1000079128 467
65 3300026089 Ga0207648_10000216 Ga0207648_1000021620 467
66 3300026095 Ga0207676_10005763 Ga0207676_100057636 467
67 3300026116 Ga0207674_10000008 Ga0207674_1000000885 467
68 3300026118 Ga0207675_100000001 Ga0207675_10000000182 467
69 3300026121 Ga0207683_10000205 Ga0207683_1000020514 467
70 3300026142 Ga0207698_10017220 Ga0207698_100172205 467
71 3300028379 Ga0268266_10009498 Ga0268266_100094986 467
72 3300028380 Ga0268265_10010874 Ga0268265_100108743 467
73 3300048905 Ga0496102_0005555 Ga0496102_0005555_276_1922 467
74 3300048912 Ga0496109_0002949 Ga0496109_0002949_3151_4797 467
75 iso_pu_bacteria 2600255279 2601612857 468
76 3300005983 Ga0081540_1000093 Ga0081540_100009317 469
77 3300005344 Ga0070661_100009905 Ga0070661_1000099055 470
78 3300005535 Ga0070684_100093689 Ga0070684_1000936892 470
79 3300005564 Ga0070664_100000840 Ga0070664_1000008402 470
80 3300005577 Ga0068857_100003552 Ga0068857_1000035525 470
81 3300025920 Ga0207649_10003325 Ga0207649_100033257 470
82 3300025945 Ga0207679_10001268 Ga0207679_100012684 470
83 3300026116 Ga0207674_10003731 Ga0207674_100037314 470
84 3300042005 Ga0439448_0008981 Ga0439448_0008981_598_2280 470
85 3300005983 Ga0081540_1000030 Ga0081540_1000030118 472
86 3300046681 Ga0495647_0022978 Ga0495647_0022978_128_1807 472
87 3300044765 Ga0466970_0001668 Ga0466970_0001668_297_1880 476
88 3300025913 Ga0207695_10000031 Ga0207695_1000003198 477
89 3300009545 Ga0105237_10004955 Ga0105237_100049554 479
90 3300025914 Ga0207671_10005981 Ga0207671_100059812 479
91 3300025924 Ga0207694_10018504 Ga0207694_100185041 479
92 3300026041 Ga0207639_10078246 Ga0207639_100782461 479
93 3300046616 Ga0495668_0086611 Ga0495668_0086611_23_1609 479
94 3300013307 Ga0157372_10163020 Ga0157372_101630201 483
95 3300046512 Ga0495610_0007481 Ga0495610_0007481_3948_5627 488
96 3300046558 Ga0495633_0003361 Ga0495633_0003361_8473_10152 488
97 3300047320 Ga0495672_0046637 Ga0495672_0046637_670_2289 488
98 3300001990 JGI24737J22298_10000041 JGI24737J22298_1000004124 491
99 3300002067 JGI24735J21928_10000001 JGI24735J21928_10000001501 491
100 3300003316 rootH1_10003753 rootH1_1000375313 491
101 3300003323 rootH1_10002176 rootH1_1000217648 491
102 3300013104 Ga0157370_10156219 Ga0157370_101562191 491
103 3300013307 Ga0157372_10077941 Ga0157372_100779413 491
104 3300020077 Ga0206351_10926739 Ga0206351_109267393 491
105 3300025949 Ga0207667_10045579 Ga0207667_100455792 491
106 3300031507 Ga0307509_10021103 Ga0307509_100211039 491
107 3300045049 Ga0466959_0001771 Ga0466959_0001771_11811_13436 491
108 3300030731 Ga0316177_1077590 Ga0316177_107759015 492
109 3300030732 Ga0316176_1032885 Ga0316176_10328855 492
110 3300030742 Ga0316183_1115618 Ga0316183_111561811 492
111 3300030744 Ga0316181_1044354 Ga0316181_10443542 492
112 3300005471 Ga0070698_100005763 Ga0070698_10000576311 494
113 3300025910 Ga0207684_10065353 Ga0207684_100653532 494
114 3300032002 Ga0307416_100025949 Ga0307416_1000259493 494
115 3300050514 nmdc:mga08x19_15356_c1 nmdc:mga08x19_15356_c1_1989_3674 494
116 3300049581 Ga0501047_0001741 Ga0501047_0001741_4657_6330 498
117 3300049822 Ga0501035_0003164 Ga0501035_0003164_14073_15746 498
118 3300014326 Ga0157380_10115851 Ga0157380_101158512 500
119 3300031251 Ga0265327_10001768 Ga0265327_100017689 501
120 3300005456 Ga0070678_100018850 Ga0070678_1000188504 502
121 3300009093 Ga0105240_10033244 Ga0105240_100332446 502
122 3300053136 Ga0500559_0005912 Ga0500559_0005912_1659_3374 502
123 3300053140 Ga0500573_0000012 Ga0500573_0000012_122746_124437 502
124 3300005468 Ga0070707_100058130 Ga0070707_1000581303 503
125 3300025920 Ga0207649_10039271 Ga0207649_100392712 503
126 3300028563 Ga0265319_1002981 Ga0265319_10029811 503
127 3300028577 Ga0265318_10006483 Ga0265318_100064834 503
128 3300031240 Ga0265320_10001952 Ga0265320_100019528 503
129 3300050514 nmdc:mga08x19_14930_c1 nmdc:mga08x19_14930_c1_263_1945 503
130 2162886007 SwRhRL2b_contig_2634945 SwRhRL2b_0292.00005250 504
131 3300005289 Ga0065704_10070190 Ga0065704_1007019072 504
132 3300005445 Ga0070708_100034806 Ga0070708_1000348064 504
133 3300005545 Ga0070695_100001818 Ga0070695_10000181811 504
134 3300005546 Ga0070696_100025773 Ga0070696_1000257732 504
135 3300005549 Ga0070704_100017759 Ga0070704_1000177593 504
136 3300005564 Ga0070664_100010256 Ga0070664_1000102563 504
137 3300006852 Ga0075433_10028456 Ga0075433_100284563 504
138 3300006871 Ga0075434_100014408 Ga0075434_1000144087 504
139 3300006914 Ga0075436_100061795 Ga0075436_1000617952 504
140 3300025910 Ga0207684_10047180 Ga0207684_100471803 504
141 3300025922 Ga0207646_10010305 Ga0207646_100103055 504
142 3300050512 nmdc:mga0n895_6889_c1 nmdc:mga0n895_6889_c1_1431_3116 504
143 3300050512 nmdc:mga0n895_8777_c1 nmdc:mga0n895_8777_c1_4296_5981 504
144 3300050514 nmdc:mga08x19_7945_c1 nmdc:mga08x19_7945_c1_3420_5105 504
145 3300050515 nmdc:mga0a205_85510_c1 nmdc:mga0a205_85510_c1_182_1867 504
146 3300005334 Ga0068869_100022163 Ga0068869_1000221633 505
147 3300009177 Ga0105248_10096093 Ga0105248_100960933 505
148 3300025261 Ga0209233_1000705 Ga0209233_10007058 505
149 3300047472 Ga0495686_0000006 Ga0495686_0000006_116292_117983 505
150 iso_pu_bacteria 2738541283 2738759329 506
151 3300010375 Ga0105239_10000005 Ga0105239_1000000519 507
152 iso_pu_bacteria 2537561587 2537875289 507
153 iso_pu_bacteria 2547132130 2547500779 507
154 iso_pu_bacteria 2554235003 2554247571 507
155 iso_pu_bacteria 2558860242 2559294702 507
156 iso_pu_bacteria 2576861471 2578459256 507
157 iso_pu_bacteria 2599185184 2599477131 507
158 iso_pu_bacteria 2599185210 2599604842 507
159 iso_pu_bacteria 2600255308 2601749586 507
160 iso_pu_bacteria 2643221579 2643908394 507
161 iso_pu_bacteria 2643221582 2643922102 507
162 iso_pu_bacteria 2643221593 2643973614 507
163 iso_pu_bacteria 2643221693 2644522097 507
164 iso_pu_bacteria 2738541278 2738725243 507
165 iso_pu_bacteria 2747842428 2747949536 507
166 iso_pu_bacteria 2747842501 2748018233 507
167 iso_pu_bacteria 2765235840 2765578063 507
168 iso_pu_bacteria 2808606387 2808985525 507
169 iso_pu_bacteria 2816332141 2816516126 507
170 iso_pu_bacteria 2818991439 2819557553 507
171 iso_pu_bacteria 2818991457 2819663803 507
172 iso_pu_bacteria 2838675328 2838678913 507
173 iso_pu_bacteria 2838714209 2838717864 507
174 iso_pu_bacteria 2838719591 2838723210 507
175 iso_pu_bacteria 2838724970 2838728581 507
176 iso_pu_bacteria 2841846520 2841849856 507
177 iso_pu_bacteria 2841859092 2841863639 507
178 iso_pu_bacteria 2842124991 2842128328 507
179 iso_pu_bacteria 2842130223 2842133936 507
180 iso_pu_bacteria 2842152218 2842155800 507
181 iso_pu_bacteria 2842170452 2842174110 507
182 iso_pu_bacteria 2842175837 2842179550 507
183 iso_pu_bacteria 2842187318 2842191071 507
184 iso_pu_bacteria 2842211629 2842215386 507
185 iso_pu_bacteria 2842224351 2842227975 507
186 iso_pu_bacteria 2842391507 2842393686 507
187 iso_pu_bacteria 2842515876 2842520422 507
188 iso_pu_bacteria 2842757796 2842759302 507
189 iso_pu_bacteria 2842780639 2842780994 507
190 iso_pu_bacteria 2842903701 2842906429 507
191 iso_pu_bacteria 2842903701 2842907817 507
192 iso_pu_bacteria 2852623160 2852623205 507
193 iso_pu_bacteria 2852649853 2852651587 507
194 iso_pu_bacteria 2852684882 2852686495 507
195 iso_pu_bacteria 2874220319 2874220712 507
196 iso_pu_bacteria 2884933994 2884937930 507
197 iso_pu_bacteria 2899792073 2899793724 507
198 iso_pu_bacteria 2899845264 2899850148 507
199 iso_pu_bacteria 2904780799 2904784272 507
200 iso_pu_bacteria 2919089067 2919090742 507
201 iso_pu_bacteria 2919114240 2919118144 507
202 iso_pu_bacteria 2919130084 2919132757 507
203 iso_pu_bacteria 2919134579 2919134625 507
204 iso_pu_bacteria 2919177583 2919179104 507
205 iso_pu_bacteria 2919437846 2919442089 507
206 iso_pu_bacteria 2926754445 2926757909 507
207 iso_pu_bacteria 2926760298 2926760616 507
208 iso_pu_bacteria 2928078545 2928079045 507
209 iso_pu_bacteria 2928147474 2928148584 507
210 iso_pu_bacteria 2928496128 2928496726 507
211 iso_pu_bacteria 2929138655 2929143406 507
212 iso_pu_bacteria 2929154850 2929155614 507
213 iso_pu_bacteria 2929195423 2929196925 507
214 iso_pu_bacteria 2931380184 2931381654 507
215 iso_pu_bacteria 2932082852 2932085878 507
216 iso_pu_bacteria 2933006813 2933010825 507
217 iso_pu_bacteria 2933011516 2933016114 507
218 iso_pu_bacteria 2933594066 2933597345 507
219 iso_pu_bacteria 2937610967 2937611555 507
220 iso_pu_bacteria 2939589442 2939592138 507
221 iso_pu_bacteria 2939622612 2939625164 507
222 iso_pu_bacteria 2939626828 2939627478 507
223 iso_pu_bacteria 2941475908 2941477014 507
224 iso_pu_bacteria 2941489479 2941490336 507
225 iso_pu_bacteria 2961047084 2961047477 507
226 iso_pu_bacteria 2961064222 2961068264 507
227 iso_pu_bacteria 2974307012 2974309686 507
228 iso_pu_bacteria 2977247770 2977250434 507
229 iso_pu_bacteria 2979089926 2979094102 507
230 iso_pu_bacteria 2979095461 2979098516 507
231 iso_pu_bacteria 2979100975 2979102594 507
232 iso_pu_bacteria 2984509177 2984509521 507
233 iso_pu_bacteria 2984514374 2984515100 507
234 iso_pu_bacteria 2984518228 2984519781 507
235 iso_pu_bacteria 2984537506 2984537854 507
236 iso_pu_bacteria 2984601300 2984604599 507
237 iso_pu_bacteria 2995948881 2995951657 507
238 iso_pu_bacteria 3000405567 3000405839 507
239 iso_pu_bacteria 650716007 650739905 507
240 iso_pu_bacteria 8002869464 8002872084 507
241 iso_pu_bacteria 8003570095 8003574537 507
242 iso_pu_bacteria 8021622325 8021625269 507
243 iso_pu_bacteria 8021648035 8021649718 507
244 3300006871 Ga0075434_100125131 Ga0075434_1001251313 508
245 3300013296 Ga0157374_10000004 Ga0157374_10000004537 508
246 3300014969 Ga0157376_10000690 Ga0157376_1000069021 508
247 3300044658 Ga0466972_0000030 Ga0466972_0000030_61074_62753 508
248 iso_pu_bacteria 2738541276 2738716982 508
249 iso_pu_bacteria 2739367656 2739614049 508
250 iso_pu_bacteria 2857627736 2857629506 508
251 iso_pu_bacteria 2899275550 2899275745 508
252 3300001979 JGI24740J21852_10010037 JGI24740J21852_100100372 509
253 3300003320 rootH2_10023917 rootH2_100239176 509
254 3300003320 rootH2_10057849 rootH2_1005784918 509
255 3300005329 Ga0070683_100002450 Ga0070683_1000024507 509
256 3300005535 Ga0070684_100007769 Ga0070684_1000077695 509
257 3300005539 Ga0068853_100043469 Ga0068853_1000434691 509
258 3300005563 Ga0068855_100000089 Ga0068855_10000008997 509
259 3300005563 Ga0068855_100016685 Ga0068855_1000166857 509
260 3300005577 Ga0068857_100006566 Ga0068857_1000065664 509
261 3300005578 Ga0068854_100048329 Ga0068854_1000483292 509
262 3300005614 Ga0068856_100040865 Ga0068856_1000408656 509
263 3300005614 Ga0068856_100045016 Ga0068856_1000450161 509
264 3300005616 Ga0068852_100000242 Ga0068852_10000024217 509
265 3300005843 Ga0068860_100001074 Ga0068860_1000010742 509
266 3300009093 Ga0105240_10000058 Ga0105240_10000058115 509
267 3300009093 Ga0105240_10000074 Ga0105240_100000743 509
268 3300009093 Ga0105240_10002072 Ga0105240_100020727 509
269 3300009093 Ga0105240_10005356 Ga0105240_1000535613 509
270 3300009093 Ga0105240_10014243 Ga0105240_100142435 509
271 3300009545 Ga0105237_10004900 Ga0105237_100049003 509
272 3300009545 Ga0105237_10008998 Ga0105237_1000899810 509
273 3300009545 Ga0105237_10010635 Ga0105237_100106353 509
274 3300009545 Ga0105237_10018295 Ga0105237_100182953 509
275 3300009551 Ga0105238_10002044 Ga0105238_100020448 509
276 3300009551 Ga0105238_10091880 Ga0105238_100918802 509
277 3300010375 Ga0105239_10000126 Ga0105239_1000012675 509
278 3300010375 Ga0105239_10000529 Ga0105239_1000052913 509
279 3300010375 Ga0105239_10001365 Ga0105239_100013652 509
280 3300010375 Ga0105239_10107592 Ga0105239_101075922 509
281 3300013100 Ga0157373_10004902 Ga0157373_100049026 509
282 3300013104 Ga0157370_10002239 Ga0157370_100022398 509
283 3300013104 Ga0157370_10011697 Ga0157370_100116974 509
284 3300013105 Ga0157369_10056666 Ga0157369_100566663 509
285 3300013296 Ga0157374_10000001 Ga0157374_10000001863 509
286 3300013296 Ga0157374_10000003 Ga0157374_10000003359 509
287 3300013307 Ga0157372_10000988 Ga0157372_100009889 509
288 3300013307 Ga0157372_10001004 Ga0157372_100010048 509
289 3300013307 Ga0157372_10004637 Ga0157372_1000463716 509
290 3300013307 Ga0157372_10041370 Ga0157372_100413703 509
291 3300013307 Ga0157372_10150392 Ga0157372_101503922 509
292 3300013307 Ga0157372_10234181 Ga0157372_102341812 509
293 3300014969 Ga0157376_10002408 Ga0157376_100024082 509
294 3300025904 Ga0207647_10010020 Ga0207647_100100208 509
295 3300025904 Ga0207647_10081062 Ga0207647_100810621 509
296 3300025911 Ga0207654_10005208 Ga0207654_100052082 509
297 3300025911 Ga0207654_10014434 Ga0207654_100144343 509
298 3300025913 Ga0207695_10000071 Ga0207695_10000071141 509
299 3300025913 Ga0207695_10000515 Ga0207695_1000051548 509
300 3300025913 Ga0207695_10001368 Ga0207695_100013688 509
301 3300025913 Ga0207695_10024440 Ga0207695_100244404 509
302 3300025913 Ga0207695_10042003 Ga0207695_100420033 509
303 3300025913 Ga0207695_10134358 Ga0207695_101343582 509
304 3300025914 Ga0207671_10003348 Ga0207671_1000334811 509
305 3300025914 Ga0207671_10003740 Ga0207671_100037405 509
306 3300025914 Ga0207671_10006176 Ga0207671_100061768 509
307 3300025914 Ga0207671_10018861 Ga0207671_100188616 509
308 3300025924 Ga0207694_10010420 Ga0207694_100104202 509
309 3300025924 Ga0207694_10011115 Ga0207694_100111153 509
310 3300025924 Ga0207694_10019150 Ga0207694_100191502 509
311 3300025944 Ga0207661_10011778 Ga0207661_100117785 509
312 3300025949 Ga0207667_10000209 Ga0207667_1000020925 509
313 3300025949 Ga0207667_10001051 Ga0207667_1000105123 509
314 3300025981 Ga0207640_10024969 Ga0207640_100249692 509
315 3300026116 Ga0207674_10014068 Ga0207674_100140684 509
316 3300026142 Ga0207698_10000781 Ga0207698_1000078117 509
317 3300031251 Ga0265327_10000115 Ga0265327_1000011517 509
318 3300033180 Ga0307510_10003333 Ga0307510_100033336 509
319 3300044658 Ga0466972_0000928 Ga0466972_0000928_2076_3749 509
320 3300044658 Ga0466972_0001549 Ga0466972_0001549_1868_3541 509
321 3300045049 Ga0466959_0001838 Ga0466959_0001838_3242_4915 509
322 3300046460 Ga0495638_0051438 Ga0495638_0051438_416_2089 509
323 3300053088 Ga0500644_0011703 Ga0500644_0011703_93_1778 509
324 3300002737 JGI25162J39368_1000055 JGI25162J39368_100005542 510
325 3300003203 JGI25406J46586_10021001 JGI25406J46586_100210012 510
326 3300003354 JGI25160J50197_1002036 JGI25160J50197_10020363 510
327 3300003354 JGI25160J50197_1005029 JGI25160J50197_10050295 510
328 3300003790 Ga0055528_1000417 Ga0055528_10004174 510
329 3300003790 Ga0055528_1002063 Ga0055528_100206311 510
330 3300005262 Ga0065165_1000036 Ga0065165_100003665 510
331 3300005327 Ga0070658_10102930 Ga0070658_101029302 510
332 3300005329 Ga0070683_100028466 Ga0070683_1000284661 510
333 3300005331 Ga0070670_100178680 Ga0070670_1001786801 510
334 3300005333 Ga0070677_10010189 Ga0070677_100101891 510
335 3300005335 Ga0070666_10006184 Ga0070666_100061843 510
336 3300005338 Ga0068868_100020561 Ga0068868_1000205615 510
337 3300005347 Ga0070668_100072862 Ga0070668_1000728621 510
338 3300005364 Ga0070673_100012309 Ga0070673_1000123095 510
339 3300005365 Ga0070688_100024266 Ga0070688_1000242662 510
340 3300005367 Ga0070667_100019189 Ga0070667_1000191893 510
341 3300005367 Ga0070667_100197158 Ga0070667_1001971581 510
342 3300005456 Ga0070678_100132911 Ga0070678_1001329111 510
343 3300005457 Ga0070662_100014194 Ga0070662_1000141942 510
344 3300005457 Ga0070662_100038949 Ga0070662_1000389492 510
345 3300005535 Ga0070684_100045143 Ga0070684_1000451432 510
346 3300005535 Ga0070684_100083619 Ga0070684_1000836191 510
347 3300005548 Ga0070665_100207792 Ga0070665_1002077921 510
348 3300005563 Ga0068855_100026716 Ga0068855_1000267164 510
349 3300005563 Ga0068855_100181186 Ga0068855_1001811863 510
350 3300005564 Ga0070664_100187919 Ga0070664_1001879191 510
351 3300005614 Ga0068856_100000825 Ga0068856_10000082516 510
352 3300005616 Ga0068852_100031708 Ga0068852_1000317083 510
353 3300005617 Ga0068859_100016078 Ga0068859_1000160784 510
354 3300005618 Ga0068864_100010956 Ga0068864_1000109564 510
355 3300005834 Ga0068851_10015833 Ga0068851_100158332 510
356 3300005841 Ga0068863_100026806 Ga0068863_1000268062 510
357 3300005843 Ga0068860_100014033 Ga0068860_1000140333 510
358 3300005843 Ga0068860_100023333 Ga0068860_1000233332 510
359 3300005844 Ga0068862_100021209 Ga0068862_1000212094 510
360 3300005985 Ga0081539_10000366 Ga0081539_100003662 510
361 3300006237 Ga0097621_100034350 Ga0097621_1000343504 510
362 3300006358 Ga0068871_100001193 Ga0068871_10000119316 510
363 3300006358 Ga0068871_100145915 Ga0068871_1001459152 510
364 3300006358 Ga0068871_100169107 Ga0068871_1001691071 510
365 3300006844 Ga0075428_100097153 Ga0075428_1000971532 510
366 3300006931 Ga0097620_100016078 Ga0097620_1000160784 510
367 3300007076 Ga0075435_100061270 Ga0075435_1000612702 510
368 3300009093 Ga0105240_10001009 Ga0105240_100010092 510
369 3300009093 Ga0105240_10001179 Ga0105240_100011792 510
370 3300009177 Ga0105248_10102356 Ga0105248_101023562 510
371 3300009553 Ga0105249_10012803 Ga0105249_100128035 510
372 3300009553 Ga0105249_10043391 Ga0105249_100433913 510
373 3300010375 Ga0105239_10000327 Ga0105239_1000032753 510
374 3300010375 Ga0105239_10010481 Ga0105239_100104812 510
375 3300010375 Ga0105239_10045632 Ga0105239_100456323 510
376 3300011119 Ga0105246_10008903 Ga0105246_100089033 510
377 3300013102 Ga0157371_10010482 Ga0157371_100104825 510
378 3300013102 Ga0157371_10077019 Ga0157371_100770193 510
379 3300013104 Ga0157370_10087792 Ga0157370_100877922 510
380 3300013105 Ga0157369_10092129 Ga0157369_100921292 510
381 3300013306 Ga0163162_10002340 Ga0163162_100023402 510
382 3300013306 Ga0163162_10008944 Ga0163162_100089443 510
383 3300013306 Ga0163162_10122689 Ga0163162_101226892 510
384 3300013308 Ga0157375_10007917 Ga0157375_100079172 510
385 3300013308 Ga0157375_10120913 Ga0157375_101209132 510
386 3300014325 Ga0163163_10003148 Ga0163163_1000314813 510
387 3300014497 Ga0182008_10003888 Ga0182008_100038887 510
388 3300014968 Ga0157379_10025153 Ga0157379_100251534 510
389 3300014969 Ga0157376_10005645 Ga0157376_100056456 510
390 3300014969 Ga0157376_10016013 Ga0157376_100160131 510
391 3300015261 Ga0182006_1000134 Ga0182006_100013432 510
392 3300017792 Ga0163161_10003332 Ga0163161_100033322 510
393 3300025233 Ga0209437_100130 Ga0209437_10013078 510
394 3300025273 Ga0209673_1000931 Ga0209673_100093115 510
395 3300025295 Ga0209564_1005562 Ga0209564_10055624 510
396 3300025295 Ga0209564_1006495 Ga0209564_10064952 510
397 3300025297 Ga0209758_1009146 Ga0209758_10091464 510
398 3300025298 Ga0209050_1000160 Ga0209050_100016056 510
399 3300025302 Ga0207426_1000681 Ga0207426_100068122 510
400 3300025893 Ga0207682_10020554 Ga0207682_100205542 510
401 3300025907 Ga0207645_10003750 Ga0207645_100037503 510
402 3300025907 Ga0207645_10009427 Ga0207645_100094277 510
403 3300025909 Ga0207705_10072857 Ga0207705_100728572 510
404 3300025913 Ga0207695_10000361 Ga0207695_1000036142 510
405 3300025913 Ga0207695_10000431 Ga0207695_1000043147 510
406 3300025913 Ga0207695_10132641 Ga0207695_101326412 510
407 3300025920 Ga0207649_10023744 Ga0207649_100237443 510
408 3300025923 Ga0207681_10092909 Ga0207681_100929091 510
409 3300025925 Ga0207650_10059137 Ga0207650_100591372 510
410 3300025933 Ga0207706_10010472 Ga0207706_100104723 510
411 3300025933 Ga0207706_10013212 Ga0207706_100132123 510
412 3300025938 Ga0207704_10055312 Ga0207704_100553122 510
413 3300025940 Ga0207691_10000164 Ga0207691_1000016452 510
414 3300025940 Ga0207691_10029890 Ga0207691_100298903 510
415 3300025941 Ga0207711_10121153 Ga0207711_101211532 510
416 3300025942 Ga0207689_10003852 Ga0207689_100038526 510
417 3300025942 Ga0207689_10025654 Ga0207689_100256543 510
418 3300025944 Ga0207661_10037793 Ga0207661_100377933 510
419 3300025945 Ga0207679_10019108 Ga0207679_100191083 510
420 3300025961 Ga0207712_10058817 Ga0207712_100588173 510
421 3300025986 Ga0207658_10035097 Ga0207658_100350973 510
422 3300026023 Ga0207677_10104620 Ga0207677_101046201 510
423 3300026041 Ga0207639_10095934 Ga0207639_100959341 510
424 3300026078 Ga0207702_10118543 Ga0207702_101185432 510
425 3300026089 Ga0207648_10005359 Ga0207648_100053593 510
426 3300026089 Ga0207648_10050199 Ga0207648_100501992 510
427 3300026095 Ga0207676_10033600 Ga0207676_100336002 510
428 3300026116 Ga0207674_10017851 Ga0207674_100178515 510
429 3300026121 Ga0207683_10030930 Ga0207683_100309302 510
430 3300026142 Ga0207698_10011065 Ga0207698_100110654 510
431 3300026142 Ga0207698_10131047 Ga0207698_101310472 510
432 3300028379 Ga0268266_10001035 Ga0268266_100010358 510
433 3300028379 Ga0268266_10009526 Ga0268266_100095266 510
434 3300028380 Ga0268265_10078688 Ga0268265_100786881 510
435 3300028381 Ga0268264_10081223 Ga0268264_100812232 510
436 3300031595 Ga0265313_10043671 Ga0265313_100436711 510
437 3300044735 Ga0466968_0022866 Ga0466968_0022866_379_2073 510
438 3300046471 Ga0495650_0037422 Ga0495650_0037422_337_2019 510
439 3300046507 Ga0495606_0017234 Ga0495606_0017234_1937_3613 510
440 3300046675 Ga0495657_0055574 Ga0495657_0055574_79_1755 510
441 3300046679 Ga0495623_0027262 Ga0495623_0027262_440_2116 510
442 3300046691 Ga0495670_0056708 Ga0495670_0056708_37_1716 510
443 3300047472 Ga0495686_0000071 Ga0495686_0000071_28085_29761 510
444 3300048905 Ga0496102_0107314 Ga0496102_0107314_229_1917 510
445 3300048915 Ga0496112_0026757 Ga0496112_0026757_542_2218 510
446 3300048917 Ga0496114_0004874 Ga0496114_0004874_6883_8571 510
447 3300048925 Ga0496122_0001285 Ga0496122_0001285_15772_17448 510
448 3300048926 Ga0496123_0003994 Ga0496123_0003994_5160_6836 510
449 3300050511 nmdc:mga08y16_101455_c1 nmdc:mga08y16_101455_c1_936_2618 510
450 3300050511 nmdc:mga08y16_110988_c1 nmdc:mga08y16_110988_c1_897_2579 510
451 3300053156 Ga0500622_0003294 Ga0500622_0003294_5477_7153 510
452 2162886007 SwRhRL2b_contig_2665035 SwRhRL2b_0037.00001210 511
453 2162886007 SwRhRL2b_contig_55046 SwRhRL2b_0296.00006170 511
454 3300002077 JGI24744J21845_10006117 JGI24744J21845_100061172 511
455 3300002737 JGI25162J39368_1000121 JGI25162J39368_100012127 511
456 3300002737 JGI25162J39368_1004071 JGI25162J39368_10040712 511
457 3300002773 JGI25152J39213_1000112 JGI25152J39213_100011247 511
458 3300002774 JGI25150J39212_1000458 JGI25150J39212_10004589 511
459 3300003187 JGI25151J46595_10000016 JGI25151J46595_10000016117 511
460 3300003187 JGI25151J46595_10000057 JGI25151J46595_100000579 511
461 3300003214 JGI25165J46597_1001182 JGI25165J46597_10011826 511
462 3300003215 JGI25153J46596_10000041 JGI25153J46596_1000004116 511
463 3300003320 rootH2_10002858 rootH2_1000285836 511
464 3300003320 rootH2_10008234 rootH2_100082344 511
465 3300003320 rootH2_10069618 rootH2_100696184 511
466 3300003322 rootL2_10012957 rootL2_100129572 511
467 3300003322 rootL2_10087003 rootL2_100870032 511
468 3300003322 rootL2_10314874 rootL2_103148741 511
469 3300003323 rootH1_10000227 rootH1_100002277 511
470 3300003323 rootH1_10001370 rootH1_1000137066 511
471 3300003323 rootH1_10122177 rootH1_101221771 511
472 3300003354 JGI25160J50197_1005029 JGI25160J50197_10050294 511
473 3300003771 Ga0055526_1000006 Ga0055526_100000683 511
474 3300003771 Ga0055526_1000627 Ga0055526_100062722 511
475 3300003773 Ga0055537_1000003 Ga0055537_1000003143 511
476 3300003773 Ga0055537_1000018 Ga0055537_100001883 511
477 3300003773 Ga0055537_1000925 Ga0055537_100092512 511
478 3300003775 Ga0055524_1000009 Ga0055524_1000009143 511
479 3300003781 Ga0055536_1004732 Ga0055536_10047327 511
480 3300003784 Ga0055534_1000004 Ga0055534_1000004143 511
481 3300003784 Ga0055534_1001119 Ga0055534_10011195 511
482 3300003790 Ga0055528_1000003 Ga0055528_1000003176 511
483 3300003790 Ga0055528_1000990 Ga0055528_10009906 511
484 3300003791 Ga0055530_10000301 Ga0055530_100003017 511
485 3300003791 Ga0055530_10000566 Ga0055530_100005667 511
486 3300003794 Ga0055531_10011268 Ga0055531_100112685 511
487 3300003856 Ga0058692_1000015 Ga0058692_100001541 511
488 3300003856 Ga0058692_1000022 Ga0058692_1000022150 511
489 3300003856 Ga0058692_1000532 Ga0058692_10005327 511
490 3300004799 Ga0058863_10091895 Ga0058863_100918951 511
491 3300004799 Ga0058863_10768226 Ga0058863_107682262 511
492 3300005289 Ga0065704_10000363 Ga0065704_1000036317 511
493 3300005289 Ga0065704_10005488 Ga0065704_100054882 511
494 3300005293 Ga0065715_10003413 Ga0065715_100034131 511
495 3300005327 Ga0070658_10000018 Ga0070658_10000018184 511
496 3300005327 Ga0070658_10000019 Ga0070658_10000019145 511
497 3300005327 Ga0070658_10005453 Ga0070658_100054532 511
498 3300005327 Ga0070658_10036214 Ga0070658_100362143 511
499 3300005327 Ga0070658_10055255 Ga0070658_100552551 511
500 3300005327 Ga0070658_10145991 Ga0070658_101459911 511
501 3300005328 Ga0070676_10000375 Ga0070676_1000037514 511
502 3300005328 Ga0070676_10004933 Ga0070676_100049332 511
503 3300005328 Ga0070676_10019786 Ga0070676_100197862 511
504 3300005329 Ga0070683_100037997 Ga0070683_1000379974 511
505 3300005331 Ga0070670_100010980 Ga0070670_1000109809 511
506 3300005335 Ga0070666_10034846 Ga0070666_100348462 511
507 3300005336 Ga0070680_100002384 Ga0070680_1000023845 511
508 3300005336 Ga0070680_100005853 Ga0070680_1000058537 511
509 3300005336 Ga0070680_100033472 Ga0070680_1000334723 511
510 3300005337 Ga0070682_100002553 Ga0070682_1000025537 511
511 3300005338 Ga0068868_100000075 Ga0068868_1000000756 511
512 3300005338 Ga0068868_100082703 Ga0068868_1000827032 511
513 3300005339 Ga0070660_100000589 Ga0070660_10000058913 511
514 3300005339 Ga0070660_100009554 Ga0070660_1000095543 511
515 3300005339 Ga0070660_100027073 Ga0070660_1000270732 511
516 3300005345 Ga0070692_10045970 Ga0070692_100459702 511
517 3300005347 Ga0070668_100000859 Ga0070668_10000085917 511
518 3300005347 Ga0070668_100040950 Ga0070668_1000409502 511
519 3300005353 Ga0070669_100113323 Ga0070669_1001133232 511
520 3300005354 Ga0070675_100122264 Ga0070675_1001222642 511
521 3300005355 Ga0070671_100073936 Ga0070671_1000739362 511
522 3300005356 Ga0070674_100010260 Ga0070674_1000102603 511
523 3300005364 Ga0070673_100000448 Ga0070673_10000044815 511
524 3300005364 Ga0070673_100001702 Ga0070673_1000017025 511
525 3300005364 Ga0070673_100004629 Ga0070673_1000046295 511
526 3300005366 Ga0070659_100057403 Ga0070659_1000574032 511
527 3300005366 Ga0070659_100063497 Ga0070659_1000634972 511
528 3300005367 Ga0070667_100000482 Ga0070667_10000048223 511
529 3300005444 Ga0070694_100003101 Ga0070694_1000031015 511
530 3300005444 Ga0070694_100027248 Ga0070694_1000272481 511
531 3300005445 Ga0070708_100035287 Ga0070708_1000352873 511
532 3300005455 Ga0070663_100000935 Ga0070663_1000009359 511
533 3300005456 Ga0070678_100016851 Ga0070678_1000168512 511
534 3300005457 Ga0070662_100000081 Ga0070662_10000008127 511
535 3300005457 Ga0070662_100000102 Ga0070662_10000010246 511
536 3300005457 Ga0070662_100009485 Ga0070662_1000094854 511
537 3300005458 Ga0070681_10001937 Ga0070681_1000193710 511
538 3300005458 Ga0070681_10004961 Ga0070681_100049618 511
539 3300005458 Ga0070681_10088789 Ga0070681_100887893 511
540 3300005458 Ga0070681_10106717 Ga0070681_101067172 511
541 3300005459 Ga0068867_100003913 Ga0068867_1000039137 511
542 3300005459 Ga0068867_100005707 Ga0068867_1000057075 511
543 3300005459 Ga0068867_100008205 Ga0068867_1000082052 511
544 3300005459 Ga0068867_100127198 Ga0068867_1001271981 511
545 3300005471 Ga0070698_100142303 Ga0070698_1001423032 511
546 3300005518 Ga0070699_100133611 Ga0070699_1001336112 511
547 3300005530 Ga0070679_100004034 Ga0070679_1000040343 511
548 3300005530 Ga0070679_100012356 Ga0070679_1000123564 511
549 3300005530 Ga0070679_100018717 Ga0070679_1000187173 511
550 3300005530 Ga0070679_100064616 Ga0070679_1000646163 511
551 3300005530 Ga0070679_100083925 Ga0070679_1000839251 511
552 3300005530 Ga0070679_100093675 Ga0070679_1000936751 511
553 3300005530 Ga0070679_100114325 Ga0070679_1001143252 511
554 3300005536 Ga0070697_100063537 Ga0070697_1000635373 511
555 3300005539 Ga0068853_100007384 Ga0068853_1000073847 511
556 3300005539 Ga0068853_100037346 Ga0068853_1000373462 511
557 3300005543 Ga0070672_100000361 Ga0070672_10000036116 511
558 3300005543 Ga0070672_100023920 Ga0070672_1000239202 511
559 3300005544 Ga0070686_100036629 Ga0070686_1000366291 511
560 3300005545 Ga0070695_100067977 Ga0070695_1000679772 511
561 3300005547 Ga0070693_100013364 Ga0070693_1000133645 511
562 3300005548 Ga0070665_100000003 Ga0070665_100000003571 511
563 3300005548 Ga0070665_100000013 Ga0070665_10000001334 511
564 3300005548 Ga0070665_100000072 Ga0070665_100000072137 511
565 3300005548 Ga0070665_100002163 Ga0070665_1000021633 511
566 3300005548 Ga0070665_100154022 Ga0070665_1001540222 511
567 3300005549 Ga0070704_100004160 Ga0070704_1000041608 511
568 3300005563 Ga0068855_100000090 Ga0068855_10000009058 511
569 3300005563 Ga0068855_100000218 Ga0068855_10000021828 511
570 3300005563 Ga0068855_100000961 Ga0068855_1000009611 511
571 3300005563 Ga0068855_100002978 Ga0068855_10000297817 511
572 3300005563 Ga0068855_100005612 Ga0068855_1000056121 511
573 3300005563 Ga0068855_100006152 Ga0068855_1000061524 511
574 3300005563 Ga0068855_100011716 Ga0068855_1000117163 511
575 3300005563 Ga0068855_100012595 Ga0068855_1000125955 511
576 3300005563 Ga0068855_100016361 Ga0068855_1000163615 511
577 3300005563 Ga0068855_100038985 Ga0068855_1000389852 511
578 3300005563 Ga0068855_100183500 Ga0068855_1001835002 511
579 3300005577 Ga0068857_100066782 Ga0068857_1000667823 511
580 3300005578 Ga0068854_100053909 Ga0068854_1000539092 511
581 3300005614 Ga0068856_100000129 Ga0068856_10000012953 511
582 3300005614 Ga0068856_100001554 Ga0068856_10000155421 511
583 3300005614 Ga0068856_100002718 Ga0068856_1000027188 511
584 3300005614 Ga0068856_100045873 Ga0068856_1000458733 511
585 3300005616 Ga0068852_100011204 Ga0068852_1000112045 511
586 3300005616 Ga0068852_100154318 Ga0068852_1001543181 511
587 3300005618 Ga0068864_100000785 Ga0068864_10000078510 511
588 3300005841 Ga0068863_100066866 Ga0068863_1000668662 511
589 3300005842 Ga0068858_100042626 Ga0068858_1000426263 511
590 3300005843 Ga0068860_100052463 Ga0068860_1000524633 511
591 3300005985 Ga0081539_10000366 Ga0081539_100003664 511
592 3300006042 Ga0075368_10001587 Ga0075368_100015876 511
593 3300006051 Ga0075364_10011781 Ga0075364_100117812 511
594 3300006186 Ga0075369_10008470 Ga0075369_100084703 511
595 3300006237 Ga0097621_100000020 Ga0097621_10000002039 511
596 3300006237 Ga0097621_100000039 Ga0097621_10000003940 511
597 3300006237 Ga0097621_100034350 Ga0097621_1000343502 511
598 3300006237 Ga0097621_100048531 Ga0097621_1000485311 511
599 3300006237 Ga0097621_100135111 Ga0097621_1001351112 511
600 3300006358 Ga0068871_100000416 Ga0068871_10000041610 511
601 3300006358 Ga0068871_100048965 Ga0068871_1000489653 511
602 3300006358 Ga0068871_100136884 Ga0068871_1001368842 511
603 3300006846 Ga0075430_100008206 Ga0075430_1000082066 511
604 3300006847 Ga0075431_100089778 Ga0075431_1000897782 511
605 3300006852 Ga0075433_10143054 Ga0075433_101430542 511
606 3300006881 Ga0068865_100000180 Ga0068865_1000001807 511
607 3300006881 Ga0068865_100000208 Ga0068865_10000020833 511
608 3300006948 Ga0099826_10000045 Ga0099826_1000004531 511
609 3300006948 Ga0099826_10015717 Ga0099826_100157173 511
610 3300009011 Ga0105251_10000013 Ga0105251_1000001334 511
611 3300009011 Ga0105251_10000376 Ga0105251_1000037615 511
612 3300009093 Ga0105240_10000074 Ga0105240_100000742 511
613 3300009093 Ga0105240_10083506 Ga0105240_100835061 511
614 3300009093 Ga0105240_10122828 Ga0105240_101228282 511
615 3300009093 Ga0105240_10125426 Ga0105240_101254261 511
616 3300009098 Ga0105245_10077748 Ga0105245_100777482 511
617 3300009147 Ga0114129_10000267 Ga0114129_1000026721 511
618 3300009148 Ga0105243_10000078 Ga0105243_100000782 511
619 3300009148 Ga0105243_10005620 Ga0105243_100056205 511
620 3300009148 Ga0105243_10032248 Ga0105243_100322484 511
621 3300009174 Ga0105241_10000514 Ga0105241_100005142 511
622 3300009174 Ga0105241_10001671 Ga0105241_100016717 511
623 3300009174 Ga0105241_10002132 Ga0105241_100021328 511
624 3300009174 Ga0105241_10026236 Ga0105241_100262362 511
625 3300009176 Ga0105242_10020147 Ga0105242_100201472 511
626 3300009176 Ga0105242_10071794 Ga0105242_100717942 511
627 3300009545 Ga0105237_10000356 Ga0105237_1000035655 511
628 3300009545 Ga0105237_10005749 Ga0105237_100057494 511
629 3300009545 Ga0105237_10013542 Ga0105237_100135424 511
630 3300009545 Ga0105237_10018295 Ga0105237_100182954 511
631 3300009545 Ga0105237_10032659 Ga0105237_100326594 511
632 3300009545 Ga0105237_10094975 Ga0105237_100949752 511
633 3300009551 Ga0105238_10001582 Ga0105238_1000158214 511
634 3300009551 Ga0105238_10002044 Ga0105238_100020449 511
635 3300009551 Ga0105238_10013194 Ga0105238_100131947 511
636 3300009553 Ga0105249_10075019 Ga0105249_100750192 511
637 3300009993 Ga0105028_100994 Ga0105028_1009943 511
638 3300010375 Ga0105239_10000021 Ga0105239_10000021123 511
639 3300010375 Ga0105239_10000132 Ga0105239_1000013244 511
640 3300010375 Ga0105239_10006154 Ga0105239_100061549 511
641 3300010375 Ga0105239_10009088 Ga0105239_100090885 511
642 3300010375 Ga0105239_10012522 Ga0105239_1001252211 511
643 3300010375 Ga0105239_10019080 Ga0105239_100190802 511
644 3300010375 Ga0105239_10022581 Ga0105239_100225813 511
645 3300010375 Ga0105239_10042699 Ga0105239_100426994 511
646 3300011119 Ga0105246_10008903 Ga0105246_100089032 511
647 3300013100 Ga0157373_10001087 Ga0157373_100010874 511
648 3300013100 Ga0157373_10001162 Ga0157373_1000116217 511
649 3300013100 Ga0157373_10015649 Ga0157373_100156492 511
650 3300013102 Ga0157371_10001061 Ga0157371_100010619 511
651 3300013102 Ga0157371_10001161 Ga0157371_1000116127 511
652 3300013102 Ga0157371_10003077 Ga0157371_100030779 511
653 3300013102 Ga0157371_10007327 Ga0157371_100073274 511
654 3300013102 Ga0157371_10009645 Ga0157371_100096457 511
655 3300013102 Ga0157371_10023127 Ga0157371_100231274 511
656 3300013102 Ga0157371_10024970 Ga0157371_100249703 511
657 3300013102 Ga0157371_10028001 Ga0157371_100280012 511
658 3300013104 Ga0157370_10000408 Ga0157370_100004087 511
659 3300013104 Ga0157370_10002931 Ga0157370_1000293115 511
660 3300013104 Ga0157370_10026998 Ga0157370_100269983 511
661 3300013104 Ga0157370_10103527 Ga0157370_101035272 511
662 3300013105 Ga0157369_10009901 Ga0157369_100099019 511
663 3300013105 Ga0157369_10046814 Ga0157369_100468143 511
664 3300013105 Ga0157369_10055337 Ga0157369_100553372 511
665 3300013296 Ga0157374_10000135 Ga0157374_1000013533 511
666 3300013296 Ga0157374_10000723 Ga0157374_1000072324 511
667 3300013296 Ga0157374_10002589 Ga0157374_100025893 511
668 3300013296 Ga0157374_10003387 Ga0157374_100033875 511
669 3300013297 Ga0157378_10017865 Ga0157378_100178655 511
670 3300013297 Ga0157378_10026601 Ga0157378_100266013 511
671 3300013297 Ga0157378_10029608 Ga0157378_100296084 511
672 3300013297 Ga0157378_10059399 Ga0157378_100593992 511
673 3300013306 Ga0163162_10000097 Ga0163162_1000009712 511
674 3300013306 Ga0163162_10000117 Ga0163162_1000011749 511
675 3300013306 Ga0163162_10000377 Ga0163162_100003773 511
676 3300013306 Ga0163162_10002723 Ga0163162_100027233 511
677 3300013307 Ga0157372_10002383 Ga0157372_100023836 511
678 3300013307 Ga0157372_10016543 Ga0157372_100165432 511
679 3300013307 Ga0157372_10026913 Ga0157372_100269133 511
680 3300013307 Ga0157372_10027302 Ga0157372_100273025 511
681 3300013307 Ga0157372_10028875 Ga0157372_100288752 511
682 3300013307 Ga0157372_10041370 Ga0157372_100413702 511
683 3300013307 Ga0157372_10051539 Ga0157372_100515395 511
684 3300013307 Ga0157372_10064472 Ga0157372_100644722 511
685 3300013307 Ga0157372_10069637 Ga0157372_100696372 511
686 3300013307 Ga0157372_10146134 Ga0157372_101461341 511
687 3300013308 Ga0157375_10004745 Ga0157375_100047454 511
688 3300013308 Ga0157375_10032230 Ga0157375_100322302 511
689 3300013308 Ga0157375_10100249 Ga0157375_101002492 511
690 3300014325 Ga0163163_10000752 Ga0163163_1000075219 511
691 3300014326 Ga0157380_10002665 Ga0157380_1000266511 511
692 3300014326 Ga0157380_10011917 Ga0157380_100119175 511
693 3300014497 Ga0182008_10004569 Ga0182008_100045697 511
694 3300014968 Ga0157379_10000440 Ga0157379_100004402 511
695 3300014969 Ga0157376_10000381 Ga0157376_100003813 511
696 3300014969 Ga0157376_10016954 Ga0157376_100169544 511
697 3300015261 Ga0182006_1012970 Ga0182006_10129702 511
698 3300015261 Ga0182006_1036715 Ga0182006_10367151 511
699 3300015262 Ga0182007_10000099 Ga0182007_100000993 511
700 3300015265 Ga0182005_1000442 Ga0182005_100044210 511
701 3300015689 Ga0183360_10001 Ga0183360_100011488 511
702 3300017792 Ga0163161_10015113 Ga0163161_100151133 511
703 3300017792 Ga0163161_10072584 Ga0163161_100725842 511
704 3300021384 Ga0213876_10003502 Ga0213876_100035024 511
705 3300021384 Ga0213876_10008761 Ga0213876_100087613 511
706 3300021384 Ga0213876_10022727 Ga0213876_100227272 511
707 3300025231 Ga0207427_100125 Ga0207427_10012548 511
708 3300025233 Ga0209437_100008 Ga0209437_100008580 511
709 3300025233 Ga0209437_100017 Ga0209437_100017516 511
710 3300025245 Ga0207425_1000044 Ga0207425_1000044170 511
711 3300025245 Ga0207425_1000388 Ga0207425_100038811 511
712 3300025258 Ga0209129_1000044 Ga0209129_1000044106 511
713 3300025261 Ga0209233_1000024 Ga0209233_100002477 511
714 3300025263 Ga0209565_1000001 Ga0209565_10000012248 511
715 3300025263 Ga0209565_1000031 Ga0209565_1000031231 511
716 3300025272 Ga0209455_1001208 Ga0209455_10012082 511
717 3300025273 Ga0209673_1000001 Ga0209673_10000012248 511
718 3300025273 Ga0209673_1000674 Ga0209673_100067412 511
719 3300025291 Ga0209675_1000001 Ga0209675_1000001284 511
720 3300025291 Ga0209675_1000015 Ga0209675_1000015330 511
721 3300025292 Ga0209676_1000225 Ga0209676_10002255 511
722 3300025292 Ga0209676_1000570 Ga0209676_100057031 511
723 3300025292 Ga0209676_1000998 Ga0209676_100099831 511
724 3300025294 Ga0209025_1000006 Ga0209025_1000006887 511
725 3300025294 Ga0209025_1000012 Ga0209025_1000012394 511
726 3300025295 Ga0209564_1000001 Ga0209564_1000001446 511
727 3300025295 Ga0209564_1000037 Ga0209564_100003739 511
728 3300025297 Ga0209758_1000018 Ga0209758_1000018263 511
729 3300025297 Ga0209758_1004557 Ga0209758_10045575 511
730 3300025298 Ga0209050_1000201 Ga0209050_100020117 511
731 3300025298 Ga0209050_1000709 Ga0209050_100070927 511
732 3300025299 Ga0209256_1000002 Ga0209256_10000021106 511
733 3300025299 Ga0209256_1002877 Ga0209256_100287710 511
734 3300025302 Ga0207426_1000052 Ga0207426_1000052109 511
735 3300025303 Ga0209051_1001496 Ga0209051_100149615 511
736 3300025304 Ga0209257_1000208 Ga0209257_100020820 511
737 3300025304 Ga0209257_1000273 Ga0209257_100027381 511
738 3300025304 Ga0209257_1001168 Ga0209257_100116831 511
739 3300025304 Ga0209257_1012484 Ga0209257_10124842 511
740 3300025735 Ga0207713_1000445 Ga0207713_10004455 511
741 3300025735 Ga0207713_1004188 Ga0207713_10041882 511
742 3300025903 Ga0207680_10116419 Ga0207680_101164191 511
743 3300025904 Ga0207647_10000058 Ga0207647_1000005838 511
744 3300025904 Ga0207647_10000321 Ga0207647_1000032117 511
745 3300025907 Ga0207645_10000544 Ga0207645_1000054429 511
746 3300025907 Ga0207645_10000949 Ga0207645_100009498 511
747 3300025907 Ga0207645_10000957 Ga0207645_1000095714 511
748 3300025907 Ga0207645_10003750 Ga0207645_100037502 511
749 3300025908 Ga0207643_10020209 Ga0207643_100202092 511
750 3300025909 Ga0207705_10000015 Ga0207705_10000015357 511
751 3300025909 Ga0207705_10000036 Ga0207705_1000003611 511
752 3300025909 Ga0207705_10001474 Ga0207705_100014747 511
753 3300025909 Ga0207705_10013309 Ga0207705_100133092 511
754 3300025909 Ga0207705_10014112 Ga0207705_100141126 511
755 3300025909 Ga0207705_10024290 Ga0207705_100242902 511
756 3300025911 Ga0207654_10001111 Ga0207654_1000111112 511
757 3300025911 Ga0207654_10002095 Ga0207654_100020954 511
758 3300025911 Ga0207654_10053172 Ga0207654_100531721 511
759 3300025912 Ga0207707_10002312 Ga0207707_1000231211 511
760 3300025912 Ga0207707_10004624 Ga0207707_100046244 511
761 3300025913 Ga0207695_10000515 Ga0207695_1000051547 511
762 3300025913 Ga0207695_10016282 Ga0207695_100162825 511
763 3300025913 Ga0207695_10037641 Ga0207695_100376414 511
764 3300025913 Ga0207695_10055700 Ga0207695_100557003 511
765 3300025913 Ga0207695_10090681 Ga0207695_100906812 511
766 3300025914 Ga0207671_10003740 Ga0207671_100037406 511
767 3300025914 Ga0207671_10006648 Ga0207671_100066482 511
768 3300025914 Ga0207671_10041627 Ga0207671_100416272 511
769 3300025914 Ga0207671_10045965 Ga0207671_100459651 511
770 3300025914 Ga0207671_10083505 Ga0207671_100835052 511
771 3300025917 Ga0207660_10003228 Ga0207660_100032283 511
772 3300025917 Ga0207660_10003846 Ga0207660_100038464 511
773 3300025917 Ga0207660_10016347 Ga0207660_100163473 511
774 3300025917 Ga0207660_10025881 Ga0207660_100258813 511
775 3300025919 Ga0207657_10009410 Ga0207657_100094102 511
776 3300025919 Ga0207657_10024891 Ga0207657_100248912 511
777 3300025919 Ga0207657_10024962 Ga0207657_100249622 511
778 3300025919 Ga0207657_10084578 Ga0207657_100845781 511
779 3300025919 Ga0207657_10094444 Ga0207657_100944442 511
780 3300025921 Ga0207652_10000160 Ga0207652_1000016029 511
781 3300025921 Ga0207652_10001233 Ga0207652_1000123310 511
782 3300025921 Ga0207652_10130020 Ga0207652_101300201 511
783 3300025923 Ga0207681_10124345 Ga0207681_101243451 511
784 3300025924 Ga0207694_10011115 Ga0207694_100111154 511
785 3300025925 Ga0207650_10006867 Ga0207650_100068679 511
786 3300025925 Ga0207650_10100345 Ga0207650_101003452 511
787 3300025926 Ga0207659_10053691 Ga0207659_100536912 511
788 3300025926 Ga0207659_10096121 Ga0207659_100961212 511
789 3300025931 Ga0207644_10055850 Ga0207644_100558502 511
790 3300025932 Ga0207690_10049667 Ga0207690_100496672 511
791 3300025933 Ga0207706_10000147 Ga0207706_1000014753 511
792 3300025933 Ga0207706_10000315 Ga0207706_1000031543 511
793 3300025933 Ga0207706_10031196 Ga0207706_100311963 511
794 3300025934 Ga0207686_10056162 Ga0207686_100561622 511
795 3300025934 Ga0207686_10080759 Ga0207686_100807592 511
796 3300025935 Ga0207709_10000007 Ga0207709_10000007239 511
797 3300025935 Ga0207709_10000550 Ga0207709_100005505 511
798 3300025938 Ga0207704_10000076 Ga0207704_1000007636 511
799 3300025938 Ga0207704_10004208 Ga0207704_100042083 511
800 3300025940 Ga0207691_10000037 Ga0207691_1000003790 511
801 3300025940 Ga0207691_10012211 Ga0207691_100122113 511
802 3300025940 Ga0207691_10073733 Ga0207691_100737331 511
803 3300025944 Ga0207661_10028736 Ga0207661_100287363 511
804 3300025949 Ga0207667_10000009 Ga0207667_10000009354 511
805 3300025949 Ga0207667_10000263 Ga0207667_1000026328 511
806 3300025949 Ga0207667_10000630 Ga0207667_1000063018 511
807 3300025949 Ga0207667_10003724 Ga0207667_1000372416 511
808 3300025949 Ga0207667_10016127 Ga0207667_100161272 511
809 3300025949 Ga0207667_10059510 Ga0207667_100595101 511
810 3300025949 Ga0207667_10064094 Ga0207667_100640941 511
811 3300025949 Ga0207667_10105103 Ga0207667_101051032 511
812 3300025960 Ga0207651_10000443 Ga0207651_1000044311 511
813 3300025960 Ga0207651_10005071 Ga0207651_100050713 511
814 3300025960 Ga0207651_10012090 Ga0207651_100120904 511
815 3300025972 Ga0207668_10001307 Ga0207668_1000130711 511
816 3300025972 Ga0207668_10018643 Ga0207668_100186434 511
817 3300025986 Ga0207658_10000629 Ga0207658_100006294 511
818 3300026023 Ga0207677_10004861 Ga0207677_100048613 511
819 3300026035 Ga0207703_10004145 Ga0207703_100041454 511
820 3300026041 Ga0207639_10013975 Ga0207639_100139753 511
821 3300026041 Ga0207639_10016611 Ga0207639_100166114 511
822 3300026041 Ga0207639_10022141 Ga0207639_100221413 511
823 3300026041 Ga0207639_10025857 Ga0207639_100258572 511
824 3300026067 Ga0207678_10006569 Ga0207678_100065693 511
825 3300026075 Ga0207708_10040730 Ga0207708_100407302 511
826 3300026078 Ga0207702_10000106 Ga0207702_1000010620 511
827 3300026078 Ga0207702_10000300 Ga0207702_1000030028 511
828 3300026088 Ga0207641_10052991 Ga0207641_100529912 511
829 3300026089 Ga0207648_10000648 Ga0207648_1000064820 511
830 3300026089 Ga0207648_10001276 Ga0207648_100012765 511
831 3300026089 Ga0207648_10003642 Ga0207648_100036428 511
832 3300026089 Ga0207648_10029570 Ga0207648_100295705 511
833 3300026095 Ga0207676_10002535 Ga0207676_100025354 511
834 3300026116 Ga0207674_10043172 Ga0207674_100431722 511
835 3300026116 Ga0207674_10058204 Ga0207674_100582041 511
836 3300026121 Ga0207683_10008614 Ga0207683_100086146 511
837 3300026121 Ga0207683_10015783 Ga0207683_100157833 511
838 3300026121 Ga0207683_10030930 Ga0207683_100309301 511
839 3300027312 Ga0209371_1000003 Ga0209371_1000003420 511
840 3300027312 Ga0209371_1000004 Ga0209371_1000004778 511
841 3300027312 Ga0209371_1000011 Ga0209371_1000011525 511
842 3300027312 Ga0209371_1000918 Ga0209371_100091812 511
843 3300027666 Ga0209282_1000196 Ga0209282_10001965 511
844 3300028379 Ga0268266_10000024 Ga0268266_10000024365 511
845 3300028379 Ga0268266_10000052 Ga0268266_10000052163 511
846 3300028379 Ga0268266_10000089 Ga0268266_10000089135 511
847 3300028379 Ga0268266_10004818 Ga0268266_100048183 511
848 3300028379 Ga0268266_10009526 Ga0268266_100095267 511
849 3300028381 Ga0268264_10038206 Ga0268264_100382063 511
850 3300028666 Ga0265336_10000823 Ga0265336_100008232 511
851 3300028786 Ga0307517_10001280 Ga0307517_1000128036 511
852 3300028786 Ga0307517_10002284 Ga0307517_1000228418 511
853 3300028794 Ga0307515_10000001 Ga0307515_100000011603 511
854 3300028794 Ga0307515_10000118 Ga0307515_1000011832 511
855 3300028794 Ga0307515_10000707 Ga0307515_1000070737 511
856 3300028794 Ga0307515_10000993 Ga0307515_1000099340 511
857 3300028800 Ga0265338_10004851 Ga0265338_100048515 511
858 3300029957 Ga0265324_10000416 Ga0265324_1000041617 511
859 3300030500 Ga0268256_1000004 Ga0268256_1000004630 511
860 3300030500 Ga0268256_1000005 Ga0268256_1000005269 511
861 3300030500 Ga0268256_1000011 Ga0268256_1000011525 511
862 3300030731 Ga0316177_1206112 Ga0316177_12061128 511
863 3300030732 Ga0316176_1116219 Ga0316176_11162193 511
864 3300030742 Ga0316183_1192789 Ga0316183_11927892 511
865 3300030742 Ga0316183_1214785 Ga0316183_12147854 511
866 3300030744 Ga0316181_1293487 Ga0316181_12934872 511
867 3300031240 Ga0265320_10000978 Ga0265320_100009786 511
868 3300031251 Ga0265327_10001661 Ga0265327_1000166118 511
869 3300031251 Ga0265327_10001768 Ga0265327_100017682 511
870 3300031344 Ga0265316_10002824 Ga0265316_1000282413 511
871 3300031456 Ga0307513_10081274 Ga0307513_100812742 511
872 3300031507 Ga0307509_10015753 Ga0307509_100157535 511
873 3300031507 Ga0307509_10059903 Ga0307509_100599032 511
874 3300031548 Ga0307408_100000005 Ga0307408_100000005160 511
875 3300031616 Ga0307508_10000022 Ga0307508_10000022135 511
876 3300031711 Ga0265314_10001473 Ga0265314_100014736 511
877 3300031711 Ga0265314_10022801 Ga0265314_100228015 511
878 3300031824 Ga0307413_10039586 Ga0307413_100395862 511
879 3300031852 Ga0307410_10053164 Ga0307410_100531642 511
880 3300031901 Ga0307406_10008212 Ga0307406_100082123 511
881 3300031911 Ga0307412_10000190 Ga0307412_100001902 511
882 3300032004 Ga0307414_10101995 Ga0307414_101019952 511
883 3300032126 Ga0307415_100014712 Ga0307415_1000147123 511
884 3300033179 Ga0307507_10001380 Ga0307507_1000138037 511
885 3300033180 Ga0307510_10087307 Ga0307510_100873072 511
886 3300033180 Ga0307510_10096437 Ga0307510_100964372 511
887 3300037312 Ga0395899_0000608 Ga0395899_0000608_35374_37053 511
888 3300037312 Ga0395899_0001724 Ga0395899_0001724_670_2349 511
889 3300037312 Ga0395899_0002489 Ga0395899_0002489_699_2378 511
890 3300037312 Ga0395899_0004925 Ga0395899_0004925_1663_3348 511
891 3300037312 Ga0395899_0004925 Ga0395899_0004925_3358_5043 511
892 3300037312 Ga0395899_0006074 Ga0395899_0006074_4992_6671 511
893 3300037312 Ga0395899_0007101 Ga0395899_0007101_3700_5379 511
894 3300037312 Ga0395899_0022778 Ga0395899_0022778_2395_4074 511
895 3300037312 Ga0395899_0043169 Ga0395899_0043169_475_2154 511
896 3300037418 Ga0395900_0002996 Ga0395900_0002996_6417_8096 511
897 3300037418 Ga0395900_0003776 Ga0395900_0003776_8589_10268 511
898 3300037418 Ga0395900_0017374 Ga0395900_0017374_4858_6543 511
899 3300037418 Ga0395900_0024025 Ga0395900_0024025_2951_4630 511
900 3300037418 Ga0395900_0032543 Ga0395900_0032543_726_2405 511
901 3300037418 Ga0395900_0075306 Ga0395900_0075306_592_2277 511
902 3300037418 Ga0395900_0102300 Ga0395900_0102300_955_2634 511
903 3300037466 Ga0395898_0000738 Ga0395898_0000738_4200_5879 511
904 3300037466 Ga0395898_0006085 Ga0395898_0006085_2386_4065 511
905 3300037466 Ga0395898_0041215 Ga0395898_0041215_1455_3134 511
906 3300037466 Ga0395898_0096548 Ga0395898_0096548_132_1811 511
907 3300037471 Ga0395905_0005293 Ga0395905_0005293_10006_11697 511
908 3300037471 Ga0395905_0018067 Ga0395905_0018067_1484_3169 511
909 3300037471 Ga0395905_0018067 Ga0395905_0018067_3179_4864 511
910 3300037471 Ga0395905_0018342 Ga0395905_0018342_3544_5229 511
911 3300037471 Ga0395905_0018721 Ga0395905_0018721_4560_6239 511
912 3300037471 Ga0395905_0036317 Ga0395905_0036317_542_2221 511
913 3300037471 Ga0395905_0052273 Ga0395905_0052273_681_2366 511
914 3300037471 Ga0395905_0164600 Ga0395905_0164600_107_1786 511
915 3300037471 Ga0395905_0182422 Ga0395905_0182422_67_1746 511
916 3300037471 Ga0395905_0210173 Ga0395905_0210173_77_1762 511
917 3300038443 Ga0395901_0002864 Ga0395901_0002864_8008_9687 511
918 3300038443 Ga0395901_0007998 Ga0395901_0007998_1532_3217 511
919 3300038443 Ga0395901_0007998 Ga0395901_0007998_3227_4912 511
920 3300038443 Ga0395901_0011134 Ga0395901_0011134_4527_6218 511
921 3300038443 Ga0395901_0015733 Ga0395901_0015733_5740_7419 511
922 3300038443 Ga0395901_0018348 Ga0395901_0018348_541_2220 511
923 3300038443 Ga0395901_0075146 Ga0395901_0075146_830_2509 511
924 3300038705 Ga0237819_00014 Ga0237819_00014_32013_33698 511
925 3300039437 Ga0436365_0265980 Ga0436365_0265980_2787_4472 511
926 3300039437 Ga0436365_1179973 Ga0436365_1179973_27822_29501 511
927 3300039437 Ga0436365_1313174 Ga0436365_1313174_16606_18285 511
928 3300039447 Ga0436361_0049735 Ga0436361_0049735_690_2372 511
929 3300039447 Ga0436361_0458961 Ga0436361_0458961_15104_16783 511
930 3300041406 Ga0439439_0003733 Ga0439439_0003733_918_2597 511
931 3300041407 Ga0439447_000932 Ga0439447_000932_6660_8345 511
932 3300042014 Ga0439457_000583 Ga0439457_000583_1888_3567 511
933 3300044658 Ga0466972_0000928 Ga0466972_0000928_393_2072 511
934 3300044684 Ga0466966_0000184 Ga0466966_0000184_35944_37623 511
935 3300044765 Ga0466970_0064323 Ga0466970_0064323_203_1882 511
936 3300044842 Ga0466957_0003931 Ga0466957_0003931_6401_8080 511
937 3300044842 Ga0466957_0023457 Ga0466957_0023457_1286_2971 511
938 3300044842 Ga0466957_0054376 Ga0466957_0054376_68_1747 511
939 3300045049 Ga0466959_0000097 Ga0466959_0000097_22046_23725 511
940 3300045976 Ga0466967_0004595 Ga0466967_0004595_7549_9240 511
941 3300045976 Ga0466967_0020593 Ga0466967_0020593_1099_2778 511
942 3300046471 Ga0495650_0000273 Ga0495650_0000273_26832_28511 511
943 3300046471 Ga0495650_0025489 Ga0495650_0025489_77_1756 511
944 3300046492 Ga0495585_0000429 Ga0495585_0000429_16251_17930 511
945 3300046507 Ga0495606_0000130 Ga0495606_0000130_28428_30107 511
946 3300046513 Ga0495616_0009400 Ga0495616_0009400_3576_5255 511
947 3300046518 Ga0495631_0023710 Ga0495631_0023710_1086_2768 511
948 3300046522 Ga0495643_0007624 Ga0495643_0007624_2053_3738 511
949 3300046523 Ga0495644_0011896 Ga0495644_0011896_1197_2876 511
950 3300046524 Ga0495648_0010205 Ga0495648_0010205_4307_5986 511
951 3300046538 Ga0495609_0011867 Ga0495609_0011867_134_1813 511
952 3300046558 Ga0495633_0000035 Ga0495633_0000035_52582_54261 511
953 3300046558 Ga0495633_0003286 Ga0495633_0003286_985_2673 511
954 3300046558 Ga0495633_0007262 Ga0495633_0007262_1609_3294 511
955 3300046616 Ga0495668_0000032 Ga0495668_0000032_146716_148395 511
956 3300046660 Ga0495625_0000036 Ga0495625_0000036_193870_195549 511
957 3300046660 Ga0495625_0000227 Ga0495625_0000227_41508_43187 511
958 3300046660 Ga0495625_0002411 Ga0495625_0002411_10871_12550 511
959 3300046660 Ga0495625_0057749 Ga0495625_0057749_13_1692 511
960 3300046674 Ga0495588_0001792 Ga0495588_0001792_4986_6671 511
961 3300046694 Ga0495649_0000017 Ga0495649_0000017_26175_27854 511
962 3300047320 Ga0495672_0006440 Ga0495672_0006440_4199_5884 511
963 3300047323 Ga0495683_0006207 Ga0495683_0006207_3095_4777 511
964 3300047443 Ga0495687_000527 Ga0495687_000527_13215_14894 511
965 3300047443 Ga0495687_007779 Ga0495687_007779_559_2238 511
966 3300047470 Ga0495681_0004504 Ga0495681_0004504_482_2167 511
967 3300047472 Ga0495686_0000083 Ga0495686_0000083_196856_198535 511
968 3300048912 Ga0496109_0028678 Ga0496109_0028678_1026_2705 511
969 3300048919 Ga0496116_0000545 Ga0496116_0000545_1749_3434 511
970 3300048919 Ga0496116_0001546 Ga0496116_0001546_251_1939 511
971 3300048919 Ga0496116_0036253 Ga0496116_0036253_1505_3190 511
972 3300048920 Ga0496117_0000002 Ga0496117_0000002_1119393_1121078 511
973 3300048920 Ga0496117_0008674 Ga0496117_0008674_6991_8676 511
974 3300048920 Ga0496117_0009998 Ga0496117_0009998_3905_5590 511
975 3300048920 Ga0496117_0016227 Ga0496117_0016227_1618_3303 511
976 3300048920 Ga0496117_0016283 Ga0496117_0016283_3924_5609 511
977 3300048921 Ga0496118_0000707 Ga0496118_0000707_33725_35410 511
978 3300048921 Ga0496118_0014548 Ga0496118_0014548_4270_5955 511
979 3300048921 Ga0496118_0103733 Ga0496118_0103733_113_1798 511
980 3300048922 Ga0496119_0000596 Ga0496119_0000596_39052_40737 511
981 3300048922 Ga0496119_0014387 Ga0496119_0014387_3694_5379 511
982 3300048922 Ga0496119_0052600 Ga0496119_0052600_551_2236 511
983 3300048923 Ga0496120_0000358 Ga0496120_0000358_33728_35413 511
984 3300048923 Ga0496120_0000879 Ga0496120_0000879_3979_5664 511
985 3300048923 Ga0496120_0003894 Ga0496120_0003894_7391_9076 511
986 3300048923 Ga0496120_0007570 Ga0496120_0007570_1884_3569 511
987 3300048924 Ga0496121_0000005 Ga0496121_0000005_610422_612107 511
988 3300048924 Ga0496121_0000036 Ga0496121_0000036_306087_307772 511
989 3300048925 Ga0496122_0000001 Ga0496122_0000001_436505_438190 511
990 3300048925 Ga0496122_0000662 Ga0496122_0000662_63669_65354 511
991 3300048925 Ga0496122_0013400 Ga0496122_0013400_2434_4119 511
992 3300048925 Ga0496122_0020421 Ga0496122_0020421_814_2499 511
993 3300048926 Ga0496123_0000001 Ga0496123_0000001_440236_441921 511
994 3300048926 Ga0496123_0000478 Ga0496123_0000478_63668_65353 511
995 3300048926 Ga0496123_0001024 Ga0496123_0001024_36887_38572 511
996 3300048926 Ga0496123_0016193 Ga0496123_0016193_426_2111 511
997 3300048926 Ga0496123_0019800 Ga0496123_0019800_1483_3168 511
998 3300048927 Ga0496124_0000009 Ga0496124_0000009_314760_316445 511
999 3300048927 Ga0496124_0000390 Ga0496124_0000390_11449_13134 511
1000 3300048927 Ga0496124_0003741 Ga0496124_0003741_1026_2711 511
1001 3300048927 Ga0496124_0028145 Ga0496124_0028145_3244_4929 511
1002 3300048927 Ga0496124_0052519 Ga0496124_0052519_269_1954 511
1003 3300048928 Ga0496125_0008112 Ga0496125_0008112_9055_10740 511
1004 3300048928 Ga0496125_0021567 Ga0496125_0021567_3926_5611 511
1005 3300048928 Ga0496125_0026856 Ga0496125_0026856_1963_3648 511
1006 3300049459 Ga0495678_005842 Ga0495678_005842_1649_3328 511
1007 3300049460 Ga0495682_0022511 Ga0495682_0022511_486_2165 511
1008 3300049569 Ga0501032_0001784 Ga0501032_0001784_4825_6537 511
1009 3300049580 Ga0501046_0019898 Ga0501046_0019898_3632_5311 511
1010 3300049586 Ga0501070_0052145 Ga0501070_0052145_1269_2948 511
1011 3300049651 Ga0501201_000090 Ga0501201_000090_3175_4854 511
1012 3300049652 Ga0501202_002037 Ga0501202_002037_604_2283 511
1013 3300049663 Ga0501223_005401 Ga0501223_005401_696_2375 511
1014 3300049669 Ga0501235_002446 Ga0501235_002446_1247_2926 511
1015 3300049822 Ga0501035_0000410 Ga0501035_0000410_10347_12059 511
1016 3300049822 Ga0501035_0081338 Ga0501035_0081338_1163_2842 511
1017 3300049823 Ga0501044_0003320 Ga0501044_0003320_5988_7700 511
1018 3300050490 nmdc:mga03n38_4961_c1 nmdc:mga03n38_4961_c1_2273_3958 511
1019 3300050491 nmdc:mga00v17_2467_c1 nmdc:mga00v17_2467_c1_104_1789 511
1020 3300050491 nmdc:mga00v17_6_c1 nmdc:mga00v17_6_c1_32522_34207 511
1021 3300050492 nmdc:mga0yw44_52746_c1 nmdc:mga0yw44_52746_c1_619_2304 511
1022 3300050493 nmdc:mga0k408_2342_c1 nmdc:mga0k408_2342_c1_3954_5633 511
1023 3300050494 nmdc:mga06z11_12305_c1 nmdc:mga06z11_12305_c1_435_2120 511
1024 3300050507 nmdc:mga05p37_1224_c1 nmdc:mga05p37_1224_c1_20865_22544 511
1025 3300050516 nmdc:mga0sz30_438_c1 nmdc:mga0sz30_438_c1_3448_5133 511
1026 3300053086 Ga0500578_0000026 Ga0500578_0000026_6006_7685 511
1027 3300053092 Ga0500583_0000078 Ga0500583_0000078_10154_11833 511
1028 3300053107 Ga0500560_000688 Ga0500560_000688_2197_3882 511
1029 3300053107 Ga0500560_001879 Ga0500560_001879_694_2379 511
1030 3300053108 Ga0500562_000004 Ga0500562_000004_61488_63167 511
1031 3300053122 Ga0500608_000174 Ga0500608_000174_23667_25349 511
1032 3300053122 Ga0500608_000986 Ga0500608_000986_5411_7093 511
1033 3300053125 Ga0500618_000004 Ga0500618_000004_265341_267020 511
1034 3300053130 Ga0500642_0023409 Ga0500642_0023409_645_2324 511
1035 3300053137 Ga0500561_0000143 Ga0500561_0000143_582_2267 511
1036 3300053156 Ga0500622_0001671 Ga0500622_0001671_13575_15254 511
1037 3300053157 Ga0500624_000854 Ga0500624_000854_147_1826 511
1038 3300053157 Ga0500624_001118 Ga0500624_001118_3167_4852 511
1039 3300053161 Ga0500634_0000167 Ga0500634_0000167_6931_8616 511
1040 3300053161 Ga0500634_0025601 Ga0500634_0025601_70_1755 511
1041 3300053730 Ga0500645_012849 Ga0500645_012849_557_2236 511
1042 3300003323 rootH1_10004675 rootH1_1000467532 512
1043 3300005288 Ga0065714_10075158 Ga0065714_100751581 512
1044 3300005335 Ga0070666_10000132 Ga0070666_1000013240 512
1045 3300005355 Ga0070671_100020821 Ga0070671_1000208213 512
1046 3300005355 Ga0070671_100137014 Ga0070671_1001370141 512
1047 3300005364 Ga0070673_100061208 Ga0070673_1000612081 512
1048 3300005367 Ga0070667_100015237 Ga0070667_1000152373 512
1049 3300005367 Ga0070667_100038040 Ga0070667_1000380403 512
1050 3300005543 Ga0070672_100014615 Ga0070672_1000146152 512
1051 3300005617 Ga0068859_100000003 Ga0068859_100000003335 512
1052 3300005834 Ga0068851_10008931 Ga0068851_100089313 512
1053 3300005841 Ga0068863_100000394 Ga0068863_10000039432 512
1054 3300005843 Ga0068860_100002493 Ga0068860_1000024934 512
1055 3300005843 Ga0068860_100005227 Ga0068860_1000052274 512
1056 3300006358 Ga0068871_100032347 Ga0068871_1000323472 512
1057 3300006931 Ga0097620_100000003 Ga0097620_100000003335 512
1058 3300009101 Ga0105247_10001444 Ga0105247_1000144412 512
1059 3300009176 Ga0105242_10051028 Ga0105242_100510281 512
1060 3300009545 Ga0105237_10001393 Ga0105237_1000139310 512
1061 3300009553 Ga0105249_10002967 Ga0105249_100029679 512
1062 3300010375 Ga0105239_10021884 Ga0105239_100218842 512
1063 3300013104 Ga0157370_10004952 Ga0157370_100049527 512
1064 3300013297 Ga0157378_10003886 Ga0157378_100038862 512
1065 3300013297 Ga0157378_10098080 Ga0157378_100980802 512
1066 3300014968 Ga0157379_10033021 Ga0157379_100330212 512
1067 3300014969 Ga0157376_10030198 Ga0157376_100301983 512
1068 3300025903 Ga0207680_10000014 Ga0207680_10000014109 512
1069 3300025914 Ga0207671_10000746 Ga0207671_100007464 512
1070 3300025931 Ga0207644_10049267 Ga0207644_100492672 512
1071 3300025942 Ga0207689_10002471 Ga0207689_100024712 512
1072 3300025986 Ga0207658_10018906 Ga0207658_100189062 512
1073 3300026088 Ga0207641_10000015 Ga0207641_10000015200 512
1074 3300028381 Ga0268264_10001958 Ga0268264_100019583 512
1075 3300028381 Ga0268264_10004239 Ga0268264_100042399 512
1076 3300031507 Ga0307509_10034576 Ga0307509_100345763 512
1077 3300031507 Ga0307509_10115835 Ga0307509_101158352 512
1078 3300031548 Ga0307408_100000745 Ga0307408_10000074525 512
1079 3300031730 Ga0307516_10000656 Ga0307516_1000065626 512
1080 iso_pu_bacteria 2738541302 2738855466 514
1081 iso_pu_bacteria 2842722452 2842723968 514
1082 iso_pu_bacteria 2842909656 2842912300 514
1083 iso_pu_bacteria 2929150217 2929153314 514
1084 iso_pu_bacteria 2945997725 2945999284 514
1085 iso_pu_bacteria 2954016120 2954021676 514
1086 iso_pu_bacteria 8056440228 8056440530 514
1087 iso_pu_bacteria 2738541283 2738758456 515
1088 iso_pu_bacteria 2738541284 2738760789 515
1089 iso_pu_bacteria 2738541284 2738764111 515
1090 iso_pu_bacteria 2738543023 2739302862 515
1091 iso_pu_bacteria 2775506987 2776616492 515
1092 iso_pu_bacteria 2852623160 2852623445 515
1093 iso_pu_bacteria 2852627209 2852631818 515
1094 iso_pu_bacteria 2884933994 2884937676 515
1095 iso_pu_bacteria 2919186247 2919191234 515
1096 iso_pu_bacteria 2939664404 2939669513 515
1097 3300005616 Ga0068852_100176224 Ga0068852_1001762241 516
1098 3300005618 Ga0068864_100065706 Ga0068864_1000657062 516
1099 3300021384 Ga0213876_10001379 Ga0213876_1000137915 516
1100 3300025944 Ga0207661_10037420 Ga0207661_100374201 516
1101 3300039437 Ga0436365_1041558 Ga0436365_1041558_729_2435 516
1102 3300049571 Ga0501034_0147866 Ga0501034_0147866_94_1806 516
1103 3300001990 JGI24737J22298_10008344 JGI24737J22298_100083443 517
1104 3300002067 JGI24735J21928_10000001 JGI24735J21928_1000000111 517
1105 3300002737 JGI25162J39368_1000024 JGI25162J39368_100002411 517
1106 3300003316 rootH1_10038419 rootH1_1003841912 517
1107 3300005288 Ga0065714_10067144 Ga0065714_100671443 517
1108 3300006195 Ga0075366_10000185 Ga0075366_100001852 517
1109 3300009545 Ga0105237_10022259 Ga0105237_100222597 517
1110 3300010375 Ga0105239_10041908 Ga0105239_100419082 517
1111 3300013105 Ga0157369_10110442 Ga0157369_101104422 517
1112 3300013306 Ga0163162_10020868 Ga0163162_100208685 517
1113 3300013307 Ga0157372_10079965 Ga0157372_100799653 517
1114 3300025233 Ga0209437_100017 Ga0209437_10001711 517
1115 3300025914 Ga0207671_10010661 Ga0207671_100106613 517
1116 3300028381 Ga0268264_10000064 Ga0268264_10000064203 517
1117 3300028794 Ga0307515_10000432 Ga0307515_100004322 517
1118 3300028794 Ga0307515_10001738 Ga0307515_1000173819 517
1119 3300033179 Ga0307507_10002988 Ga0307507_1000298828 517
1120 3300046492 Ga0495585_0000156 Ga0495585_0000156_40080_41789 517
1121 3300046492 Ga0495585_0000570 Ga0495585_0000570_19943_21652 517
1122 3300046507 Ga0495606_0016588 Ga0495606_0016588_1081_2790 517
1123 3300046558 Ga0495633_0000014 Ga0495633_0000014_228330_230039 517
1124 3300046616 Ga0495668_0000012 Ga0495668_0000012_333107_334816 517
1125 3300046660 Ga0495625_0007620 Ga0495625_0007620_6421_8130 517
1126 3300046660 Ga0495625_0011975 Ga0495625_0011975_3709_5418 517
1127 3300047472 Ga0495686_0000693 Ga0495686_0000693_38907_40616 517
1128 3300048089 Ga0495614_0016941 Ga0495614_0016941_50_1759 517
1129 3300049674 Ga0501242_001387 Ga0501242_001387_405_2132 517
1130 3300049763 Ga0501266_001020 Ga0501266_001020_1525_3234 517
1131 3300050493 nmdc:mga0k408_16_c2 nmdc:mga0k408_16_c2_24759_26468 517
1132 3300053125 Ga0500618_000001 Ga0500618_000001_198564_200273 517
1133 3300053157 Ga0500624_000356 Ga0500624_000356_6151_7860 517
1134 iso_pu_bacteria 2599185184 2599477587 517
1135 iso_pu_bacteria 2599185184 2599481156 517
1136 iso_pu_bacteria 2738541278 2738726129 517
1137 iso_pu_bacteria 2919437846 2919440950 517
1138 iso_pu_bacteria 2928078545 2928079498 517
1139 iso_pu_bacteria 2928078545 2928082970 517
1140 iso_pu_bacteria 2928147474 2928148018 517
1141 iso_pu_bacteria 2928147474 2928149989 517
1142 iso_pu_bacteria 2932082852 2932083911 517
1143 3300005288 Ga0065714_10008043 Ga0065714_100080433 518
1144 3300005366 Ga0070659_100018570 Ga0070659_1000185703 518
1145 3300005457 Ga0070662_100002814 Ga0070662_1000028142 518
1146 3300005563 Ga0068855_100000240 Ga0068855_10000024015 518
1147 3300005614 Ga0068856_100012116 Ga0068856_1000121167 518
1148 3300009093 Ga0105240_10083538 Ga0105240_100835382 518
1149 3300009174 Ga0105241_10005205 Ga0105241_100052052 518
1150 3300013100 Ga0157373_10020440 Ga0157373_100204403 518
1151 3300013102 Ga0157371_10000978 Ga0157371_1000097813 518
1152 3300013105 Ga0157369_10139870 Ga0157369_101398702 518
1153 3300013296 Ga0157374_10003010 Ga0157374_100030102 518
1154 3300013307 Ga0157372_10034279 Ga0157372_100342795 518
1155 3300014497 Ga0182008_10000021 Ga0182008_10000021149 518
1156 3300015261 Ga0182006_1014856 Ga0182006_10148563 518
1157 3300017792 Ga0163161_10000465 Ga0163161_1000046511 518
1158 3300017792 Ga0163161_10000921 Ga0163161_1000092117 518
1159 3300025904 Ga0207647_10002212 Ga0207647_1000221210 518
1160 3300025911 Ga0207654_10007436 Ga0207654_100074364 518
1161 3300025913 Ga0207695_10006707 Ga0207695_100067072 518
1162 3300025932 Ga0207690_10010554 Ga0207690_100105543 518
1163 3300025933 Ga0207706_10006573 Ga0207706_100065732 518
1164 3300025949 Ga0207667_10000037 Ga0207667_10000037119 518
1165 3300026023 Ga0207677_10015559 Ga0207677_100155594 518
1166 3300031731 Ga0307405_10000015 Ga0307405_1000001544 518
1167 3300032004 Ga0307414_10012073 Ga0307414_100120732 518
1168 3300032004 Ga0307414_10144418 Ga0307414_101444181 518
1169 3300046512 Ga0495610_0000232 Ga0495610_0000232_42246_43946 518
1170 3300046513 Ga0495616_0004230 Ga0495616_0004230_1090_2835 518
1171 3300046520 Ga0495637_0009463 Ga0495637_0009463_1969_3669 518
1172 3300046538 Ga0495609_0007309 Ga0495609_0007309_3012_4712 518
1173 3300046660 Ga0495625_0000030 Ga0495625_0000030_140035_141780 518
1174 3300046665 Ga0495661_0036314 Ga0495661_0036314_385_2130 518
1175 3300046694 Ga0495649_0000041 Ga0495649_0000041_99423_101168 518
1176 2162886007 SwRhRL2b_contig_12447 SwRhRL2b_0179.00002590 519
1177 2162886007 SwRhRL2b_contig_2612864 SwRhRL2b_0227.00003040 519
1178 3300001989 JGI24739J22299_10006142 JGI24739J22299_100061422 519
1179 3300002077 JGI24744J21845_10001354 JGI24744J21845_100013543 519
1180 3300003320 rootH2_10001101 rootH2_1000110143 519
1181 3300003320 rootH2_10165063 rootH2_101650635 519
1182 3300003354 JGI25160J50197_1002186 JGI25160J50197_10021866 519
1183 3300004799 Ga0058863_11840617 Ga0058863_118406171 519
1184 3300004803 Ga0058862_10000476 Ga0058862_100004763 519
1185 3300005288 Ga0065714_10002519 Ga0065714_1000251921 519
1186 3300005289 Ga0065704_10000253 Ga0065704_1000025328 519
1187 3300005289 Ga0065704_10088577 Ga0065704_100885772 519
1188 3300005327 Ga0070658_10000011 Ga0070658_1000001193 519
1189 3300005328 Ga0070676_10000193 Ga0070676_100001936 519
1190 3300005328 Ga0070676_10000984 Ga0070676_100009847 519
1191 3300005328 Ga0070676_10006242 Ga0070676_100062423 519
1192 3300005331 Ga0070670_100026104 Ga0070670_1000261042 519
1193 3300005331 Ga0070670_100030729 Ga0070670_1000307293 519
1194 3300005334 Ga0068869_100026646 Ga0068869_1000266462 519
1195 3300005334 Ga0068869_100032765 Ga0068869_1000327652 519
1196 3300005335 Ga0070666_10000132 Ga0070666_1000013238 519
1197 3300005335 Ga0070666_10000637 Ga0070666_1000063712 519
1198 3300005335 Ga0070666_10010136 Ga0070666_100101366 519
1199 3300005338 Ga0068868_100000428 Ga0068868_1000004284 519
1200 3300005338 Ga0068868_100009407 Ga0068868_1000094075 519
1201 3300005338 Ga0068868_100010284 Ga0068868_1000102842 519
1202 3300005338 Ga0068868_100022890 Ga0068868_1000228903 519
1203 3300005339 Ga0070660_100005390 Ga0070660_1000053906 519
1204 3300005347 Ga0070668_100009543 Ga0070668_1000095436 519
1205 3300005353 Ga0070669_100003023 Ga0070669_10000302310 519
1206 3300005353 Ga0070669_100015356 Ga0070669_1000153563 519
1207 3300005354 Ga0070675_100009919 Ga0070675_1000099193 519
1208 3300005355 Ga0070671_100035443 Ga0070671_1000354432 519
1209 3300005355 Ga0070671_100052161 Ga0070671_1000521612 519
1210 3300005364 Ga0070673_100000498 Ga0070673_1000004982 519
1211 3300005364 Ga0070673_100002543 Ga0070673_1000025433 519
1212 3300005364 Ga0070673_100050694 Ga0070673_1000506942 519
1213 3300005364 Ga0070673_100059400 Ga0070673_1000594002 519
1214 3300005365 Ga0070688_100009847 Ga0070688_1000098474 519
1215 3300005366 Ga0070659_100046417 Ga0070659_1000464171 519
1216 3300005367 Ga0070667_100000376 Ga0070667_10000037640 519
1217 3300005367 Ga0070667_100013528 Ga0070667_1000135283 519
1218 3300005367 Ga0070667_100048415 Ga0070667_1000484153 519
1219 3300005456 Ga0070678_100027004 Ga0070678_1000270041 519
1220 3300005456 Ga0070678_100081249 Ga0070678_1000812492 519
1221 3300005457 Ga0070662_100000032 Ga0070662_10000003213 519
1222 3300005457 Ga0070662_100007733 Ga0070662_1000077337 519
1223 3300005457 Ga0070662_100023035 Ga0070662_1000230352 519
1224 3300005458 Ga0070681_10009928 Ga0070681_100099287 519
1225 3300005459 Ga0068867_100006982 Ga0068867_1000069825 519
1226 3300005459 Ga0068867_100017005 Ga0068867_1000170052 519
1227 3300005459 Ga0068867_100034168 Ga0068867_1000341683 519
1228 3300005530 Ga0070679_100003498 Ga0070679_1000034986 519
1229 3300005539 Ga0068853_100015769 Ga0068853_1000157693 519
1230 3300005539 Ga0068853_100061441 Ga0068853_1000614412 519
1231 3300005543 Ga0070672_100000053 Ga0070672_10000005316 519
1232 3300005548 Ga0070665_100000001 Ga0070665_100000001582 519
1233 3300005548 Ga0070665_100000003 Ga0070665_100000003627 519
1234 3300005548 Ga0070665_100023188 Ga0070665_1000231886 519
1235 3300005548 Ga0070665_100045031 Ga0070665_1000450314 519
1236 3300005563 Ga0068855_100000508 Ga0068855_1000005082 519
1237 3300005614 Ga0068856_100000794 Ga0068856_10000079421 519
1238 3300005614 Ga0068856_100010926 Ga0068856_1000109266 519
1239 3300005616 Ga0068852_100002816 Ga0068852_1000028164 519
1240 3300005616 Ga0068852_100005191 Ga0068852_1000051911 519
1241 3300005616 Ga0068852_100008342 Ga0068852_1000083423 519
1242 3300005617 Ga0068859_100000003 Ga0068859_100000003333 519
1243 3300005617 Ga0068859_100000029 Ga0068859_1000000293 519
1244 3300005617 Ga0068859_100014762 Ga0068859_1000147622 519
1245 3300005617 Ga0068859_100037042 Ga0068859_1000370422 519
1246 3300005617 Ga0068859_100040381 Ga0068859_1000403813 519
1247 3300005618 Ga0068864_100001685 Ga0068864_1000016856 519
1248 3300005618 Ga0068864_100010772 Ga0068864_1000107723 519
1249 3300005618 Ga0068864_100039616 Ga0068864_1000396161 519
1250 3300005618 Ga0068864_100149468 Ga0068864_1001494681 519
1251 3300005719 Ga0068861_100025846 Ga0068861_1000258462 519
1252 3300005719 Ga0068861_100053430 Ga0068861_1000534302 519
1253 3300005719 Ga0068861_100109905 Ga0068861_1001099052 519
1254 3300005834 Ga0068851_10010820 Ga0068851_100108202 519
1255 3300005841 Ga0068863_100000394 Ga0068863_10000039430 519
1256 3300005841 Ga0068863_100002832 Ga0068863_1000028323 519
1257 3300005841 Ga0068863_100056546 Ga0068863_1000565462 519
1258 3300005841 Ga0068863_100099700 Ga0068863_1000997002 519
1259 3300005841 Ga0068863_100139021 Ga0068863_1001390212 519
1260 3300005842 Ga0068858_100003697 Ga0068858_1000036977 519
1261 3300005842 Ga0068858_100020680 Ga0068858_1000206802 519
1262 3300005842 Ga0068858_100030635 Ga0068858_1000306352 519
1263 3300005843 Ga0068860_100000097 Ga0068860_100000097132 519
1264 3300005843 Ga0068860_100001069 Ga0068860_10000106914 519
1265 3300005843 Ga0068860_100002493 Ga0068860_1000024936 519
1266 3300005843 Ga0068860_100003262 Ga0068860_10000326212 519
1267 3300005843 Ga0068860_100005227 Ga0068860_1000052272 519
1268 3300005843 Ga0068860_100007318 Ga0068860_1000073183 519
1269 3300005843 Ga0068860_100021645 Ga0068860_1000216452 519
1270 3300005843 Ga0068860_100038549 Ga0068860_1000385493 519
1271 3300005844 Ga0068862_100004418 Ga0068862_1000044185 519
1272 3300006195 Ga0075366_10001480 Ga0075366_100014804 519
1273 3300006237 Ga0097621_100000827 Ga0097621_1000008275 519
1274 3300006237 Ga0097621_100005142 Ga0097621_1000051422 519
1275 3300006237 Ga0097621_100108884 Ga0097621_1001088842 519
1276 3300006358 Ga0068871_100000088 Ga0068871_10000008832 519
1277 3300006358 Ga0068871_100000130 Ga0068871_10000013038 519
1278 3300006358 Ga0068871_100041136 Ga0068871_1000411363 519
1279 3300006358 Ga0068871_100108532 Ga0068871_1001085322 519
1280 3300006358 Ga0068871_100115973 Ga0068871_1001159732 519
1281 3300006881 Ga0068865_100000050 Ga0068865_10000005013 519
1282 3300006881 Ga0068865_100002647 Ga0068865_1000026473 519
1283 3300006881 Ga0068865_100007029 Ga0068865_1000070292 519
1284 3300006881 Ga0068865_100080477 Ga0068865_1000804771 519
1285 3300006931 Ga0097620_100000003 Ga0097620_100000003333 519
1286 3300006931 Ga0097620_100000029 Ga0097620_1000000293 519
1287 3300006931 Ga0097620_100014762 Ga0097620_1000147622 519
1288 3300006931 Ga0097620_100037046 Ga0097620_1000370462 519
1289 3300006931 Ga0097620_100040381 Ga0097620_1000403813 519
1290 3300009093 Ga0105240_10003320 Ga0105240_100033205 519
1291 3300009093 Ga0105240_10018086 Ga0105240_100180862 519
1292 3300009093 Ga0105240_10023926 Ga0105240_100239267 519
1293 3300009093 Ga0105240_10027258 Ga0105240_100272586 519
1294 3300009093 Ga0105240_10067069 Ga0105240_100670692 519
1295 3300009093 Ga0105240_10097290 Ga0105240_100972902 519
1296 3300009093 Ga0105240_10206190 Ga0105240_102061902 519
1297 3300009094 Ga0111539_10005429 Ga0111539_100054293 519
1298 3300009094 Ga0111539_10281246 Ga0111539_102812462 519
1299 3300009098 Ga0105245_10043754 Ga0105245_100437541 519
1300 3300009101 Ga0105247_10001444 Ga0105247_1000144414 519
1301 3300009101 Ga0105247_10003817 Ga0105247_100038175 519
1302 3300009148 Ga0105243_10018319 Ga0105243_100183192 519
1303 3300009174 Ga0105241_10000398 Ga0105241_100003988 519
1304 3300009174 Ga0105241_10003450 Ga0105241_100034503 519
1305 3300009174 Ga0105241_10007032 Ga0105241_100070323 519
1306 3300009174 Ga0105241_10015295 Ga0105241_100152953 519
1307 3300009174 Ga0105241_10073664 Ga0105241_100736642 519
1308 3300009176 Ga0105242_10053548 Ga0105242_100535482 519
1309 3300009176 Ga0105242_10053850 Ga0105242_100538502 519
1310 3300009176 Ga0105242_10134238 Ga0105242_101342382 519
1311 3300009176 Ga0105242_10138849 Ga0105242_101388491 519
1312 3300009177 Ga0105248_10090763 Ga0105248_100907632 519
1313 3300009545 Ga0105237_10001393 Ga0105237_1000139312 519
1314 3300009545 Ga0105237_10001999 Ga0105237_1000199910 519
1315 3300009545 Ga0105237_10003774 Ga0105237_100037742 519
1316 3300009545 Ga0105237_10011200 Ga0105237_100112004 519
1317 3300009545 Ga0105237_10013638 Ga0105237_100136383 519
1318 3300009545 Ga0105237_10016081 Ga0105237_100160813 519
1319 3300009545 Ga0105237_10016676 Ga0105237_100166763 519
1320 3300009545 Ga0105237_10027908 Ga0105237_100279083 519
1321 3300009545 Ga0105237_10123980 Ga0105237_101239802 519
1322 3300009551 Ga0105238_10023197 Ga0105238_100231972 519
1323 3300009551 Ga0105238_10069474 Ga0105238_100694741 519
1324 3300009551 Ga0105238_10105228 Ga0105238_101052283 519
1325 3300009553 Ga0105249_10002967 Ga0105249_100029677 519
1326 3300009553 Ga0105249_10014303 Ga0105249_100143032 519
1327 3300009553 Ga0105249_10015028 Ga0105249_100150282 519
1328 3300009553 Ga0105249_10019812 Ga0105249_100198125 519
1329 3300009553 Ga0105249_10037959 Ga0105249_100379592 519
1330 3300010375 Ga0105239_10000255 Ga0105239_1000025549 519
1331 3300010375 Ga0105239_10006696 Ga0105239_100066962 519
1332 3300010375 Ga0105239_10021183 Ga0105239_100211832 519
1333 3300010375 Ga0105239_10022957 Ga0105239_100229573 519
1334 3300010375 Ga0105239_10038077 Ga0105239_100380774 519
1335 3300010375 Ga0105239_10122793 Ga0105239_101227932 519
1336 3300011119 Ga0105246_10017045 Ga0105246_100170453 519
1337 3300013100 Ga0157373_10001710 Ga0157373_100017102 519
1338 3300013102 Ga0157371_10023728 Ga0157371_100237282 519
1339 3300013102 Ga0157371_10027184 Ga0157371_100271843 519
1340 3300013102 Ga0157371_10042556 Ga0157371_100425562 519
1341 3300013104 Ga0157370_10001057 Ga0157370_1000105721 519
1342 3300013104 Ga0157370_10047974 Ga0157370_100479744 519
1343 3300013296 Ga0157374_10001012 Ga0157374_100010123 519
1344 3300013296 Ga0157374_10002880 Ga0157374_100028803 519
1345 3300013296 Ga0157374_10003782 Ga0157374_100037828 519
1346 3300013296 Ga0157374_10019983 Ga0157374_100199836 519
1347 3300013296 Ga0157374_10067123 Ga0157374_100671233 519
1348 3300013297 Ga0157378_10009315 Ga0157378_100093153 519
1349 3300013297 Ga0157378_10014774 Ga0157378_100147743 519
1350 3300013297 Ga0157378_10029608 Ga0157378_100296083 519
1351 3300013297 Ga0157378_10057546 Ga0157378_100575462 519
1352 3300013306 Ga0163162_10000031 Ga0163162_1000003138 519
1353 3300013306 Ga0163162_10001952 Ga0163162_100019529 519
1354 3300013306 Ga0163162_10003770 Ga0163162_100037706 519
1355 3300013306 Ga0163162_10005204 Ga0163162_100052042 519
1356 3300013306 Ga0163162_10006392 Ga0163162_100063922 519
1357 3300013306 Ga0163162_10008568 Ga0163162_100085683 519
1358 3300013306 Ga0163162_10021340 Ga0163162_100213406 519
1359 3300013306 Ga0163162_10025992 Ga0163162_100259922 519
1360 3300013307 Ga0157372_10037755 Ga0157372_100377552 519
1361 3300013307 Ga0157372_10110269 Ga0157372_101102691 519
1362 3300013307 Ga0157372_10170363 Ga0157372_101703631 519
1363 3300013307 Ga0157372_10206152 Ga0157372_102061521 519
1364 3300013308 Ga0157375_10017919 Ga0157375_100179193 519
1365 3300013308 Ga0157375_10024778 Ga0157375_100247784 519
1366 3300013308 Ga0157375_10036838 Ga0157375_100368382 519
1367 3300013308 Ga0157375_10047336 Ga0157375_100473362 519
1368 3300013308 Ga0157375_10087601 Ga0157375_100876012 519
1369 3300013308 Ga0157375_10112862 Ga0157375_101128622 519
1370 3300014325 Ga0163163_10018483 Ga0163163_100184832 519
1371 3300014325 Ga0163163_10032245 Ga0163163_100322453 519
1372 3300014326 Ga0157380_10003484 Ga0157380_100034843 519
1373 3300014497 Ga0182008_10000211 Ga0182008_100002115 519
1374 3300014745 Ga0157377_10001155 Ga0157377_100011554 519
1375 3300014968 Ga0157379_10008259 Ga0157379_100082595 519
1376 3300014968 Ga0157379_10018199 Ga0157379_100181992 519
1377 3300014968 Ga0157379_10021550 Ga0157379_100215506 519
1378 3300014969 Ga0157376_10014177 Ga0157376_100141776 519
1379 3300014969 Ga0157376_10019754 Ga0157376_100197543 519
1380 3300014969 Ga0157376_10047947 Ga0157376_100479472 519
1381 3300014969 Ga0157376_10072578 Ga0157376_100725782 519
1382 3300014969 Ga0157376_10186346 Ga0157376_101863461 519
1383 3300015261 Ga0182006_1001197 Ga0182006_10011974 519
1384 3300015261 Ga0182006_1003188 Ga0182006_10031886 519
1385 3300015262 Ga0182007_10002027 Ga0182007_100020273 519
1386 3300017792 Ga0163161_10005950 Ga0163161_100059507 519
1387 3300025272 Ga0209455_1005969 Ga0209455_10059692 519
1388 3300025302 Ga0207426_1000258 Ga0207426_100025885 519
1389 3300025315 Ga0207697_10024262 Ga0207697_100242622 519
1390 3300025899 Ga0207642_10051885 Ga0207642_100518851 519
1391 3300025900 Ga0207710_10000906 Ga0207710_100009062 519
1392 3300025901 Ga0207688_10025859 Ga0207688_100258593 519
1393 3300025903 Ga0207680_10000014 Ga0207680_10000014111 519
1394 3300025903 Ga0207680_10000016 Ga0207680_10000016109 519
1395 3300025903 Ga0207680_10000593 Ga0207680_100005936 519
1396 3300025904 Ga0207647_10001351 Ga0207647_1000135110 519
1397 3300025907 Ga0207645_10000082 Ga0207645_1000008232 519
1398 3300025907 Ga0207645_10000413 Ga0207645_100004133 519
1399 3300025907 Ga0207645_10000863 Ga0207645_1000086311 519
1400 3300025907 Ga0207645_10003660 Ga0207645_100036608 519
1401 3300025907 Ga0207645_10022717 Ga0207645_100227172 519
1402 3300025907 Ga0207645_10043213 Ga0207645_100432133 519
1403 3300025909 Ga0207705_10000015 Ga0207705_1000001593 519
1404 3300025911 Ga0207654_10001242 Ga0207654_100012422 519
1405 3300025911 Ga0207654_10001903 Ga0207654_100019039 519
1406 3300025912 Ga0207707_10012635 Ga0207707_100126357 519
1407 3300025913 Ga0207695_10000812 Ga0207695_1000081249 519
1408 3300025913 Ga0207695_10006104 Ga0207695_1000610413 519
1409 3300025913 Ga0207695_10047145 Ga0207695_100471452 519
1410 3300025914 Ga0207671_10000746 Ga0207671_100007466 519
1411 3300025914 Ga0207671_10002546 Ga0207671_100025462 519
1412 3300025914 Ga0207671_10003027 Ga0207671_100030274 519
1413 3300025914 Ga0207671_10008293 Ga0207671_100082932 519
1414 3300025914 Ga0207671_10009363 Ga0207671_1000936310 519
1415 3300025914 Ga0207671_10078054 Ga0207671_100780542 519
1416 3300025918 Ga0207662_10045414 Ga0207662_100454142 519
1417 3300025921 Ga0207652_10003157 Ga0207652_100031579 519
1418 3300025923 Ga0207681_10039265 Ga0207681_100392652 519
1419 3300025924 Ga0207694_10022181 Ga0207694_100221812 519
1420 3300025926 Ga0207659_10034688 Ga0207659_100346883 519
1421 3300025926 Ga0207659_10049355 Ga0207659_100493552 519
1422 3300025931 Ga0207644_10009732 Ga0207644_100097323 519
1423 3300025933 Ga0207706_10000191 Ga0207706_1000019155 519
1424 3300025933 Ga0207706_10001034 Ga0207706_1000103416 519
1425 3300025933 Ga0207706_10139324 Ga0207706_101393241 519
1426 3300025938 Ga0207704_10000078 Ga0207704_1000007847 519
1427 3300025938 Ga0207704_10001285 Ga0207704_100012853 519
1428 3300025938 Ga0207704_10003694 Ga0207704_100036948 519
1429 3300025940 Ga0207691_10000012 Ga0207691_10000012127 519
1430 3300025940 Ga0207691_10138035 Ga0207691_101380351 519
1431 3300025942 Ga0207689_10000681 Ga0207689_100006813 519
1432 3300025942 Ga0207689_10002471 Ga0207689_100024714 519
1433 3300025942 Ga0207689_10004825 Ga0207689_100048252 519
1434 3300025942 Ga0207689_10008418 Ga0207689_100084187 519
1435 3300025942 Ga0207689_10036630 Ga0207689_100366302 519
1436 3300025942 Ga0207689_10037273 Ga0207689_100372732 519
1437 3300025949 Ga0207667_10062738 Ga0207667_100627384 519
1438 3300025949 Ga0207667_10143416 Ga0207667_101434162 519
1439 3300025960 Ga0207651_10013034 Ga0207651_100130343 519
1440 3300025960 Ga0207651_10087153 Ga0207651_100871532 519
1441 3300025961 Ga0207712_10014611 Ga0207712_100146112 519
1442 3300025961 Ga0207712_10028762 Ga0207712_100287622 519
1443 3300025972 Ga0207668_10014181 Ga0207668_100141812 519
1444 3300025986 Ga0207658_10000954 Ga0207658_100009542 519
1445 3300026023 Ga0207677_10004743 Ga0207677_100047433 519
1446 3300026023 Ga0207677_10006126 Ga0207677_100061262 519
1447 3300026023 Ga0207677_10020762 Ga0207677_100207621 519
1448 3300026023 Ga0207677_10047362 Ga0207677_100473622 519
1449 3300026035 Ga0207703_10006005 Ga0207703_100060053 519
1450 3300026035 Ga0207703_10110443 Ga0207703_101104432 519
1451 3300026041 Ga0207639_10005140 Ga0207639_100051403 519
1452 3300026078 Ga0207702_10000201 Ga0207702_1000020151 519
1453 3300026078 Ga0207702_10021832 Ga0207702_100218322 519
1454 3300026078 Ga0207702_10071933 Ga0207702_100719332 519
1455 3300026088 Ga0207641_10000015 Ga0207641_10000015202 519
1456 3300026088 Ga0207641_10002550 Ga0207641_100025507 519
1457 3300026088 Ga0207641_10007808 Ga0207641_100078083 519
1458 3300026088 Ga0207641_10044466 Ga0207641_100444661 519
1459 3300026089 Ga0207648_10000472 Ga0207648_1000047239 519
1460 3300026089 Ga0207648_10059637 Ga0207648_100596372 519
1461 3300026095 Ga0207676_10011694 Ga0207676_100116943 519
1462 3300026095 Ga0207676_10035730 Ga0207676_100357302 519
1463 3300026116 Ga0207674_10005270 Ga0207674_100052707 519
1464 3300026118 Ga0207675_100000791 Ga0207675_1000007913 519
1465 3300026118 Ga0207675_100082228 Ga0207675_1000822282 519
1466 3300026121 Ga0207683_10001161 Ga0207683_100011617 519
1467 3300026121 Ga0207683_10009360 Ga0207683_100093606 519
1468 3300026121 Ga0207683_10009842 Ga0207683_100098423 519
1469 3300026121 Ga0207683_10076193 Ga0207683_100761932 519
1470 3300026142 Ga0207698_10001356 Ga0207698_100013561 519
1471 3300026142 Ga0207698_10057517 Ga0207698_100575172 519
1472 3300028379 Ga0268266_10000038 Ga0268266_1000003859 519
1473 3300028379 Ga0268266_10000052 Ga0268266_10000052219 519
1474 3300028379 Ga0268266_10001883 Ga0268266_100018838 519
1475 3300028380 Ga0268265_10055712 Ga0268265_100557122 519
1476 3300028381 Ga0268264_10000167 Ga0268264_1000016793 519
1477 3300028381 Ga0268264_10003119 Ga0268264_100031194 519
1478 3300028381 Ga0268264_10005092 Ga0268264_100050925 519
1479 3300028381 Ga0268264_10010880 Ga0268264_100108805 519
1480 3300028381 Ga0268264_10013618 Ga0268264_100136181 519
1481 3300028381 Ga0268264_10072542 Ga0268264_100725422 519
1482 3300028786 Ga0307517_10041986 Ga0307517_100419862 519
1483 3300028794 Ga0307515_10000039 Ga0307515_1000003925 519
1484 3300028794 Ga0307515_10000118 Ga0307515_1000011834 519
1485 3300028800 Ga0265338_10020137 Ga0265338_100201376 519
1486 3300030521 Ga0307511_10000539 Ga0307511_100005393 519
1487 3300030521 Ga0307511_10007925 Ga0307511_100079254 519
1488 3300031507 Ga0307509_10089495 Ga0307509_100894951 519
1489 3300031507 Ga0307509_10100060 Ga0307509_101000602 519
1490 3300031507 Ga0307509_10158173 Ga0307509_101581731 519
1491 3300031616 Ga0307508_10039632 Ga0307508_100396323 519
1492 3300031730 Ga0307516_10000292 Ga0307516_100002925 519
1493 3300031730 Ga0307516_10000656 Ga0307516_1000065627 519
1494 3300031730 Ga0307516_10039679 Ga0307516_100396792 519
1495 3300031911 Ga0307412_10000091 Ga0307412_100000915 519
1496 3300032004 Ga0307414_10001947 Ga0307414_100019477 519
1497 3300033180 Ga0307510_10003325 Ga0307510_1000332516 519
1498 3300036401 Ga0373937_0050907 Ga0373937_0050907_1475_3205 519
1499 3300037312 Ga0395899_0000001 Ga0395899_0000001_981169_982884 519
1500 3300037312 Ga0395899_0000312 Ga0395899_0000312_42067_43782 519
1501 3300037418 Ga0395900_0000014 Ga0395900_0000014_59428_61143 519
1502 3300037418 Ga0395900_0000128 Ga0395900_0000128_97571_99286 519
1503 3300037418 Ga0395900_0005426 Ga0395900_0005426_1963_3678 519
1504 3300037466 Ga0395898_0004221 Ga0395898_0004221_3873_5588 519
1505 3300037471 Ga0395905_0000037 Ga0395905_0000037_59418_61133 519
1506 3300037471 Ga0395905_0006237 Ga0395905_0006237_2623_4338 519
1507 3300038443 Ga0395901_0000166 Ga0395901_0000166_59282_60997 519
1508 3300038443 Ga0395901_0043422 Ga0395901_0043422_1006_2721 519
1509 3300042005 Ga0439448_0010150 Ga0439448_0010150_870_2585 519
1510 3300044656 Ga0466969_0000340 Ga0466969_0000340_1453_3186 519
1511 3300044658 Ga0466972_0000077 Ga0466972_0000077_425_2158 519
1512 3300044658 Ga0466972_0000102 Ga0466972_0000102_31162_32991 519
1513 3300044658 Ga0466972_0011368 Ga0466972_0011368_740_2473 519
1514 3300044658 Ga0466972_0034518 Ga0466972_0034518_80_1810 519
1515 3300044684 Ga0466966_0000116 Ga0466966_0000116_13233_14966 519
1516 3300045049 Ga0466959_0000021 Ga0466959_0000021_95063_96796 519
1517 3300046507 Ga0495606_0000002 Ga0495606_0000002_68949_70748 519
1518 3300046517 Ga0495630_0039507 Ga0495630_0039507_1665_3395 519
1519 3300046518 Ga0495631_0011238 Ga0495631_0011238_531_2246 519
1520 3300046529 Ga0495652_0040478 Ga0495652_0040478_560_2290 519
1521 3300046648 Ga0495611_0000101 Ga0495611_0000101_47267_49000 519
1522 3300046660 Ga0495625_0002070 Ga0495625_0002070_2640_4370 519
1523 3300046683 Ga0495658_0007827 Ga0495658_0007827_1048_2778 519
1524 3300047319 Ga0495674_0096991 Ga0495674_0096991_683_2413 519
1525 3300047320 Ga0495672_0008827 Ga0495672_0008827_4154_5869 519
1526 3300047320 Ga0495672_0010671 Ga0495672_0010671_3905_5638 519
1527 3300047320 Ga0495672_0013482 Ga0495672_0013482_3376_5091 519
1528 3300047320 Ga0495672_0035561 Ga0495672_0035561_411_2126 519
1529 3300047323 Ga0495683_0016346 Ga0495683_0016346_1470_3185 519
1530 3300047443 Ga0495687_000001 Ga0495687_000001_528719_530434 519
1531 3300047443 Ga0495687_001574 Ga0495687_001574_15267_16982 519
1532 3300047443 Ga0495687_002393 Ga0495687_002393_8573_10303 519
1533 3300048925 Ga0496122_0000395 Ga0496122_0000395_63600_65303 519
1534 3300048926 Ga0496123_0004187 Ga0496123_0004187_3099_4802 519
1535 3300048928 Ga0496125_0016681 Ga0496125_0016681_4844_6547 519
1536 3300049513 Ga0501290_000620 Ga0501290_000620_3351_5084 519
1537 3300049521 Ga0501298_001313 Ga0501298_001313_1589_3322 519
1538 3300049522 Ga0501299_000750 Ga0501299_000750_140_1873 519
1539 3300049571 Ga0501034_0024000 Ga0501034_0024000_1237_2952 519
1540 3300049581 Ga0501047_0079796 Ga0501047_0079796_103_1833 519
1541 3300049649 Ga0501198_000624 Ga0501198_000624_1114_2847 519
1542 3300049651 Ga0501201_000660 Ga0501201_000660_1190_2923 519
1543 3300049654 Ga0501207_000817 Ga0501207_000817_208_1941 519
1544 3300049661 Ga0501217_000145 Ga0501217_000145_1272_3005 519
1545 3300049663 Ga0501223_001768 Ga0501223_001768_430_2163 519
1546 3300049664 Ga0501224_000130 Ga0501224_000130_3668_5401 519
1547 3300049669 Ga0501235_000672 Ga0501235_000672_1890_3623 519
1548 3300049688 Ga0501259_000174 Ga0501259_000174_5945_7678 519
1549 3300049689 Ga0501260_001080 Ga0501260_001080_198_1931 519
1550 3300049705 Ga0501225_0001324 Ga0501225_0001324_1726_3459 519
1551 3300049707 Ga0501234_000932 Ga0501234_000932_330_2063 519
1552 3300050493 nmdc:mga0k408_177_c3 nmdc:mga0k408_177_c3_14591_16321 519
1553 3300053080 Ga0500635_0000855 Ga0500635_0000855_1730_3445 519
1554 3300053085 Ga0495619_0014565 Ga0495619_0014565_2170_3900 519
1555 3300053092 Ga0500583_0000022 Ga0500583_0000022_31096_32826 519
1556 3300053092 Ga0500583_0001571 Ga0500583_0001571_2021_3736 519
1557 3300053092 Ga0500583_0001982 Ga0500583_0001982_1628_3364 519
1558 3300053122 Ga0500608_000743 Ga0500608_000743_9057_10772 519
1559 3300053122 Ga0500608_003342 Ga0500608_003342_899_2629 519
1560 3300053130 Ga0500642_0022016 Ga0500642_0022016_438_2153 519
1561 3300053139 Ga0500568_0000305 Ga0500568_0000305_28082_29797 519
1562 3300053139 Ga0500568_0011005 Ga0500568_0011005_2239_3954 519
1563 3300053153 Ga0500616_0006875 Ga0500616_0006875_3145_4860 519

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05199

GMC_oxred_C

GMC oxidoreductase

472

593

0.89

PF00732

GMC_oxred_N

GMC oxidoreductase

49

381

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6aa8-assembly1.cif.gz_F crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with nad+ 1.004 15 42
3ado-assembly1.cif.gz_A crystal structure of the rabbit l-gulonate 3-dehydrogenase 0.9772 15 42
8ozw-assembly1.cif.gz_A imine reductase from ajellomyces dermatitidis in complex nadph4 0.97 15 42
4oqy-assembly1.cif.gz_B streptomyces sp. gf3546 imine reductase 0.9632 15 42
8a3x-assembly1.cif.gz_B imine reductase from ensifer adhaerens in complex with nadp+ 0.9608 15 42
ID Description Score Start End Superfamily
2d5cB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9964 16 42 3.40.50.720
3k30B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9855 15 46 3.40.50.720
af_O61709_2_252_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9814 16 42 3.40.50.720
4kuhA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9808 15 41 3.40.50.720
5z2gB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.98 16 42 3.50.50.60
ID Description Score Start End GO Terms
AF-K1LUE5-F1-model_v4 Gluconate 2-dehydrogenase flavoprotein (EC 1.1.99.3) 0.9844 379 514 GO:0033717
AF-A0A1Q7YDC6-F1-model_v4 GMC family oxidoreductase 0.9815 72 519 GO:0016614
GO:0050660
AF-A0A4Q5RE69-F1-model_v4 GMC family oxidoreductase 0.9802 113 490 GO:0016614
GO:0050660
AF-A0A519TBE8-F1-model_v4 GMC family oxidoreductase 0.98 379 518 GO:0016614
AF-A0A6J4LQS2-F1-model_v4 Glucose-methanol-choline (GMC) oxidoreductase:NAD binding site 0.9792 12 519 GO:0016289
GO:0016614
GO:0050660

Feature Viewer

pLDDT pTM Quality
90.64 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map