F494779

General Info

Members Datasets Scaffolds Average Seq Length
1563 987 978 119

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_13156344|Ga0105249_131563441
Length 124
Sequence MTPMSMTVLTVDDSRTMREMLRLALTDVGYRVVQAEDGVHGLEVLAHETPDVIVTDINMPRMDGFGFIEEVRSDPEHRRILILVLTTESDAEKKNRARMAGATGWIVKPFNPVKLVDAIRRVAA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
14 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
15 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
16 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
17 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
18 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
19 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
20 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
21 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
22 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
23 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
24 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
25 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
26 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
27 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
28 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
29 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
30 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
31 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
32 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
33 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
34 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
35 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
36 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
37 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
38 2516143018 Ensifer sp. BR816 Isolate Nodule
39 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
40 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
41 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
42 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
43 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
44 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
45 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
46 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
47 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
48 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
49 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
50 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
51 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
52 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
53 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
54 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
55 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
56 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
57 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
58 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
59 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
60 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
61 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
62 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
63 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
64 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
65 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
66 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
67 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
68 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
69 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
70 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
71 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
72 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
73 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
74 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
75 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
76 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
77 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
78 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
79 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
80 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
81 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
82 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
83 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
84 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
85 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
86 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
87 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
88 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
89 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
90 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
91 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
92 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
93 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
94 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
95 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
96 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
97 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
98 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
99 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
100 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
101 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
102 2643221557 Ensifer sp. Root558 Isolate Unclassified
103 2643221558 Rhizobium sp. Root149 Isolate Unclassified
104 2643221568 Rhizobium sp. Root564 Isolate Unclassified
105 2643221582 Rhizobium sp. Root651 Isolate Unclassified
106 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
107 2643221599 Rhizobium sp. Root708 Isolate Unclassified
108 2643221607 Rhizobium sp. Root73 Isolate Unclassified
109 2643221610 Ensifer sp. Root74 Isolate Unclassified
110 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
111 2643221618 Ensifer sp. Root231 Isolate Unclassified
112 2643221626 Ensifer sp. Root31 Isolate Unclassified
113 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
114 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
115 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
116 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
117 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
118 2643221655 Ensifer sp. Root1252 Isolate Unclassified
119 2643221659 Ensifer sp. Root127 Isolate Unclassified
120 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
121 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
122 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
123 2643221668 Ensifer sp. Root423 Isolate Unclassified
124 2643221675 Ensifer sp. Root1298 Isolate Unclassified
125 2643221680 Ensifer sp. Root1312 Isolate Unclassified
126 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
127 2643221688 Rhizobium sp. Root482 Isolate Unclassified
128 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
129 2643221693 Rhizobium sp. Root491 Isolate Unclassified
130 2643221698 Ensifer sp. Root142 Isolate Unclassified
131 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
132 2643221712 Ensifer sp. Root258 Isolate Unclassified
133 2643221718 Rhizobium sp. Root268 Isolate Unclassified
134 2643221719 Rhizobium sp. Root274 Isolate Unclassified
135 2643221723 Ensifer sp. Root278 Isolate Unclassified
136 2643221726 Ensifer sp. Root954 Isolate Unclassified
137 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
138 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
139 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
140 2718217882 Rhizobium sp. N741 Isolate Nodule
141 2718217927 Rhizobium sp. N324 Isolate Nodule
142 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
143 2718218009 Rhizobium sp. N561 Isolate Nodule
144 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
145 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
146 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
147 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
148 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
149 2718218363 Rhizobium sp. N113 Isolate Nodule
150 2718218365 Rhizobium sp. N731 Isolate Nodule
151 2718218366 Rhizobium sp. N621 Isolate Nodule
152 2718218423 Rhizobium sp. N941 Isolate Nodule
153 2721755514 Rhizobium sp. N6212 Isolate Nodule
154 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
155 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
156 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
157 2721755809 Rhizobium sp. N541 Isolate Nodule
158 2721755810 Rhizobium sp. N871 Isolate Nodule
159 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
160 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
161 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
162 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
163 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
164 2728369365 Rhizobium sp. N1341 Isolate Nodule
165 2728369397 Rhizobium sp. N1314 Isolate Nodule
166 2738541293 Rhizobium sp. GV031 Isolate Unclassified
167 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
168 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
169 2738543024 Aminobacter sp. AP02 Isolate Unclassified
170 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
171 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
172 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
173 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
174 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
175 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
176 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
177 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
178 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
179 2791355256 Rhizobium sp. M10 Isolate Nodule
180 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
181 2791355260 Rhizobium sp. L9 Isolate Nodule
182 2791355261 Rhizobium sp. J15 Isolate Nodule
183 2791355262 Rhizobium sp. M1 Isolate Nodule
184 2791355263 Rhizobium chutanense C5 Isolate Nodule
185 2791355264 Rhizobium sp. S9 Isolate Nodule
186 2791355265 Rhizobium sp. H4 Isolate Nodule
187 2791355266 Rhizobium sp. L43 Isolate Nodule
188 2791355267 Rhizobium sp. L18 Isolate Nodule
189 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
190 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
191 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
192 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
193 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
194 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
195 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
196 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
197 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
198 2802429633 Rhizobium anhuiense J3 Isolate Nodule
199 2802429634 Rhizobium anhuiense S10 Isolate Nodule
200 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
201 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
202 2802429637 Rhizobium anhuiense C15 Isolate Nodule
203 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
204 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
205 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
206 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
207 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
208 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
209 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
210 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
211 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
212 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
213 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
214 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
215 2838048938 Rhizobium pisi 27/80 Isolate Nodule
216 2838061910 Rhizobium phaseoli L15 Isolate Nodule
217 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
218 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
219 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
220 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
221 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
222 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
223 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
224 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
225 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
226 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
227 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
228 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
229 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
230 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
231 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
232 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
233 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
234 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
235 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
236 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
237 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
238 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
239 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
240 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
241 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
242 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
243 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
244 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
245 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
246 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
247 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
248 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
249 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
250 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
251 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
252 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
253 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
254 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
255 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
256 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
257 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
258 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
259 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
260 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
261 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
262 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
263 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
264 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
265 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
266 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
267 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
268 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
269 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
270 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
271 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
272 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
273 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
274 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
275 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
276 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
277 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
278 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
279 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
280 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
281 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
282 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
283 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
284 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
285 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
286 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
287 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
288 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
289 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
290 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
291 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
292 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
293 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
294 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
295 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
296 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
297 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
298 2844163670 Ensifer sp. 1H6 Isolate Unclassified
299 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
300 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
301 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
302 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
303 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
304 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
305 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
306 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
307 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
308 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
309 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
310 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
311 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
312 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
313 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
314 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
315 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
316 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
317 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
318 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
319 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
320 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
321 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
322 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
323 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
324 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
325 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
326 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
327 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
328 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
329 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
330 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
331 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
332 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
333 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
334 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
335 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
336 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
337 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
338 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
339 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
340 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
341 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
342 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
343 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
344 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
345 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
346 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
347 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
348 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
349 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
350 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
351 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
352 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
353 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
354 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
355 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
356 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
357 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
358 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
359 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
360 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
361 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
362 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
363 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
364 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
365 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
366 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
367 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
368 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
369 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
370 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
371 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
372 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
373 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
374 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
375 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
376 2933599457 Rhizobium phaseoli M3 Isolate Nodule
377 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
378 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
379 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
380 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
381 2936381700 Rhizobium chutanense C16 Isolate Unclassified
382 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
383 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
384 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
385 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
386 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
387 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
388 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
389 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
390 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
391 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
392 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
393 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
394 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
395 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
396 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
397 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
398 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
399 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
400 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
401 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
402 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
403 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
404 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
405 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
406 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
407 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
408 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
409 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
410 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
411 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
412 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
413 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
414 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
415 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
416 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
417 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
418 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
419 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
420 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
421 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
422 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
423 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
424 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
425 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
426 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
427 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
428 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
429 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
430 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
431 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
432 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
433 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
434 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
435 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
436 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
437 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
438 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
439 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
440 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
441 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
442 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
443 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
444 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
445 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
446 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
447 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
448 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
449 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
450 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
451 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
452 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
453 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
454 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
455 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
456 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
457 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
458 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
459 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
460 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
461 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
462 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
463 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
464 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
465 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
466 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
467 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
468 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
469 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
470 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
471 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
472 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
473 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
474 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
475 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
476 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
477 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
478 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
479 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
480 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
481 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
482 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
483 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
484 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
485 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
486 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
487 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
488 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
489 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
490 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
491 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
492 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
493 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
494 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
495 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
496 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
497 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
498 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
499 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
500 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
501 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
502 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
503 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
504 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
505 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
506 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
507 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
508 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
509 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
510 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
511 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
512 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
513 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
514 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
515 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
516 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
517 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
518 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
519 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
520 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
521 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
522 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
523 2996887358 Rhizobium sp. R711 Isolate Nodule
524 2996893221 Rhizobium sp. R635 Isolate Nodule
525 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
526 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
527 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
528 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
529 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
530 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
531 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
532 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
533 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
534 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
535 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
536 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
537 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
538 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
539 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
540 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
541 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
542 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
543 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
544 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
545 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
546 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
547 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
548 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
549 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
550 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
551 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
552 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
553 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
554 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
555 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
556 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
557 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
558 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
559 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
560 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
561 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
562 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
563 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
564 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
565 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
566 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
567 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
568 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
569 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
570 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
571 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
572 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
573 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
574 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
575 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
576 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
577 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
578 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
579 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
580 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
581 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
582 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
583 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
584 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
585 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
586 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
587 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
588 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
589 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
590 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
591 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
592 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
593 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
594 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
595 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
596 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
597 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
598 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
599 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
600 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
601 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
602 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
603 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
604 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
605 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
606 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
607 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
608 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
609 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
610 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
611 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
612 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
613 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
614 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
615 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
616 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
617 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
618 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
619 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
620 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
621 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
622 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
623 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
624 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
625 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
626 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
627 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
628 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
629 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
630 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
631 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
632 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
633 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
634 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
635 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
636 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
637 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
638 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
639 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
640 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
641 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
642 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
643 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
644 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
645 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
646 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
647 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
648 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
649 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
650 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
651 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
652 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
653 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
654 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
655 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
656 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
657 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
658 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
659 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
660 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
661 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
662 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
663 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
664 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
665 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
666 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
667 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
668 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
669 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
670 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
671 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
672 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
673 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
674 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
675 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
676 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
677 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
678 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
679 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
680 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
681 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
682 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
683 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
684 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
685 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
686 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
687 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
688 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
689 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
690 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
691 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
692 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
693 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
694 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
695 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
696 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
697 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
698 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
699 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
700 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
701 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
702 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
703 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
704 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
705 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
706 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
707 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
708 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
709 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
710 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
711 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
712 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
713 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
714 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
715 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
716 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
717 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
718 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
719 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
720 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
721 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
722 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
723 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
724 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
725 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
726 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
727 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
728 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
729 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
730 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
731 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
732 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
733 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
734 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
735 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
736 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
737 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
738 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
739 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
740 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
741 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
742 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
743 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
744 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
745 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
746 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
747 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
748 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
749 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
750 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
751 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
752 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
753 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
754 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
755 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
756 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
757 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
758 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
759 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
760 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
761 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
762 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
763 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
764 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
765 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
766 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
767 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
768 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
769 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
770 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
771 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
772 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
773 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
774 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
775 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
776 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
777 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
778 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
779 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
780 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
781 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
782 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
783 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
784 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
785 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
786 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
787 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
788 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
789 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
790 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
791 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
792 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
793 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
794 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
795 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
796 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
797 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
798 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
799 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
800 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
801 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
802 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
803 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
804 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
805 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
806 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
807 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
808 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
809 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
810 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
811 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
812 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
813 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
814 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
815 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
816 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
817 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
818 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
819 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
820 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
821 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
822 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
823 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
824 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
825 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
826 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
827 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
828 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
829 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
830 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
831 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
832 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
833 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
834 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
835 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
836 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
837 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
838 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
839 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
840 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
841 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
842 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
843 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
844 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
845 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
846 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
847 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
848 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
849 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
850 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
851 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
852 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
853 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
854 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
855 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
856 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
857 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
858 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
859 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
860 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
861 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
862 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
863 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
864 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
865 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
866 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
867 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
868 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
869 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
870 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
871 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
872 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
873 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
874 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
875 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
876 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
877 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
878 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
879 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
880 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
881 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
882 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
883 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
884 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
885 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
886 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
887 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
888 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
889 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
890 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
891 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
892 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
893 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
894 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
895 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
896 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
897 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
898 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
899 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
900 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
901 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
902 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
903 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
904 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
905 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
906 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
907 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
908 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
909 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
910 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
911 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
912 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
913 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
914 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
915 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
916 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
917 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
918 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
919 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
920 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
921 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
922 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
923 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
924 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
925 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
926 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
927 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
928 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
929 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
930 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
931 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
932 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
933 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
934 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
935 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
936 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
937 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
938 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
939 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
940 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
941 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
942 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
943 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
944 8005258706 Rhizobium sp. R693 Isolate Nodule
945 8005275841 Rhizobium sp. N4311 Isolate Nodule
946 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
947 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
948 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
949 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
950 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
951 8005321885 Rhizobium sp. R72 Isolate Nodule
952 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
953 8005382845 Rhizobium sp. R634 Isolate Nodule
954 8005395548 Rhizobium sp. R339 Isolate Nodule
955 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
956 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
957 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
958 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
959 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
960 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
961 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
962 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
963 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
964 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
965 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
966 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
967 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
968 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
969 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
970 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
971 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
972 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
973 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
974 8018176218 Rhizobium sp. N122 Isolate Nodule
975 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
976 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
977 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
978 8024501048 Rhizobium sp. H4 Isolate Nodule
979 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
980 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
981 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
982 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
983 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
984 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
985 8056382006 Rhizobium croatiense 13T Isolate Nodule
986 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
987 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 62.19
Metatranscriptomes 0.45
Isolates 37.36

Biome Distribution

Category Percentage (%)
Aerial Root 0.32
Bulb 0
Endosphere 21.18
Nodule 28.02
Rhizoplane 1.92
Rhizosphere 33.27
Stem 0
Stem Tuber 0
Unclassified 15.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10078009 3300001979 Bacteria 873
2 JGI24739J22299_10101900 3300001989 Bacteria 866
3 JGI25155J39150_1000157 3300002704 Bacteria 30370
4 JGI25156J39149_1000029 3300002705 Bacteria 126505
5 JGI25162J39368_1000169 3300002737 Bacteria 72114
6 JGI25162J39368_1000508 3300002737 Bacteria 29158
7 JGI25154J39366_1000286 3300002738 Bacteria 30355
8 JGI25158J39367_1000022 3300002739 Bacteria 38866
9 JGI25158J39367_1008510 3300002739 Bacteria 1424
10 JGI25157J39369_1000247 3300002741 Bacteria 41079
11 JGI25157J39369_1027527 3300002741 Bacteria 658
12 JGI25152J39213_1000754 3300002773 Bacteria 16448
13 JGI25152J39213_1002420 3300002773 Bacteria 7110
14 JGI25152J39213_1007158 3300002773 Bacteria 2925
15 JGI25152J39213_1007181 3300002773 Bacteria 2917
16 JGI25152J39213_1018249 3300002773 Bacteria 1301
17 JGI25152J39213_1049203 3300002773 Bacteria 556
18 JGI25150J39212_1000012 3300002774 Bacteria 182468
19 JGI25150J39212_1012992 3300002774 Bacteria 1456
20 JGI25150J39212_1040828 3300002774 Bacteria 600
21 JGI25159J45721_1000137 3300002987 Bacteria 34522
22 JGI25159J45721_1000730 3300002987 Bacteria 14342
23 JGI25159J45721_1000995 3300002987 Bacteria 12247
24 JGI25151J46595_10000025 3300003187 Bacteria 213302
25 JGI25151J46595_10000504 3300003187 Bacteria 36683
26 JGI25151J46595_10005603 3300003187 Bacteria 6463
27 JGI25165J46597_1000355 3300003214 Bacteria 51475
28 JGI25165J46597_1000491 3300003214 Bacteria 38149
29 JGI25165J46597_1002805 3300003214 Bacteria 5045
30 JGI25153J46596_10001788 3300003215 Bacteria 12753
31 JGI25153J46596_10005320 3300003215 Bacteria 6767
32 JGI25153J46596_10036315 3300003215 Bacteria 1582
33 JGI25153J46596_10056097 3300003215 Bacteria 1098
34 JGI25153J46596_10071670 3300003215 Bacteria 894
35 JGI25153J46596_10124555 3300003215 Bacteria 577
36 JGI25153J46596_10130682 3300003215 Bacteria 556
37 rootH1_10048107 3300003316 Bacteria 2363
38 rootH1_10071907 3300003316 Bacteria 2296
39 rootH2_10053074 3300003320 Bacteria 3781
40 JGI25160J50197_1000003 3300003354 Bacteria 482719
41 JGI25160J50197_1000041 3300003354 Bacteria 152843
42 JGI25160J50197_1002613 3300003354 Bacteria 8305
43 JGI25160J50197_1004984 3300003354 Bacteria 5632
44 JGI25160J50197_1017611 3300003354 Bacteria 2256
45 JGI25160J50197_1018216 3300003354 Bacteria 2195
46 JGI25161J50226_1000002 3300003374 Bacteria 420324
47 JGI25161J50226_1000143 3300003374 Bacteria 49711
48 JGI25161J50226_1000493 3300003374 Bacteria 17725
49 JGI25161J50226_1003550 3300003374 Bacteria 3526
50 Ga0006562J51391_1043415 3300003578 Bacteria 5210
51 Ga0055525_1022401 3300003759 Bacteria 538
52 Ga0055526_1003130 3300003771 Bacteria 10716
53 Ga0055526_1008527 3300003771 Bacteria 5093
54 Ga0055526_1017338 3300003771 Bacteria 2756
55 Ga0055526_1023017 3300003771 Bacteria 2094
56 Ga0055524_1000776 3300003775 Bacteria 21442
57 Ga0055524_1005585 3300003775 Bacteria 5587
58 Ga0055524_1009446 3300003775 Bacteria 3963
59 Ga0055524_1011959 3300003775 Bacteria 3358
60 Ga0055524_1025683 3300003775 Bacteria 1838
61 Ga0055524_1038858 3300003775 Bacteria 1238
62 Ga0055524_1070685 3300003775 Bacteria 674
63 Ga0055536_1010875 3300003781 Bacteria 3554
64 Ga0055536_1014772 3300003781 Bacteria 2715
65 Ga0055536_1017433 3300003781 Bacteria 2351
66 Ga0055536_1036409 3300003781 Bacteria 1217
67 Ga0055528_1002642 3300003790 Bacteria 9467
68 Ga0055528_1005397 3300003790 Bacteria 5961
69 Ga0055528_1015407 3300003790 Bacteria 2764
70 Ga0055528_1018451 3300003790 Bacteria 2364
71 Ga0055528_1021991 3300003790 Bacteria 2000
72 Ga0055528_1030289 3300003790 Bacteria 1440
73 Ga0055528_1061004 3300003790 Bacteria 713
74 Ga0055530_10006294 3300003791 Bacteria 5336
75 Ga0055530_10013218 3300003791 Bacteria 2827
76 Ga0055530_10017705 3300003791 Bacteria 2222
77 Ga0055530_10045901 3300003791 Bacteria 1040
78 Ga0055540_1000249 3300003792 Bacteria 49180
79 Ga0055540_1001900 3300003792 Bacteria 11701
80 Ga0055540_1013868 3300003792 Bacteria 2437
81 Ga0055540_1029082 3300003792 Bacteria 1297
82 Ga0055540_1054790 3300003792 Bacteria 812
83 Ga0055531_10002859 3300003794 Bacteria 11257
84 Ga0055531_10012244 3300003794 Bacteria 4052
85 Ga0055531_10018093 3300003794 Bacteria 2931
86 Ga0055531_10039030 3300003794 Bacteria 1416
87 Ga0055531_10051894 3300003794 Bacteria 1072
88 Ga0058692_1000651 3300003856 Bacteria 14332
89 Ga0058692_1013890 3300003856 Bacteria 1861
90 Ga0055543_1000008 3300004625 Bacteria 202062
91 Ga0055543_1000158 3300004625 Bacteria 56811
92 Ga0055543_1000263 3300004625 Bacteria 39326
93 Ga0065165_1000031 3300005262 Bacteria 216330
94 Ga0065165_1000041 3300005262 Bacteria 203876
95 Ga0065165_1000084 3300005262 Bacteria 154822
96 Ga0065165_1010587 3300005262 Bacteria 3960
97 Ga0065165_1034182 3300005262 Bacteria 1575
98 Ga0065165_1039619 3300005262 Bacteria 1410
99 Ga0065165_1055368 3300005262 Bacteria 1107
100 Ga0065165_1079876 3300005262 Bacteria 851
101 Ga0065704_10137683 3300005289 Bacteria 1552
102 Ga0065704_10665693 3300005289 Bacteria 576
103 Ga0070683_100552656 3300005329 Bacteria 1101
104 Ga0070670_100000160 3300005331 Bacteria 61135
105 Ga0070670_100133611 3300005331 Bacteria 2144
106 Ga0068869_101010912 3300005334 Bacteria 724
107 Ga0070666_10438029 3300005335 Bacteria 943
108 Ga0070682_101357988 3300005337 Bacteria 606
109 Ga0068868_101851282 3300005338 Bacteria 571
110 Ga0070661_100603418 3300005344 Bacteria 888
111 Ga0070661_100815188 3300005344 Bacteria 767
112 Ga0070661_100956661 3300005344 Bacteria 709
113 Ga0070668_100054086 3300005347 Bacteria 3096
114 Ga0070668_100405507 3300005347 Bacteria 1165
115 Ga0070668_100482492 3300005347 Bacteria 1071
116 Ga0070668_100808790 3300005347 Bacteria 833
117 Ga0070668_101342495 3300005347 Bacteria 651
118 Ga0070668_101784401 3300005347 Bacteria 566
119 Ga0070669_100024928 3300005353 Bacteria 4292
120 Ga0070669_100036001 3300005353 Bacteria 3586
121 Ga0070669_100180066 3300005353 Bacteria 1653
122 Ga0070669_100973327 3300005353 Bacteria 727
123 Ga0070675_100383261 3300005354 Bacteria 1252
124 Ga0070671_100013500 3300005355 Bacteria 6586
125 Ga0070671_100503752 3300005355 Bacteria 1042
126 Ga0070674_102121993 3300005356 Bacteria 513
127 Ga0070673_100876418 3300005364 Bacteria 832
128 Ga0070667_100784861 3300005367 Bacteria 884
129 Ga0070663_100170749 3300005455 Bacteria 1681
130 Ga0070678_100750252 3300005456 Bacteria 883
131 Ga0068867_101515586 3300005459 Bacteria 625
132 Ga0068853_100207758 3300005539 Bacteria 1784
133 Ga0070665_100005844 3300005548 Bacteria 12621
134 Ga0070665_100030475 3300005548 Bacteria 5427
135 Ga0070665_100032832 3300005548 Bacteria 5223
136 Ga0070665_100213012 3300005548 Bacteria 1933
137 Ga0070665_100328437 3300005548 Bacteria 1534
138 Ga0070665_101182587 3300005548 Bacteria 776
139 Ga0070665_101802296 3300005548 Bacteria 619
140 Ga0068855_100030372 3300005563 Bacteria 6464
141 Ga0068855_100317861 3300005563 Bacteria 1722
142 Ga0068855_101120624 3300005563 Bacteria 822
143 Ga0068857_101409713 3300005577 Bacteria 678
144 Ga0068854_100010614 3300005578 Bacteria 5977
145 Ga0068856_100101170 3300005614 Bacteria 2875
146 Ga0068856_101832887 3300005614 Bacteria 618
147 Ga0068852_100922705 3300005616 Bacteria 891
148 Ga0068852_101176693 3300005616 Bacteria 788
149 Ga0068864_100000240 3300005618 Bacteria 49024
150 Ga0068864_100001714 3300005618 Bacteria 18005
151 Ga0068864_100341215 3300005618 Bacteria 1412
152 Ga0068861_100397653 3300005719 Bacteria 1222
153 Ga0068851_10042342 3300005834 Bacteria 2292
154 Ga0068863_100001917 3300005841 Bacteria 20674
155 Ga0068863_100735081 3300005841 Bacteria 982
156 Ga0068863_101163610 3300005841 Bacteria 777
157 Ga0068858_100001006 3300005842 Bacteria 29047
158 Ga0068858_102240578 3300005842 Bacteria 540
159 Ga0068862_100226730 3300005844 Bacteria 1694
160 Ga0081540_1010783 3300005983 Bacteria 6144
161 Ga0075365_10006204 3300006038 Bacteria 6552
162 Ga0075365_10021238 3300006038 Bacteria 4046
163 Ga0075365_10334231 3300006038 Bacteria 1067
164 Ga0075365_10350076 3300006038 Bacteria 1041
165 Ga0075365_10725838 3300006038 Bacteria 702
166 Ga0075365_10981071 3300006038 Bacteria 595
167 Ga0075368_10010047 3300006042 Bacteria 3415
168 Ga0075368_10011301 3300006042 Bacteria 3245
169 Ga0075368_10236157 3300006042 Bacteria 779
170 Ga0075368_10307345 3300006042 Bacteria 685
171 Ga0075363_100049133 3300006048 Bacteria 2245
172 Ga0075363_100090371 3300006048 Bacteria 1684
173 Ga0075364_10001052 3300006051 Bacteria 14687
174 Ga0075364_10165349 3300006051 Bacteria 1495
175 Ga0075364_10334440 3300006051 Bacteria 1032
176 Ga0075364_10351014 3300006051 Bacteria 1005
177 Ga0075364_10575783 3300006051 Bacteria 769
178 Ga0070716_101022326 3300006173 Bacteria 655
179 Ga0075362_10004265 3300006177 Bacteria 5109
180 Ga0075367_10010146 3300006178 Bacteria 4939
181 Ga0075367_10028237 3300006178 Bacteria 3199
182 Ga0075367_10615790 3300006178 Bacteria 690
183 Ga0075369_10003814 3300006186 Bacteria 5526
184 Ga0075369_10021204 3300006186 Bacteria 2667
185 Ga0075369_10027411 3300006186 Bacteria 2382
186 Ga0075369_10031385 3300006186 Bacteria 2242
187 Ga0075366_10030453 3300006195 Bacteria 3172
188 Ga0075366_10046399 3300006195 Bacteria 2574
189 Ga0097621_100435565 3300006237 Bacteria 1179
190 Ga0097621_101121651 3300006237 Bacteria 739
191 Ga0075370_10035786 3300006353 Bacteria 2788
192 Ga0075370_10103761 3300006353 Bacteria 1647
193 Ga0075370_10104739 3300006353 Bacteria 1640
194 Ga0075370_10114996 3300006353 Bacteria 1564
195 Ga0075370_10123658 3300006353 Bacteria 1507
196 Ga0075370_10711266 3300006353 Bacteria 611
197 Ga0075370_10900826 3300006353 Bacteria 541
198 Ga0075370_10948807 3300006353 Bacteria 526
199 Ga0068871_101940169 3300006358 Bacteria 560
200 Ga0068865_100005107 3300006881 Bacteria 7943
201 Ga0068865_100566870 3300006881 Bacteria 956
202 Ga0079104_1000452 3300006946 Bacteria 46570
203 Ga0099826_10000109 3300006948 Bacteria 38139
204 Ga0099826_10007398 3300006948 Bacteria 8108
205 Ga0105250_10002929 3300009092 Bacteria 8331
206 Ga0105250_10034101 3300009092 Bacteria 2043
207 Ga0105250_10086700 3300009092 Bacteria 1271
208 Ga0105250_10180982 3300009092 Bacteria 884
209 Ga0105240_10000460 3300009093 Bacteria 74956
210 Ga0111539_13408799 3300009094 Bacteria 511
211 Ga0105247_10012709 3300009101 Bacteria 5052
212 Ga0105247_10353343 3300009101 Bacteria 1034
213 Ga0105247_10801600 3300009101 Bacteria 719
214 Ga0105243_10208802 3300009148 Bacteria 1718
215 Ga0105243_10493996 3300009148 Bacteria 1158
216 Ga0105243_11112475 3300009148 Bacteria 799
217 Ga0105243_11316340 3300009148 Bacteria 740
218 Ga0105243_12887611 3300009148 Bacteria 521
219 Ga0105241_10101290 3300009174 Bacteria 2290
220 Ga0105241_11722792 3300009174 Bacteria 609
221 Ga0105248_10000176 3300009177 Bacteria 74521
222 Ga0105248_10004022 3300009177 Bacteria 16257
223 Ga0105248_10005982 3300009177 Bacteria 13357
224 Ga0105248_10107777 3300009177 Bacteria 3141
225 Ga0105248_10107913 3300009177 Bacteria 3139
226 Ga0105248_10329291 3300009177 Bacteria 1720
227 Ga0105248_11815045 3300009177 Bacteria 692
228 Ga0105237_10000814 3300009545 Bacteria 42652
229 Ga0105237_10585591 3300009545 Bacteria 1123
230 Ga0105237_11236926 3300009545 Bacteria 753
231 Ga0105237_11463543 3300009545 Bacteria 690
232 Ga0105238_10027119 3300009551 Bacteria 5839
233 Ga0105238_10077631 3300009551 Bacteria 3312
234 Ga0105238_10264115 3300009551 Bacteria 1701
235 Ga0105238_10505742 3300009551 Bacteria 1209
236 Ga0105238_11397939 3300009551 Bacteria 727
237 Ga0105249_10586507 3300009553 Bacteria 1168
238 Ga0105249_11199832 3300009553 Bacteria 830
239 Ga0105249_13156344 3300009553 Bacteria 530
240 Ga0123340_1093941 3300009763 Bacteria 503
241 Ga0123341_1000040 3300009765 Bacteria 59249
242 Ga0123341_1073155 3300009765 Bacteria 1453
243 Ga0123342_1014285 3300009766 Bacteria 7630
244 Ga0123342_1039459 3300009766 Bacteria 1792
245 Ga0105030_113102 3300009987 Bacteria 723
246 Ga0105239_10000961 3300010375 Bacteria 40476
247 Ga0105239_10159048 3300010375 Bacteria 2523
248 Ga0105239_10193801 3300010375 Bacteria 2275
249 Ga0105239_10233349 3300010375 Bacteria 2064
250 Ga0105239_10371799 3300010375 Bacteria 1615
251 Ga0105239_10518869 3300010375 Bacteria 1355
252 Ga0105239_11549480 3300010375 Bacteria 766
253 Ga0105239_12639659 3300010375 Bacteria 586
254 Ga0105246_10353607 3300011119 Bacteria 1205
255 Ga0105246_10649120 3300011119 Bacteria 918
256 Ga0105246_11733790 3300011119 Bacteria 595
257 Ga0105246_11861212 3300011119 Bacteria 577
258 Ga0157313_1003595 3300012503 Bacteria 1013
259 Ga0157373_10003509 3300013100 Bacteria 11857
260 Ga0157373_10042843 3300013100 Bacteria 3234
261 Ga0157373_10290460 3300013100 Bacteria 1159
262 Ga0157371_10000004 3300013102 Bacteria 512593
263 Ga0157371_10003340 3300013102 Bacteria 14639
264 Ga0157371_10080735 3300013102 Bacteria 2303
265 Ga0157371_11243995 3300013102 Bacteria 575
266 Ga0157370_10000185 3300013104 Bacteria 78153
267 Ga0157370_10000952 3300013104 Bacteria 36741
268 Ga0157370_10018309 3300013104 Bacteria 7046
269 Ga0157370_10136553 3300013104 Bacteria 2285
270 Ga0157370_10448370 3300013104 Bacteria 1186
271 Ga0157369_10070646 3300013105 Bacteria 3750
272 Ga0157369_10238099 3300013105 Bacteria 1901
273 Ga0157369_10284397 3300013105 Bacteria 1722
274 Ga0157369_12316037 3300013105 Bacteria 544
275 Ga0171463_1001 3300013249 Bacteria 1406070
276 Ga0157378_11596515 3300013297 Bacteria 698
277 Ga0163162_10613725 3300013306 Bacteria 1213
278 Ga0163162_10995183 3300013306 Bacteria 948
279 Ga0157372_11291385 3300013307 Bacteria 842
280 Ga0157375_10981328 3300013308 Bacteria 985
281 Ga0157375_12263679 3300013308 Bacteria 648
282 Ga0163163_10219368 3300014325 Bacteria 1950
283 Ga0182008_10222477 3300014497 Bacteria 966
284 Ga0182008_10792027 3300014497 Bacteria 549
285 Ga0157379_10014475 3300014968 Bacteria 6923
286 Ga0157379_10022628 3300014968 Bacteria 5569
287 Ga0157379_10071276 3300014968 Bacteria 3109
288 Ga0157379_12163972 3300014968 Bacteria 552
289 Ga0182007_10009194 3300015262 Bacteria 4007
290 Ga0182007_10016853 3300015262 Bacteria 2684
291 Ga0183363_1032 3300015690 Bacteria 48614
292 Ga0163161_10302984 3300017792 Bacteria 1259
293 Ga0163161_10609878 3300017792 Bacteria 901
294 Ga0163161_11065777 3300017792 Bacteria 693
295 Ga0214544_1000012 3300021320 Bacteria 229808
296 Ga0214542_1000011 3300021321 Bacteria 238260
297 Ga0214542_1020695 3300021321 Bacteria 4752
298 Ga0214543_1000004 3300021327 Bacteria 527190
299 Ga0214543_1000259 3300021327 Bacteria 81880
300 Ga0213876_10009519 3300021384 Bacteria 5228
301 Ga0213876_10124471 3300021384 Bacteria 1369
302 Ga0228711_1000019 3300022739 Bacteria 111795
303 Ga0228710_1000022 3300022740 Bacteria 111795
304 Ga0209435_100011 3300025206 Bacteria 413027
305 Ga0209436_100006 3300025208 Bacteria 150277
306 Ga0209436_100461 3300025208 Bacteria 18099
307 Ga0209436_120174 3300025208 Bacteria 905
308 Ga0209672_106589 3300025228 Bacteria 1872
309 Ga0209563_107244 3300025230 Bacteria 1837
310 Ga0209437_100056 3300025233 Bacteria 363071
311 Ga0209437_100196 3300025233 Bacteria 121199
312 Ga0209437_123673 3300025233 Bacteria 703
313 Ga0207425_1000012 3300025245 Bacteria 528324
314 Ga0207425_1002334 3300025245 Bacteria 6782
315 Ga0207425_1011264 3300025245 Bacteria 2140
316 Ga0207425_1013527 3300025245 Bacteria 1883
317 Ga0207425_1019165 3300025245 Bacteria 1476
318 Ga0209646_1000024 3300025246 Bacteria 413027
319 Ga0209646_1013773 3300025246 Bacteria 1224
320 Ga0209026_1000030 3300025250 Bacteria 329811
321 Ga0209026_1009025 3300025250 Bacteria 2009
322 Ga0209026_1013997 3300025250 Bacteria 1351
323 Ga0209148_1012672 3300025254 Bacteria 1535
324 Ga0209759_1000011 3300025256 Bacteria 413027
325 Ga0209129_1000081 3300025258 Bacteria 183694
326 Ga0209129_1000105 3300025258 Bacteria 159104
327 Ga0209129_1001283 3300025258 Bacteria 14346
328 Ga0209129_1002860 3300025258 Bacteria 7973
329 Ga0209129_1004702 3300025258 Bacteria 5191
330 Ga0209129_1006056 3300025258 Bacteria 4046
331 Ga0209129_1006941 3300025258 Bacteria 3499
332 Ga0209129_1026787 3300025258 Bacteria 992
333 Ga0209233_1000037 3300025261 Bacteria 554620
334 Ga0209233_1000071 3300025261 Bacteria 363290
335 Ga0209233_1000243 3300025261 Bacteria 90170
336 Ga0209565_1021330 3300025263 Bacteria 1355
337 Ga0209455_1021228 3300025272 Bacteria 1265
338 Ga0209455_1032763 3300025272 Bacteria 860
339 Ga0209673_1000015 3300025273 Bacteria 530618
340 Ga0209673_1000709 3300025273 Bacteria 46936
341 Ga0209673_1002913 3300025273 Bacteria 10793
342 Ga0209673_1003355 3300025273 Bacteria 9554
343 Ga0209673_1003862 3300025273 Bacteria 8457
344 Ga0209673_1006637 3300025273 Bacteria 5529
345 Ga0209673_1017237 3300025273 Bacteria 2667
346 Ga0209673_1024310 3300025273 Bacteria 2039
347 Ga0209673_1071668 3300025273 Bacteria 822
348 Ga0209130_1000002 3300025284 Bacteria 722648
349 Ga0209130_1000005 3300025284 Bacteria 599620
350 Ga0209130_1000088 3300025284 Bacteria 152927
351 Ga0209130_1009773 3300025284 Bacteria 2700
352 Ga0209130_1018896 3300025284 Bacteria 1609
353 Ga0209130_1061378 3300025284 Bacteria 650
354 Ga0209675_1027511 3300025291 Bacteria 1397
355 Ga0209675_1057977 3300025291 Bacteria 774
356 Ga0209676_1004283 3300025292 Bacteria 8044
357 Ga0209676_1021813 3300025292 Bacteria 2138
358 Ga0209676_1023267 3300025292 Bacteria 2031
359 Ga0209025_1000024 3300025294 Bacteria 528324
360 Ga0209025_1000037 3300025294 Bacteria 383429
361 Ga0209025_1000060 3300025294 Bacteria 305017
362 Ga0209025_1000295 3300025294 Bacteria 111489
363 Ga0209025_1000574 3300025294 Bacteria 66723
364 Ga0209025_1006666 3300025294 Bacteria 8872
365 Ga0209025_1009433 3300025294 Bacteria 6798
366 Ga0209025_1013443 3300025294 Bacteria 5144
367 Ga0209025_1028633 3300025294 Bacteria 2721
368 Ga0209025_1057488 3300025294 Bacteria 1486
369 Ga0209564_1000093 3300025295 Bacteria 245793
370 Ga0209564_1000576 3300025295 Bacteria 58256
371 Ga0209564_1000744 3300025295 Bacteria 46190
372 Ga0209564_1003315 3300025295 Bacteria 11185
373 Ga0209564_1005971 3300025295 Bacteria 6737
374 Ga0209564_1006979 3300025295 Bacteria 5926
375 Ga0209564_1009085 3300025295 Bacteria 4786
376 Ga0209758_1000046 3300025297 Bacteria 364931
377 Ga0209758_1000441 3300025297 Bacteria 69800
378 Ga0209758_1000575 3300025297 Bacteria 57471
379 Ga0209758_1000810 3300025297 Bacteria 44076
380 Ga0209758_1000908 3300025297 Bacteria 40149
381 Ga0209758_1001120 3300025297 Bacteria 34521
382 Ga0209758_1001232 3300025297 Bacteria 32007
383 Ga0209758_1010784 3300025297 Bacteria 5411
384 Ga0209758_1013969 3300025297 Bacteria 4320
385 Ga0209758_1026693 3300025297 Bacteria 2490
386 Ga0209050_1000034 3300025298 Bacteria 433906
387 Ga0209050_1005438 3300025298 Bacteria 8002
388 Ga0209050_1009000 3300025298 Bacteria 5201
389 Ga0209050_1024927 3300025298 Bacteria 2052
390 Ga0209050_1077227 3300025298 Bacteria 720
391 Ga0209256_1000027 3300025299 Bacteria 423283
392 Ga0209256_1000646 3300025299 Bacteria 47375
393 Ga0209256_1003123 3300025299 Bacteria 12093
394 Ga0209256_1004576 3300025299 Bacteria 8570
395 Ga0209256_1005525 3300025299 Bacteria 7225
396 Ga0209256_1007741 3300025299 Bacteria 5201
397 Ga0209256_1014779 3300025299 Bacteria 2778
398 Ga0209256_1014852 3300025299 Bacteria 2766
399 Ga0207426_1000012 3300025302 Bacteria 730942
400 Ga0207426_1000013 3300025302 Bacteria 721897
401 Ga0207426_1000015 3300025302 Bacteria 599316
402 Ga0207426_1000063 3300025302 Bacteria 358920
403 Ga0207426_1000172 3300025302 Bacteria 163690
404 Ga0207426_1001042 3300025302 Bacteria 26389
405 Ga0209051_1000435 3300025303 Bacteria 56550
406 Ga0209051_1001495 3300025303 Bacteria 19567
407 Ga0209051_1002880 3300025303 Bacteria 11825
408 Ga0209051_1019893 3300025303 Bacteria 2914
409 Ga0209051_1036220 3300025303 Bacteria 1825
410 Ga0209051_1067311 3300025303 Bacteria 1095
411 Ga0209257_1000052 3300025304 Bacteria 430947
412 Ga0209257_1000100 3300025304 Bacteria 253399
413 Ga0209257_1000598 3300025304 Bacteria 59869
414 Ga0209257_1001343 3300025304 Bacteria 29827
415 Ga0209257_1012130 3300025304 Bacteria 4037
416 Ga0209257_1020887 3300025304 Bacteria 2400
417 Ga0209257_1023518 3300025304 Bacteria 2163
418 Ga0207656_10225010 3300025321 Bacteria 913
419 Ga0207656_10340142 3300025321 Bacteria 748
420 Ga0207696_1031812 3300025711 Bacteria 1593
421 Ga0207696_1032059 3300025711 Bacteria 1585
422 Ga0207696_1084825 3300025711 Bacteria 872
423 Ga0207713_1085596 3300025735 Bacteria 1122
424 Ga0207710_10020985 3300025900 Bacteria 2796
425 Ga0207680_10297600 3300025903 Bacteria 1124
426 Ga0207680_10401684 3300025903 Bacteria 968
427 Ga0207647_10175295 3300025904 Bacteria 1248
428 Ga0207643_10415325 3300025908 Bacteria 852
429 Ga0207705_11060769 3300025909 Bacteria 625
430 Ga0207654_10045441 3300025911 Bacteria 2499
431 Ga0207695_10000036 3300025913 Bacteria 477897
432 Ga0207671_10000517 3300025914 Bacteria 52359
433 Ga0207671_10745778 3300025914 Bacteria 778
434 Ga0207681_10049100 3300025923 Bacteria 2851
435 Ga0207681_10108503 3300025923 Bacteria 2015
436 Ga0207681_10873051 3300025923 Bacteria 753
437 Ga0207694_10133400 3300025924 Bacteria 1992
438 Ga0207694_10184930 3300025924 Bacteria 1691
439 Ga0207694_11217587 3300025924 Bacteria 637
440 Ga0207650_10000391 3300025925 Bacteria 40030
441 Ga0207650_11261671 3300025925 Bacteria 629
442 Ga0207644_10007043 3300025931 Bacteria 7323
443 Ga0207690_11048426 3300025932 Bacteria 679
444 Ga0207706_10382793 3300025933 Bacteria 1221
445 Ga0207706_10840126 3300025933 Bacteria 778
446 Ga0207709_10448230 3300025935 Bacteria 997
447 Ga0207709_10487815 3300025935 Bacteria 959
448 Ga0207669_10139013 3300025937 Bacteria 1683
449 Ga0207704_10016615 3300025938 Bacteria 3788
450 Ga0207704_11388388 3300025938 Bacteria 602
451 Ga0207711_10000088 3300025941 Bacteria 98086
452 Ga0207711_10006678 3300025941 Bacteria 9711
453 Ga0207711_10050074 3300025941 Bacteria 3576
454 Ga0207711_10065919 3300025941 Bacteria 3131
455 Ga0207711_10300230 3300025941 Bacteria 1481
456 Ga0207711_10368907 3300025941 Bacteria 1331
457 Ga0207711_11229739 3300025941 Bacteria 691
458 Ga0207689_10022429 3300025942 Bacteria 5309
459 Ga0207689_10837715 3300025942 Bacteria 776
460 Ga0207689_10974135 3300025942 Bacteria 716
461 Ga0207661_10228577 3300025944 Bacteria 1647
462 Ga0207679_11535789 3300025945 Bacteria 610
463 Ga0207667_10106886 3300025949 Bacteria 2887
464 Ga0207667_10267492 3300025949 Bacteria 1748
465 Ga0207668_10549373 3300025972 Bacteria 1000
466 Ga0207668_10655134 3300025972 Bacteria 919
467 Ga0207668_10764367 3300025972 Bacteria 853
468 Ga0207668_11641758 3300025972 Bacteria 580
469 Ga0207640_10009208 3300025981 Bacteria 5521
470 Ga0207658_10106810 3300025986 Bacteria 2205
471 Ga0207677_10553827 3300026023 Bacteria 1003
472 Ga0207703_10000049 3300026035 Bacteria 149817
473 Ga0207703_10000065 3300026035 Bacteria 126087
474 Ga0207639_10083560 3300026041 Bacteria 2534
475 Ga0207678_11541227 3300026067 Bacteria 586
476 Ga0207702_10009604 3300026078 Bacteria 8121
477 Ga0207702_10630023 3300026078 Bacteria 1054
478 Ga0207702_10957383 3300026078 Bacteria 849
479 Ga0207702_11873570 3300026078 Bacteria 591
480 Ga0207641_10000011 3300026088 Bacteria 384362
481 Ga0207641_10570758 3300026088 Bacteria 1105
482 Ga0207641_11137079 3300026088 Bacteria 780
483 Ga0207676_10000117 3300026095 Bacteria 69834
484 Ga0207676_10000450 3300026095 Bacteria 34793
485 Ga0207676_11980020 3300026095 Bacteria 581
486 Ga0207683_10283332 3300026121 Bacteria 1514
487 Ga0207683_10666579 3300026121 Bacteria 964
488 Ga0207683_11650880 3300026121 Bacteria 590
489 Ga0207698_10216991 3300026142 Bacteria 1726
490 Ga0207698_11180582 3300026142 Bacteria 779
491 Ga0207698_12012934 3300026142 Bacteria 592
492 Ga0209281_1000200 3300027111 Bacteria 135685
493 Ga0209281_1000227 3300027111 Bacteria 119329
494 Ga0209281_1000488 3300027111 Bacteria 54963
495 Ga0209371_1000009 3300027312 Bacteria 963030
496 Ga0209371_1000315 3300027312 Bacteria 53030
497 Ga0209371_1000424 3300027312 Bacteria 43444
498 Ga0209371_1001877 3300027312 Bacteria 12897
499 Ga0209371_1051918 3300027312 Bacteria 783
500 Ga0209282_1000042 3300027666 Bacteria 119329
501 Ga0209282_1002131 3300027666 Bacteria 11280
502 Ga0209282_1067761 3300027666 Bacteria 1958
503 Ga0209813_10006309 3300027866 Bacteria 2924
504 Ga0268266_10017078 3300028379 Bacteria 6197
505 Ga0268266_10023603 3300028379 Bacteria 5236
506 Ga0268266_10026656 3300028379 Bacteria 4917
507 Ga0268266_10645466 3300028379 Bacteria 1018
508 Ga0268266_10950213 3300028379 Bacteria 831
509 Ga0268266_12339963 3300028379 Bacteria 505
510 Ga0265337_1031981 3300028556 Bacteria 1559
511 Ga0307517_10011375 3300028786 Bacteria 12334
512 Ga0307517_10023634 3300028786 Bacteria 7629
513 Ga0307517_10076425 3300028786 Bacteria 2924
514 Ga0307515_10000121 3300028794 Bacteria 188657
515 Ga0307515_10001309 3300028794 Bacteria 56564
516 Ga0307515_10001439 3300028794 Bacteria 53690
517 Ga0307515_10123486 3300028794 Bacteria 2912
518 Ga0307515_10138941 3300028794 Bacteria 2619
519 Ga0265338_10053113 3300028800 Bacteria 3629
520 Ga0265338_10073745 3300028800 Bacteria 2907
521 Ga0265338_10587579 3300028800 Bacteria 777
522 Ga0268256_1000010 3300030500 Bacteria 963034
523 Ga0268256_1001516 3300030500 Bacteria 13723
524 Ga0268256_1003952 3300030500 Bacteria 6393
525 Ga0268256_1057698 3300030500 Bacteria 790
526 Ga0307511_10031341 3300030521 Bacteria 4752
527 Ga0316183_1129785 3300030742 Bacteria 1363
528 Ga0316181_1057884 3300030744 Bacteria 1829
529 Ga0265328_10000269 3300031239 Bacteria 24054
530 Ga0265328_10005153 3300031239 Bacteria 5621
531 Ga0265328_10013865 3300031239 Bacteria 3181
532 Ga0265328_10028534 3300031239 Bacteria 2087
533 Ga0265320_10105686 3300031240 Bacteria 1294
534 Ga0265340_10092943 3300031247 Bacteria 1408
535 Ga0265331_10000017 3300031250 Bacteria 269978
536 Ga0265331_10052588 3300031250 Bacteria 1945
537 Ga0265327_10003050 3300031251 Bacteria 16579
538 Ga0265327_10051465 3300031251 Bacteria 2150
539 Ga0307513_10002360 3300031456 Bacteria 26237
540 Ga0307513_10009529 3300031456 Bacteria 12280
541 Ga0307513_10013648 3300031456 Bacteria 9964
542 Ga0307513_10617623 3300031456 Bacteria 792
543 Ga0307408_102483871 3300031548 Bacteria 504
544 Ga0307508_10132253 3300031616 Bacteria 2099
545 Ga0307508_10331662 3300031616 Bacteria 1113
546 Ga0307514_10392924 3300031649 Bacteria 713
547 Ga0307516_10040422 3300031730 Bacteria 4643
548 Ga0307516_10094347 3300031730 Bacteria 2817
549 Ga0307405_10002866 3300031731 Bacteria 7749
550 Ga0307405_10080836 3300031731 Bacteria 2123
551 Ga0307405_10183326 3300031731 Bacteria 1505
552 Ga0307413_10066432 3300031824 Bacteria 2250
553 Ga0307413_10502494 3300031824 Bacteria 974
554 Ga0307413_10550779 3300031824 Bacteria 936
555 Ga0307413_10836493 3300031824 Bacteria 776
556 Ga0307413_11662035 3300031824 Bacteria 569
557 Ga0307410_11309745 3300031852 Bacteria 634
558 Ga0307406_10004188 3300031901 Bacteria 7848
559 Ga0307406_10105837 3300031901 Bacteria 1926
560 Ga0307406_10445064 3300031901 Bacteria 1038
561 Ga0307406_11251775 3300031901 Bacteria 646
562 Ga0307406_11486929 3300031901 Bacteria 596
563 Ga0307412_10156165 3300031911 Bacteria 1689
564 Ga0307412_10208968 3300031911 Bacteria 1488
565 Ga0307412_11295844 3300031911 Bacteria 656
566 Ga0315914_1000009 3300031967 Bacteria 182444
567 Ga0307409_101484028 3300031995 Bacteria 705
568 Ga0307409_101748957 3300031995 Bacteria 651
569 Ga0307416_100575107 3300032002 Bacteria 1203
570 Ga0307416_102347334 3300032002 Bacteria 633
571 Ga0307416_103177913 3300032002 Bacteria 550
572 Ga0307414_10085311 3300032004 Bacteria 2326
573 Ga0307414_10199377 3300032004 Bacteria 1626
574 Ga0307414_10300885 3300032004 Bacteria 1357
575 Ga0307414_10354377 3300032004 Bacteria 1260
576 Ga0307414_10372094 3300032004 Bacteria 1232
577 Ga0307414_10430671 3300032004 Bacteria 1152
578 Ga0307414_10438627 3300032004 Bacteria 1142
579 Ga0307414_10665692 3300032004 Bacteria 939
580 Ga0307414_10733037 3300032004 Bacteria 897
581 Ga0307414_10980290 3300032004 Bacteria 777
582 Ga0307414_11018868 3300032004 Bacteria 762
583 Ga0307411_10074830 3300032005 Bacteria 2310
584 Ga0307411_10195726 3300032005 Bacteria 1548
585 Ga0307415_101778897 3300032126 Bacteria 596
586 Ga0307510_10069446 3300033180 Bacteria 3528
587 Ga0315913_1000015 3300033430 Bacteria 119325
588 Ga0315915_1000013 3300033464 Bacteria 182438
589 Ga0373936_0007277 3300035113 Bacteria 4164
590 Ga0373935_0023925 3300035692 Bacteria 3754
591 Ga0373927_0000086 3300035695 Bacteria 69853
592 Ga0373927_0847122 3300035695 Bacteria 604
593 Ga0373925_0049197 3300037068 Bacteria 3142
594 Ga0395899_0000115 3300037312 Bacteria 133287
595 Ga0395900_0000002 3300037418 Bacteria 671103
596 Ga0395900_0095061 3300037418 Bacteria 3062
597 Ga0395900_0245810 3300037418 Bacteria 1793
598 Ga0395900_0591565 3300037418 Bacteria 1051
599 Ga0395898_0334290 3300037466 Bacteria 1444
600 Ga0395898_0451169 3300037466 Bacteria 1225
601 Ga0395905_0000775 3300037471 Bacteria 42024
602 Ga0395905_0004148 3300037471 Bacteria 15152
603 Ga0395905_0004590 3300037471 Bacteria 14285
604 Ga0395905_0035866 3300037471 Bacteria 4657
605 Ga0395905_0278327 3300037471 Bacteria 1559
606 Ga0395905_0303914 3300037471 Bacteria 1483
607 Ga0395905_1174878 3300037471 Bacteria 671
608 Ga0395905_1632519 3300037471 Bacteria 550
609 Ga0436364_1135428 3300037853 Bacteria 718
610 Ga0395901_0000021 3300038443 Bacteria 307734
611 Ga0395901_0678106 3300038443 Bacteria 1031
612 Ga0395901_2121977 3300038443 Bacteria 507
613 Ga0400483_069742 3300039062 Bacteria 1084
614 Ga0436365_1337824 3300039437 Bacteria 2361
615 Ga0436365_1539869 3300039437 Bacteria 4655
616 Ga0436365_1813847 3300039437 Bacteria 4570
617 Ga0436361_0274223 3300039447 Bacteria 1326
618 Ga0439466_0066170 3300041411 Bacteria 1157
619 Ga0439465_0019332 3300041413 Bacteria 2129
620 Ga0439465_0241362 3300041413 Bacteria 666
621 Ga0451789_1120526 3300041443 Bacteria 1531
622 Ga0451793_0777568 3300041452 Bacteria 1132
623 Ga0451797_1370065 3300041453 Bacteria 682
624 Ga0451798_0546958 3300041458 Bacteria 619
625 Ga0451800_0889189 3300041459 Bacteria 1001
626 Ga0451833_0083929 3300041491 Bacteria 1068
627 Ga0451835_1175652 3300041492 Bacteria 536
628 Ga0451837_0020740 3300041494 Bacteria 1326
629 Ga0451837_1567163 3300041494 Bacteria 699
630 Ga0451839_0309708 3300041496 Bacteria 656
631 Ga0451839_0514090 3300041496 Bacteria 650
632 Ga0451839_1658776 3300041496 Bacteria 1605
633 Ga0451845_0065414 3300041501 Bacteria 968
634 Ga0451845_0572252 3300041501 Bacteria 560
635 Ga0451847_0008967 3300041503 Bacteria 1903
636 Ga0451849_0309163 3300041505 Bacteria 1500
637 Ga0451851_0018808 3300041507 Bacteria 1859
638 Ga0451843_0234753 3300041509 Bacteria 2032
639 Ga0451855_1877089 3300041511 Bacteria 591
640 Ga0439445_0134722 3300042004 Bacteria 714
641 Ga0439457_145475 3300042014 Bacteria 569
642 Ga0450902_050370 3300042137 Bacteria 714
643 Ga0450906_004335 3300042145 Bacteria 2976
644 Ga0439446_0144064 3300042156 Bacteria 780
645 Ga0439434_0200313 3300042435 Bacteria 673
646 Ga0450918_003239 3300042531 Bacteria 3036
647 Ga0450901_004681 3300042533 Bacteria 1412
648 Ga0451577_0447308 3300042876 Bacteria 1173
649 Ga0466966_0240813 3300044684 Bacteria 1091
650 Ga0453684_1155530 3300044712 Bacteria 815
651 Ga0466968_0154008 3300044735 Bacteria 1058
652 Ga0466968_0180512 3300044735 Bacteria 981
653 Ga0466970_0046618 3300044765 Bacteria 2309
654 Ga0466970_0104303 3300044765 Bacteria 1546
655 Ga0466957_1171350 3300044842 Bacteria 555
656 Ga0466959_0078806 3300045049 Bacteria 2376
657 Ga0495592_0159316 3300046454 Bacteria 1554
658 Ga0495590_0065412 3300046457 Bacteria 1273
659 Ga0495629_0041534 3300046459 Bacteria 3236
660 Ga0495629_0070621 3300046459 Bacteria 2436
661 Ga0495638_0000788 3300046460 Bacteria 33436
662 Ga0495638_0027611 3300046460 Bacteria 3672
663 Ga0495638_0306798 3300046460 Bacteria 853
664 Ga0495638_0514346 3300046460 Bacteria 601
665 Ga0495650_0037454 3300046471 Bacteria 2112
666 Ga0495585_0025868 3300046492 Bacteria 3357
667 Ga0495585_0104218 3300046492 Bacteria 1514
668 Ga0495585_0216711 3300046492 Bacteria 968
669 Ga0495585_0325579 3300046492 Bacteria 751
670 Ga0495594_0032228 3300046499 Bacteria 2844
671 Ga0495583_0046211 3300046506 Bacteria 2009
672 Ga0495583_0080675 3300046506 Bacteria 1414
673 Ga0495606_0002833 3300046507 Bacteria 19241
674 Ga0495606_0061197 3300046507 Bacteria 2409
675 Ga0495606_0088372 3300046507 Bacteria 1911
676 Ga0495606_0138560 3300046507 Bacteria 1439
677 Ga0495606_0518369 3300046507 Bacteria 599
678 Ga0495610_0070490 3300046512 Bacteria 1632
679 Ga0495610_0073033 3300046512 Bacteria 1595
680 Ga0495620_0073896 3300046515 Bacteria 1389
681 Ga0495620_0074969 3300046515 Bacteria 1377
682 Ga0495620_0114149 3300046515 Bacteria 1068
683 Ga0495631_0002313 3300046518 Bacteria 10860
684 Ga0495632_0061531 3300046519 Bacteria 1822
685 Ga0495637_0260066 3300046520 Bacteria 623
686 Ga0495643_0004997 3300046522 Bacteria 9092
687 Ga0495643_0071047 3300046522 Bacteria 1827
688 Ga0495643_0160402 3300046522 Bacteria 1107
689 Ga0495648_0039283 3300046524 Bacteria 3013
690 Ga0495654_0000321 3300046530 Bacteria 42082
691 Ga0495654_0097209 3300046530 Bacteria 1360
692 Ga0495665_0255845 3300046531 Bacteria 901
693 Ga0495598_0023253 3300046537 Bacteria 1667
694 Ga0495609_0069570 3300046538 Bacteria 1547
695 Ga0495609_0141709 3300046538 Bacteria 1026
696 Ga0495621_0057343 3300046539 Bacteria 1406
697 Ga0495597_0000813 3300046542 Bacteria 24618
698 Ga0495597_0003637 3300046542 Bacteria 8859
699 Ga0495597_0051736 3300046542 Bacteria 1810
700 Ga0495597_0285478 3300046542 Bacteria 642
701 Ga0495622_0000963 3300046557 Bacteria 15444
702 Ga0495622_0002438 3300046557 Bacteria 9028
703 Ga0495622_0077239 3300046557 Bacteria 1534
704 Ga0495622_0082184 3300046557 Bacteria 1482
705 Ga0495633_0031134 3300046558 Bacteria 2589
706 Ga0495633_0046685 3300046558 Bacteria 2048
707 Ga0495668_0013397 3300046616 Bacteria 4837
708 Ga0495668_0019313 3300046616 Bacteria 3930
709 Ga0495668_0027993 3300046616 Bacteria 3190
710 Ga0495668_0029393 3300046616 Bacteria 3105
711 Ga0495668_0080284 3300046616 Bacteria 1790
712 Ga0495668_0197925 3300046616 Bacteria 1100
713 Ga0495668_0578228 3300046616 Bacteria 620
714 Ga0495625_0005054 3300046660 Bacteria 12222
715 Ga0495625_0014276 3300046660 Bacteria 6348
716 Ga0495625_0165101 3300046660 Bacteria 1481
717 Ga0495625_0624856 3300046660 Bacteria 644
718 Ga0495625_0753889 3300046660 Bacteria 570
719 Ga0495659_0487479 3300046664 Bacteria 539
720 Ga0495588_0000622 3300046674 Bacteria 16604
721 Ga0495657_0067955 3300046675 Bacteria 2337
722 Ga0495657_0723614 3300046675 Bacteria 571
723 Ga0495669_0005381 3300046684 Bacteria 5339
724 Ga0495669_0015869 3300046684 Bacteria 3225
725 Ga0495613_1014607 3300046689 Bacteria 532
726 Ga0495671_0639191 3300046692 Bacteria 506
727 Ga0495649_0000195 3300046694 Bacteria 53545
728 Ga0495649_0081906 3300046694 Bacteria 1725
729 Ga0495600_0181205 3300046809 Bacteria 1357
730 Ga0495604_0061667 3300047317 Bacteria 2867
731 Ga0495636_0066855 3300047318 Bacteria 1529
732 Ga0495636_0301946 3300047318 Bacteria 749
733 Ga0495687_021303 3300047443 Bacteria 3140
734 Ga0495687_024306 3300047443 Bacteria 2881
735 Ga0495685_100673 3300047447 Bacteria 954
736 Ga0495673_0264146 3300047469 Bacteria 625
737 Ga0495681_0002829 3300047470 Bacteria 12267
738 Ga0495686_0003381 3300047472 Bacteria 13890
739 Ga0495686_0005379 3300047472 Bacteria 10121
740 Ga0495686_0321681 3300047472 Bacteria 848
741 Ga0495593_0021279 3300047673 Bacteria 3625
742 Ga0495593_0037463 3300047673 Bacteria 2623
743 Ga0495602_0163275 3300048088 Bacteria 1737
744 Ga0495602_0196282 3300048088 Bacteria 1543
745 Ga0495602_0258471 3300048088 Bacteria 1293
746 Ga0495615_0010927 3300048090 Bacteria 1831
747 Ga0496100_0587636 3300048903 Bacteria 864
748 Ga0496101_0439660 3300048904 Bacteria 1029
749 Ga0496102_0056832 3300048905 Bacteria 3571
750 Ga0496102_0236282 3300048905 Bacteria 1723
751 Ga0496103_0075274 3300048906 Bacteria 2117
752 Ga0496106_0171404 3300048909 Bacteria 1720
753 Ga0496106_0771941 3300048909 Bacteria 763
754 Ga0496107_0188739 3300048910 Bacteria 1531
755 Ga0496107_1144043 3300048910 Bacteria 561
756 Ga0496110_0969953 3300048913 Bacteria 757
757 Ga0496111_0120191 3300048914 Bacteria 1941
758 Ga0496112_0111656 3300048915 Bacteria 2703
759 Ga0496112_0747249 3300048915 Bacteria 904
760 Ga0496113_0075732 3300048916 Bacteria 2569
761 Ga0496114_0869795 3300048917 Bacteria 782
762 Ga0496115_0239664 3300048918 Bacteria 1495
763 Ga0496116_0000100 3300048919 Bacteria 194740
764 Ga0496116_0032053 3300048919 Bacteria 3752
765 Ga0496116_0045758 3300048919 Bacteria 2959
766 Ga0496116_0051218 3300048919 Bacteria 2744
767 Ga0496116_0091248 3300048919 Bacteria 1851
768 Ga0496117_0000002 3300048920 Bacteria 2483758
769 Ga0496117_0001791 3300048920 Bacteria 29241
770 Ga0496117_0012903 3300048920 Bacteria 7324
771 Ga0496117_0032290 3300048920 Bacteria 3980
772 Ga0496117_0038183 3300048920 Bacteria 3566
773 Ga0496117_0043996 3300048920 Bacteria 3238
774 Ga0496118_0001493 3300048921 Bacteria 34920
775 Ga0496118_0005547 3300048921 Bacteria 14306
776 Ga0496118_0012623 3300048921 Bacteria 8083
777 Ga0496118_0013675 3300048921 Bacteria 7658
778 Ga0496118_0140606 3300048921 Bacteria 1531
779 Ga0496118_0141853 3300048921 Bacteria 1521
780 Ga0496118_0512401 3300048921 Bacteria 594
781 Ga0496119_0021013 3300048922 Bacteria 4733
782 Ga0496119_0118962 3300048922 Bacteria 1455
783 Ga0496119_0143714 3300048922 Bacteria 1285
784 Ga0496119_0214447 3300048922 Bacteria 988
785 Ga0496120_0000021 3300048923 Bacteria 250966
786 Ga0496120_0063299 3300048923 Bacteria 2058
787 Ga0496120_0231359 3300048923 Bacteria 878
788 Ga0496121_0000001 3300048924 Bacteria 1830318
789 Ga0496121_0000035 3300048924 Bacteria 374316
790 Ga0496121_0002141 3300048924 Bacteria 31012
791 Ga0496121_0022266 3300048924 Bacteria 6162
792 Ga0496121_0032085 3300048924 Bacteria 4782
793 Ga0496121_0042559 3300048924 Bacteria 3947
794 Ga0496121_0167883 3300048924 Bacteria 1597
795 Ga0496121_0262893 3300048924 Bacteria 1190
796 Ga0496122_0000001 3300048925 Bacteria 1827766
797 Ga0496122_0000147 3300048925 Bacteria 165589
798 Ga0496122_0001112 3300048925 Bacteria 46455
799 Ga0496122_0004207 3300048925 Bacteria 18095
800 Ga0496122_0008413 3300048925 Bacteria 11146
801 Ga0496122_0013026 3300048925 Bacteria 8191
802 Ga0496122_0015681 3300048925 Bacteria 7226
803 Ga0496122_0024484 3300048925 Bacteria 5281
804 Ga0496122_0047821 3300048925 Bacteria 3297
805 Ga0496122_0071060 3300048925 Bacteria 2482
806 Ga0496122_0262025 3300048925 Bacteria 958
807 Ga0496122_0439888 3300048925 Bacteria 650
808 Ga0496123_0000001 3300048926 Bacteria 1831497
809 Ga0496123_0000158 3300048926 Bacteria 136078
810 Ga0496123_0000910 3300048926 Bacteria 46499
811 Ga0496123_0002037 3300048926 Bacteria 26111
812 Ga0496123_0022317 3300048926 Bacteria 4882
813 Ga0496123_0042793 3300048926 Bacteria 3120
814 Ga0496123_0049038 3300048926 Bacteria 2835
815 Ga0496124_0000063 3300048927 Bacteria 229705
816 Ga0496124_0000551 3300048927 Bacteria 63371
817 Ga0496124_0007381 3300048927 Bacteria 11691
818 Ga0496124_0012187 3300048927 Bacteria 8508
819 Ga0496124_0018460 3300048927 Bacteria 6531
820 Ga0496124_0025998 3300048927 Bacteria 5287
821 Ga0496124_0062995 3300048927 Bacteria 3100
822 Ga0496124_0064963 3300048927 Bacteria 3044
823 Ga0496124_0117870 3300048927 Bacteria 2126
824 Ga0496124_0150110 3300048927 Bacteria 1829
825 Ga0496124_0276703 3300048927 Bacteria 1226
826 Ga0496124_0444722 3300048927 Bacteria 886
827 Ga0496125_0000001 3300048928 Bacteria 1766138
828 Ga0496125_0000981 3300048928 Bacteria 44598
829 Ga0496125_0002858 3300048928 Bacteria 21733
830 Ga0496125_0013065 3300048928 Bacteria 8189
831 Ga0496125_0115672 3300048928 Bacteria 1928
832 Ga0496125_0167406 3300048928 Bacteria 1483
833 Ga0496125_0198605 3300048928 Bacteria 1316
834 Ga0496125_0444468 3300048928 Bacteria 744
835 Ga0496126_0000094 3300048929 Bacteria 208184
836 Ga0496126_0000195 3300048929 Bacteria 135582
837 Ga0496126_0047799 3300048929 Bacteria 3915
838 Ga0496126_0293240 3300048929 Bacteria 1344
839 Ga0496126_0299066 3300048929 Bacteria 1328
840 Ga0496126_0353391 3300048929 Bacteria 1201
841 Ga0496126_0785835 3300048929 Bacteria 732
842 Ga0495678_156762 3300049459 Bacteria 731
843 Ga0495682_0199132 3300049460 Bacteria 710
844 Ga0501032_0042531 3300049569 Bacteria 3081
845 Ga0501032_0919352 3300049569 Bacteria 551
846 Ga0501033_0015006 3300049570 Bacteria 5880
847 Ga0501033_0891422 3300049570 Bacteria 598
848 Ga0501034_0079252 3300049571 Bacteria 3288
849 Ga0501034_0155393 3300049571 Bacteria 2262
850 Ga0501037_0021934 3300049573 Bacteria 4727
851 Ga0501039_0041848 3300049575 Bacteria 3540
852 Ga0501043_0045856 3300049579 Bacteria 3436
853 Ga0501043_0525262 3300049579 Bacteria 882
854 Ga0501043_0579837 3300049579 Bacteria 830
855 Ga0501046_0000010 3300049580 Bacteria 331082
856 Ga0501047_0798024 3300049581 Bacteria 759
857 Ga0501068_0542544 3300049584 Bacteria 756
858 Ga0501217_201692 3300049661 Bacteria 620
859 Ga0501238_015989 3300049671 Bacteria 1037
860 Ga0501083_0023462 3300049744 Bacteria 4277
861 Ga0501280_009045 3300049776 Bacteria 1386
862 Ga0501282_018999 3300049778 Bacteria 752
863 Ga0501035_0157260 3300049822 Bacteria 1969
864 Ga0501035_0757760 3300049822 Bacteria 778
865 Ga0501035_1169967 3300049822 Bacteria 598
866 Ga0501044_0106113 3300049823 Bacteria 2821
867 Ga0501044_0741084 3300049823 Bacteria 865
868 Ga0501044_1631306 3300049823 Bacteria 510
869 Ga0501045_0235454 3300049824 Bacteria 1363
870 nmdc:mga03683_12461_c1 3300050489 Bacteria 3107
871 nmdc:mga03n38_29831_c1 3300050490 Bacteria 2287
872 nmdc:mga00v17_461028_c1 3300050491 Bacteria 825
873 nmdc:mga00v17_48_c1 3300050491 Bacteria 75606
874 nmdc:mga0k408_41790_c1 3300050493 Bacteria 2640
875 nmdc:mga06z11_151024_c1 3300050494 Bacteria 1321
876 nmdc:mga06z11_273385_c1 3300050494 Bacteria 999
877 nmdc:mga04h51_131851_c1 3300050495 Bacteria 941
878 nmdc:mga04h51_342866_c1 3300050495 Bacteria 616
879 nmdc:mga07m45_131410_c1 3300050496 Bacteria 1449
880 nmdc:mga07m45_76567_c1 3300050496 Bacteria 1907
881 nmdc:mga0sz30_287_c1 3300050516 Bacteria 19364
882 nmdc:mga0sz30_56625_c1 3300050516 Bacteria 1670
883 Ga0500635_0000049 3300053080 Bacteria 80019
884 Ga0500635_0000206 3300053080 Bacteria 29145
885 Ga0500635_0042545 3300053080 Bacteria 1524
886 Ga0495619_0221365 3300053085 Bacteria 1311
887 Ga0500578_0044347 3300053086 Bacteria 2855
888 Ga0500578_0119773 3300053086 Bacteria 1655
889 Ga0500644_0005368 3300053088 Bacteria 3235
890 Ga0500644_0262693 3300053088 Bacteria 731
891 Ga0500646_0030215 3300053090 Bacteria 1486
892 Ga0500583_0003643 3300053092 Bacteria 4889
893 Ga0500583_0018503 3300053092 Bacteria 2834
894 Ga0500651_0014812 3300053093 Bacteria 4776
895 Ga0500651_0030892 3300053093 Bacteria 3372
896 Ga0500566_0004235 3300053094 Bacteria 8557
897 Ga0500566_0205087 3300053094 Bacteria 992
898 Ga0500640_233343 3300053095 Bacteria 608
899 Ga0500641_0209788 3300053096 Bacteria 829
900 Ga0500641_0293627 3300053096 Bacteria 670
901 Ga0500654_161509 3300053099 Bacteria 759
902 Ga0500555_000482 3300053103 Bacteria 16522
903 Ga0500556_0022858 3300053104 Bacteria 2035
904 Ga0500556_0088470 3300053104 Bacteria 1180
905 Ga0500556_0380734 3300053104 Bacteria 543
906 Ga0500569_017906 3300053109 Bacteria 1820
907 Ga0500569_028905 3300053109 Bacteria 1540
908 Ga0500572_031619 3300053111 Bacteria 1480
909 Ga0500595_001765 3300053119 Bacteria 11252
910 Ga0500595_008956 3300053119 Bacteria 4065
911 Ga0500595_106985 3300053119 Bacteria 798
912 Ga0500607_015699 3300053121 Bacteria 4357
913 Ga0500607_126759 3300053121 Bacteria 1225
914 Ga0500608_000264 3300053122 Bacteria 20418
915 Ga0500608_000299 3300053122 Bacteria 19175
916 Ga0500608_028919 3300053122 Bacteria 2618
917 Ga0500608_091203 3300053122 Bacteria 1424
918 Ga0500614_002102 3300053123 Bacteria 4546
919 Ga0500614_009181 3300053123 Bacteria 2107
920 Ga0500618_000119 3300053125 Bacteria 64330
921 Ga0500618_000340 3300053125 Bacteria 33633
922 Ga0500618_003445 3300053125 Bacteria 5409
923 Ga0500618_022665 3300053125 Bacteria 1524
924 Ga0500652_115619 3300053131 Bacteria 1121
925 Ga0500655_047411 3300053133 Bacteria 852
926 Ga0500658_0019740 3300053134 Bacteria 2539
927 Ga0500658_0026026 3300053134 Bacteria 2252
928 Ga0500658_0275878 3300053134 Bacteria 773
929 Ga0500559_0026207 3300053136 Bacteria 2482
930 Ga0500559_0039817 3300053136 Bacteria 2045
931 Ga0500561_0000213 3300053137 Bacteria 10547
932 Ga0500573_0111661 3300053140 Bacteria 1529
933 Ga0500573_0337804 3300053140 Bacteria 737
934 Ga0500573_0472620 3300053140 Bacteria 573
935 Ga0500590_013988 3300053148 Bacteria 4129
936 Ga0500603_039331 3300053150 Bacteria 1255
937 Ga0500604_0028145 3300053151 Bacteria 1631
938 Ga0500616_0002453 3300053153 Bacteria 15395
939 Ga0500616_0005613 3300053153 Bacteria 8473
940 Ga0500616_0014854 3300053153 Bacteria 4463
941 Ga0500616_0236487 3300053153 Bacteria 788
942 Ga0500619_000843 3300053154 Bacteria 5232
943 Ga0500619_054415 3300053154 Bacteria 1303
944 Ga0500620_058086 3300053155 Bacteria 1312
945 Ga0500622_0003939 3300053156 Bacteria 9593
946 Ga0500622_0005171 3300053156 Bacteria 7908
947 Ga0500624_010282 3300053157 Bacteria 1345
948 Ga0500624_041506 3300053157 Bacteria 828
949 Ga0500624_068052 3300053157 Bacteria 692
950 Ga0500627_0147335 3300053158 Bacteria 1063
951 Ga0500627_0321076 3300053158 Bacteria 673
952 Ga0500634_0018456 3300053161 Bacteria 3747
953 Ga0500634_0239472 3300053161 Bacteria 763
954 Ga0500638_065841 3300053162 Bacteria 1737
955 Ga0500639_159819 3300053163 Bacteria 1027
956 Ga0500636_0000006 3300053177 Bacteria 183899
957 Ga0500636_0004914 3300053177 Bacteria 7593
958 Ga0500636_0008065 3300053177 Bacteria 6098
959 Ga0500636_0037934 3300053177 Bacteria 2850
960 Ga0500636_0038056 3300053177 Bacteria 2846
961 Ga0500637_0019735 3300053178 Bacteria 3639
962 Ga0500637_0132372 3300053178 Bacteria 1445
963 Ga0500576_031215 3300053725 Bacteria 2419
964 Ga0500576_093741 3300053725 Bacteria 1241
965 Ga0500625_024463 3300053729 Bacteria 2853
966 Ga0500625_028102 3300053729 Bacteria 2668
967 Ga0500645_001281 3300053730 Bacteria 13136
968 Ga0500645_201735 3300053730 Bacteria 536
969 Ga0500596_000027 3300053735 Bacteria 19954
970 Ga0500596_006255 3300053735 Bacteria 2030
971 Ga0500601_021637 3300053737 Bacteria 743
972 Ga0590075_065736 3300059424 Bacteria 936
973 Ga0587067_037556 3300059640 Bacteria 926
974 Ga0587067_084806 3300059640 Bacteria 708
975 Ga0587067_135757 3300059640 Bacteria 605
976 Ga0587072_111208 3300059643 Bacteria 626
977 Ga0587076_057420 3300059645 Bacteria 776
978 Ga0587107_056323 3300059652 Bacteria 681

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046507 Ga0495606_0138560 Ga0495606_0138560_1095_1403 102
2 3300005334 Ga0068869_101010912 Ga0068869_1010109121 105
3 3300005353 Ga0070669_100036001 Ga0070669_1000360013 105
4 3300041492 Ga0451835_1175652 Ga0451835_1175652_11_328 105
5 3300041496 Ga0451839_0514090 Ga0451839_0514090_11_328 105
6 3300041496 Ga0451839_1658776 Ga0451839_1658776_11_328 105
7 3300041501 Ga0451845_0065414 Ga0451845_0065414_11_328 105
8 3300046507 Ga0495606_0002833 Ga0495606_0002833_10263_10580 105
9 3300046557 Ga0495622_0077239 Ga0495622_0077239_29_346 105
10 3300048913 Ga0496110_0969953 Ga0496110_0969953_183_500 105
11 3300048916 Ga0496113_0075732 Ga0496113_0075732_788_1105 105
12 3300048920 Ga0496117_0000002 Ga0496117_0000002_2051314_2051631 105
13 3300048921 Ga0496118_0001493 Ga0496118_0001493_19477_19794 105
14 3300048922 Ga0496119_0143714 Ga0496119_0143714_453_770 105
15 3300048923 Ga0496120_0000021 Ga0496120_0000021_14944_15261 105
16 3300048924 Ga0496121_0042559 Ga0496121_0042559_2420_2737 105
17 3300048925 Ga0496122_0000001 Ga0496122_0000001_1422104_1422421 105
18 3300048926 Ga0496123_0000001 Ga0496123_0000001_1425835_1426152 105
19 3300048928 Ga0496125_0444468 Ga0496125_0444468_28_345 105
20 3300050490 nmdc:mga03n38_29831_c1 nmdc:mga03n38_29831_c1_156_473 105
21 3300050491 nmdc:mga00v17_48_c1 nmdc:mga00v17_48_c1_22821_23138 105
22 3300050493 nmdc:mga0k408_41790_c1 nmdc:mga0k408_41790_c1_1260_1577 105
23 3300050494 nmdc:mga06z11_151024_c1 nmdc:mga06z11_151024_c1_695_1012 105
24 3300050496 nmdc:mga07m45_131410_c1 nmdc:mga07m45_131410_c1_69_386 105
25 3300050516 nmdc:mga0sz30_287_c1 nmdc:mga0sz30_287_c1_12919_13236 105
26 3300041453 Ga0451797_1370065 Ga0451797_1370065_137_460 107
27 3300045049 Ga0466959_0078806 Ga0466959_0078806_646_1005 107
28 3300037418 Ga0395900_0591565 Ga0395900_0591565_416_742 108
29 3300037471 Ga0395905_0303914 Ga0395905_0303914_142_468 108
30 3300037853 Ga0436364_1135428 Ga0436364_1135428_213_539 108
31 3300041494 Ga0451837_1567163 Ga0451837_1567163_17_343 108
32 3300042156 Ga0439446_0144064 Ga0439446_0144064_438_764 108
33 3300042435 Ga0439434_0200313 Ga0439434_0200313_285_611 108
34 3300044735 Ga0466968_0180512 Ga0466968_0180512_583_909 108
35 3300044842 Ga0466957_1171350 Ga0466957_1171350_24_350 108
36 3300047318 Ga0495636_0066855 Ga0495636_0066855_150_476 108
37 3300048905 Ga0496102_0236282 Ga0496102_0236282_20_346 108
38 3300048910 Ga0496107_1144043 Ga0496107_1144043_13_339 108
39 3300049569 Ga0501032_0919352 Ga0501032_0919352_101_427 108
40 3300049571 Ga0501034_0155393 Ga0501034_0155393_1164_1490 108
41 3300049579 Ga0501043_0525262 Ga0501043_0525262_103_429 108
42 3300049822 Ga0501035_0757760 Ga0501035_0757760_252_578 108
43 3300049822 Ga0501035_1169967 Ga0501035_1169967_250_576 108
44 3300050494 nmdc:mga06z11_273385_c1 nmdc:mga06z11_273385_c1_530_856 108
45 3300053080 Ga0500635_0042545 Ga0500635_0042545_1017_1349 108
46 3300053122 Ga0500608_091203 Ga0500608_091203_864_1196 108
47 3300053134 Ga0500658_0275878 Ga0500658_0275878_437_763 108
48 3300031240 Ga0265320_10105686 Ga0265320_101056862 109
49 3300031824 Ga0307413_10836493 Ga0307413_108364932 109
50 3300032004 Ga0307414_10199377 Ga0307414_101993772 109
51 3300032004 Ga0307414_10372094 Ga0307414_103720943 109
52 3300032004 Ga0307414_10980290 Ga0307414_109802901 109
53 3300032004 Ga0307414_10300885 Ga0307414_103008853 110
54 3300032004 Ga0307414_10430671 Ga0307414_104306712 110
55 3300037471 Ga0395905_1632519 Ga0395905_1632519_138_503 110
56 3300053140 Ga0500573_0111661 Ga0500573_0111661_218_583 110
57 3300032004 Ga0307414_10354377 Ga0307414_103543773 111
58 3300046460 Ga0495638_0306798 Ga0495638_0306798_253_618 111
59 3300046694 Ga0495649_0000195 Ga0495649_0000195_29509_29874 111
60 3300010375 Ga0105239_12639659 Ga0105239_126396592 113
61 3300032004 Ga0307414_10665692 Ga0307414_106656923 115
62 3300013102 Ga0157371_10080735 Ga0157371_100807352 116
63 3300013105 Ga0157369_10284397 Ga0157369_102843973 116
64 3300031730 Ga0307516_10040422 Ga0307516_100404223 116
65 3300048914 Ga0496111_0120191 Ga0496111_0120191_762_1127 116
66 iso_pu_bacteria 2894817345 2894819673 116
67 iso_pu_bacteria 2894817345 2894821925 116
68 3300044712 Ga0453684_1155530 Ga0453684_1155530_374_733 117
69 iso_pu_bacteria 2508501122 2509106962 117
70 iso_pu_bacteria 2509276019 2509375082 117
71 iso_pu_bacteria 2509276021 2509388520 117
72 iso_pu_bacteria 2509276033 2509444070 117
73 iso_pu_bacteria 2510065019 2510131333 117
74 iso_pu_bacteria 2510065057 2510303572 117
75 iso_pu_bacteria 2510461069 2510841135 117
76 iso_pu_bacteria 2510461076 2510897687 117
77 iso_pu_bacteria 2510917022 2511134790 117
78 iso_pu_bacteria 2510917026 2511169057 117
79 iso_pu_bacteria 2510917028 2511184708 117
80 iso_pu_bacteria 2510917030 2511197623 117
81 iso_pu_bacteria 2511231052 2511500444 117
82 iso_pu_bacteria 2512047086 2512531904 117
83 iso_pu_bacteria 2512875026 2512972766 117
84 iso_pu_bacteria 2513237084 2513570551 117
85 iso_pu_bacteria 2513237085 2513580296 117
86 iso_pu_bacteria 2513237086 2513585420 117
87 iso_pu_bacteria 2513237088 2513596653 117
88 iso_pu_bacteria 2513237089 2513602845 117
89 iso_pu_bacteria 2513237091 2513616669 117
90 iso_pu_bacteria 2513237093 2513634170 117
91 iso_pu_bacteria 2513237103 2513707042 117
92 iso_pu_bacteria 2513237138 2513864934 117
93 iso_pu_bacteria 2513237140 2513885642 117
94 iso_pu_bacteria 2513237143 2513904007 117
95 iso_pu_bacteria 2513237144 2513910272 117
96 iso_pu_bacteria 2513237146 2513929782 117
97 iso_pu_bacteria 2513237156 2513986195 117
98 iso_pu_bacteria 2513237159 2513996684 117
99 iso_pu_bacteria 2513237160 2514005097 117
100 iso_pu_bacteria 2513237162 2514020327 117
101 iso_pu_bacteria 2515075009 2515110286 117
102 iso_pu_bacteria 2515154113 2515634494 117
103 iso_pu_bacteria 2515154114 2515643719 117
104 iso_pu_bacteria 2515154116 2515657117 117
105 iso_pu_bacteria 2515154134 2515743383 117
106 iso_pu_bacteria 2516143018 2516204417 117
107 iso_pu_bacteria 2516653046 2516891777 117
108 iso_pu_bacteria 2516653077 2517038971 117
109 iso_pu_bacteria 2516653085 2517079237 117
110 iso_pu_bacteria 2517093000 2517093165 117
111 iso_pu_bacteria 2517287029 2517409435 117
112 iso_pu_bacteria 2517487022 2517568575 117
113 iso_pu_bacteria 2524023207 2524450609 117
114 iso_pu_bacteria 2524023209 2524458280 117
115 iso_pu_bacteria 2529292951 2530647902 117
116 iso_pu_bacteria 2534681796 2535515015 117
117 iso_pu_bacteria 2537561587 2537876004 117
118 iso_pu_bacteria 2551306084 2551677066 117
119 iso_pu_bacteria 2551306085 2551684032 117
120 iso_pu_bacteria 2551306086 2551696050 117
121 iso_pu_bacteria 2551306087 2551704003 117
122 iso_pu_bacteria 2551306089 2551710311 117
123 iso_pu_bacteria 2551306090 2551721073 117
124 iso_pu_bacteria 2551306091 2551725589 117
125 iso_pu_bacteria 2551306092 2551734948 117
126 iso_pu_bacteria 2551306093 2551743803 117
127 iso_pu_bacteria 2554235003 2554246548 117
128 iso_pu_bacteria 2558860100 2558866186 117
129 iso_pu_bacteria 2558860242 2559293723 117
130 iso_pu_bacteria 2558860983 2561467010 117
131 iso_pu_bacteria 2582581283 2585164918 117
132 iso_pu_bacteria 2582581294 2585203592 117
133 iso_pu_bacteria 2582581298 2585223680 117
134 iso_pu_bacteria 2582581299 2585229738 117
135 iso_pu_bacteria 2582581304 2585255996 117
136 iso_pu_bacteria 2582581306 2585265294 117
137 iso_pu_bacteria 2582581307 2585273856 117
138 iso_pu_bacteria 2582581308 2585280157 117
139 iso_pu_bacteria 2582581315 2585326062 117
140 iso_pu_bacteria 2582581316 2585330231 117
141 iso_pu_bacteria 2582581865 2585385572 117
142 iso_pu_bacteria 2582581866 2585391988 117
143 iso_pu_bacteria 2582581867 2585398631 117
144 iso_pu_bacteria 2585427526 2585529347 117
145 iso_pu_bacteria 2585427527 2585533592 117
146 iso_pu_bacteria 2585427528 2585539602 117
147 iso_pu_bacteria 2585427529 2585545724 117
148 iso_pu_bacteria 2585427530 2585553181 117
149 iso_pu_bacteria 2585427531 2585560032 117
150 iso_pu_bacteria 2585427590 2585819219 117
151 iso_pu_bacteria 2585427593 2585837559 117
152 iso_pu_bacteria 2585427594 2585844125 117
153 iso_pu_bacteria 2585427608 2585900707 117
154 iso_pu_bacteria 2585427609 2585905788 117
155 iso_pu_bacteria 2585427633 2585994311 117
156 iso_pu_bacteria 2585427634 2585998769 117
157 iso_pu_bacteria 2585428125 2587979096 117
158 iso_pu_bacteria 2599185156 2599332931 117
159 iso_pu_bacteria 2599185170 2599419270 117
160 iso_pu_bacteria 2599185210 2599606031 117
161 iso_pu_bacteria 2599185236 2599719632 117
162 iso_pu_bacteria 2599185352 2600191370 117
163 iso_pu_bacteria 2600254933 2600374622 117
164 iso_pu_bacteria 2600255279 2601609252 117
165 iso_pu_bacteria 2600255308 2601746027 117
166 iso_pu_bacteria 2615840624 2616297034 117
167 iso_pu_bacteria 2615840626 2616310296 117
168 iso_pu_bacteria 2615840698 2616553323 117
169 iso_pu_bacteria 2617270742 2617380344 117
170 iso_pu_bacteria 2643221557 2643806205 117
171 iso_pu_bacteria 2643221558 2643812835 117
172 iso_pu_bacteria 2643221568 2643855222 117
173 iso_pu_bacteria 2643221582 2643918318 117
174 iso_pu_bacteria 2643221598 2643998134 117
175 iso_pu_bacteria 2643221599 2644004817 117
176 iso_pu_bacteria 2643221607 2644047235 117
177 iso_pu_bacteria 2643221610 2644070191 117
178 iso_pu_bacteria 2643221614 2644087004 117
179 iso_pu_bacteria 2643221618 2644103327 117
180 iso_pu_bacteria 2643221626 2644144266 117
181 iso_pu_bacteria 2643221634 2644190494 117
182 iso_pu_bacteria 2643221636 2644199606 117
183 iso_pu_bacteria 2643221637 2644206788 117
184 iso_pu_bacteria 2643221643 2644241627 117
185 iso_pu_bacteria 2643221653 2644297717 117
186 iso_pu_bacteria 2643221655 2644306257 117
187 iso_pu_bacteria 2643221659 2644330506 117
188 iso_pu_bacteria 2643221661 2644341958 117
189 iso_pu_bacteria 2643221663 2644353421 117
190 iso_pu_bacteria 2643221666 2644368245 117
191 iso_pu_bacteria 2643221668 2644377467 117
192 iso_pu_bacteria 2643221675 2644420953 117
193 iso_pu_bacteria 2643221680 2644454476 117
194 iso_pu_bacteria 2643221686 2644480024 117
195 iso_pu_bacteria 2643221688 2644492326 117
196 iso_pu_bacteria 2643221689 2644496837 117
197 iso_pu_bacteria 2643221693 2644519310 117
198 iso_pu_bacteria 2643221698 2644542747 117
199 iso_pu_bacteria 2643221699 2644550644 117
200 iso_pu_bacteria 2643221712 2644611868 117
201 iso_pu_bacteria 2643221718 2644650436 117
202 iso_pu_bacteria 2643221719 2644655970 117
203 iso_pu_bacteria 2643221723 2644671883 117
204 iso_pu_bacteria 2643221726 2644692414 117
205 iso_pu_bacteria 2657244999 2657681818 117
206 iso_pu_bacteria 2667528174 2671113745 117
207 iso_pu_bacteria 2690316117 2692317335 117
208 iso_pu_bacteria 2718217882 2719179486 117
209 iso_pu_bacteria 2718217927 2719384042 117
210 iso_pu_bacteria 2718217997 2719663833 117
211 iso_pu_bacteria 2718218009 2719730156 117
212 iso_pu_bacteria 2718218199 2720490252 117
213 iso_pu_bacteria 2718218232 2720611629 117
214 iso_pu_bacteria 2718218233 2720618478 117
215 iso_pu_bacteria 2718218235 2720629886 117
216 iso_pu_bacteria 2718218269 2720773581 117
217 iso_pu_bacteria 2718218363 2721145579 117
218 iso_pu_bacteria 2718218365 2721157096 117
219 iso_pu_bacteria 2718218366 2721162458 117
220 iso_pu_bacteria 2718218423 2721397812 117
221 iso_pu_bacteria 2721755514 2722838628 117
222 iso_pu_bacteria 2721755556 2723025252 117
223 iso_pu_bacteria 2721755684 2723558837 117
224 iso_pu_bacteria 2721755685 2723565407 117
225 iso_pu_bacteria 2721755809 2724036622 117
226 iso_pu_bacteria 2721755810 2724042912 117
227 iso_pu_bacteria 2721755819 2724088188 117
228 iso_pu_bacteria 2721755822 2724102672 117
229 iso_pu_bacteria 2721755823 2724108568 117
230 iso_pu_bacteria 2724679232 2725948911 117
231 iso_pu_bacteria 2728369352 2730106188 117
232 iso_pu_bacteria 2728369365 2730162723 117
233 iso_pu_bacteria 2728369397 2730296728 117
234 iso_pu_bacteria 2738541293 2738801322 117
235 iso_pu_bacteria 2738541317 2738948330 117
236 iso_pu_bacteria 2738541333 2739036992 117
237 iso_pu_bacteria 2738543024 2739306120 117
238 iso_pu_bacteria 2751185821 2753461266 117
239 iso_pu_bacteria 2765235942 2766062833 117
240 iso_pu_bacteria 2775507049 2776911989 117
241 iso_pu_bacteria 2775507266 2778179633 117
242 iso_pu_bacteria 2791355082 2792583000 117
243 iso_pu_bacteria 2791355091 2792623887 117
244 iso_pu_bacteria 2791355092 2792629733 117
245 iso_pu_bacteria 2791355094 2792638066 117
246 iso_pu_bacteria 2791355253 2793282071 117
247 iso_pu_bacteria 2791355256 2793295291 117
248 iso_pu_bacteria 2791355259 2793316413 117
249 iso_pu_bacteria 2791355260 2793323357 117
250 iso_pu_bacteria 2791355261 2793326249 117
251 iso_pu_bacteria 2791355262 2793334310 117
252 iso_pu_bacteria 2791355263 2793341889 117
253 iso_pu_bacteria 2791355264 2793348226 117
254 iso_pu_bacteria 2791355265 2793355708 117
255 iso_pu_bacteria 2791355266 2793361595 117
256 iso_pu_bacteria 2791355267 2793364593 117
257 iso_pu_bacteria 2802428858 2802720392 117
258 iso_pu_bacteria 2802428859 2802726212 117
259 iso_pu_bacteria 2802428860 2802731624 117
260 iso_pu_bacteria 2802428861 2802739375 117
261 iso_pu_bacteria 2802428862 2802742517 117
262 iso_pu_bacteria 2802428863 2802749222 117
263 iso_pu_bacteria 2802429268 2804750838 117
264 iso_pu_bacteria 2802429605 2805929288 117
265 iso_pu_bacteria 2802429606 2805932453 117
266 iso_pu_bacteria 2802429633 2806047626 117
267 iso_pu_bacteria 2802429634 2806055045 117
268 iso_pu_bacteria 2802429635 2806062053 117
269 iso_pu_bacteria 2802429636 2806067221 117
270 iso_pu_bacteria 2802429637 2806076542 117
271 iso_pu_bacteria 2808606387 2808986449 117
272 iso_pu_bacteria 2818991272 2819245241 117
273 iso_pu_bacteria 2818991439 2819556579 117
274 iso_pu_bacteria 2818991448 2819608492 117
275 iso_pu_bacteria 2818991453 2819640597 117
276 iso_pu_bacteria 2818991461 2819686236 117
277 iso_pu_bacteria 2821123053 2821123555 117
278 iso_pu_bacteria 2838016132 2838020201 117
279 iso_pu_bacteria 2838022645 2838025720 117
280 iso_pu_bacteria 2838029111 2838029375 117
281 iso_pu_bacteria 2838035591 2838037046 117
282 iso_pu_bacteria 2838042994 2838044521 117
283 iso_pu_bacteria 2838048938 2838051583 117
284 iso_pu_bacteria 2838061910 2838064058 117
285 iso_pu_bacteria 2838068647 2838071027 117
286 iso_pu_bacteria 2838074704 2838075291 117
287 iso_pu_bacteria 2838661181 2838663777 117
288 iso_pu_bacteria 2838668709 2838672478 117
289 iso_pu_bacteria 2838675328 2838677307 117
290 iso_pu_bacteria 2838680041 2838680500 117
291 iso_pu_bacteria 2838686498 2838691666 117
292 iso_pu_bacteria 2838694306 2838695467 117
293 iso_pu_bacteria 2838701080 2838703780 117
294 iso_pu_bacteria 2838707686 2838708844 117
295 iso_pu_bacteria 2838714209 2838716195 117
296 iso_pu_bacteria 2838719591 2838720005 117
297 iso_pu_bacteria 2838724970 2838726947 117
298 iso_pu_bacteria 2838729681 2838733850 117
299 iso_pu_bacteria 2838736955 2838739411 117
300 iso_pu_bacteria 2838742623 2838747086 117
301 iso_pu_bacteria 2841840854 2841843309 117
302 iso_pu_bacteria 2841846520 2841846937 117
303 iso_pu_bacteria 2841851746 2841856227 117
304 iso_pu_bacteria 2841859092 2841860535 117
305 iso_pu_bacteria 2841864319 2841866896 117
306 iso_pu_bacteria 2842077413 2842079921 117
307 iso_pu_bacteria 2842110456 2842112126 117
308 iso_pu_bacteria 2842118031 2842120539 117
309 iso_pu_bacteria 2842124991 2842127034 117
310 iso_pu_bacteria 2842130223 2842132200 117
311 iso_pu_bacteria 2842140634 2842145970 117
312 iso_pu_bacteria 2842146304 2842148428 117
313 iso_pu_bacteria 2842152218 2842152631 117
314 iso_pu_bacteria 2842156927 2842162015 117
315 iso_pu_bacteria 2842163707 2842169608 117
316 iso_pu_bacteria 2842170452 2842172440 117
317 iso_pu_bacteria 2842175837 2842176250 117
318 iso_pu_bacteria 2842180545 2842185857 117
319 iso_pu_bacteria 2842187318 2842189302 117
320 iso_pu_bacteria 2842192696 2842192802 117
321 iso_pu_bacteria 2842198810 2842202871 117
322 iso_pu_bacteria 2842205361 2842207035 117
323 iso_pu_bacteria 2842211629 2842213616 117
324 iso_pu_bacteria 2842217011 2842218878 117
325 iso_pu_bacteria 2842224351 2842224766 117
326 iso_pu_bacteria 2842229732 2842235385 117
327 iso_pu_bacteria 2842237096 2842238255 117
328 iso_pu_bacteria 2842243621 2842248160 117
329 iso_pu_bacteria 2842250916 2842253494 117
330 iso_pu_bacteria 2842257432 2842262246 117
331 iso_pu_bacteria 2842264693 2842268845 117
332 iso_pu_bacteria 2842271015 2842276639 117
333 iso_pu_bacteria 2842278818 2842280272 117
334 iso_pu_bacteria 2842285085 2842286754 117
335 iso_pu_bacteria 2842291075 2842293582 117
336 iso_pu_bacteria 2842298080 2842299534 117
337 iso_pu_bacteria 2842304105 2842306585 117
338 iso_pu_bacteria 2842311132 2842312705 117
339 iso_pu_bacteria 2842317721 2842322430 117
340 iso_pu_bacteria 2842341865 2842343158 117
341 iso_pu_bacteria 2842357229 2842360961 117
342 iso_pu_bacteria 2842363717 2842367117 117
343 iso_pu_bacteria 2842370503 2842370963 117
344 iso_pu_bacteria 2842377471 2842379979 117
345 iso_pu_bacteria 2842384541 2842387050 117
346 iso_pu_bacteria 2842395702 2842399164 117
347 iso_pu_bacteria 2842402390 2842403693 117
348 iso_pu_bacteria 2842409023 2842410605 117
349 iso_pu_bacteria 2842415677 2842417251 117
350 iso_pu_bacteria 2842422224 2842424642 117
351 iso_pu_bacteria 2842428310 2842432955 117
352 iso_pu_bacteria 2842434925 2842439260 117
353 iso_pu_bacteria 2842441272 2842445889 117
354 iso_pu_bacteria 2842447887 2842451930 117
355 iso_pu_bacteria 2842462802 2842467075 117
356 iso_pu_bacteria 2842469257 2842473897 117
357 iso_pu_bacteria 2842475841 2842476195 117
358 iso_pu_bacteria 2842482326 2842487660 117
359 iso_pu_bacteria 2842489311 2842492544 117
360 iso_pu_bacteria 2842495871 2842500124 117
361 iso_pu_bacteria 2842502639 2842502903 117
362 iso_pu_bacteria 2842509118 2842509121 117
363 iso_pu_bacteria 2842515876 2842517320 117
364 iso_pu_bacteria 2842521101 2842521614 117
365 iso_pu_bacteria 2842922631 2842923239 117
366 iso_pu_bacteria 2844163670 2844165166 117
367 iso_pu_bacteria 2844454524 2844456075 117
368 iso_pu_bacteria 2847417321 2847417596 117
369 iso_pu_bacteria 2848992105 2848992402 117
370 iso_pu_bacteria 2850079185 2850079898 117
371 iso_pu_bacteria 2852387548 2852388394 117
372 iso_pu_bacteria 2854896431 2854898178 117
373 iso_pu_bacteria 2854916844 2854919860 117
374 iso_pu_bacteria 2855825444 2855828145 117
375 iso_pu_bacteria 2855839649 2855839917 117
376 iso_pu_bacteria 2855872281 2855873459 117
377 iso_pu_bacteria 2857516855 2857521728 117
378 iso_pu_bacteria 2857531043 2857531118 117
379 iso_pu_bacteria 2858800743 2858803890 117
380 iso_pu_bacteria 2891088606 2891090849 117
381 iso_pu_bacteria 2891373044 2891375017 117
382 iso_pu_bacteria 2896384573 2896391635 117
383 iso_pu_bacteria 2899792073 2899792617 117
384 iso_pu_bacteria 2899803654 2899805385 117
385 iso_pu_bacteria 2899845264 2899846013 117
386 iso_pu_bacteria 2913295892 2913298071 117
387 iso_pu_bacteria 2913308742 2913313328 117
388 iso_pu_bacteria 2915980308 2915980705 117
389 iso_pu_bacteria 2915986958 2915990579 117
390 iso_pu_bacteria 2915993759 2915998222 117
391 iso_pu_bacteria 2916000859 2916001026 117
392 iso_pu_bacteria 2916007675 2916011083 117
393 iso_pu_bacteria 2916014648 2916015503 117
394 iso_pu_bacteria 2916021584 2916025426 117
395 iso_pu_bacteria 2916028427 2916031112 117
396 iso_pu_bacteria 2916035215 2916036433 117
397 iso_pu_bacteria 2916041962 2916045650 117
398 iso_pu_bacteria 2916048683 2916053745 117
399 iso_pu_bacteria 2916055098 2916057324 117
400 iso_pu_bacteria 2916061851 2916063728 117
401 iso_pu_bacteria 2916068649 2916069643 117
402 iso_pu_bacteria 2916076590 2916082181 117
403 iso_pu_bacteria 2919100787 2919101434 117
404 iso_pu_bacteria 2919114240 2919116398 117
405 iso_pu_bacteria 2919166419 2919166793 117
406 iso_pu_bacteria 2919171160 2919172180 117
407 iso_pu_bacteria 2919408235 2919408716 117
408 iso_pu_bacteria 2920760137 2920763475 117
409 iso_pu_bacteria 2920822456 2920823289 117
410 iso_pu_bacteria 2921201388 2921207020 117
411 iso_pu_bacteria 2921208531 2921212216 117
412 iso_pu_bacteria 2921237296 2921242026 117
413 iso_pu_bacteria 2921244191 2921248898 117
414 iso_pu_bacteria 2921250672 2921257237 117
415 iso_pu_bacteria 2921257292 2921260940 117
416 iso_pu_bacteria 2921263974 2921266399 117
417 iso_pu_bacteria 2921282425 2921288492 117
418 iso_pu_bacteria 2921289301 2921294455 117
419 iso_pu_bacteria 2921296804 2921298014 117
420 iso_pu_bacteria 2923556063 2923557062 117
421 iso_pu_bacteria 2924144063 2924149830 117
422 iso_pu_bacteria 2924150972 2924156583 117
423 iso_pu_bacteria 2924158325 2924163415 117
424 iso_pu_bacteria 2924165586 2924170411 117
425 iso_pu_bacteria 2924172951 2924177694 117
426 iso_pu_bacteria 2924179722 2924183548 117
427 iso_pu_bacteria 2924186466 2924190784 117
428 iso_pu_bacteria 2924193448 2924199079 117
429 iso_pu_bacteria 2924200457 2924205611 117
430 iso_pu_bacteria 2924207177 2924209129 117
431 iso_pu_bacteria 2924214083 2924215223 117
432 iso_pu_bacteria 2924221636 2924228351 117
433 iso_pu_bacteria 2924228884 2924232839 117
434 iso_pu_bacteria 2926754445 2926757352 117
435 iso_pu_bacteria 2926760298 2926761568 117
436 iso_pu_bacteria 2928972540 2928973251 117
437 iso_pu_bacteria 2929138655 2929138727 117
438 iso_pu_bacteria 2933006813 2933007276 117
439 iso_pu_bacteria 2933011516 2933015133 117
440 iso_pu_bacteria 2933570622 2933573654 117
441 iso_pu_bacteria 2933586486 2933587454 117
442 iso_pu_bacteria 2933594066 2933594481 117
443 iso_pu_bacteria 2933599457 2933601826 117
444 iso_pu_bacteria 2935894831 2935895991 117
445 iso_pu_bacteria 2935901341 2935907249 117
446 iso_pu_bacteria 2936367885 2936369013 117
447 iso_pu_bacteria 2936375103 2936378371 117
448 iso_pu_bacteria 2936381700 2936383658 117
449 iso_pu_bacteria 2937002841 2937007617 117
450 iso_pu_bacteria 2937009748 2937014865 117
451 iso_pu_bacteria 2937016420 2937022391 117
452 iso_pu_bacteria 2937023124 2937023285 117
453 iso_pu_bacteria 2937029754 2937034607 117
454 iso_pu_bacteria 2937036028 2937041232 117
455 iso_pu_bacteria 2937042894 2937045985 117
456 iso_pu_bacteria 2937049772 2937051826 117
457 iso_pu_bacteria 2937056579 2937062643 117
458 iso_pu_bacteria 2937063883 2937068343 117
459 iso_pu_bacteria 2937071275 2937074840 117
460 iso_pu_bacteria 2937078374 2937078819 117
461 iso_pu_bacteria 2937084907 2937089105 117
462 iso_pu_bacteria 2937091812 2937095209 117
463 iso_pu_bacteria 2937098957 2937104399 117
464 iso_pu_bacteria 2937106411 2937112411 117
465 iso_pu_bacteria 2937113482 2937119563 117
466 iso_pu_bacteria 2937119839 2937126099 117
467 iso_pu_bacteria 2937126314 2937131522 117
468 iso_pu_bacteria 2941499720 2941500799 117
469 iso_pu_bacteria 2957375807 2957382135 117
470 iso_pu_bacteria 2957382221 2957388585 117
471 iso_pu_bacteria 2957388812 2957393988 117
472 iso_pu_bacteria 2957395598 2957399082 117
473 iso_pu_bacteria 2957402308 2957403343 117
474 iso_pu_bacteria 2957408893 2957412035 117
475 iso_pu_bacteria 2957415311 2957418137 117
476 iso_pu_bacteria 2957422303 2957423658 117
477 iso_pu_bacteria 2957430029 2957434070 117
478 iso_pu_bacteria 2957437181 2957442560 117
479 iso_pu_bacteria 2957443900 2957447206 117
480 iso_pu_bacteria 2957450854 2957455239 117
481 iso_pu_bacteria 2957457609 2957462744 117
482 iso_pu_bacteria 2957464669 2957466236 117
483 iso_pu_bacteria 2957471148 2957472167 117
484 iso_pu_bacteria 2957478035 2957479705 117
485 iso_pu_bacteria 2957484790 2957484922 117
486 iso_pu_bacteria 2957491536 2957496113 117
487 iso_pu_bacteria 2957498199 2957500575 117
488 iso_pu_bacteria 2957505466 2957508216 117
489 iso_pu_bacteria 2960584000 2960589376 117
490 iso_pu_bacteria 2960591022 2960594688 117
491 iso_pu_bacteria 2960597568 2960603483 117
492 iso_pu_bacteria 2960603979 2960608768 117
493 iso_pu_bacteria 2960610863 2960614407 117
494 iso_pu_bacteria 2960617483 2960621618 117
495 iso_pu_bacteria 2960624210 2960628912 117
496 iso_pu_bacteria 2960631154 2960637535 117
497 iso_pu_bacteria 2960637947 2960645042 117
498 iso_pu_bacteria 2960645483 2960647994 117
499 iso_pu_bacteria 2960652885 2960658371 117
500 iso_pu_bacteria 2960660292 2960660490 117
501 iso_pu_bacteria 2960667422 2960672275 117
502 iso_pu_bacteria 2960674078 2960677199 117
503 iso_pu_bacteria 2960680706 2960686533 117
504 iso_pu_bacteria 2960687367 2960690388 117
505 iso_pu_bacteria 2960693952 2960698902 117
506 iso_pu_bacteria 2964607997 2964613083 117
507 iso_pu_bacteria 2964615318 2964618939 117
508 iso_pu_bacteria 2964621998 2964627994 117
509 iso_pu_bacteria 2964628898 2964632726 117
510 iso_pu_bacteria 2964636051 2964639024 117
511 iso_pu_bacteria 2964643177 2964649292 117
512 iso_pu_bacteria 2964649959 2964650253 117
513 iso_pu_bacteria 2964656573 2964661145 117
514 iso_pu_bacteria 2964663802 2964668184 117
515 iso_pu_bacteria 2964670856 2964677336 117
516 iso_pu_bacteria 2964678106 2964683370 117
517 iso_pu_bacteria 2964685014 2964690623 117
518 iso_pu_bacteria 2964691889 2964694688 117
519 iso_pu_bacteria 2964698721 2964700582 117
520 iso_pu_bacteria 2964705432 2964709897 117
521 iso_pu_bacteria 2964712639 2964717319 117
522 iso_pu_bacteria 2964719344 2964722981 117
523 iso_pu_bacteria 2967664464 2967667276 117
524 iso_pu_bacteria 2967671571 2967675345 117
525 iso_pu_bacteria 2967678726 2967684782 117
526 iso_pu_bacteria 2967686174 2967691447 117
527 iso_pu_bacteria 2967693043 2967694991 117
528 iso_pu_bacteria 2967699805 2967704118 117
529 iso_pu_bacteria 2967706974 2967712172 117
530 iso_pu_bacteria 2967714385 2967714585 117
531 iso_pu_bacteria 2967721400 2967722540 117
532 iso_pu_bacteria 2967728569 2967730480 117
533 iso_pu_bacteria 2967735183 2967739335 117
534 iso_pu_bacteria 2967742019 2967744179 117
535 iso_pu_bacteria 2967748971 2967754974 117
536 iso_pu_bacteria 2967755722 2967759316 117
537 iso_pu_bacteria 2967762386 2967766468 117
538 iso_pu_bacteria 2967769361 2967774654 117
539 iso_pu_bacteria 2967775926 2967782542 117
540 iso_pu_bacteria 2970019648 2970022854 117
541 iso_pu_bacteria 2970026789 2970030501 117
542 iso_pu_bacteria 2970033650 2970037023 117
543 iso_pu_bacteria 2970040964 2970041202 117
544 iso_pu_bacteria 2970047711 2970052798 117
545 iso_pu_bacteria 2970054988 2970056755 117
546 iso_pu_bacteria 2970061556 2970067908 117
547 iso_pu_bacteria 2970068827 2970073943 117
548 iso_pu_bacteria 2970076120 2970081686 117
549 iso_pu_bacteria 2970082768 2970088472 117
550 iso_pu_bacteria 2970088815 2970091365 117
551 iso_pu_bacteria 2970095765 2970102007 117
552 iso_pu_bacteria 2970102677 2970105896 117
553 iso_pu_bacteria 2970109326 2970115669 117
554 iso_pu_bacteria 2970116247 2970117535 117
555 iso_pu_bacteria 2970122695 2970124313 117
556 iso_pu_bacteria 2970129317 2970131489 117
557 iso_pu_bacteria 2970136068 2970136696 117
558 iso_pu_bacteria 2970143518 2970147688 117
559 iso_pu_bacteria 2970149975 2970151783 117
560 iso_pu_bacteria 2970156795 2970163337 117
561 iso_pu_bacteria 2970164137 2970170015 117
562 iso_pu_bacteria 2970170962 2970175737 117
563 iso_pu_bacteria 2970177841 2970181977 117
564 iso_pu_bacteria 2970184632 2970189206 117
565 iso_pu_bacteria 2970191845 2970196647 117
566 iso_pu_bacteria 2977240413 2977240754 117
567 iso_pu_bacteria 2977516862 2977519986 117
568 iso_pu_bacteria 2977523885 2977528391 117
569 iso_pu_bacteria 2977530762 2977535783 117
570 iso_pu_bacteria 2977537788 2977543888 117
571 iso_pu_bacteria 2977544691 2977549543 117
572 iso_pu_bacteria 2977551784 2977553599 117
573 iso_pu_bacteria 2977558990 2977564817 117
574 iso_pu_bacteria 2977565890 2977571823 117
575 iso_pu_bacteria 2977572785 2977574590 117
576 iso_pu_bacteria 2977579622 2977584526 117
577 iso_pu_bacteria 2978969890 2978973209 117
578 iso_pu_bacteria 2979089926 2979093142 117
579 iso_pu_bacteria 2979095461 2979099471 117
580 iso_pu_bacteria 2979100975 2979105110 117
581 iso_pu_bacteria 2984509177 2984513049 117
582 iso_pu_bacteria 2984518228 2984520587 117
583 iso_pu_bacteria 2984537506 2984539881 117
584 iso_pu_bacteria 2984587000 2984591458 117
585 iso_pu_bacteria 2984601300 2984602088 117
586 iso_pu_bacteria 2989349275 2989351493 117
587 iso_pu_bacteria 2989771324 2989772709 117
588 iso_pu_bacteria 2989776772 2989777341 117
589 iso_pu_bacteria 2996887358 2996888431 117
590 iso_pu_bacteria 2996893221 2996893350 117
591 iso_pu_bacteria 3003930520 3003931867 117
592 iso_pu_bacteria 3005409236 3005411148 117
593 iso_pu_bacteria 3005416602 3005422892 117
594 iso_pu_bacteria 3005445848 3005446099 117
595 iso_pu_bacteria 3005452660 3005452756 117
596 iso_pu_bacteria 639633055 639646565 117
597 iso_pu_bacteria 643692032 643824461 117
598 iso_pu_bacteria 648276728 648741575 117
599 iso_pu_bacteria 650716007 650738965 117
600 iso_pu_bacteria 8002060224 8002060377 117
601 iso_pu_bacteria 8002285264 8002287272 117
602 iso_pu_bacteria 8003570095 8003572597 117
603 iso_pu_bacteria 8003992118 8003992369 117
604 iso_pu_bacteria 8003999396 8003999698 117
605 iso_pu_bacteria 8005246636 8005247471 117
606 iso_pu_bacteria 8005258706 8005261009 117
607 iso_pu_bacteria 8005275841 8005278753 117
608 iso_pu_bacteria 8005282627 8005289093 117
609 iso_pu_bacteria 8005289223 8005291167 117
610 iso_pu_bacteria 8005301065 8005301466 117
611 iso_pu_bacteria 8005307578 8005309279 117
612 iso_pu_bacteria 8005314921 8005321572 117
613 iso_pu_bacteria 8005321885 8005322958 117
614 iso_pu_bacteria 8005376324 8005377519 117
615 iso_pu_bacteria 8005382845 8005387381 117
616 iso_pu_bacteria 8005395548 8005400041 117
617 iso_pu_bacteria 8005430974 8005432847 117
618 iso_pu_bacteria 8005460587 8005460925 117
619 iso_pu_bacteria 8005484373 8005484864 117
620 iso_pu_bacteria 8005497431 8005498577 117
621 iso_pu_bacteria 8005542996 8005543687 117
622 iso_pu_bacteria 8005556819 8005560538 117
623 iso_pu_bacteria 8005563573 8005564004 117
624 iso_pu_bacteria 8005570704 8005576837 117
625 iso_pu_bacteria 8005619151 8005619769 117
626 iso_pu_bacteria 8005626139 8005628341 117
627 iso_pu_bacteria 8005645114 8005649558 117
628 iso_pu_bacteria 8005658619 8005660704 117
629 iso_pu_bacteria 8005668836 8005669988 117
630 iso_pu_bacteria 8005682033 8005685199 117
631 iso_pu_bacteria 8005688590 8005690182 117
632 iso_pu_bacteria 8005695170 8005699338 117
633 iso_pu_bacteria 8018127388 8018133037 117
634 iso_pu_bacteria 8018150411 8018153004 117
635 iso_pu_bacteria 8018163183 8018168938 117
636 iso_pu_bacteria 8018176218 8018178885 117
637 iso_pu_bacteria 8023680758 8023684325 117
638 iso_pu_bacteria 8024479707 8024480191 117
639 iso_pu_bacteria 8024486573 8024491495 117
640 iso_pu_bacteria 8024501048 8024501687 117
641 iso_pu_bacteria 8046767195 8046770786 117
642 iso_pu_bacteria 8049293176 8049293395 117
643 iso_pu_bacteria 8054460903 8054461239 117
644 iso_pu_bacteria 8054558443 8054562312 117
645 iso_pu_bacteria 8055431914 8055435666 117
646 iso_pu_bacteria 8056375014 8056375550 117
647 iso_pu_bacteria 8056382006 8056385864 117
648 iso_pu_bacteria 8057575449 8057577752 117
649 iso_pu_bacteria 8057874678 8057875964 117
650 3300005262 Ga0065165_1010587 Ga0065165_10105873 119
651 3300005616 Ga0068852_100922705 Ga0068852_1009227052 119
652 3300014968 Ga0157379_10014475 Ga0157379_100144752 119
653 3300026121 Ga0207683_11650880 Ga0207683_116508802 119
654 3300031901 Ga0307406_11486929 Ga0307406_114869292 119
655 3300046542 Ga0495597_0285478 Ga0495597_0285478_123_482 119
656 3300046660 Ga0495625_0014276 Ga0495625_0014276_822_1181 119
657 3300046660 Ga0495625_0624856 Ga0495625_0624856_27_392 119
658 3300046660 Ga0495625_0753889 Ga0495625_0753889_114_479 119
659 3300047472 Ga0495686_0003381 Ga0495686_0003381_1614_1979 119
660 3300053096 Ga0500641_0209788 Ga0500641_0209788_284_649 119
661 3300053099 Ga0500654_161509 Ga0500654_161509_98_457 119
662 3300005614 Ga0068856_101832887 Ga0068856_1018328871 120
663 3300006237 Ga0097621_101121651 Ga0097621_1011216512 120
664 3300009553 Ga0105249_11199832 Ga0105249_111998322 120
665 3300026078 Ga0207702_10957383 Ga0207702_109573831 120
666 3300028800 Ga0265338_10587579 Ga0265338_105875792 120
667 3300031247 Ga0265340_10092943 Ga0265340_100929432 120
668 3300039437 Ga0436365_1813847 Ga0436365_1813847_2272_2643 120
669 3300042876 Ga0451577_0447308 Ga0451577_0447308_403_768 120
670 3300046499 Ga0495594_0032228 Ga0495594_0032228_58_420 120
671 3300048917 Ga0496114_0869795 Ga0496114_0869795_315_680 120
672 iso_pu_bacteria 2941485952 2941489035 120
673 3300001979 JGI24740J21852_10078009 JGI24740J21852_100780092 121
674 3300001989 JGI24739J22299_10101900 JGI24739J22299_101019002 121
675 3300002704 JGI25155J39150_1000157 JGI25155J39150_10001575 121
676 3300002705 JGI25156J39149_1000029 JGI25156J39149_10000295 121
677 3300002737 JGI25162J39368_1000169 JGI25162J39368_100016919 121
678 3300002737 JGI25162J39368_1000508 JGI25162J39368_10005089 121
679 3300002738 JGI25154J39366_1000286 JGI25154J39366_10002865 121
680 3300002739 JGI25158J39367_1000022 JGI25158J39367_100002222 121
681 3300002739 JGI25158J39367_1008510 JGI25158J39367_10085102 121
682 3300002741 JGI25157J39369_1000247 JGI25157J39369_10002475 121
683 3300002741 JGI25157J39369_1027527 JGI25157J39369_10275271 121
684 3300002773 JGI25152J39213_1000754 JGI25152J39213_10007548 121
685 3300002773 JGI25152J39213_1002420 JGI25152J39213_10024201 121
686 3300002773 JGI25152J39213_1007158 JGI25152J39213_10071583 121
687 3300002773 JGI25152J39213_1007181 JGI25152J39213_10071812 121
688 3300002773 JGI25152J39213_1018249 JGI25152J39213_10182493 121
689 3300002773 JGI25152J39213_1049203 JGI25152J39213_10492031 121
690 3300002774 JGI25150J39212_1000012 JGI25150J39212_10000126 121
691 3300002774 JGI25150J39212_1012992 JGI25150J39212_10129923 121
692 3300002774 JGI25150J39212_1040828 JGI25150J39212_10408282 121
693 3300002987 JGI25159J45721_1000137 JGI25159J45721_10001378 121
694 3300002987 JGI25159J45721_1000730 JGI25159J45721_10007306 121
695 3300002987 JGI25159J45721_1000995 JGI25159J45721_100099511 121
696 3300003187 JGI25151J46595_10000025 JGI25151J46595_1000002546 121
697 3300003187 JGI25151J46595_10000504 JGI25151J46595_100005042 121
698 3300003187 JGI25151J46595_10005603 JGI25151J46595_100056033 121
699 3300003214 JGI25165J46597_1000355 JGI25165J46597_100035533 121
700 3300003214 JGI25165J46597_1000491 JGI25165J46597_10004918 121
701 3300003214 JGI25165J46597_1002805 JGI25165J46597_10028055 121
702 3300003215 JGI25153J46596_10001788 JGI25153J46596_100017888 121
703 3300003215 JGI25153J46596_10005320 JGI25153J46596_100053205 121
704 3300003215 JGI25153J46596_10036315 JGI25153J46596_100363152 121
705 3300003215 JGI25153J46596_10056097 JGI25153J46596_100560972 121
706 3300003215 JGI25153J46596_10071670 JGI25153J46596_100716702 121
707 3300003215 JGI25153J46596_10124555 JGI25153J46596_101245551 121
708 3300003215 JGI25153J46596_10130682 JGI25153J46596_101306821 121
709 3300003316 rootH1_10048107 rootH1_100481073 121
710 3300003316 rootH1_10071907 rootH1_100719072 121
711 3300003320 rootH2_10053074 rootH2_100530746 121
712 3300003354 JGI25160J50197_1000003 JGI25160J50197_1000003445 121
713 3300003354 JGI25160J50197_1000041 JGI25160J50197_100004159 121
714 3300003354 JGI25160J50197_1002613 JGI25160J50197_10026138 121
715 3300003354 JGI25160J50197_1004984 JGI25160J50197_10049846 121
716 3300003354 JGI25160J50197_1017611 JGI25160J50197_10176113 121
717 3300003354 JGI25160J50197_1018216 JGI25160J50197_10182162 121
718 3300003374 JGI25161J50226_1000002 JGI25161J50226_100000259 121
719 3300003374 JGI25161J50226_1000143 JGI25161J50226_100014333 121
720 3300003374 JGI25161J50226_1000493 JGI25161J50226_10004938 121
721 3300003374 JGI25161J50226_1003550 JGI25161J50226_10035502 121
722 3300003578 Ga0006562J51391_1043415 Ga0006562J51391_10434153 121
723 3300003759 Ga0055525_1022401 Ga0055525_10224011 121
724 3300003771 Ga0055526_1003130 Ga0055526_10031308 121
725 3300003771 Ga0055526_1008527 Ga0055526_10085276 121
726 3300003771 Ga0055526_1017338 Ga0055526_10173383 121
727 3300003771 Ga0055526_1023017 Ga0055526_10230173 121
728 3300003775 Ga0055524_1000776 Ga0055524_10007763 121
729 3300003775 Ga0055524_1005585 Ga0055524_10055854 121
730 3300003775 Ga0055524_1009446 Ga0055524_10094463 121
731 3300003775 Ga0055524_1011959 Ga0055524_10119591 121
732 3300003775 Ga0055524_1025683 Ga0055524_10256832 121
733 3300003775 Ga0055524_1038858 Ga0055524_10388582 121
734 3300003775 Ga0055524_1070685 Ga0055524_10706852 121
735 3300003781 Ga0055536_1010875 Ga0055536_10108753 121
736 3300003781 Ga0055536_1014772 Ga0055536_10147722 121
737 3300003781 Ga0055536_1017433 Ga0055536_10174332 121
738 3300003781 Ga0055536_1036409 Ga0055536_10364092 121
739 3300003790 Ga0055528_1002642 Ga0055528_10026422 121
740 3300003790 Ga0055528_1005397 Ga0055528_10053972 121
741 3300003790 Ga0055528_1015407 Ga0055528_10154071 121
742 3300003790 Ga0055528_1018451 Ga0055528_10184511 121
743 3300003790 Ga0055528_1021991 Ga0055528_10219911 121
744 3300003790 Ga0055528_1030289 Ga0055528_10302892 121
745 3300003790 Ga0055528_1061004 Ga0055528_10610041 121
746 3300003791 Ga0055530_10006294 Ga0055530_100062945 121
747 3300003791 Ga0055530_10013218 Ga0055530_100132183 121
748 3300003791 Ga0055530_10017705 Ga0055530_100177052 121
749 3300003791 Ga0055530_10045901 Ga0055530_100459012 121
750 3300003792 Ga0055540_1000249 Ga0055540_100024914 121
751 3300003792 Ga0055540_1001900 Ga0055540_10019003 121
752 3300003792 Ga0055540_1013868 Ga0055540_10138682 121
753 3300003792 Ga0055540_1029082 Ga0055540_10290822 121
754 3300003792 Ga0055540_1054790 Ga0055540_10547902 121
755 3300003794 Ga0055531_10002859 Ga0055531_100028593 121
756 3300003794 Ga0055531_10012244 Ga0055531_100122443 121
757 3300003794 Ga0055531_10018093 Ga0055531_100180933 121
758 3300003794 Ga0055531_10039030 Ga0055531_100390302 121
759 3300003794 Ga0055531_10051894 Ga0055531_100518942 121
760 3300003856 Ga0058692_1000651 Ga0058692_100065111 121
761 3300003856 Ga0058692_1013890 Ga0058692_10138903 121
762 3300004625 Ga0055543_1000008 Ga0055543_100000857 121
763 3300004625 Ga0055543_1000158 Ga0055543_100015835 121
764 3300004625 Ga0055543_1000263 Ga0055543_100026333 121
765 3300005262 Ga0065165_1000031 Ga0065165_100003172 121
766 3300005262 Ga0065165_1000041 Ga0065165_100004164 121
767 3300005262 Ga0065165_1000084 Ga0065165_1000084121 121
768 3300005262 Ga0065165_1034182 Ga0065165_10341822 121
769 3300005262 Ga0065165_1039619 Ga0065165_10396193 121
770 3300005262 Ga0065165_1055368 Ga0065165_10553683 121
771 3300005262 Ga0065165_1079876 Ga0065165_10798762 121
772 3300005289 Ga0065704_10137683 Ga0065704_101376832 121
773 3300005289 Ga0065704_10665693 Ga0065704_106656932 121
774 3300005329 Ga0070683_100552656 Ga0070683_1005526563 121
775 3300005331 Ga0070670_100000160 Ga0070670_10000016020 121
776 3300005331 Ga0070670_100133611 Ga0070670_1001336111 121
777 3300005335 Ga0070666_10438029 Ga0070666_104380292 121
778 3300005337 Ga0070682_101357988 Ga0070682_1013579881 121
779 3300005338 Ga0068868_101851282 Ga0068868_1018512821 121
780 3300005344 Ga0070661_100603418 Ga0070661_1006034182 121
781 3300005344 Ga0070661_100815188 Ga0070661_1008151881 121
782 3300005344 Ga0070661_100956661 Ga0070661_1009566612 121
783 3300005347 Ga0070668_100054086 Ga0070668_1000540864 121
784 3300005347 Ga0070668_100405507 Ga0070668_1004055072 121
785 3300005347 Ga0070668_100482492 Ga0070668_1004824922 121
786 3300005347 Ga0070668_100808790 Ga0070668_1008087902 121
787 3300005347 Ga0070668_101342495 Ga0070668_1013424951 121
788 3300005347 Ga0070668_101784401 Ga0070668_1017844012 121
789 3300005353 Ga0070669_100024928 Ga0070669_1000249282 121
790 3300005353 Ga0070669_100180066 Ga0070669_1001800662 121
791 3300005353 Ga0070669_100973327 Ga0070669_1009733271 121
792 3300005354 Ga0070675_100383261 Ga0070675_1003832611 121
793 3300005355 Ga0070671_100013500 Ga0070671_1000135002 121
794 3300005355 Ga0070671_100503752 Ga0070671_1005037522 121
795 3300005356 Ga0070674_102121993 Ga0070674_1021219931 121
796 3300005364 Ga0070673_100876418 Ga0070673_1008764182 121
797 3300005367 Ga0070667_100784861 Ga0070667_1007848612 121
798 3300005455 Ga0070663_100170749 Ga0070663_1001707492 121
799 3300005456 Ga0070678_100750252 Ga0070678_1007502522 121
800 3300005459 Ga0068867_101515586 Ga0068867_1015155861 121
801 3300005539 Ga0068853_100207758 Ga0068853_1002077582 121
802 3300005548 Ga0070665_100005844 Ga0070665_10000584412 121
803 3300005548 Ga0070665_100030475 Ga0070665_1000304756 121
804 3300005548 Ga0070665_100032832 Ga0070665_1000328321 121
805 3300005548 Ga0070665_100213012 Ga0070665_1002130123 121
806 3300005548 Ga0070665_100328437 Ga0070665_1003284371 121
807 3300005548 Ga0070665_101182587 Ga0070665_1011825872 121
808 3300005548 Ga0070665_101802296 Ga0070665_1018022961 121
809 3300005563 Ga0068855_100030372 Ga0068855_1000303723 121
810 3300005563 Ga0068855_100317861 Ga0068855_1003178612 121
811 3300005563 Ga0068855_101120624 Ga0068855_1011206242 121
812 3300005577 Ga0068857_101409713 Ga0068857_1014097132 121
813 3300005578 Ga0068854_100010614 Ga0068854_1000106145 121
814 3300005614 Ga0068856_100101170 Ga0068856_1001011702 121
815 3300005616 Ga0068852_101176693 Ga0068852_1011766932 121
816 3300005618 Ga0068864_100000240 Ga0068864_10000024045 121
817 3300005618 Ga0068864_100001714 Ga0068864_10000171412 121
818 3300005618 Ga0068864_100341215 Ga0068864_1003412152 121
819 3300005719 Ga0068861_100397653 Ga0068861_1003976532 121
820 3300005834 Ga0068851_10042342 Ga0068851_100423423 121
821 3300005841 Ga0068863_100001917 Ga0068863_10000191721 121
822 3300005841 Ga0068863_100735081 Ga0068863_1007350811 121
823 3300005841 Ga0068863_101163610 Ga0068863_1011636102 121
824 3300005842 Ga0068858_100001006 Ga0068858_1000010064 121
825 3300005842 Ga0068858_102240578 Ga0068858_1022405781 121
826 3300005844 Ga0068862_100226730 Ga0068862_1002267302 121
827 3300005983 Ga0081540_1010783 Ga0081540_10107834 121
828 3300006038 Ga0075365_10006204 Ga0075365_100062044 121
829 3300006038 Ga0075365_10021238 Ga0075365_100212382 121
830 3300006038 Ga0075365_10334231 Ga0075365_103342313 121
831 3300006038 Ga0075365_10350076 Ga0075365_103500763 121
832 3300006038 Ga0075365_10725838 Ga0075365_107258382 121
833 3300006038 Ga0075365_10981071 Ga0075365_109810712 121
834 3300006042 Ga0075368_10010047 Ga0075368_100100472 121
835 3300006042 Ga0075368_10011301 Ga0075368_100113012 121
836 3300006042 Ga0075368_10236157 Ga0075368_102361572 121
837 3300006042 Ga0075368_10307345 Ga0075368_103073452 121
838 3300006048 Ga0075363_100049133 Ga0075363_1000491333 121
839 3300006048 Ga0075363_100090371 Ga0075363_1000903713 121
840 3300006051 Ga0075364_10001052 Ga0075364_1000105211 121
841 3300006051 Ga0075364_10165349 Ga0075364_101653493 121
842 3300006051 Ga0075364_10334440 Ga0075364_103344402 121
843 3300006051 Ga0075364_10351014 Ga0075364_103510142 121
844 3300006051 Ga0075364_10575783 Ga0075364_105757832 121
845 3300006173 Ga0070716_101022326 Ga0070716_1010223262 121
846 3300006177 Ga0075362_10004265 Ga0075362_100042653 121
847 3300006178 Ga0075367_10010146 Ga0075367_100101462 121
848 3300006178 Ga0075367_10028237 Ga0075367_100282372 121
849 3300006178 Ga0075367_10615790 Ga0075367_106157902 121
850 3300006186 Ga0075369_10003814 Ga0075369_100038145 121
851 3300006186 Ga0075369_10021204 Ga0075369_100212042 121
852 3300006186 Ga0075369_10027411 Ga0075369_100274112 121
853 3300006186 Ga0075369_10031385 Ga0075369_100313852 121
854 3300006195 Ga0075366_10030453 Ga0075366_100304533 121
855 3300006195 Ga0075366_10046399 Ga0075366_100463992 121
856 3300006237 Ga0097621_100435565 Ga0097621_1004355652 121
857 3300006353 Ga0075370_10035786 Ga0075370_100357862 121
858 3300006353 Ga0075370_10103761 Ga0075370_101037612 121
859 3300006353 Ga0075370_10104739 Ga0075370_101047392 121
860 3300006353 Ga0075370_10114996 Ga0075370_101149963 121
861 3300006353 Ga0075370_10123658 Ga0075370_101236582 121
862 3300006353 Ga0075370_10711266 Ga0075370_107112661 121
863 3300006353 Ga0075370_10900826 Ga0075370_109008261 121
864 3300006353 Ga0075370_10948807 Ga0075370_109488071 121
865 3300006358 Ga0068871_101940169 Ga0068871_1019401692 121
866 3300006881 Ga0068865_100005107 Ga0068865_1000051074 121
867 3300006881 Ga0068865_100566870 Ga0068865_1005668702 121
868 3300006946 Ga0079104_1000452 Ga0079104_100045220 121
869 3300006948 Ga0099826_10000109 Ga0099826_100001099 121
870 3300006948 Ga0099826_10007398 Ga0099826_100073982 121
871 3300009092 Ga0105250_10002929 Ga0105250_100029292 121
872 3300009092 Ga0105250_10034101 Ga0105250_100341013 121
873 3300009092 Ga0105250_10086700 Ga0105250_100867002 121
874 3300009092 Ga0105250_10180982 Ga0105250_101809822 121
875 3300009093 Ga0105240_10000460 Ga0105240_1000046033 121
876 3300009094 Ga0111539_13408799 Ga0111539_134087992 121
877 3300009101 Ga0105247_10012709 Ga0105247_100127097 121
878 3300009101 Ga0105247_10353343 Ga0105247_103533433 121
879 3300009101 Ga0105247_10801600 Ga0105247_108016002 121
880 3300009148 Ga0105243_10208802 Ga0105243_102088022 121
881 3300009148 Ga0105243_10493996 Ga0105243_104939962 121
882 3300009148 Ga0105243_11112475 Ga0105243_111124752 121
883 3300009148 Ga0105243_11316340 Ga0105243_113163401 121
884 3300009148 Ga0105243_12887611 Ga0105243_128876111 121
885 3300009174 Ga0105241_10101290 Ga0105241_101012902 121
886 3300009174 Ga0105241_11722792 Ga0105241_117227921 121
887 3300009177 Ga0105248_10000176 Ga0105248_1000017640 121
888 3300009177 Ga0105248_10004022 Ga0105248_100040222 121
889 3300009177 Ga0105248_10005982 Ga0105248_1000598211 121
890 3300009177 Ga0105248_10107777 Ga0105248_101077772 121
891 3300009177 Ga0105248_10107913 Ga0105248_101079132 121
892 3300009177 Ga0105248_10329291 Ga0105248_103292912 121
893 3300009177 Ga0105248_11815045 Ga0105248_118150452 121
894 3300009545 Ga0105237_10000814 Ga0105237_1000081433 121
895 3300009545 Ga0105237_10585591 Ga0105237_105855912 121
896 3300009545 Ga0105237_11236926 Ga0105237_112369262 121
897 3300009545 Ga0105237_11463543 Ga0105237_114635432 121
898 3300009551 Ga0105238_10027119 Ga0105238_100271196 121
899 3300009551 Ga0105238_10077631 Ga0105238_100776315 121
900 3300009551 Ga0105238_10264115 Ga0105238_102641152 121
901 3300009551 Ga0105238_10505742 Ga0105238_105057422 121
902 3300009551 Ga0105238_11397939 Ga0105238_113979391 121
903 3300009553 Ga0105249_10586507 Ga0105249_105865072 121
904 3300009553 Ga0105249_13156344 Ga0105249_131563441 121
905 3300009763 Ga0123340_1093941 Ga0123340_10939412 121
906 3300009765 Ga0123341_1000040 Ga0123341_100004020 121
907 3300009765 Ga0123341_1073155 Ga0123341_10731552 121
908 3300009766 Ga0123342_1014285 Ga0123342_10142855 121
909 3300009766 Ga0123342_1039459 Ga0123342_10394592 121
910 3300009987 Ga0105030_113102 Ga0105030_1131021 121
911 3300010375 Ga0105239_10000961 Ga0105239_1000096133 121
912 3300010375 Ga0105239_10159048 Ga0105239_101590482 121
913 3300010375 Ga0105239_10193801 Ga0105239_101938012 121
914 3300010375 Ga0105239_10233349 Ga0105239_102333492 121
915 3300010375 Ga0105239_10371799 Ga0105239_103717993 121
916 3300010375 Ga0105239_10518869 Ga0105239_105188693 121
917 3300010375 Ga0105239_11549480 Ga0105239_115494802 121
918 3300011119 Ga0105246_10353607 Ga0105246_103536073 121
919 3300011119 Ga0105246_10649120 Ga0105246_106491202 121
920 3300011119 Ga0105246_11733790 Ga0105246_117337902 121
921 3300011119 Ga0105246_11861212 Ga0105246_118612122 121
922 3300012503 Ga0157313_1003595 Ga0157313_10035952 121
923 3300013100 Ga0157373_10003509 Ga0157373_1000350912 121
924 3300013100 Ga0157373_10042843 Ga0157373_100428432 121
925 3300013100 Ga0157373_10290460 Ga0157373_102904603 121
926 3300013102 Ga0157371_10000004 Ga0157371_10000004404 121
927 3300013102 Ga0157371_10003340 Ga0157371_1000334010 121
928 3300013102 Ga0157371_11243995 Ga0157371_112439952 121
929 3300013104 Ga0157370_10000185 Ga0157370_1000018531 121
930 3300013104 Ga0157370_10000952 Ga0157370_1000095211 121
931 3300013104 Ga0157370_10018309 Ga0157370_100183094 121
932 3300013104 Ga0157370_10136553 Ga0157370_101365533 121
933 3300013104 Ga0157370_10448370 Ga0157370_104483702 121
934 3300013105 Ga0157369_10070646 Ga0157369_100706463 121
935 3300013105 Ga0157369_10238099 Ga0157369_102380993 121
936 3300013105 Ga0157369_12316037 Ga0157369_123160371 121
937 3300013249 Ga0171463_1001 Ga0171463_1001776 121
938 3300013297 Ga0157378_11596515 Ga0157378_115965152 121
939 3300013306 Ga0163162_10613725 Ga0163162_106137251 121
940 3300013306 Ga0163162_10995183 Ga0163162_109951833 121
941 3300013307 Ga0157372_11291385 Ga0157372_112913852 121
942 3300013308 Ga0157375_10981328 Ga0157375_109813283 121
943 3300013308 Ga0157375_12263679 Ga0157375_122636791 121
944 3300014325 Ga0163163_10219368 Ga0163163_102193683 121
945 3300014497 Ga0182008_10222477 Ga0182008_102224773 121
946 3300014497 Ga0182008_10792027 Ga0182008_107920272 121
947 3300014968 Ga0157379_10022628 Ga0157379_100226283 121
948 3300014968 Ga0157379_10071276 Ga0157379_100712765 121
949 3300014968 Ga0157379_12163972 Ga0157379_121639722 121
950 3300015262 Ga0182007_10009194 Ga0182007_100091945 121
951 3300015262 Ga0182007_10016853 Ga0182007_100168533 121
952 3300015690 Ga0183363_1032 Ga0183363_103234 121
953 3300017792 Ga0163161_10302984 Ga0163161_103029842 121
954 3300017792 Ga0163161_10609878 Ga0163161_106098783 121
955 3300017792 Ga0163161_11065777 Ga0163161_110657772 121
956 3300021320 Ga0214544_1000012 Ga0214544_100001268 121
957 3300021321 Ga0214542_1000011 Ga0214542_100001162 121
958 3300021321 Ga0214542_1020695 Ga0214542_10206952 121
959 3300021327 Ga0214543_1000004 Ga0214543_1000004438 121
960 3300021327 Ga0214543_1000259 Ga0214543_100025939 121
961 3300021384 Ga0213876_10009519 Ga0213876_100095192 121
962 3300021384 Ga0213876_10124471 Ga0213876_101244713 121
963 3300022739 Ga0228711_1000019 Ga0228711_100001984 121
964 3300022740 Ga0228710_1000022 Ga0228710_100002284 121
965 3300025206 Ga0209435_100011 Ga0209435_100011405 121
966 3300025208 Ga0209436_100006 Ga0209436_1000064 121
967 3300025208 Ga0209436_100461 Ga0209436_10046112 121
968 3300025208 Ga0209436_120174 Ga0209436_1201743 121
969 3300025228 Ga0209672_106589 Ga0209672_1065891 121
970 3300025230 Ga0209563_107244 Ga0209563_1072443 121
971 3300025233 Ga0209437_100056 Ga0209437_10005657 121
972 3300025233 Ga0209437_100196 Ga0209437_10019660 121
973 3300025233 Ga0209437_123673 Ga0209437_1236732 121
974 3300025245 Ga0207425_1000012 Ga0207425_1000012209 121
975 3300025245 Ga0207425_1002334 Ga0207425_10023343 121
976 3300025245 Ga0207425_1011264 Ga0207425_10112642 121
977 3300025245 Ga0207425_1013527 Ga0207425_10135273 121
978 3300025245 Ga0207425_1019165 Ga0207425_10191652 121
979 3300025246 Ga0209646_1000024 Ga0209646_10000245 121
980 3300025246 Ga0209646_1013773 Ga0209646_10137733 121
981 3300025250 Ga0209026_1000030 Ga0209026_10000305 121
982 3300025250 Ga0209026_1009025 Ga0209026_10090252 121
983 3300025250 Ga0209026_1013997 Ga0209026_10139973 121
984 3300025254 Ga0209148_1012672 Ga0209148_10126722 121
985 3300025256 Ga0209759_1000011 Ga0209759_1000011405 121
986 3300025258 Ga0209129_1000081 Ga0209129_1000081152 121
987 3300025258 Ga0209129_1000105 Ga0209129_1000105163 121
988 3300025258 Ga0209129_1001283 Ga0209129_100128312 121
989 3300025258 Ga0209129_1002860 Ga0209129_10028602 121
990 3300025258 Ga0209129_1004702 Ga0209129_10047022 121
991 3300025258 Ga0209129_1006056 Ga0209129_10060562 121
992 3300025258 Ga0209129_1006941 Ga0209129_10069413 121
993 3300025258 Ga0209129_1026787 Ga0209129_10267873 121
994 3300025261 Ga0209233_1000037 Ga0209233_1000037502 121
995 3300025261 Ga0209233_1000071 Ga0209233_100007157 121
996 3300025261 Ga0209233_1000243 Ga0209233_100024363 121
997 3300025263 Ga0209565_1021330 Ga0209565_10213303 121
998 3300025272 Ga0209455_1021228 Ga0209455_10212282 121
999 3300025272 Ga0209455_1032763 Ga0209455_10327632 121
1000 3300025273 Ga0209673_1000015 Ga0209673_1000015444 121
1001 3300025273 Ga0209673_1000709 Ga0209673_100070916 121
1002 3300025273 Ga0209673_1002913 Ga0209673_10029133 121
1003 3300025273 Ga0209673_1003355 Ga0209673_10033551 121
1004 3300025273 Ga0209673_1003862 Ga0209673_10038623 121
1005 3300025273 Ga0209673_1006637 Ga0209673_10066373 121
1006 3300025273 Ga0209673_1017237 Ga0209673_10172373 121
1007 3300025273 Ga0209673_1024310 Ga0209673_10243103 121
1008 3300025273 Ga0209673_1071668 Ga0209673_10716682 121
1009 3300025284 Ga0209130_1000002 Ga0209130_1000002140 121
1010 3300025284 Ga0209130_1000005 Ga0209130_100000531 121
1011 3300025284 Ga0209130_1000088 Ga0209130_1000088137 121
1012 3300025284 Ga0209130_1009773 Ga0209130_10097732 121
1013 3300025284 Ga0209130_1018896 Ga0209130_10188962 121
1014 3300025284 Ga0209130_1061378 Ga0209130_10613781 121
1015 3300025291 Ga0209675_1027511 Ga0209675_10275112 121
1016 3300025291 Ga0209675_1057977 Ga0209675_10579772 121
1017 3300025292 Ga0209676_1004283 Ga0209676_10042834 121
1018 3300025292 Ga0209676_1021813 Ga0209676_10218132 121
1019 3300025292 Ga0209676_1023267 Ga0209676_10232673 121
1020 3300025294 Ga0209025_1000024 Ga0209025_1000024209 121
1021 3300025294 Ga0209025_1000037 Ga0209025_1000037348 121
1022 3300025294 Ga0209025_1000060 Ga0209025_1000060271 121
1023 3300025294 Ga0209025_1000295 Ga0209025_100029579 121
1024 3300025294 Ga0209025_1000574 Ga0209025_10005745 121
1025 3300025294 Ga0209025_1006666 Ga0209025_10066669 121
1026 3300025294 Ga0209025_1009433 Ga0209025_10094334 121
1027 3300025294 Ga0209025_1013443 Ga0209025_10134433 121
1028 3300025294 Ga0209025_1028633 Ga0209025_10286333 121
1029 3300025294 Ga0209025_1057488 Ga0209025_10574882 121
1030 3300025295 Ga0209564_1000093 Ga0209564_100009333 121
1031 3300025295 Ga0209564_1000576 Ga0209564_10005769 121
1032 3300025295 Ga0209564_1000744 Ga0209564_100074414 121
1033 3300025295 Ga0209564_1003315 Ga0209564_10033153 121
1034 3300025295 Ga0209564_1005971 Ga0209564_10059713 121
1035 3300025295 Ga0209564_1006979 Ga0209564_10069792 121
1036 3300025295 Ga0209564_1009085 Ga0209564_10090853 121
1037 3300025297 Ga0209758_1000046 Ga0209758_1000046333 121
1038 3300025297 Ga0209758_1000441 Ga0209758_100044127 121
1039 3300025297 Ga0209758_1000575 Ga0209758_10005757 121
1040 3300025297 Ga0209758_1000810 Ga0209758_100081041 121
1041 3300025297 Ga0209758_1000908 Ga0209758_100090817 121
1042 3300025297 Ga0209758_1001120 Ga0209758_100112028 121
1043 3300025297 Ga0209758_1001232 Ga0209758_10012322 121
1044 3300025297 Ga0209758_1010784 Ga0209758_10107842 121
1045 3300025297 Ga0209758_1013969 Ga0209758_10139692 121
1046 3300025297 Ga0209758_1026693 Ga0209758_10266932 121
1047 3300025298 Ga0209050_1000034 Ga0209050_1000034270 121
1048 3300025298 Ga0209050_1005438 Ga0209050_10054388 121
1049 3300025298 Ga0209050_1009000 Ga0209050_10090004 121
1050 3300025298 Ga0209050_1024927 Ga0209050_10249273 121
1051 3300025298 Ga0209050_1077227 Ga0209050_10772272 121
1052 3300025299 Ga0209256_1000027 Ga0209256_1000027389 121
1053 3300025299 Ga0209256_1000646 Ga0209256_100064615 121
1054 3300025299 Ga0209256_1003123 Ga0209256_10031234 121
1055 3300025299 Ga0209256_1004576 Ga0209256_10045765 121
1056 3300025299 Ga0209256_1005525 Ga0209256_10055255 121
1057 3300025299 Ga0209256_1007741 Ga0209256_10077417 121
1058 3300025299 Ga0209256_1014779 Ga0209256_10147793 121
1059 3300025299 Ga0209256_1014852 Ga0209256_10148521 121
1060 3300025302 Ga0207426_1000012 Ga0207426_1000012192 121
1061 3300025302 Ga0207426_1000013 Ga0207426_1000013140 121
1062 3300025302 Ga0207426_1000015 Ga0207426_1000015568 121
1063 3300025302 Ga0207426_1000063 Ga0207426_1000063308 121
1064 3300025302 Ga0207426_1000172 Ga0207426_100017228 121
1065 3300025302 Ga0207426_1001042 Ga0207426_10010426 121
1066 3300025303 Ga0209051_1000435 Ga0209051_100043537 121
1067 3300025303 Ga0209051_1001495 Ga0209051_100149519 121
1068 3300025303 Ga0209051_1002880 Ga0209051_100288011 121
1069 3300025303 Ga0209051_1019893 Ga0209051_10198933 121
1070 3300025303 Ga0209051_1036220 Ga0209051_10362203 121
1071 3300025303 Ga0209051_1067311 Ga0209051_10673111 121
1072 3300025304 Ga0209257_1000052 Ga0209257_1000052140 121
1073 3300025304 Ga0209257_1000100 Ga0209257_10001005 121
1074 3300025304 Ga0209257_1000598 Ga0209257_100059841 121
1075 3300025304 Ga0209257_1001343 Ga0209257_100134329 121
1076 3300025304 Ga0209257_1012130 Ga0209257_10121302 121
1077 3300025304 Ga0209257_1020887 Ga0209257_10208872 121
1078 3300025304 Ga0209257_1023518 Ga0209257_10235182 121
1079 3300025321 Ga0207656_10225010 Ga0207656_102250102 121
1080 3300025321 Ga0207656_10340142 Ga0207656_103401422 121
1081 3300025711 Ga0207696_1031812 Ga0207696_10318122 121
1082 3300025711 Ga0207696_1032059 Ga0207696_10320593 121
1083 3300025711 Ga0207696_1084825 Ga0207696_10848252 121
1084 3300025735 Ga0207713_1085596 Ga0207713_10855962 121
1085 3300025900 Ga0207710_10020985 Ga0207710_100209852 121
1086 3300025903 Ga0207680_10297600 Ga0207680_102976003 121
1087 3300025903 Ga0207680_10401684 Ga0207680_104016842 121
1088 3300025904 Ga0207647_10175295 Ga0207647_101752952 121
1089 3300025908 Ga0207643_10415325 Ga0207643_104153252 121
1090 3300025909 Ga0207705_11060769 Ga0207705_110607691 121
1091 3300025911 Ga0207654_10045441 Ga0207654_100454412 121
1092 3300025913 Ga0207695_10000036 Ga0207695_1000003633 121
1093 3300025914 Ga0207671_10000517 Ga0207671_1000051710 121
1094 3300025914 Ga0207671_10745778 Ga0207671_107457782 121
1095 3300025923 Ga0207681_10049100 Ga0207681_100491001 121
1096 3300025923 Ga0207681_10108503 Ga0207681_101085033 121
1097 3300025923 Ga0207681_10873051 Ga0207681_108730512 121
1098 3300025924 Ga0207694_10133400 Ga0207694_101334002 121
1099 3300025924 Ga0207694_10184930 Ga0207694_101849302 121
1100 3300025924 Ga0207694_11217587 Ga0207694_112175872 121
1101 3300025925 Ga0207650_10000391 Ga0207650_1000039133 121
1102 3300025925 Ga0207650_11261671 Ga0207650_112616711 121
1103 3300025931 Ga0207644_10007043 Ga0207644_100070437 121
1104 3300025932 Ga0207690_11048426 Ga0207690_110484262 121
1105 3300025933 Ga0207706_10382793 Ga0207706_103827932 121
1106 3300025933 Ga0207706_10840126 Ga0207706_108401261 121
1107 3300025935 Ga0207709_10448230 Ga0207709_104482302 121
1108 3300025935 Ga0207709_10487815 Ga0207709_104878152 121
1109 3300025937 Ga0207669_10139013 Ga0207669_101390133 121
1110 3300025938 Ga0207704_10016615 Ga0207704_100166152 121
1111 3300025938 Ga0207704_11388388 Ga0207704_113883882 121
1112 3300025941 Ga0207711_10000088 Ga0207711_1000008831 121
1113 3300025941 Ga0207711_10006678 Ga0207711_100066783 121
1114 3300025941 Ga0207711_10050074 Ga0207711_100500742 121
1115 3300025941 Ga0207711_10065919 Ga0207711_100659192 121
1116 3300025941 Ga0207711_10300230 Ga0207711_103002302 121
1117 3300025941 Ga0207711_10368907 Ga0207711_103689072 121
1118 3300025941 Ga0207711_11229739 Ga0207711_112297391 121
1119 3300025942 Ga0207689_10022429 Ga0207689_100224294 121
1120 3300025942 Ga0207689_10837715 Ga0207689_108377151 121
1121 3300025942 Ga0207689_10974135 Ga0207689_109741352 121
1122 3300025944 Ga0207661_10228577 Ga0207661_102285772 121
1123 3300025945 Ga0207679_11535789 Ga0207679_115357892 121
1124 3300025949 Ga0207667_10106886 Ga0207667_101068862 121
1125 3300025949 Ga0207667_10267492 Ga0207667_102674923 121
1126 3300025972 Ga0207668_10549373 Ga0207668_105493732 121
1127 3300025972 Ga0207668_10655134 Ga0207668_106551342 121
1128 3300025972 Ga0207668_10764367 Ga0207668_107643672 121
1129 3300025972 Ga0207668_11641758 Ga0207668_116417582 121
1130 3300025981 Ga0207640_10009208 Ga0207640_100092085 121
1131 3300025986 Ga0207658_10106810 Ga0207658_101068102 121
1132 3300026023 Ga0207677_10553827 Ga0207677_105538272 121
1133 3300026035 Ga0207703_10000049 Ga0207703_10000049128 121
1134 3300026035 Ga0207703_10000065 Ga0207703_10000065118 121
1135 3300026041 Ga0207639_10083560 Ga0207639_100835603 121
1136 3300026067 Ga0207678_11541227 Ga0207678_115412271 121
1137 3300026078 Ga0207702_10009604 Ga0207702_100096043 121
1138 3300026078 Ga0207702_10630023 Ga0207702_106300232 121
1139 3300026078 Ga0207702_11873570 Ga0207702_118735702 121
1140 3300026088 Ga0207641_10000011 Ga0207641_10000011260 121
1141 3300026088 Ga0207641_10000011 Ga0207641_10000011408 121
1142 3300026088 Ga0207641_10570758 Ga0207641_105707582 121
1143 3300026088 Ga0207641_11137079 Ga0207641_111370792 121
1144 3300026095 Ga0207676_10000117 Ga0207676_100001175 121
1145 3300026095 Ga0207676_10000450 Ga0207676_100004505 121
1146 3300026095 Ga0207676_11980020 Ga0207676_119800202 121
1147 3300026121 Ga0207683_10283332 Ga0207683_102833322 121
1148 3300026121 Ga0207683_10666579 Ga0207683_106665792 121
1149 3300026142 Ga0207698_10216991 Ga0207698_102169913 121
1150 3300026142 Ga0207698_11180582 Ga0207698_111805821 121
1151 3300026142 Ga0207698_12012934 Ga0207698_120129342 121
1152 3300027111 Ga0209281_1000200 Ga0209281_100020064 121
1153 3300027111 Ga0209281_1000227 Ga0209281_100022790 121
1154 3300027111 Ga0209281_1000488 Ga0209281_100048841 121
1155 3300027312 Ga0209371_1000009 Ga0209371_1000009523 121
1156 3300027312 Ga0209371_1000315 Ga0209371_10003155 121
1157 3300027312 Ga0209371_1000424 Ga0209371_10004248 121
1158 3300027312 Ga0209371_1001877 Ga0209371_10018775 121
1159 3300027312 Ga0209371_1051918 Ga0209371_10519182 121
1160 3300027666 Ga0209282_1000042 Ga0209282_100004290 121
1161 3300027666 Ga0209282_1002131 Ga0209282_10021317 121
1162 3300027666 Ga0209282_1067761 Ga0209282_10677613 121
1163 3300027866 Ga0209813_10006309 Ga0209813_100063093 121
1164 3300028379 Ga0268266_10017078 Ga0268266_100170786 121
1165 3300028379 Ga0268266_10023603 Ga0268266_100236031 121
1166 3300028379 Ga0268266_10026656 Ga0268266_100266563 121
1167 3300028379 Ga0268266_10645466 Ga0268266_106454662 121
1168 3300028379 Ga0268266_10950213 Ga0268266_109502132 121
1169 3300028379 Ga0268266_12339963 Ga0268266_123399632 121
1170 3300028556 Ga0265337_1031981 Ga0265337_10319813 121
1171 3300028786 Ga0307517_10011375 Ga0307517_1001137511 121
1172 3300028786 Ga0307517_10023634 Ga0307517_100236344 121
1173 3300028786 Ga0307517_10076425 Ga0307517_100764252 121
1174 3300028794 Ga0307515_10000121 Ga0307515_1000012183 121
1175 3300028794 Ga0307515_10001309 Ga0307515_1000130917 121
1176 3300028794 Ga0307515_10001439 Ga0307515_100014399 121
1177 3300028794 Ga0307515_10123486 Ga0307515_101234862 121
1178 3300028794 Ga0307515_10138941 Ga0307515_101389412 121
1179 3300028800 Ga0265338_10053113 Ga0265338_100531134 121
1180 3300028800 Ga0265338_10073745 Ga0265338_100737453 121
1181 3300030500 Ga0268256_1000010 Ga0268256_1000010522 121
1182 3300030500 Ga0268256_1001516 Ga0268256_10015165 121
1183 3300030500 Ga0268256_1003952 Ga0268256_10039526 121
1184 3300030500 Ga0268256_1057698 Ga0268256_10576982 121
1185 3300030521 Ga0307511_10031341 Ga0307511_100313413 121
1186 3300030742 Ga0316183_1129785 Ga0316183_11297853 121
1187 3300030744 Ga0316181_1057884 Ga0316181_10578843 121
1188 3300031239 Ga0265328_10000269 Ga0265328_1000026925 121
1189 3300031239 Ga0265328_10005153 Ga0265328_100051536 121
1190 3300031239 Ga0265328_10013865 Ga0265328_100138654 121
1191 3300031239 Ga0265328_10028534 Ga0265328_100285342 121
1192 3300031250 Ga0265331_10000017 Ga0265331_10000017258 121
1193 3300031250 Ga0265331_10052588 Ga0265331_100525882 121
1194 3300031251 Ga0265327_10003050 Ga0265327_1000305014 121
1195 3300031251 Ga0265327_10051465 Ga0265327_100514653 121
1196 3300031456 Ga0307513_10002360 Ga0307513_100023609 121
1197 3300031456 Ga0307513_10009529 Ga0307513_100095297 121
1198 3300031456 Ga0307513_10013648 Ga0307513_100136485 121
1199 3300031456 Ga0307513_10617623 Ga0307513_106176232 121
1200 3300031548 Ga0307408_102483871 Ga0307408_1024838711 121
1201 3300031616 Ga0307508_10132253 Ga0307508_101322532 121
1202 3300031616 Ga0307508_10331662 Ga0307508_103316621 121
1203 3300031649 Ga0307514_10392924 Ga0307514_103929242 121
1204 3300031730 Ga0307516_10094347 Ga0307516_100943474 121
1205 3300031731 Ga0307405_10002866 Ga0307405_100028662 121
1206 3300031731 Ga0307405_10080836 Ga0307405_100808363 121
1207 3300031731 Ga0307405_10183326 Ga0307405_101833262 121
1208 3300031824 Ga0307413_10066432 Ga0307413_100664323 121
1209 3300031824 Ga0307413_10502494 Ga0307413_105024942 121
1210 3300031824 Ga0307413_10550779 Ga0307413_105507792 121
1211 3300031824 Ga0307413_11662035 Ga0307413_116620351 121
1212 3300031852 Ga0307410_11309745 Ga0307410_113097452 121
1213 3300031901 Ga0307406_10004188 Ga0307406_100041889 121
1214 3300031901 Ga0307406_10105837 Ga0307406_101058373 121
1215 3300031901 Ga0307406_10445064 Ga0307406_104450642 121
1216 3300031901 Ga0307406_11251775 Ga0307406_112517752 121
1217 3300031911 Ga0307412_10156165 Ga0307412_101561652 121
1218 3300031911 Ga0307412_10208968 Ga0307412_102089682 121
1219 3300031911 Ga0307412_11295844 Ga0307412_112958441 121
1220 3300031967 Ga0315914_1000009 Ga0315914_100000937 121
1221 3300031995 Ga0307409_101484028 Ga0307409_1014840281 121
1222 3300031995 Ga0307409_101748957 Ga0307409_1017489572 121
1223 3300032002 Ga0307416_100575107 Ga0307416_1005751072 121
1224 3300032002 Ga0307416_102347334 Ga0307416_1023473342 121
1225 3300032002 Ga0307416_103177913 Ga0307416_1031779132 121
1226 3300032004 Ga0307414_10085311 Ga0307414_100853112 121
1227 3300032004 Ga0307414_10438627 Ga0307414_104386272 121
1228 3300032004 Ga0307414_10733037 Ga0307414_107330373 121
1229 3300032004 Ga0307414_11018868 Ga0307414_110188682 121
1230 3300032005 Ga0307411_10074830 Ga0307411_100748302 121
1231 3300032005 Ga0307411_10195726 Ga0307411_101957262 121
1232 3300032126 Ga0307415_101778897 Ga0307415_1017788972 121
1233 3300033180 Ga0307510_10069446 Ga0307510_100694463 121
1234 3300033430 Ga0315913_1000015 Ga0315913_100001590 121
1235 3300033464 Ga0315915_1000013 Ga0315915_1000013151 121
1236 3300035113 Ga0373936_0007277 Ga0373936_0007277_2501_2866 121
1237 3300035692 Ga0373935_0023925 Ga0373935_0023925_160_525 121
1238 3300035695 Ga0373927_0000086 Ga0373927_0000086_39443_39808 121
1239 3300035695 Ga0373927_0847122 Ga0373927_0847122_175_540 121
1240 3300037068 Ga0373925_0049197 Ga0373925_0049197_115_480 121
1241 3300037312 Ga0395899_0000115 Ga0395899_0000115_116300_116665 121
1242 3300037418 Ga0395900_0000002 Ga0395900_0000002_153630_153995 121
1243 3300037418 Ga0395900_0095061 Ga0395900_0095061_1351_1716 121
1244 3300037418 Ga0395900_0245810 Ga0395900_0245810_189_557 121
1245 3300037466 Ga0395898_0334290 Ga0395898_0334290_124_489 121
1246 3300037466 Ga0395898_0451169 Ga0395898_0451169_290_655 121
1247 3300037471 Ga0395905_0000775 Ga0395905_0000775_16660_17025 121
1248 3300037471 Ga0395905_0004148 Ga0395905_0004148_2256_2621 121
1249 3300037471 Ga0395905_0004590 Ga0395905_0004590_124_489 121
1250 3300037471 Ga0395905_0035866 Ga0395905_0035866_2213_2578 121
1251 3300037471 Ga0395905_0278327 Ga0395905_0278327_940_1305 121
1252 3300037471 Ga0395905_1174878 Ga0395905_1174878_49_414 121
1253 3300038443 Ga0395901_0000021 Ga0395901_0000021_140910_141275 121
1254 3300038443 Ga0395901_0678106 Ga0395901_0678106_63_431 121
1255 3300038443 Ga0395901_2121977 Ga0395901_2121977_32_397 121
1256 3300039062 Ga0400483_069742 Ga0400483_069742_188_553 121
1257 3300039437 Ga0436365_1337824 Ga0436365_1337824_825_1190 121
1258 3300039437 Ga0436365_1539869 Ga0436365_1539869_2106_2471 121
1259 3300039447 Ga0436361_0274223 Ga0436361_0274223_767_1132 121
1260 3300041411 Ga0439466_0066170 Ga0439466_0066170_577_942 121
1261 3300041413 Ga0439465_0019332 Ga0439465_0019332_1380_1745 121
1262 3300041413 Ga0439465_0241362 Ga0439465_0241362_47_412 121
1263 3300041443 Ga0451789_1120526 Ga0451789_1120526_845_1210 121
1264 3300041452 Ga0451793_0777568 Ga0451793_0777568_235_600 121
1265 3300041458 Ga0451798_0546958 Ga0451798_0546958_199_564 121
1266 3300041459 Ga0451800_0889189 Ga0451800_0889189_116_481 121
1267 3300041491 Ga0451833_0083929 Ga0451833_0083929_167_532 121
1268 3300041494 Ga0451837_0020740 Ga0451837_0020740_54_419 121
1269 3300041496 Ga0451839_0309708 Ga0451839_0309708_275_640 121
1270 3300041501 Ga0451845_0572252 Ga0451845_0572252_124_489 121
1271 3300041503 Ga0451847_0008967 Ga0451847_0008967_543_908 121
1272 3300041505 Ga0451849_0309163 Ga0451849_0309163_945_1310 121
1273 3300041507 Ga0451851_0018808 Ga0451851_0018808_1295_1660 121
1274 3300041509 Ga0451843_0234753 Ga0451843_0234753_632_997 121
1275 3300041511 Ga0451855_1877089 Ga0451855_1877089_74_439 121
1276 3300042004 Ga0439445_0134722 Ga0439445_0134722_181_546 121
1277 3300042014 Ga0439457_145475 Ga0439457_145475_30_395 121
1278 3300042137 Ga0450902_050370 Ga0450902_050370_149_514 121
1279 3300042145 Ga0450906_004335 Ga0450906_004335_939_1304 121
1280 3300042531 Ga0450918_003239 Ga0450918_003239_1839_2204 121
1281 3300042533 Ga0450901_004681 Ga0450901_004681_854_1219 121
1282 3300044684 Ga0466966_0240813 Ga0466966_0240813_190_555 121
1283 3300044735 Ga0466968_0154008 Ga0466968_0154008_422_787 121
1284 3300044765 Ga0466970_0046618 Ga0466970_0046618_714_1079 121
1285 3300044765 Ga0466970_0104303 Ga0466970_0104303_718_1083 121
1286 3300046454 Ga0495592_0159316 Ga0495592_0159316_625_990 121
1287 3300046457 Ga0495590_0065412 Ga0495590_0065412_764_1129 121
1288 3300046459 Ga0495629_0041534 Ga0495629_0041534_2379_2744 121
1289 3300046459 Ga0495629_0070621 Ga0495629_0070621_685_1050 121
1290 3300046460 Ga0495638_0000788 Ga0495638_0000788_25212_25577 121
1291 3300046460 Ga0495638_0027611 Ga0495638_0027611_564_929 121
1292 3300046460 Ga0495638_0514346 Ga0495638_0514346_55_420 121
1293 3300046471 Ga0495650_0037454 Ga0495650_0037454_932_1297 121
1294 3300046492 Ga0495585_0025868 Ga0495585_0025868_1956_2321 121
1295 3300046492 Ga0495585_0104218 Ga0495585_0104218_339_704 121
1296 3300046492 Ga0495585_0216711 Ga0495585_0216711_26_391 121
1297 3300046492 Ga0495585_0325579 Ga0495585_0325579_15_380 121
1298 3300046506 Ga0495583_0046211 Ga0495583_0046211_764_1129 121
1299 3300046506 Ga0495583_0080675 Ga0495583_0080675_1039_1404 121
1300 3300046507 Ga0495606_0061197 Ga0495606_0061197_384_749 121
1301 3300046507 Ga0495606_0088372 Ga0495606_0088372_260_625 121
1302 3300046507 Ga0495606_0518369 Ga0495606_0518369_70_435 121
1303 3300046512 Ga0495610_0070490 Ga0495610_0070490_1031_1396 121
1304 3300046512 Ga0495610_0073033 Ga0495610_0073033_93_458 121
1305 3300046515 Ga0495620_0073896 Ga0495620_0073896_994_1359 121
1306 3300046515 Ga0495620_0074969 Ga0495620_0074969_606_971 121
1307 3300046515 Ga0495620_0114149 Ga0495620_0114149_79_444 121
1308 3300046518 Ga0495631_0002313 Ga0495631_0002313_2670_3035 121
1309 3300046519 Ga0495632_0061531 Ga0495632_0061531_19_384 121
1310 3300046520 Ga0495637_0260066 Ga0495637_0260066_114_479 121
1311 3300046522 Ga0495643_0004997 Ga0495643_0004997_625_990 121
1312 3300046522 Ga0495643_0071047 Ga0495643_0071047_687_1052 121
1313 3300046522 Ga0495643_0160402 Ga0495643_0160402_40_411 121
1314 3300046524 Ga0495648_0039283 Ga0495648_0039283_2352_2717 121
1315 3300046530 Ga0495654_0000321 Ga0495654_0000321_11371_11736 121
1316 3300046530 Ga0495654_0097209 Ga0495654_0097209_292_657 121
1317 3300046531 Ga0495665_0255845 Ga0495665_0255845_285_650 121
1318 3300046537 Ga0495598_0023253 Ga0495598_0023253_283_654 121
1319 3300046538 Ga0495609_0069570 Ga0495609_0069570_616_981 121
1320 3300046538 Ga0495609_0141709 Ga0495609_0141709_12_377 121
1321 3300046539 Ga0495621_0057343 Ga0495621_0057343_817_1188 121
1322 3300046542 Ga0495597_0000813 Ga0495597_0000813_11698_12063 121
1323 3300046542 Ga0495597_0003637 Ga0495597_0003637_6451_6816 121
1324 3300046542 Ga0495597_0051736 Ga0495597_0051736_10_375 121
1325 3300046557 Ga0495622_0000963 Ga0495622_0000963_9492_9857 121
1326 3300046557 Ga0495622_0002438 Ga0495622_0002438_5183_5548 121
1327 3300046557 Ga0495622_0082184 Ga0495622_0082184_937_1302 121
1328 3300046558 Ga0495633_0031134 Ga0495633_0031134_505_870 121
1329 3300046558 Ga0495633_0046685 Ga0495633_0046685_295_660 121
1330 3300046616 Ga0495668_0013397 Ga0495668_0013397_3685_4050 121
1331 3300046616 Ga0495668_0019313 Ga0495668_0019313_1375_1746 121
1332 3300046616 Ga0495668_0027993 Ga0495668_0027993_1755_2120 121
1333 3300046616 Ga0495668_0029393 Ga0495668_0029393_1328_1693 121
1334 3300046616 Ga0495668_0080284 Ga0495668_0080284_994_1359 121
1335 3300046616 Ga0495668_0197925 Ga0495668_0197925_23_388 121
1336 3300046616 Ga0495668_0578228 Ga0495668_0578228_55_420 121
1337 3300046660 Ga0495625_0005054 Ga0495625_0005054_8157_8522 121
1338 3300046660 Ga0495625_0165101 Ga0495625_0165101_221_586 121
1339 3300046664 Ga0495659_0487479 Ga0495659_0487479_84_449 121
1340 3300046674 Ga0495588_0000622 Ga0495588_0000622_12613_12978 121
1341 3300046675 Ga0495657_0067955 Ga0495657_0067955_1097_1462 121
1342 3300046675 Ga0495657_0723614 Ga0495657_0723614_98_463 121
1343 3300046684 Ga0495669_0005381 Ga0495669_0005381_232_597 121
1344 3300046684 Ga0495669_0015869 Ga0495669_0015869_433_798 121
1345 3300046689 Ga0495613_1014607 Ga0495613_1014607_133_498 121
1346 3300046692 Ga0495671_0639191 Ga0495671_0639191_91_456 121
1347 3300046694 Ga0495649_0081906 Ga0495649_0081906_135_500 121
1348 3300046809 Ga0495600_0181205 Ga0495600_0181205_542_907 121
1349 3300047317 Ga0495604_0061667 Ga0495604_0061667_1516_1881 121
1350 3300047318 Ga0495636_0301946 Ga0495636_0301946_115_480 121
1351 3300047443 Ga0495687_021303 Ga0495687_021303_513_878 121
1352 3300047443 Ga0495687_024306 Ga0495687_024306_1294_1659 121
1353 3300047447 Ga0495685_100673 Ga0495685_100673_297_662 121
1354 3300047469 Ga0495673_0264146 Ga0495673_0264146_123_488 121
1355 3300047470 Ga0495681_0002829 Ga0495681_0002829_4582_4947 121
1356 3300047472 Ga0495686_0005379 Ga0495686_0005379_7620_7985 121
1357 3300047472 Ga0495686_0321681 Ga0495686_0321681_44_409 121
1358 3300047673 Ga0495593_0021279 Ga0495593_0021279_2254_2619 121
1359 3300047673 Ga0495593_0037463 Ga0495593_0037463_1313_1678 121
1360 3300048088 Ga0495602_0163275 Ga0495602_0163275_509_874 121
1361 3300048088 Ga0495602_0196282 Ga0495602_0196282_528_893 121
1362 3300048088 Ga0495602_0258471 Ga0495602_0258471_241_606 121
1363 3300048090 Ga0495615_0010927 Ga0495615_0010927_233_604 121
1364 3300048903 Ga0496100_0587636 Ga0496100_0587636_374_739 121
1365 3300048904 Ga0496101_0439660 Ga0496101_0439660_538_912 121
1366 3300048905 Ga0496102_0056832 Ga0496102_0056832_357_722 121
1367 3300048906 Ga0496103_0075274 Ga0496103_0075274_982_1347 121
1368 3300048909 Ga0496106_0171404 Ga0496106_0171404_472_837 121
1369 3300048909 Ga0496106_0771941 Ga0496106_0771941_124_489 121
1370 3300048910 Ga0496107_0188739 Ga0496107_0188739_184_549 121
1371 3300048915 Ga0496112_0111656 Ga0496112_0111656_852_1217 121
1372 3300048915 Ga0496112_0747249 Ga0496112_0747249_66_431 121
1373 3300048918 Ga0496115_0239664 Ga0496115_0239664_142_507 121
1374 3300048919 Ga0496116_0000100 Ga0496116_0000100_101888_102253 121
1375 3300048919 Ga0496116_0032053 Ga0496116_0032053_522_887 121
1376 3300048919 Ga0496116_0045758 Ga0496116_0045758_2150_2515 121
1377 3300048919 Ga0496116_0051218 Ga0496116_0051218_1610_1975 121
1378 3300048919 Ga0496116_0091248 Ga0496116_0091248_1227_1592 121
1379 3300048920 Ga0496117_0001791 Ga0496117_0001791_21168_21533 121
1380 3300048920 Ga0496117_0012903 Ga0496117_0012903_6923_7288 121
1381 3300048920 Ga0496117_0032290 Ga0496117_0032290_455_820 121
1382 3300048920 Ga0496117_0038183 Ga0496117_0038183_813_1178 121
1383 3300048920 Ga0496117_0043996 Ga0496117_0043996_346_711 121
1384 3300048921 Ga0496118_0005547 Ga0496118_0005547_6894_7259 121
1385 3300048921 Ga0496118_0012623 Ga0496118_0012623_7692_8057 121
1386 3300048921 Ga0496118_0013675 Ga0496118_0013675_5627_5992 121
1387 3300048921 Ga0496118_0140606 Ga0496118_0140606_985_1350 121
1388 3300048921 Ga0496118_0141853 Ga0496118_0141853_187_552 121
1389 3300048921 Ga0496118_0512401 Ga0496118_0512401_196_561 121
1390 3300048922 Ga0496119_0021013 Ga0496119_0021013_3580_3945 121
1391 3300048922 Ga0496119_0118962 Ga0496119_0118962_1074_1439 121
1392 3300048922 Ga0496119_0214447 Ga0496119_0214447_526_891 121
1393 3300048923 Ga0496120_0063299 Ga0496120_0063299_379_744 121
1394 3300048923 Ga0496120_0231359 Ga0496120_0231359_405_770 121
1395 3300048924 Ga0496121_0000001 Ga0496121_0000001_161543_161908 121
1396 3300048924 Ga0496121_0000035 Ga0496121_0000035_370540_370905 121
1397 3300048924 Ga0496121_0002141 Ga0496121_0002141_14572_14937 121
1398 3300048924 Ga0496121_0022266 Ga0496121_0022266_3849_4214 121
1399 3300048924 Ga0496121_0032085 Ga0496121_0032085_2663_3028 121
1400 3300048924 Ga0496121_0167883 Ga0496121_0167883_323_688 121
1401 3300048924 Ga0496121_0262893 Ga0496121_0262893_749_1114 121
1402 3300048925 Ga0496122_0000147 Ga0496122_0000147_102213_102578 121
1403 3300048925 Ga0496122_0001112 Ga0496122_0001112_26170_26535 121
1404 3300048925 Ga0496122_0004207 Ga0496122_0004207_15606_15971 121
1405 3300048925 Ga0496122_0008413 Ga0496122_0008413_9649_10014 121
1406 3300048925 Ga0496122_0013026 Ga0496122_0013026_1634_1999 121
1407 3300048925 Ga0496122_0015681 Ga0496122_0015681_1458_1823 121
1408 3300048925 Ga0496122_0024484 Ga0496122_0024484_64_429 121
1409 3300048925 Ga0496122_0047821 Ga0496122_0047821_1268_1633 121
1410 3300048925 Ga0496122_0071060 Ga0496122_0071060_603_968 121
1411 3300048925 Ga0496122_0262025 Ga0496122_0262025_492_857 121
1412 3300048925 Ga0496122_0439888 Ga0496122_0439888_163_528 121
1413 3300048926 Ga0496123_0000158 Ga0496123_0000158_111226_111591 121
1414 3300048926 Ga0496123_0000910 Ga0496123_0000910_19921_20286 121
1415 3300048926 Ga0496123_0002037 Ga0496123_0002037_20088_20453 121
1416 3300048926 Ga0496123_0022317 Ga0496123_0022317_2393_2758 121
1417 3300048926 Ga0496123_0042793 Ga0496123_0042793_944_1309 121
1418 3300048926 Ga0496123_0049038 Ga0496123_0049038_2441_2806 121
1419 3300048927 Ga0496124_0000063 Ga0496124_0000063_188345_188710 121
1420 3300048927 Ga0496124_0000551 Ga0496124_0000551_11688_12053 121
1421 3300048927 Ga0496124_0007381 Ga0496124_0007381_8682_9047 121
1422 3300048927 Ga0496124_0012187 Ga0496124_0012187_8111_8476 121
1423 3300048927 Ga0496124_0018460 Ga0496124_0018460_1581_1946 121
1424 3300048927 Ga0496124_0025998 Ga0496124_0025998_4868_5233 121
1425 3300048927 Ga0496124_0062995 Ga0496124_0062995_2125_2490 121
1426 3300048927 Ga0496124_0064963 Ga0496124_0064963_2416_2781 121
1427 3300048927 Ga0496124_0117870 Ga0496124_0117870_1197_1562 121
1428 3300048927 Ga0496124_0150110 Ga0496124_0150110_329_694 121
1429 3300048927 Ga0496124_0276703 Ga0496124_0276703_209_574 121
1430 3300048927 Ga0496124_0444722 Ga0496124_0444722_275_640 121
1431 3300048928 Ga0496125_0000001 Ga0496125_0000001_274985_275350 121
1432 3300048928 Ga0496125_0000981 Ga0496125_0000981_40501_40866 121
1433 3300048928 Ga0496125_0002858 Ga0496125_0002858_20928_21293 121
1434 3300048928 Ga0496125_0013065 Ga0496125_0013065_642_1007 121
1435 3300048928 Ga0496125_0115672 Ga0496125_0115672_979_1344 121
1436 3300048928 Ga0496125_0167406 Ga0496125_0167406_605_970 121
1437 3300048928 Ga0496125_0198605 Ga0496125_0198605_789_1154 121
1438 3300048929 Ga0496126_0000094 Ga0496126_0000094_193410_193775 121
1439 3300048929 Ga0496126_0000195 Ga0496126_0000195_24095_24460 121
1440 3300048929 Ga0496126_0047799 Ga0496126_0047799_1264_1629 121
1441 3300048929 Ga0496126_0293240 Ga0496126_0293240_86_451 121
1442 3300048929 Ga0496126_0299066 Ga0496126_0299066_511_876 121
1443 3300048929 Ga0496126_0353391 Ga0496126_0353391_573_938 121
1444 3300048929 Ga0496126_0785835 Ga0496126_0785835_146_511 121
1445 3300049459 Ga0495678_156762 Ga0495678_156762_335_700 121
1446 3300049460 Ga0495682_0199132 Ga0495682_0199132_174_539 121
1447 3300049569 Ga0501032_0042531 Ga0501032_0042531_1414_1779 121
1448 3300049570 Ga0501033_0015006 Ga0501033_0015006_3911_4276 121
1449 3300049570 Ga0501033_0891422 Ga0501033_0891422_160_525 121
1450 3300049571 Ga0501034_0079252 Ga0501034_0079252_1336_1701 121
1451 3300049573 Ga0501037_0021934 Ga0501037_0021934_554_919 121
1452 3300049575 Ga0501039_0041848 Ga0501039_0041848_2491_2856 121
1453 3300049579 Ga0501043_0045856 Ga0501043_0045856_1628_1993 121
1454 3300049579 Ga0501043_0579837 Ga0501043_0579837_427_792 121
1455 3300049580 Ga0501046_0000010 Ga0501046_0000010_293206_293571 121
1456 3300049581 Ga0501047_0798024 Ga0501047_0798024_219_584 121
1457 3300049584 Ga0501068_0542544 Ga0501068_0542544_262_627 121
1458 3300049661 Ga0501217_201692 Ga0501217_201692_191_556 121
1459 3300049671 Ga0501238_015989 Ga0501238_015989_384_749 121
1460 3300049744 Ga0501083_0023462 Ga0501083_0023462_56_421 121
1461 3300049776 Ga0501280_009045 Ga0501280_009045_233_598 121
1462 3300049778 Ga0501282_018999 Ga0501282_018999_185_550 121
1463 3300049822 Ga0501035_0157260 Ga0501035_0157260_87_452 121
1464 3300049823 Ga0501044_0106113 Ga0501044_0106113_936_1301 121
1465 3300049823 Ga0501044_0741084 Ga0501044_0741084_357_722 121
1466 3300049823 Ga0501044_1631306 Ga0501044_1631306_97_462 121
1467 3300049824 Ga0501045_0235454 Ga0501045_0235454_888_1253 121
1468 3300050489 nmdc:mga03683_12461_c1 nmdc:mga03683_12461_c1_1738_2103 121
1469 3300050491 nmdc:mga00v17_461028_c1 nmdc:mga00v17_461028_c1_75_440 121
1470 3300050495 nmdc:mga04h51_131851_c1 nmdc:mga04h51_131851_c1_102_467 121
1471 3300050495 nmdc:mga04h51_342866_c1 nmdc:mga04h51_342866_c1_92_457 121
1472 3300050496 nmdc:mga07m45_76567_c1 nmdc:mga07m45_76567_c1_744_1115 121
1473 3300050516 nmdc:mga0sz30_56625_c1 nmdc:mga0sz30_56625_c1_1055_1420 121
1474 3300053080 Ga0500635_0000049 Ga0500635_0000049_12604_12969 121
1475 3300053080 Ga0500635_0000206 Ga0500635_0000206_11087_11452 121
1476 3300053085 Ga0495619_0221365 Ga0495619_0221365_565_930 121
1477 3300053086 Ga0500578_0044347 Ga0500578_0044347_437_802 121
1478 3300053086 Ga0500578_0119773 Ga0500578_0119773_634_999 121
1479 3300053088 Ga0500644_0005368 Ga0500644_0005368_1157_1522 121
1480 3300053088 Ga0500644_0262693 Ga0500644_0262693_83_448 121
1481 3300053090 Ga0500646_0030215 Ga0500646_0030215_445_810 121
1482 3300053092 Ga0500583_0003643 Ga0500583_0003643_1621_1986 121
1483 3300053092 Ga0500583_0018503 Ga0500583_0018503_512_877 121
1484 3300053093 Ga0500651_0014812 Ga0500651_0014812_1624_1989 121
1485 3300053093 Ga0500651_0030892 Ga0500651_0030892_2297_2662 121
1486 3300053094 Ga0500566_0004235 Ga0500566_0004235_2836_3201 121
1487 3300053094 Ga0500566_0205087 Ga0500566_0205087_27_392 121
1488 3300053095 Ga0500640_233343 Ga0500640_233343_99_464 121
1489 3300053096 Ga0500641_0293627 Ga0500641_0293627_221_586 121
1490 3300053103 Ga0500555_000482 Ga0500555_000482_15779_16147 121
1491 3300053104 Ga0500556_0022858 Ga0500556_0022858_757_1122 121
1492 3300053104 Ga0500556_0088470 Ga0500556_0088470_396_761 121
1493 3300053104 Ga0500556_0380734 Ga0500556_0380734_23_388 121
1494 3300053109 Ga0500569_017906 Ga0500569_017906_742_1107 121
1495 3300053109 Ga0500569_028905 Ga0500569_028905_1082_1447 121
1496 3300053111 Ga0500572_031619 Ga0500572_031619_655_1020 121
1497 3300053119 Ga0500595_001765 Ga0500595_001765_1925_2290 121
1498 3300053119 Ga0500595_008956 Ga0500595_008956_228_593 121
1499 3300053119 Ga0500595_106985 Ga0500595_106985_416_781 121
1500 3300053121 Ga0500607_015699 Ga0500607_015699_786_1151 121
1501 3300053121 Ga0500607_126759 Ga0500607_126759_496_861 121
1502 3300053122 Ga0500608_000264 Ga0500608_000264_12546_12911 121
1503 3300053122 Ga0500608_000299 Ga0500608_000299_10905_11270 121
1504 3300053122 Ga0500608_028919 Ga0500608_028919_488_853 121
1505 3300053123 Ga0500614_002102 Ga0500614_002102_2266_2631 121
1506 3300053123 Ga0500614_009181 Ga0500614_009181_785_1150 121
1507 3300053125 Ga0500618_000119 Ga0500618_000119_26407_26772 121
1508 3300053125 Ga0500618_000340 Ga0500618_000340_31939_32304 121
1509 3300053125 Ga0500618_003445 Ga0500618_003445_3928_4293 121
1510 3300053125 Ga0500618_022665 Ga0500618_022665_310_675 121
1511 3300053131 Ga0500652_115619 Ga0500652_115619_375_740 121
1512 3300053133 Ga0500655_047411 Ga0500655_047411_389_754 121
1513 3300053134 Ga0500658_0019740 Ga0500658_0019740_1977_2342 121
1514 3300053134 Ga0500658_0026026 Ga0500658_0026026_452_817 121
1515 3300053136 Ga0500559_0026207 Ga0500559_0026207_1375_1740 121
1516 3300053136 Ga0500559_0039817 Ga0500559_0039817_175_540 121
1517 3300053137 Ga0500561_0000213 Ga0500561_0000213_5336_5701 121
1518 3300053140 Ga0500573_0337804 Ga0500573_0337804_265_630 121
1519 3300053140 Ga0500573_0472620 Ga0500573_0472620_90_455 121
1520 3300053148 Ga0500590_013988 Ga0500590_013988_2972_3337 121
1521 3300053150 Ga0500603_039331 Ga0500603_039331_821_1186 121
1522 3300053151 Ga0500604_0028145 Ga0500604_0028145_722_1087 121
1523 3300053153 Ga0500616_0002453 Ga0500616_0002453_10452_10817 121
1524 3300053153 Ga0500616_0005613 Ga0500616_0005613_6785_7150 121
1525 3300053153 Ga0500616_0014854 Ga0500616_0014854_3526_3891 121
1526 3300053153 Ga0500616_0236487 Ga0500616_0236487_49_414 121
1527 3300053154 Ga0500619_000843 Ga0500619_000843_1916_2281 121
1528 3300053154 Ga0500619_054415 Ga0500619_054415_260_625 121
1529 3300053155 Ga0500620_058086 Ga0500620_058086_645_1010 121
1530 3300053156 Ga0500622_0003939 Ga0500622_0003939_1343_1708 121
1531 3300053156 Ga0500622_0005171 Ga0500622_0005171_7379_7744 121
1532 3300053157 Ga0500624_010282 Ga0500624_010282_120_485 121
1533 3300053157 Ga0500624_041506 Ga0500624_041506_328_693 121
1534 3300053157 Ga0500624_068052 Ga0500624_068052_308_673 121
1535 3300053158 Ga0500627_0147335 Ga0500627_0147335_125_490 121
1536 3300053158 Ga0500627_0321076 Ga0500627_0321076_174_539 121
1537 3300053161 Ga0500634_0018456 Ga0500634_0018456_289_654 121
1538 3300053161 Ga0500634_0239472 Ga0500634_0239472_109_474 121
1539 3300053162 Ga0500638_065841 Ga0500638_065841_221_586 121
1540 3300053163 Ga0500639_159819 Ga0500639_159819_314_679 121
1541 3300053177 Ga0500636_0000006 Ga0500636_0000006_125771_126136 121
1542 3300053177 Ga0500636_0004914 Ga0500636_0004914_385_750 121
1543 3300053177 Ga0500636_0008065 Ga0500636_0008065_1668_2033 121
1544 3300053177 Ga0500636_0037934 Ga0500636_0037934_1776_2141 121
1545 3300053177 Ga0500636_0038056 Ga0500636_0038056_1647_2012 121
1546 3300053178 Ga0500637_0019735 Ga0500637_0019735_234_599 121
1547 3300053178 Ga0500637_0132372 Ga0500637_0132372_1009_1374 121
1548 3300053725 Ga0500576_031215 Ga0500576_031215_1894_2259 121
1549 3300053725 Ga0500576_093741 Ga0500576_093741_368_733 121
1550 3300053729 Ga0500625_024463 Ga0500625_024463_659_1024 121
1551 3300053729 Ga0500625_028102 Ga0500625_028102_2019_2384 121
1552 3300053730 Ga0500645_001281 Ga0500645_001281_11227_11592 121
1553 3300053730 Ga0500645_201735 Ga0500645_201735_62_427 121
1554 3300053735 Ga0500596_000027 Ga0500596_000027_204_569 121
1555 3300053735 Ga0500596_006255 Ga0500596_006255_957_1322 121
1556 3300053737 Ga0500601_021637 Ga0500601_021637_33_398 121
1557 3300059424 Ga0590075_065736 Ga0590075_065736_546_911 121
1558 3300059640 Ga0587067_037556 Ga0587067_037556_105_470 121
1559 3300059640 Ga0587067_084806 Ga0587067_084806_34_399 121
1560 3300059640 Ga0587067_135757 Ga0587067_135757_75_440 121
1561 3300059643 Ga0587072_111208 Ga0587072_111208_127_492 121
1562 3300059645 Ga0587076_057420 Ga0587076_057420_102_467 121
1563 3300059652 Ga0587107_056323 Ga0587107_056323_42_407 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

8

120

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.975 3 120
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.9715 2 120
3t6k-assembly2.cif.gz_B crystal structure of a putative response regulator (caur_3799) from chloroflexus aurantiacus j-10-fl at 1.86 a resolution 0.9706 1 120
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9701 3 120
4h60-assembly1.cif.gz_A high resolution structure of vibrio cholerae chemotaxis protein chey4 crystallized in low ph (4.0) condition 0.9688 1 119
ID Description Score Start End Superfamily
3t6kB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9702 1 120 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9671 3 87 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9668 1 120 3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9665 1 81 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9635 3 81 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A5N7YCC1-F1-model_v4 deleted 0.9913 1 120
AF-A0A7W8SY33-F1-model_v4 DNA-binding response OmpR family regulator/DNA-binding CsgD family transcriptional regulator 0.9896 2 120 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A6F8VAE9-F1-model_v4 Guanylate cyclase 0.9895 1 120 GO:0000160
GO:0006355
AF-A0A1H1GEX6-F1-model_v4 Two component transcriptional regulator, LuxR family 0.9893 2 120 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7W8USS0-F1-model_v4 DNA-binding response OmpR family regulator/DNA-binding CsgD family transcriptional regulator 0.9891 2 120 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Feature Viewer

pLDDT pTM Quality
93.4 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map