F494672

General Info

Members Datasets Scaffolds Average Seq Length
1544 390 1543 341

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10009963|Ga0105245_100099637
Length 399
Sequence LALFDSRKMPGVQGGRYKNNKALRVGRLDLLARQDKATKAEYSRGGAGMSSGAGREPKMEQPSRRIVTGAALDEDARIDASVRPQRFADYIGQSRVKENIEIAIQAARSRGEALDHVLLYGPPGLGKTTLAQIIASELGVTIKTSSGPLLERKGDLTAILTSLEQREVFFLDEIHRLVPAIEEVLYPAMEDYRIDLVIGQGAGARIHPFILNRFTLIGATTRAGLVTAPLRSRFGIVHRLEFYTSEDLVTIIRRSASILGIAVDDDGAFELARRSRGTPRVANRLLRRARDFAQVRAQGHITLAVAKEALQMLGVDEHGLDEVDRTLMLTILQKYAGGPVGLSTLAASISEEEDAIEEIYEPYLMQLGLLDRTQRGRVATALAYKHFGLESPRRQPGLF

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
188 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
189 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
190 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
191 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
195 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
196 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
197 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
198 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
199 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
200 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
204 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
205 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
206 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
207 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
210 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
211 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
212 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
220 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
221 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
222 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
223 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
224 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
226 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
227 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
228 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
229 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
230 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
231 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
232 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
233 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
234 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
235 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
238 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
239 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
240 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
243 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
244 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
245 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
246 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
247 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
248 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
249 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
250 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
251 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
252 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
253 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
254 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
255 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
256 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
257 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
258 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
259 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
260 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
261 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
262 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
265 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
266 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
267 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
268 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
269 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
270 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
271 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
272 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
273 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
274 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
275 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
276 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
277 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
278 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
279 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
280 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
281 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
282 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
283 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
284 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
285 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
286 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
287 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
288 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
289 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
290 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
291 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
292 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
293 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
294 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
295 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
296 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
297 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
298 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
299 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
300 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
301 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
302 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
303 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
304 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
305 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
306 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
307 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
308 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
309 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
310 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
313 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
314 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
315 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
316 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
319 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
320 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
321 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
322 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
323 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
324 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
325 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
326 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
327 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
328 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
329 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
330 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
331 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
347 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
348 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
349 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
350 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
351 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
352 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
353 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
354 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
355 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
356 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
357 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
358 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
359 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
360 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
361 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
362 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
365 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
366 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
367 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
368 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
369 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
370 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
371 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
372 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
373 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
374 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
375 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
376 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
377 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
378 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
379 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
380 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
381 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
382 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
383 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
384 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
385 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
386 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
387 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
388 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
389 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
390 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.26
Isolates 0.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.71
Nodule 0
Rhizoplane 3.17
Rhizosphere 95.73
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10013078 3300003203 Bacteria 3581
2 Ga0065712_10003117 3300005290 Bacteria 3928
3 Ga0065712_10067822 3300005290 Bacteria 28686
4 Ga0065712_10068256 3300005290 Bacteria 12406
5 Ga0065712_10069647 3300005290 Bacteria 6927
6 Ga0065712_10086315 3300005290 Bacteria 2636
7 Ga0065712_10092300 3300005290 Bacteria 2336
8 Ga0065712_10096909 3300005290 Bacteria 2168
9 Ga0065712_10117705 3300005290 Bacteria 1716
10 Ga0065715_10010472 3300005293 Bacteria 2805
11 Ga0065715_10090135 3300005293 Bacteria 7597
12 Ga0065715_10093135 3300005293 Bacteria 4798
13 Ga0065715_10093168 3300005293 Bacteria 4784
14 Ga0065715_10094425 3300005293 Bacteria 4344
15 Ga0065715_10113341 3300005293 Bacteria 2493
16 Ga0065715_10117987 3300005293 Bacteria 2330
17 Ga0065707_10001479 3300005295 Bacteria 9195
18 Ga0065707_10082300 3300005295 Bacteria 17197
19 Ga0065707_10114653 3300005295 Bacteria 2291
20 Ga0065707_10132595 3300005295 Bacteria 1895
21 Ga0065707_10162560 3300005295 Bacteria 1550
22 Ga0065707_10167462 3300005295 Bacteria 1511
23 Ga0070676_10007541 3300005328 Bacteria 5844
24 Ga0070676_10026430 3300005328 Bacteria 3286
25 Ga0070676_10042457 3300005328 Bacteria 2640
26 Ga0070683_100000767 3300005329 Bacteria 23601
27 Ga0070683_100200920 3300005329 Bacteria 1893
28 Ga0070690_100016845 3300005330 Bacteria 4387
29 Ga0070690_100047784 3300005330 Bacteria 2723
30 Ga0070690_100137999 3300005330 Bacteria 1653
31 Ga0070670_100004018 3300005331 Bacteria 12279
32 Ga0070670_100005693 3300005331 Bacteria 10524
33 Ga0070670_100006799 3300005331 Bacteria 9681
34 Ga0070670_100014101 3300005331 Bacteria 6857
35 Ga0070670_100053037 3300005331 Bacteria 3482
36 Ga0070670_100068457 3300005331 Bacteria 3047
37 Ga0070670_100082316 3300005331 Bacteria 2766
38 Ga0070670_100117557 3300005331 Bacteria 2293
39 Ga0070677_10001941 3300005333 Bacteria 6558
40 Ga0070677_10016182 3300005333 Bacteria 2653
41 Ga0070677_10051067 3300005333 Bacteria 1672
42 Ga0068869_100001962 3300005334 Bacteria 12329
43 Ga0068869_100019703 3300005334 Bacteria 4615
44 Ga0070666_10016269 3300005335 Bacteria 4756
45 Ga0070666_10063651 3300005335 Bacteria 2500
46 Ga0070666_10112771 3300005335 Bacteria 1881
47 Ga0070682_100000035 3300005337 Bacteria 150016
48 Ga0068868_100043851 3300005338 Bacteria 3494
49 Ga0068868_100141734 3300005338 Bacteria 1973
50 Ga0068868_100144848 3300005338 Bacteria 1953
51 Ga0068868_100194443 3300005338 Bacteria 1688
52 Ga0070660_100154479 3300005339 Bacteria 1847
53 Ga0070689_100016312 3300005340 Bacteria 5435
54 Ga0070689_100020541 3300005340 Bacteria 4902
55 Ga0070689_100023685 3300005340 Bacteria 4599
56 Ga0070689_100059391 3300005340 Bacteria 2972
57 Ga0070689_100100302 3300005340 Bacteria 2291
58 Ga0070689_100172345 3300005340 Bacteria 1754
59 Ga0070691_10005391 3300005341 Bacteria 5817
60 Ga0070687_100003542 3300005343 Bacteria 6079
61 Ga0070687_100006797 3300005343 Bacteria 4718
62 Ga0070687_100186401 3300005343 Bacteria 1247
63 Ga0070687_100246111 3300005343 Bacteria 1108
64 Ga0070661_100023235 3300005344 Bacteria 4443
65 Ga0070661_100032912 3300005344 Bacteria 3754
66 Ga0070661_100067305 3300005344 Bacteria 2632
67 Ga0070668_100025473 3300005347 Bacteria 4484
68 Ga0070669_100002591 3300005353 Bacteria 13067
69 Ga0070669_100027676 3300005353 Bacteria 4080
70 Ga0070669_100040428 3300005353 Bacteria 3389
71 Ga0070669_100058689 3300005353 Bacteria 2824
72 Ga0070669_100103009 3300005353 Bacteria 2156
73 Ga0070669_100136306 3300005353 Bacteria 1888
74 Ga0070669_100189810 3300005353 Bacteria 1611
75 Ga0070675_100000442 3300005354 Bacteria 28196
76 Ga0070675_100001024 3300005354 Bacteria 20115
77 Ga0070675_100012826 3300005354 Bacteria 6576
78 Ga0070675_100024303 3300005354 Bacteria 4852
79 Ga0070675_100031700 3300005354 Bacteria 4275
80 Ga0070675_100035531 3300005354 Bacteria 4050
81 Ga0070675_100037927 3300005354 Bacteria 3926
82 Ga0070675_100049232 3300005354 Bacteria 3458
83 Ga0070675_100064924 3300005354 Bacteria 3018
84 Ga0070675_100072539 3300005354 Bacteria 2858
85 Ga0070675_100106845 3300005354 Bacteria 2363
86 Ga0070675_100126641 3300005354 Bacteria 2173
87 Ga0070675_100159643 3300005354 Bacteria 1938
88 Ga0070675_100171016 3300005354 Bacteria 1874
89 Ga0070675_100254623 3300005354 Bacteria 1537
90 Ga0070671_100022132 3300005355 Bacteria 5193
91 Ga0070671_100359700 3300005355 Bacteria 1243
92 Ga0070674_100004110 3300005356 Bacteria 8268
93 Ga0070674_100016261 3300005356 Bacteria 4662
94 Ga0070674_100052135 3300005356 Bacteria 2821
95 Ga0070674_100052750 3300005356 Bacteria 2806
96 Ga0070674_100071144 3300005356 Bacteria 2459
97 Ga0070674_100080733 3300005356 Bacteria 2323
98 Ga0070674_100098405 3300005356 Bacteria 2126
99 Ga0070674_100100078 3300005356 Bacteria 2110
100 Ga0070673_100007497 3300005364 Bacteria 7204
101 Ga0070673_100008711 3300005364 Bacteria 6767
102 Ga0070673_100011429 3300005364 Bacteria 6056
103 Ga0070673_100039289 3300005364 Bacteria 3620
104 Ga0070673_100045756 3300005364 Bacteria 3396
105 Ga0070673_100052057 3300005364 Bacteria 3211
106 Ga0070673_100054726 3300005364 Bacteria 3140
107 Ga0070673_100058579 3300005364 Bacteria 3046
108 Ga0070673_100074909 3300005364 Bacteria 2728
109 Ga0070673_100082692 3300005364 Bacteria 2607
110 Ga0070673_100272439 3300005364 Bacteria 1482
111 Ga0070688_100009725 3300005365 Bacteria 5277
112 Ga0070688_100021012 3300005365 Bacteria 3806
113 Ga0070688_100085427 3300005365 Bacteria 2051
114 Ga0070688_100101264 3300005365 Bacteria 1900
115 Ga0070688_100118249 3300005365 Bacteria 1771
116 Ga0070688_100206141 3300005365 Bacteria 1378
117 Ga0070667_100014780 3300005367 Bacteria 6449
118 Ga0070667_100106411 3300005367 Bacteria 2428
119 Ga0070667_100156520 3300005367 Bacteria 2004
120 Ga0070667_100207474 3300005367 Bacteria 1741
121 Ga0070667_100262386 3300005367 Bacteria 1547
122 Ga0070703_10003911 3300005406 Bacteria 4220
123 Ga0070703_10019537 3300005406 Bacteria 1964
124 Ga0070709_10004268 3300005434 Bacteria 7711
125 Ga0070709_10037201 3300005434 Bacteria 2971
126 Ga0070709_10069154 3300005434 Bacteria 2273
127 Ga0070714_100165808 3300005435 Bacteria 2002
128 Ga0070713_100028719 3300005436 Bacteria 4395
129 Ga0070713_100031212 3300005436 Bacteria 4242
130 Ga0070713_100097566 3300005436 Bacteria 2540
131 Ga0070713_100199094 3300005436 Bacteria 1808
132 Ga0070701_10007445 3300005438 Bacteria 4678
133 Ga0070701_10025421 3300005438 Bacteria 2876
134 Ga0070701_10025882 3300005438 Bacteria 2854
135 Ga0070711_100009831 3300005439 Bacteria 5899
136 Ga0070711_100083557 3300005439 Bacteria 2282
137 Ga0070711_100212492 3300005439 Bacteria 1499
138 Ga0070705_100000288 3300005440 Bacteria 30044
139 Ga0070705_100000449 3300005440 Bacteria 23638
140 Ga0070705_100026756 3300005440 Bacteria 3143
141 Ga0070705_100057794 3300005440 Bacteria 2289
142 Ga0070705_100115577 3300005440 Bacteria 1723
143 Ga0070700_100003978 3300005441 Bacteria 7679
144 Ga0070700_100010664 3300005441 Bacteria 5075
145 Ga0070700_100011740 3300005441 Bacteria 4862
146 Ga0070700_100153909 3300005441 Bacteria 1575
147 Ga0070694_100000762 3300005444 Bacteria 17985
148 Ga0070694_100020020 3300005444 Bacteria 4262
149 Ga0070694_100028490 3300005444 Bacteria 3635
150 Ga0070694_100032377 3300005444 Bacteria 3434
151 Ga0070694_100180103 3300005444 Bacteria 1563
152 Ga0070694_100335306 3300005444 Bacteria 1168
153 Ga0070708_100019182 3300005445 Bacteria 5741
154 Ga0070708_100028160 3300005445 Bacteria 4832
155 Ga0070708_100048944 3300005445 Bacteria 3739
156 Ga0070708_100057244 3300005445 Bacteria 3470
157 Ga0070708_100205444 3300005445 Bacteria 1845
158 Ga0070708_100293505 3300005445 Bacteria 1531
159 Ga0070708_100325323 3300005445 Bacteria 1448
160 Ga0070663_100009691 3300005455 Bacteria 5975
161 Ga0070678_100237450 3300005456 Bacteria 1522
162 Ga0070662_100036324 3300005457 Bacteria 3484
163 Ga0070662_100050184 3300005457 Bacteria 3010
164 Ga0070662_100076829 3300005457 Bacteria 2476
165 Ga0070681_10000926 3300005458 Bacteria 24766
166 Ga0070681_10005093 3300005458 Bacteria 12679
167 Ga0068867_100004543 3300005459 Bacteria 9755
168 Ga0068867_100007110 3300005459 Bacteria 7911
169 Ga0068867_100012153 3300005459 Bacteria 6083
170 Ga0068867_100015273 3300005459 Bacteria 5443
171 Ga0068867_100040773 3300005459 Bacteria 3391
172 Ga0068867_100068142 3300005459 Bacteria 2655
173 Ga0068867_100110181 3300005459 Bacteria 2114
174 Ga0068867_100129921 3300005459 Bacteria 1956
175 Ga0068867_100235012 3300005459 Bacteria 1483
176 Ga0068867_100414885 3300005459 Bacteria 1139
177 Ga0070685_10002548 3300005466 Bacteria 9333
178 Ga0070685_10003010 3300005466 Bacteria 8594
179 Ga0070685_10191722 3300005466 Bacteria 1323
180 Ga0070706_100007364 3300005467 Bacteria 10323
181 Ga0070706_100017811 3300005467 Bacteria 6553
182 Ga0070706_100062834 3300005467 Bacteria 3431
183 Ga0070706_100070232 3300005467 Bacteria 3239
184 Ga0070706_100201483 3300005467 Bacteria 1859
185 Ga0070707_100000011 3300005468 Bacteria 158252
186 Ga0070707_100002468 3300005468 Bacteria 17624
187 Ga0070707_100045214 3300005468 Bacteria 4215
188 Ga0070707_100049961 3300005468 Bacteria 4009
189 Ga0070707_100052066 3300005468 Bacteria 3924
190 Ga0070707_100060347 3300005468 Bacteria 3637
191 Ga0070707_100103657 3300005468 Bacteria 2757
192 Ga0070707_100211057 3300005468 Bacteria 1892
193 Ga0070698_100001654 3300005471 Bacteria 24859
194 Ga0070698_100002474 3300005471 Bacteria 20388
195 Ga0070698_100014002 3300005471 Bacteria 8483
196 Ga0070698_100015006 3300005471 Bacteria 8189
197 Ga0070698_100072730 3300005471 Bacteria 3446
198 Ga0070698_100163544 3300005471 Bacteria 2169
199 Ga0070699_100000558 3300005518 Bacteria 35133
200 Ga0070699_100009920 3300005518 Bacteria 8250
201 Ga0070699_100026285 3300005518 Bacteria 5021
202 Ga0070699_100042605 3300005518 Bacteria 3929
203 Ga0070699_100060971 3300005518 Bacteria 3269
204 Ga0070699_100063016 3300005518 Bacteria 3214
205 Ga0070699_100091306 3300005518 Bacteria 2662
206 Ga0070699_100104888 3300005518 Bacteria 2479
207 Ga0070699_100152609 3300005518 Bacteria 2044
208 Ga0070699_100217634 3300005518 Bacteria 1702
209 Ga0070699_100421623 3300005518 Bacteria 1208
210 Ga0070679_100011918 3300005530 Bacteria 8298
211 Ga0070679_100124285 3300005530 Bacteria 2563
212 Ga0070684_100004962 3300005535 Bacteria 10158
213 Ga0070684_100010485 3300005535 Bacteria 7343
214 Ga0070684_100122918 3300005535 Bacteria 2336
215 Ga0070697_100004983 3300005536 Bacteria 10194
216 Ga0070697_100057979 3300005536 Bacteria 3151
217 Ga0070697_100097400 3300005536 Bacteria 2441
218 Ga0070697_100162709 3300005536 Bacteria 1886
219 Ga0070697_100162949 3300005536 Bacteria 1884
220 Ga0070697_100267488 3300005536 Bacteria 1465
221 Ga0068853_100174627 3300005539 Bacteria 1946
222 Ga0070672_100000360 3300005543 Bacteria 26221
223 Ga0070672_100037705 3300005543 Bacteria 3689
224 Ga0070672_100066328 3300005543 Bacteria 2858
225 Ga0070672_100104885 3300005543 Bacteria 2297
226 Ga0070672_100115218 3300005543 Bacteria 2194
227 Ga0070672_100144402 3300005543 Bacteria 1965
228 Ga0070672_100247639 3300005543 Bacteria 1500
229 Ga0070686_100006747 3300005544 Bacteria 6388
230 Ga0070686_100147924 3300005544 Bacteria 1642
231 Ga0070695_100000582 3300005545 Bacteria 19251
232 Ga0070695_100008733 3300005545 Bacteria 6021
233 Ga0070695_100165990 3300005545 Bacteria 1554
234 Ga0070695_100296084 3300005545 Bacteria 1194
235 Ga0070696_100001518 3300005546 Bacteria 15229
236 Ga0070696_100003257 3300005546 Bacteria 10825
237 Ga0070696_100018392 3300005546 Bacteria 4722
238 Ga0070696_100033671 3300005546 Bacteria 3522
239 Ga0070696_100070820 3300005546 Bacteria 2453
240 Ga0070693_100000004 3300005547 Bacteria 94899
241 Ga0070693_100005655 3300005547 Bacteria 6029
242 Ga0070665_100000122 3300005548 Bacteria 147483
243 Ga0070665_100002388 3300005548 Bacteria 20707
244 Ga0070665_100003370 3300005548 Bacteria 17092
245 Ga0070665_100166571 3300005548 Bacteria 2206
246 Ga0070704_100000802 3300005549 Bacteria 15581
247 Ga0070704_100012627 3300005549 Bacteria 5223
248 Ga0070704_100012700 3300005549 Bacteria 5210
249 Ga0070704_100020062 3300005549 Bacteria 4303
250 Ga0070704_100049606 3300005549 Bacteria 2946
251 Ga0070704_100133034 3300005549 Bacteria 1931
252 Ga0070704_100153527 3300005549 Bacteria 1813
253 Ga0070704_100197329 3300005549 Bacteria 1622
254 Ga0068855_100345507 3300005563 Bacteria 1640
255 Ga0070664_100009155 3300005564 Bacteria 8040
256 Ga0070664_100040446 3300005564 Bacteria 3930
257 Ga0070664_100050239 3300005564 Bacteria 3529
258 Ga0070664_100054162 3300005564 Bacteria 3403
259 Ga0070664_100128131 3300005564 Bacteria 2228
260 Ga0070664_100147749 3300005564 Bacteria 2074
261 Ga0068857_100031800 3300005577 Bacteria 4663
262 Ga0068857_100041841 3300005577 Bacteria 4063
263 Ga0068857_100043627 3300005577 Bacteria 3977
264 Ga0068857_100124417 3300005577 Bacteria 2323
265 Ga0068854_100011543 3300005578 Bacteria 5758
266 Ga0070702_100002550 3300005615 Bacteria 7914
267 Ga0070702_100041188 3300005615 Bacteria 2589
268 Ga0070702_100105012 3300005615 Bacteria 1740
269 Ga0070702_100153084 3300005615 Bacteria 1482
270 Ga0068852_100026364 3300005616 Bacteria 4723
271 Ga0068852_100176540 3300005616 Bacteria 2006
272 Ga0068859_100004358 3300005617 Bacteria 14441
273 Ga0068859_100007450 3300005617 Bacteria 11108
274 Ga0068859_100023926 3300005617 Bacteria 6129
275 Ga0068859_100034044 3300005617 Bacteria 5115
276 Ga0068859_100053436 3300005617 Bacteria 4063
277 Ga0068859_100098046 3300005617 Bacteria 2985
278 Ga0068864_100000007 3300005618 Bacteria 392187
279 Ga0068864_100008459 3300005618 Bacteria 8492
280 Ga0068864_100008524 3300005618 Bacteria 8459
281 Ga0068864_100022414 3300005618 Bacteria 5296
282 Ga0068864_100037340 3300005618 Bacteria 4146
283 Ga0068864_100066381 3300005618 Bacteria 3131
284 Ga0068864_100067698 3300005618 Bacteria 3101
285 Ga0068864_100166898 3300005618 Bacteria 2005
286 Ga0068864_100276282 3300005618 Bacteria 1567
287 Ga0068864_100486886 3300005618 Bacteria 1185
288 Ga0068866_10010430 3300005718 Bacteria 3982
289 Ga0068861_100001024 3300005719 Bacteria 17105
290 Ga0068861_100004253 3300005719 Bacteria 9595
291 Ga0068861_100011191 3300005719 Bacteria 6229
292 Ga0068861_100018977 3300005719 Bacteria 4905
293 Ga0068861_100092894 3300005719 Bacteria 2385
294 Ga0068861_100130396 3300005719 Bacteria 2040
295 Ga0068861_100346505 3300005719 Bacteria 1301
296 Ga0068861_100383676 3300005719 Bacteria 1242
297 Ga0068851_10012457 3300005834 Bacteria 4009
298 Ga0068870_10002841 3300005840 Bacteria 7291
299 Ga0068870_10006109 3300005840 Bacteria 5293
300 Ga0068870_10006855 3300005840 Bacteria 5052
301 Ga0068870_10014126 3300005840 Bacteria 3766
302 Ga0068870_10066587 3300005840 Bacteria 1951
303 Ga0068870_10183760 3300005840 Bacteria 1257
304 Ga0068863_100089191 3300005841 Bacteria 2923
305 Ga0068863_100131497 3300005841 Bacteria 2390
306 Ga0068863_100135370 3300005841 Bacteria 2354
307 Ga0068858_100000717 3300005842 Bacteria 34513
308 Ga0068858_100010084 3300005842 Bacteria 8969
309 Ga0068858_100059383 3300005842 Bacteria 3535
310 Ga0068858_100096421 3300005842 Bacteria 2756
311 Ga0068858_100098730 3300005842 Bacteria 2722
312 Ga0068858_100182368 3300005842 Bacteria 1982
313 Ga0068860_100000658 3300005843 Bacteria 40219
314 Ga0068860_100002851 3300005843 Bacteria 17951
315 Ga0068860_100015659 3300005843 Bacteria 7403
316 Ga0068860_100095866 3300005843 Bacteria 2828
317 Ga0068860_100185812 3300005843 Bacteria 2010
318 Ga0068860_100196091 3300005843 Bacteria 1956
319 Ga0068860_100276596 3300005843 Bacteria 1640
320 Ga0068862_100002475 3300005844 Bacteria 16354
321 Ga0068862_100006398 3300005844 Bacteria 9794
322 Ga0068862_100016709 3300005844 Bacteria 6110
323 Ga0068862_100018886 3300005844 Bacteria 5744
324 Ga0068862_100167988 3300005844 Bacteria 1962
325 Ga0068862_100169822 3300005844 Bacteria 1952
326 Ga0068862_100172065 3300005844 Bacteria 1939
327 Ga0068862_100312083 3300005844 Bacteria 1449
328 Ga0068862_100484977 3300005844 Bacteria 1171
329 Ga0081539_10000025 3300005985 Bacteria 340255
330 Ga0081539_10000134 3300005985 Bacteria 173625
331 Ga0081539_10004230 3300005985 Bacteria 16158
332 Ga0070717_10000160 3300006028 Bacteria 50638
333 Ga0070717_10288392 3300006028 Bacteria 1457
334 Ga0075368_10006201 3300006042 Bacteria 4165
335 Ga0075432_10055177 3300006058 Bacteria 1407
336 Ga0070715_10063972 3300006163 Bacteria 1623
337 Ga0070716_100004009 3300006173 Bacteria 6991
338 Ga0070716_100042123 3300006173 Bacteria 2547
339 Ga0070716_100201173 3300006173 Bacteria 1324
340 Ga0070716_100219253 3300006173 Bacteria 1277
341 Ga0070712_100021014 3300006175 Bacteria 4280
342 Ga0070712_100077573 3300006175 Bacteria 2395
343 Ga0070712_100112029 3300006175 Bacteria 2038
344 Ga0075367_10003716 3300006178 Bacteria 7337
345 Ga0075367_10060288 3300006178 Bacteria 2262
346 Ga0097621_100005430 3300006237 Bacteria 8984
347 Ga0097621_100058986 3300006237 Bacteria 3141
348 Ga0097621_100059085 3300006237 Bacteria 3138
349 Ga0097621_100089132 3300006237 Bacteria 2579
350 Ga0097621_100100594 3300006237 Bacteria 2432
351 Ga0075370_10076812 3300006353 Bacteria 1916
352 Ga0068871_100001401 3300006358 Bacteria 16134
353 Ga0068871_100016049 3300006358 Bacteria 5628
354 Ga0068871_100060151 3300006358 Bacteria 3098
355 Ga0068871_100075412 3300006358 Bacteria 2784
356 Ga0068871_100117926 3300006358 Bacteria 2239
357 Ga0075428_100000005 3300006844 Bacteria 326130
358 Ga0075428_100002473 3300006844 Bacteria 20060
359 Ga0075428_100003359 3300006844 Bacteria 17508
360 Ga0075428_100006386 3300006844 Bacteria 13120
361 Ga0075428_100009431 3300006844 Bacteria 10834
362 Ga0075428_100016154 3300006844 Bacteria 8253
363 Ga0075428_100027209 3300006844 Bacteria 6331
364 Ga0075428_100048327 3300006844 Bacteria 4670
365 Ga0075428_100057559 3300006844 Bacteria 4255
366 Ga0075428_100166741 3300006844 Bacteria 2389
367 Ga0075428_100395198 3300006844 Bacteria 1482
368 Ga0075428_100442094 3300006844 Bacteria 1393
369 Ga0075430_100002136 3300006846 Bacteria 16365
370 Ga0075430_100002239 3300006846 Bacteria 16031
371 Ga0075430_100005588 3300006846 Bacteria 10624
372 Ga0075430_100014486 3300006846 Bacteria 6716
373 Ga0075430_100020148 3300006846 Bacteria 5675
374 Ga0075430_100034120 3300006846 Bacteria 4318
375 Ga0075430_100095682 3300006846 Bacteria 2482
376 Ga0075430_100175267 3300006846 Bacteria 1784
377 Ga0075430_100314349 3300006846 Bacteria 1295
378 Ga0075431_100000575 3300006847 Bacteria 31085
379 Ga0075431_100001153 3300006847 Bacteria 23746
380 Ga0075431_100005566 3300006847 Bacteria 12437
381 Ga0075431_100007412 3300006847 Bacteria 10923
382 Ga0075431_100010853 3300006847 Bacteria 9164
383 Ga0075431_100032234 3300006847 Bacteria 5400
384 Ga0075431_100074509 3300006847 Bacteria 3502
385 Ga0075431_100177433 3300006847 Bacteria 2188
386 Ga0075431_100192911 3300006847 Bacteria 2087
387 Ga0075431_100198791 3300006847 Bacteria 2052
388 Ga0075431_100330244 3300006847 Bacteria 1536
389 Ga0075433_10003019 3300006852 Bacteria 12931
390 Ga0075433_10050195 3300006852 Bacteria 3631
391 Ga0075433_10065855 3300006852 Bacteria 3178
392 Ga0075433_10067923 3300006852 Bacteria 3128
393 Ga0075433_10083058 3300006852 Bacteria 2826
394 Ga0075433_10088168 3300006852 Bacteria 2741
395 Ga0075433_10097299 3300006852 Bacteria 2605
396 Ga0075434_100000919 3300006871 Bacteria 23605
397 Ga0075434_100025674 3300006871 Bacteria 5765
398 Ga0075434_100037402 3300006871 Bacteria 4805
399 Ga0075434_100051482 3300006871 Bacteria 4093
400 Ga0075434_100062148 3300006871 Bacteria 3717
401 Ga0075434_100084179 3300006871 Bacteria 3179
402 Ga0075434_100100251 3300006871 Bacteria 2902
403 Ga0075434_100110857 3300006871 Bacteria 2755
404 Ga0075434_100127023 3300006871 Bacteria 2567
405 Ga0075434_100166250 3300006871 Bacteria 2226
406 Ga0075434_100176521 3300006871 Bacteria 2156
407 Ga0075434_100193417 3300006871 Bacteria 2055
408 Ga0075434_100204784 3300006871 Bacteria 1993
409 Ga0075434_100271683 3300006871 Bacteria 1714
410 Ga0075434_100396614 3300006871 Bacteria 1401
411 Ga0075434_100487985 3300006871 Bacteria 1253
412 Ga0075429_100003923 3300006880 Bacteria 12713
413 Ga0075429_100013537 3300006880 Bacteria 7077
414 Ga0075429_100016751 3300006880 Bacteria 6347
415 Ga0075429_100035327 3300006880 Bacteria 4347
416 Ga0075429_100036989 3300006880 Bacteria 4249
417 Ga0075429_100068908 3300006880 Bacteria 3079
418 Ga0075429_100091401 3300006880 Bacteria 2655
419 Ga0075429_100112122 3300006880 Bacteria 2384
420 Ga0075429_100116987 3300006880 Bacteria 2330
421 Ga0068865_100105696 3300006881 Bacteria 2068
422 Ga0075436_100007865 3300006914 Bacteria 7295
423 Ga0075436_100008907 3300006914 Bacteria 6869
424 Ga0075436_100011225 3300006914 Bacteria 6141
425 Ga0075436_100037045 3300006914 Bacteria 3367
426 Ga0075436_100042530 3300006914 Bacteria 3134
427 Ga0075436_100090348 3300006914 Bacteria 2129
428 Ga0097620_100004358 3300006931 Bacteria 14441
429 Ga0097620_100007450 3300006931 Bacteria 11108
430 Ga0097620_100023926 3300006931 Bacteria 6129
431 Ga0097620_100034044 3300006931 Bacteria 5115
432 Ga0097620_100053435 3300006931 Bacteria 4063
433 Ga0097620_100098046 3300006931 Bacteria 2985
434 Ga0075435_100000185 3300007076 Bacteria 37052
435 Ga0075435_100004809 3300007076 Bacteria 9342
436 Ga0075435_100006977 3300007076 Bacteria 8019
437 Ga0075435_100035383 3300007076 Bacteria 3963
438 Ga0075435_100336062 3300007076 Bacteria 1294
439 Ga0099794_10010639 3300007265 Bacteria 3912
440 Ga0099794_10012772 3300007265 Bacteria 3637
441 Ga0099794_10019314 3300007265 Bacteria 3067
442 Ga0099794_10049428 3300007265 Bacteria 2021
443 Ga0099794_10050745 3300007265 Bacteria 1996
444 Ga0099795_10011684 3300007788 Bacteria 2635
445 Ga0105240_10018260 3300009093 Bacteria 9428
446 Ga0105240_10024901 3300009093 Bacteria 7878
447 Ga0105240_10045142 3300009093 Bacteria 5593
448 Ga0105240_10118771 3300009093 Bacteria 3186
449 Ga0111539_10000008 3300009094 Bacteria 382609
450 Ga0111539_10010233 3300009094 Bacteria 11819
451 Ga0111539_10015435 3300009094 Bacteria 9501
452 Ga0111539_10017849 3300009094 Bacteria 8786
453 Ga0111539_10053056 3300009094 Bacteria 4826
454 Ga0111539_10069612 3300009094 Bacteria 4155
455 Ga0111539_10120056 3300009094 Bacteria 3080
456 Ga0111539_10162093 3300009094 Bacteria 2615
457 Ga0111539_10172713 3300009094 Bacteria 2525
458 Ga0111539_10237395 3300009094 Bacteria 2122
459 Ga0111539_10259101 3300009094 Bacteria 2025
460 Ga0111539_10366046 3300009094 Bacteria 1678
461 Ga0111539_10385603 3300009094 Bacteria 1631
462 Ga0111539_10419146 3300009094 Bacteria 1559
463 Ga0111539_10428901 3300009094 Bacteria 1540
464 Ga0111539_10505083 3300009094 Bacteria 1408
465 Ga0111539_10531179 3300009094 Bacteria 1371
466 Ga0105245_10004535 3300009098 Bacteria 12264
467 Ga0105245_10005359 3300009098 Bacteria 11269
468 Ga0105245_10009963 3300009098 Bacteria 8277
469 Ga0105245_10033714 3300009098 Bacteria 4538
470 Ga0105245_10050297 3300009098 Bacteria 3735
471 Ga0105245_10152435 3300009098 Bacteria 2186
472 Ga0114129_10000574 3300009147 Bacteria 45251
473 Ga0114129_10001790 3300009147 Bacteria 29271
474 Ga0114129_10002431 3300009147 Bacteria 25841
475 Ga0114129_10007344 3300009147 Bacteria 15689
476 Ga0114129_10008510 3300009147 Bacteria 14623
477 Ga0114129_10020281 3300009147 Bacteria 9460
478 Ga0114129_10024870 3300009147 Bacteria 8491
479 Ga0114129_10049166 3300009147 Bacteria 5927
480 Ga0114129_10057984 3300009147 Bacteria 5418
481 Ga0114129_10103084 3300009147 Bacteria 3945
482 Ga0114129_10126427 3300009147 Bacteria 3514
483 Ga0114129_10147067 3300009147 Bacteria 3227
484 Ga0114129_10191633 3300009147 Bacteria 2776
485 Ga0114129_10400489 3300009147 Bacteria 1809
486 Ga0114129_10413203 3300009147 Unclassified 1776
487 Ga0105243_10013883 3300009148 Bacteria 6098
488 Ga0105243_10077158 3300009148 Bacteria 2709
489 Ga0105243_10118442 3300009148 Bacteria 2228
490 Ga0105243_10229795 3300009148 Bacteria 1645
491 Ga0105241_10033243 3300009174 Bacteria 3871
492 Ga0105241_10360000 3300009174 Bacteria 1266
493 Ga0105242_10007676 3300009176 Bacteria 8301
494 Ga0105242_10074387 3300009176 Bacteria 2827
495 Ga0105242_10129741 3300009176 Bacteria 2174
496 Ga0105242_10142896 3300009176 Bacteria 2079
497 Ga0105248_10001544 3300009177 Bacteria 25631
498 Ga0105248_10029775 3300009177 Bacteria 6092
499 Ga0105248_10039996 3300009177 Bacteria 5255
500 Ga0105248_10084089 3300009177 Bacteria 3579
501 Ga0105248_10093304 3300009177 Bacteria 3390
502 Ga0105248_10100342 3300009177 Bacteria 3262
503 Ga0105248_10119465 3300009177 Bacteria 2973
504 Ga0105248_10128088 3300009177 Bacteria 2864
505 Ga0105248_10182129 3300009177 Bacteria 2367
506 Ga0105248_10207658 3300009177 Bacteria 2207
507 Ga0105248_10410839 3300009177 Bacteria 1524
508 Ga0105238_10000002 3300009551 Bacteria 772711
509 Ga0105238_10203277 3300009551 Bacteria 1957
510 Ga0105249_10021476 3300009553 Bacteria 5779
511 Ga0105249_10032539 3300009553 Bacteria 4719
512 Ga0105249_10052119 3300009553 Bacteria 3736
513 Ga0105249_10104120 3300009553 Bacteria 2674
514 Ga0105249_10549398 3300009553 Bacteria 1205
515 Ga0099796_10002341 3300010159 Bacteria 4139
516 Ga0105239_10051109 3300010375 Bacteria 4532
517 Ga0105246_10016281 3300011119 Bacteria 4707
518 Ga0157374_10000038 3300013296 Bacteria 169868
519 Ga0157374_10001975 3300013296 Bacteria 17206
520 Ga0157374_10179131 3300013296 Bacteria 2070
521 Ga0157374_10200211 3300013296 Bacteria 1955
522 Ga0157378_10000044 3300013297 Bacteria 106822
523 Ga0157378_10000678 3300013297 Bacteria 31999
524 Ga0157378_10001262 3300013297 Bacteria 22775
525 Ga0157378_10002388 3300013297 Bacteria 16681
526 Ga0157378_10003083 3300013297 Bacteria 14811
527 Ga0157378_10281354 3300013297 Bacteria 1603
528 Ga0157378_10299363 3300013297 Bacteria 1556
529 Ga0163162_10006374 3300013306 Bacteria 11424
530 Ga0163162_10030754 3300013306 Bacteria 5321
531 Ga0163162_10031743 3300013306 Bacteria 5241
532 Ga0163162_10072255 3300013306 Bacteria 3505
533 Ga0157375_10000003 3300013308 Bacteria 476325
534 Ga0157375_10000010 3300013308 Bacteria 361011
535 Ga0157375_10006844 3300013308 Bacteria 9934
536 Ga0157375_10046618 3300013308 Bacteria 4228
537 Ga0157375_10094436 3300013308 Bacteria 3060
538 Ga0163163_10000023 3300014325 Bacteria 185843
539 Ga0163163_10007293 3300014325 Bacteria 9753
540 Ga0163163_10015982 3300014325 Bacteria 6956
541 Ga0163163_10074644 3300014325 Bacteria 3383
542 Ga0163163_10347387 3300014325 Bacteria 1539
543 Ga0157380_10007520 3300014326 Bacteria 7739
544 Ga0157380_10008698 3300014326 Bacteria 7257
545 Ga0157380_10011997 3300014326 Bacteria 6270
546 Ga0157380_10013898 3300014326 Bacteria 5878
547 Ga0157380_10015991 3300014326 Bacteria 5524
548 Ga0157380_10044711 3300014326 Bacteria 3472
549 Ga0157380_10049170 3300014326 Bacteria 3324
550 Ga0157380_10068673 3300014326 Bacteria 2857
551 Ga0157380_10084766 3300014326 Bacteria 2599
552 Ga0157380_10196324 3300014326 Bacteria 1786
553 Ga0157380_10204107 3300014326 Bacteria 1756
554 Ga0157380_10303700 3300014326 Bacteria 1471
555 Ga0157380_10331615 3300014326 Bacteria 1415
556 Ga0157377_10000004 3300014745 Bacteria 430019
557 Ga0157377_10000074 3300014745 Bacteria 77443
558 Ga0157377_10002734 3300014745 Bacteria 7847
559 Ga0157377_10008196 3300014745 Bacteria 5085
560 Ga0157379_10005070 3300014968 Bacteria 11291
561 Ga0157379_10207188 3300014968 Bacteria 1774
562 Ga0157376_10000003 3300014969 Bacteria 568634
563 Ga0157376_10000008 3300014969 Bacteria 351192
564 Ga0157376_10000231 3300014969 Bacteria 38978
565 Ga0157376_10055323 3300014969 Bacteria 3310
566 Ga0157376_10138252 3300014969 Bacteria 2182
567 Ga0157376_10325007 3300014969 Bacteria 1464
568 Ga0157376_10610909 3300014969 Bacteria 1086
569 Ga0163161_10024629 3300017792 Bacteria 4253
570 Ga0163161_10072790 3300017792 Bacteria 2517
571 Ga0228598_1000166 3300024227 Bacteria 11590
572 Ga0207697_10007162 3300025315 Bacteria 4990
573 Ga0207697_10025607 3300025315 Bacteria 2411
574 Ga0207653_10000691 3300025885 Bacteria 11593
575 Ga0207682_10002808 3300025893 Bacteria 7700
576 Ga0207682_10008627 3300025893 Bacteria 4029
577 Ga0207682_10026000 3300025893 Bacteria 2323
578 Ga0207682_10035209 3300025893 Bacteria 2021
579 Ga0207642_10002113 3300025899 Bacteria 6145
580 Ga0207642_10072235 3300025899 Bacteria 1646
581 Ga0207688_10000078 3300025901 Bacteria 37290
582 Ga0207688_10023905 3300025901 Bacteria 3350
583 Ga0207688_10122377 3300025901 Bacteria 1519
584 Ga0207685_10048472 3300025905 Bacteria 1627
585 Ga0207699_10001243 3300025906 Bacteria 12111
586 Ga0207699_10021854 3300025906 Bacteria 3458
587 Ga0207699_10044858 3300025906 Bacteria 2576
588 Ga0207699_10056021 3300025906 Bacteria 2348
589 Ga0207699_10060540 3300025906 Bacteria 2274
590 Ga0207645_10000374 3300025907 Bacteria 37092
591 Ga0207645_10001092 3300025907 Bacteria 22384
592 Ga0207645_10010985 3300025907 Bacteria 6195
593 Ga0207645_10034102 3300025907 Bacteria 3270
594 Ga0207645_10047816 3300025907 Bacteria 2732
595 Ga0207643_10003058 3300025908 Bacteria 8996
596 Ga0207643_10006513 3300025908 Bacteria 6254
597 Ga0207643_10038368 3300025908 Bacteria 2690
598 Ga0207643_10064690 3300025908 Bacteria 2093
599 Ga0207643_10101174 3300025908 Bacteria 1690
600 Ga0207643_10168825 3300025908 Bacteria 1320
601 Ga0207643_10186244 3300025908 Bacteria 1258
602 Ga0207684_10002227 3300025910 Bacteria 19778
603 Ga0207684_10048144 3300025910 Bacteria 3615
604 Ga0207684_10051922 3300025910 Bacteria 3479
605 Ga0207707_10008909 3300025912 Bacteria 8713
606 Ga0207707_10022422 3300025912 Bacteria 5520
607 Ga0207695_10034283 3300025913 Bacteria 5523
608 Ga0207695_10119515 3300025913 Bacteria 2605
609 Ga0207671_10147123 3300025914 Bacteria 1818
610 Ga0207693_10003389 3300025915 Bacteria 13619
611 Ga0207693_10015404 3300025915 Bacteria 6135
612 Ga0207693_10015622 3300025915 Bacteria 6087
613 Ga0207693_10034863 3300025915 Bacteria 3969
614 Ga0207693_10194445 3300025915 Bacteria 1596
615 Ga0207663_10006081 3300025916 Bacteria 6139
616 Ga0207663_10059865 3300025916 Bacteria 2411
617 Ga0207663_10066980 3300025916 Bacteria 2301
618 Ga0207660_10108613 3300025917 Bacteria 2084
619 Ga0207662_10007437 3300025918 Bacteria 5966
620 Ga0207662_10034763 3300025918 Bacteria 2941
621 Ga0207662_10056672 3300025918 Bacteria 2341
622 Ga0207662_10068771 3300025918 Bacteria 2139
623 Ga0207657_10131981 3300025919 Bacteria 2046
624 Ga0207649_10005573 3300025920 Bacteria 6809
625 Ga0207649_10085622 3300025920 Bacteria 2051
626 Ga0207652_10015551 3300025921 Bacteria 6190
627 Ga0207646_10000055 3300025922 Bacteria 158886
628 Ga0207646_10000122 3300025922 Bacteria 105908
629 Ga0207646_10001764 3300025922 Bacteria 26210
630 Ga0207646_10044362 3300025922 Bacteria 3991
631 Ga0207646_10051322 3300025922 Bacteria 3691
632 Ga0207646_10089322 3300025922 Bacteria 2758
633 Ga0207646_10115678 3300025922 Bacteria 2409
634 Ga0207646_10407768 3300025922 Bacteria 1227
635 Ga0207681_10000705 3300025923 Bacteria 21963
636 Ga0207681_10030851 3300025923 Bacteria 3497
637 Ga0207681_10048185 3300025923 Bacteria 2875
638 Ga0207681_10048216 3300025923 Bacteria 2874
639 Ga0207681_10049316 3300025923 Bacteria 2845
640 Ga0207681_10057761 3300025923 Bacteria 2653
641 Ga0207681_10080337 3300025923 Bacteria 2300
642 Ga0207681_10095641 3300025923 Bacteria 2131
643 Ga0207681_10164773 3300025923 Bacteria 1674
644 Ga0207681_10167476 3300025923 Bacteria 1662
645 Ga0207681_10372897 3300025923 Bacteria 1147
646 Ga0207694_10000001 3300025924 Bacteria 4078485
647 Ga0207650_10010475 3300025925 Bacteria 6358
648 Ga0207650_10015200 3300025925 Bacteria 5357
649 Ga0207650_10017612 3300025925 Bacteria 5003
650 Ga0207650_10019816 3300025925 Bacteria 4733
651 Ga0207650_10030655 3300025925 Bacteria 3876
652 Ga0207650_10119526 3300025925 Bacteria 2050
653 Ga0207650_10223524 3300025925 Bacteria 1516
654 Ga0207659_10000501 3300025926 Bacteria 23548
655 Ga0207659_10003555 3300025926 Bacteria 9373
656 Ga0207659_10014754 3300025926 Bacteria 5049
657 Ga0207659_10020760 3300025926 Bacteria 4348
658 Ga0207659_10064234 3300025926 Bacteria 2656
659 Ga0207659_10073756 3300025926 Bacteria 2500
660 Ga0207659_10098749 3300025926 Bacteria 2196
661 Ga0207659_10139943 3300025926 Bacteria 1878
662 Ga0207687_10000771 3300025927 Bacteria 21608
663 Ga0207687_10008609 3300025927 Bacteria 6672
664 Ga0207687_10034362 3300025927 Bacteria 3442
665 Ga0207687_10067081 3300025927 Bacteria 2551
666 Ga0207687_10067321 3300025927 Bacteria 2547
667 Ga0207700_10044131 3300025928 Bacteria 3280
668 Ga0207700_10063685 3300025928 Bacteria 2806
669 Ga0207700_10078610 3300025928 Bacteria 2567
670 Ga0207700_10097605 3300025928 Bacteria 2335
671 Ga0207700_10141252 3300025928 Bacteria 1979
672 Ga0207700_10178810 3300025928 Bacteria 1775
673 Ga0207664_10109716 3300025929 Bacteria 2293
674 Ga0207644_10046516 3300025931 Bacteria 3092
675 Ga0207644_10050148 3300025931 Bacteria 2991
676 Ga0207644_10067758 3300025931 Bacteria 2602
677 Ga0207644_10078777 3300025931 Bacteria 2430
678 Ga0207644_10181615 3300025931 Bacteria 1649
679 Ga0207690_10010646 3300025932 Bacteria 5480
680 Ga0207690_10082194 3300025932 Bacteria 2253
681 Ga0207690_10106393 3300025932 Bacteria 2013
682 Ga0207690_10134218 3300025932 Bacteria 1816
683 Ga0207706_10005517 3300025933 Bacteria 11795
684 Ga0207706_10039316 3300025933 Bacteria 4193
685 Ga0207706_10042267 3300025933 Bacteria 4040
686 Ga0207706_10054366 3300025933 Bacteria 3534
687 Ga0207706_10075480 3300025933 Bacteria 2964
688 Ga0207706_10075776 3300025933 Bacteria 2959
689 Ga0207686_10017235 3300025934 Bacteria 4067
690 Ga0207686_10046039 3300025934 Bacteria 2688
691 Ga0207686_10085013 3300025934 Bacteria 2074
692 Ga0207686_10099192 3300025934 Bacteria 1941
693 Ga0207686_10106152 3300025934 Bacteria 1885
694 Ga0207686_10235655 3300025934 Bacteria 1329
695 Ga0207709_10007327 3300025935 Bacteria 6151
696 Ga0207709_10025497 3300025935 Bacteria 3385
697 Ga0207709_10040623 3300025935 Bacteria 2786
698 Ga0207709_10058837 3300025935 Bacteria 2390
699 Ga0207709_10125183 3300025935 Bacteria 1742
700 Ga0207670_10011233 3300025936 Bacteria 5191
701 Ga0207670_10022933 3300025936 Bacteria 3877
702 Ga0207670_10048147 3300025936 Bacteria 2843
703 Ga0207670_10051749 3300025936 Bacteria 2759
704 Ga0207670_10051766 3300025936 Bacteria 2759
705 Ga0207670_10068660 3300025936 Bacteria 2443
706 Ga0207670_10113522 3300025936 Bacteria 1957
707 Ga0207670_10240256 3300025936 Bacteria 1395
708 Ga0207670_10317870 3300025936 Bacteria 1224
709 Ga0207669_10010135 3300025937 Bacteria 4526
710 Ga0207669_10010275 3300025937 Bacteria 4501
711 Ga0207669_10022027 3300025937 Bacteria 3377
712 Ga0207669_10139147 3300025937 Bacteria 1682
713 Ga0207669_10177867 3300025937 Bacteria 1522
714 Ga0207704_10011415 3300025938 Bacteria 4374
715 Ga0207704_10225874 3300025938 Bacteria 1389
716 Ga0207704_10261912 3300025938 Bacteria 1304
717 Ga0207665_10000008 3300025939 Bacteria 173434
718 Ga0207665_10008235 3300025939 Bacteria 6883
719 Ga0207665_10050032 3300025939 Bacteria 2809
720 Ga0207665_10052689 3300025939 Bacteria 2742
721 Ga0207665_10080243 3300025939 Bacteria 2244
722 Ga0207665_10136108 3300025939 Bacteria 1748
723 Ga0207665_10197299 3300025939 Bacteria 1465
724 Ga0207665_10246000 3300025939 Bacteria 1320
725 Ga0207665_10260036 3300025939 Bacteria 1286
726 Ga0207691_10006666 3300025940 Bacteria 11139
727 Ga0207691_10008868 3300025940 Bacteria 9654
728 Ga0207691_10010705 3300025940 Bacteria 8805
729 Ga0207691_10036965 3300025940 Bacteria 4524
730 Ga0207691_10040373 3300025940 Bacteria 4312
731 Ga0207691_10043122 3300025940 Bacteria 4158
732 Ga0207691_10064984 3300025940 Bacteria 3304
733 Ga0207691_10067224 3300025940 Bacteria 3241
734 Ga0207691_10104004 3300025940 Bacteria 2531
735 Ga0207691_10200543 3300025940 Bacteria 1737
736 Ga0207711_10070974 3300025941 Bacteria 3021
737 Ga0207711_10076066 3300025941 Bacteria 2923
738 Ga0207711_10078675 3300025941 Bacteria 2877
739 Ga0207711_10121043 3300025941 Bacteria 2336
740 Ga0207689_10004769 3300025942 Bacteria 12231
741 Ga0207689_10006874 3300025942 Bacteria 10004
742 Ga0207689_10023079 3300025942 Bacteria 5225
743 Ga0207689_10066454 3300025942 Bacteria 2965
744 Ga0207689_10094010 3300025942 Bacteria 2462
745 Ga0207689_10136530 3300025942 Bacteria 2020
746 Ga0207689_10148118 3300025942 Bacteria 1934
747 Ga0207689_10300848 3300025942 Bacteria 1330
748 Ga0207689_10365401 3300025942 Bacteria 1200
749 Ga0207661_10000567 3300025944 Bacteria 23624
750 Ga0207661_10076026 3300025944 Bacteria 2757
751 Ga0207661_10225408 3300025944 Bacteria 1658
752 Ga0207679_10002887 3300025945 Bacteria 10658
753 Ga0207679_10008110 3300025945 Bacteria 6680
754 Ga0207679_10038680 3300025945 Bacteria 3401
755 Ga0207679_10061002 3300025945 Bacteria 2805
756 Ga0207679_10080569 3300025945 Bacteria 2486
757 Ga0207679_10195768 3300025945 Bacteria 1684
758 Ga0207679_10345999 3300025945 Bacteria 1294
759 Ga0207679_10466302 3300025945 Bacteria 1122
760 Ga0207651_10003088 3300025960 Bacteria 8094
761 Ga0207651_10013243 3300025960 Bacteria 4710
762 Ga0207651_10017893 3300025960 Bacteria 4200
763 Ga0207651_10017894 3300025960 Bacteria 4200
764 Ga0207651_10025651 3300025960 Bacteria 3667
765 Ga0207651_10068350 3300025960 Bacteria 2504
766 Ga0207651_10079593 3300025960 Bacteria 2355
767 Ga0207651_10093640 3300025960 Bacteria 2207
768 Ga0207651_10136320 3300025960 Bacteria 1888
769 Ga0207651_10164201 3300025960 Bacteria 1744
770 Ga0207651_10328403 3300025960 Bacteria 1281
771 Ga0207712_10020761 3300025961 Bacteria 4306
772 Ga0207712_10026599 3300025961 Bacteria 3856
773 Ga0207712_10033799 3300025961 Bacteria 3459
774 Ga0207712_10135594 3300025961 Bacteria 1882
775 Ga0207712_10179426 3300025961 Bacteria 1662
776 Ga0207668_10172199 3300025972 Bacteria 1699
777 Ga0207640_10005632 3300025981 Bacteria 6828
778 Ga0207640_10018088 3300025981 Bacteria 4134
779 Ga0207640_10053034 3300025981 Bacteria 2645
780 Ga0207658_10085333 3300025986 Bacteria 2432
781 Ga0207677_10030076 3300026023 Bacteria 3461
782 Ga0207677_10112640 3300026023 Bacteria 2029
783 Ga0207677_10259951 3300026023 Bacteria 1415
784 Ga0207703_10111147 3300026035 Bacteria 2338
785 Ga0207703_10183813 3300026035 Bacteria 1846
786 Ga0207703_10251546 3300026035 Bacteria 1593
787 Ga0207703_10365100 3300026035 Bacteria 1332
788 Ga0207639_10000028 3300026041 Bacteria 197736
789 Ga0207639_10078745 3300026041 Bacteria 2602
790 Ga0207678_10019603 3300026067 Bacteria 5946
791 Ga0207678_10064943 3300026067 Bacteria 3135
792 Ga0207708_10030417 3300026075 Bacteria 4093
793 Ga0207708_10052944 3300026075 Bacteria 3091
794 Ga0207708_10060418 3300026075 Bacteria 2893
795 Ga0207708_10077717 3300026075 Bacteria 2548
796 Ga0207708_10078793 3300026075 Bacteria 2530
797 Ga0207708_10087996 3300026075 Bacteria 2392
798 Ga0207708_10109996 3300026075 Bacteria 2138
799 Ga0207708_10352092 3300026075 Bacteria 1208
800 Ga0207641_10068952 3300026088 Bacteria 3034
801 Ga0207641_10176334 3300026088 Bacteria 1954
802 Ga0207648_10003537 3300026089 Bacteria 16338
803 Ga0207648_10006736 3300026089 Bacteria 11394
804 Ga0207648_10014255 3300026089 Bacteria 7349
805 Ga0207648_10026662 3300026089 Bacteria 5133
806 Ga0207648_10037009 3300026089 Bacteria 4298
807 Ga0207648_10040076 3300026089 Bacteria 4116
808 Ga0207648_10055320 3300026089 Bacteria 3464
809 Ga0207648_10061425 3300026089 Bacteria 3277
810 Ga0207676_10000015 3300026095 Bacteria 329100
811 Ga0207676_10036130 3300026095 Bacteria 3756
812 Ga0207676_10082326 3300026095 Bacteria 2617
813 Ga0207676_10082601 3300026095 Bacteria 2614
814 Ga0207676_10084144 3300026095 Bacteria 2592
815 Ga0207676_10116410 3300026095 Bacteria 2246
816 Ga0207676_10130061 3300026095 Bacteria 2139
817 Ga0207676_10272370 3300026095 Bacteria 1534
818 Ga0207674_10035104 3300026116 Bacteria 5235
819 Ga0207674_10067461 3300026116 Bacteria 3601
820 Ga0207674_10137541 3300026116 Bacteria 2404
821 Ga0207674_10197575 3300026116 Bacteria 1961
822 Ga0207674_10288408 3300026116 Bacteria 1590
823 Ga0207675_100001961 3300026118 Bacteria 20530
824 Ga0207675_100002780 3300026118 Bacteria 17190
825 Ga0207675_100023842 3300026118 Bacteria 5691
826 Ga0207675_100027174 3300026118 Bacteria 5330
827 Ga0207675_100034443 3300026118 Bacteria 4722
828 Ga0207675_100048944 3300026118 Bacteria 3945
829 Ga0207675_100179457 3300026118 Bacteria 2027
830 Ga0207675_100196272 3300026118 Bacteria 1937
831 Ga0207675_100281120 3300026118 Bacteria 1617
832 Ga0207675_100302616 3300026118 Bacteria 1558
833 Ga0207675_100321919 3300026118 Bacteria 1510
834 Ga0207683_10048058 3300026121 Bacteria 3737
835 Ga0207683_10072444 3300026121 Bacteria 3047
836 Ga0207683_10075713 3300026121 Bacteria 2979
837 Ga0207683_10116065 3300026121 Bacteria 2400
838 Ga0207683_10200125 3300026121 Bacteria 1815
839 Ga0207683_10220060 3300026121 Bacteria 1730
840 Ga0207683_10490057 3300026121 Bacteria 1135
841 Ga0209179_1015421 3300027512 Bacteria 1419
842 Ga0209588_1005892 3300027671 Bacteria 3533
843 Ga0209588_1013432 3300027671 Bacteria 2496
844 Ga0209971_1006519 3300027682 Bacteria 2761
845 Ga0207428_10000285 3300027907 Bacteria 68342
846 Ga0207428_10005347 3300027907 Bacteria 11972
847 Ga0207428_10009579 3300027907 Bacteria 8675
848 Ga0207428_10019994 3300027907 Bacteria 5702
849 Ga0207428_10049425 3300027907 Bacteria 3370
850 Ga0207428_10104509 3300027907 Bacteria 2185
851 Ga0207428_10246372 3300027907 Bacteria 1334
852 Ga0207428_10253670 3300027907 Bacteria 1311
853 Ga0265354_1001565 3300028016 Bacteria 3212
854 Ga0265354_1001601 3300028016 Bacteria 3167
855 Ga0268266_10000153 3300028379 Bacteria 131887
856 Ga0268266_10000217 3300028379 Bacteria 100718
857 Ga0268266_10357377 3300028379 Bacteria 1374
858 Ga0268265_10000714 3300028380 Bacteria 32686
859 Ga0268265_10010217 3300028380 Bacteria 6337
860 Ga0268265_10100882 3300028380 Bacteria 2331
861 Ga0268265_10201002 3300028380 Bacteria 1729
862 Ga0268265_10214148 3300028380 Bacteria 1681
863 Ga0268265_10292863 3300028380 Bacteria 1462
864 Ga0268265_10316410 3300028380 Bacteria 1411
865 Ga0268264_10001337 3300028381 Bacteria 23185
866 Ga0268264_10001966 3300028381 Bacteria 18469
867 Ga0268264_10032193 3300028381 Bacteria 4302
868 Ga0268264_10092137 3300028381 Bacteria 2615
869 Ga0268264_10225569 3300028381 Bacteria 1727
870 Ga0268264_10355430 3300028381 Bacteria 1396
871 Ga0265319_1002464 3300028563 Bacteria 10098
872 Ga0265318_10000320 3300028577 Bacteria 38387
873 Ga0265338_10032726 3300028800 Bacteria 5062
874 Ga0265338_10038545 3300028800 Bacteria 4525
875 Ga0307511_10003746 3300030521 Bacteria 15547
876 Ga0265770_1001477 3300030878 Bacteria 3232
877 Ga0265765_1001239 3300030879 Bacteria 2317
878 Ga0265760_10000020 3300031090 Bacteria 71420
879 Ga0265760_10018513 3300031090 Bacteria 2007
880 Ga0265328_10028844 3300031239 Bacteria 2075
881 Ga0265328_10062127 3300031239 Bacteria 1371
882 Ga0265320_10000139 3300031240 Bacteria 61536
883 Ga0265320_10028961 3300031240 Bacteria 2870
884 Ga0265320_10059973 3300031240 Bacteria 1818
885 Ga0265325_10019621 3300031241 Bacteria 3734
886 Ga0265329_10000050 3300031242 Bacteria 51098
887 Ga0265329_10013066 3300031242 Bacteria 2970
888 Ga0265340_10025923 3300031247 Bacteria 2966
889 Ga0265339_10004465 3300031249 Bacteria 9546
890 Ga0265339_10156312 3300031249 Bacteria 1150
891 Ga0265331_10000135 3300031250 Bacteria 96750
892 Ga0265331_10006194 3300031250 Bacteria 7099
893 Ga0265331_10017191 3300031250 Bacteria 3778
894 Ga0265331_10026792 3300031250 Bacteria 2894
895 Ga0265316_10000531 3300031344 Bacteria 42984
896 Ga0265316_10000752 3300031344 Bacteria 35775
897 Ga0265316_10031452 3300031344 Bacteria 4339
898 Ga0265316_10067052 3300031344 Bacteria 2776
899 Ga0265316_10088298 3300031344 Bacteria 2367
900 Ga0307408_100019683 3300031548 Bacteria 4547
901 Ga0307408_100061025 3300031548 Bacteria 2751
902 Ga0307408_100130347 3300031548 Bacteria 1961
903 Ga0307408_100228101 3300031548 Bacteria 1523
904 Ga0265313_10001857 3300031595 Bacteria 19236
905 Ga0265313_10017309 3300031595 Bacteria 4101
906 Ga0307508_10019767 3300031616 Bacteria 6119
907 Ga0265314_10023524 3300031711 Bacteria 4695
908 Ga0265314_10029100 3300031711 Bacteria 4110
909 Ga0265314_10060442 3300031711 Bacteria 2586
910 Ga0265342_10000694 3300031712 Bacteria 35309
911 Ga0316576_10076797 3300031727 Bacteria 2472
912 Ga0307405_10000638 3300031731 Bacteria 13469
913 Ga0307413_10002032 3300031824 Bacteria 8053
914 Ga0307413_10017654 3300031824 Bacteria 3722
915 Ga0307410_10005295 3300031852 Bacteria 6809
916 Ga0307410_10005377 3300031852 Bacteria 6771
917 Ga0307410_10013809 3300031852 Bacteria 4727
918 Ga0307410_10026539 3300031852 Bacteria 3648
919 Ga0307406_10023741 3300031901 Bacteria 3653
920 Ga0307406_10033035 3300031901 Bacteria 3164
921 Ga0307407_10010455 3300031903 Bacteria 4378
922 Ga0307407_10010616 3300031903 Bacteria 4352
923 Ga0307407_10047429 3300031903 Bacteria 2438
924 Ga0307407_10066880 3300031903 Bacteria 2121
925 Ga0307407_10188770 3300031903 Bacteria 1372
926 Ga0307412_10022746 3300031911 Bacteria 3848
927 Ga0307412_10155456 3300031911 Bacteria 1692
928 Ga0307412_10330698 3300031911 Bacteria 1216
929 Ga0307409_100003656 3300031995 Bacteria 8414
930 Ga0307409_100065126 3300031995 Bacteria 2866
931 Ga0307409_100179543 3300031995 Bacteria 1872
932 Ga0307416_100003391 3300032002 Bacteria 9341
933 Ga0307416_100024508 3300032002 Bacteria 4406
934 Ga0307416_100027297 3300032002 Bacteria 4225
935 Ga0307416_100033527 3300032002 Bacteria 3894
936 Ga0307416_100046069 3300032002 Bacteria 3439
937 Ga0307416_100046391 3300032002 Bacteria 3428
938 Ga0307416_100129459 3300032002 Bacteria 2268
939 Ga0307416_100252380 3300032002 Bacteria 1718
940 Ga0307416_100423376 3300032002 Bacteria 1376
941 Ga0307416_100452523 3300032002 Bacteria 1337
942 Ga0307416_100495620 3300032002 Bacteria 1285
943 Ga0307414_10022618 3300032004 Bacteria 3970
944 Ga0307414_10030123 3300032004 Bacteria 3542
945 Ga0307414_10047654 3300032004 Bacteria 2951
946 Ga0307411_10025874 3300032005 Bacteria 3523
947 Ga0307411_10026725 3300032005 Bacteria 3479
948 Ga0307411_10069895 3300032005 Bacteria 2373
949 Ga0307411_10127043 3300032005 Bacteria 1856
950 Ga0307411_10171712 3300032005 Bacteria 1636
951 Ga0307415_100008737 3300032126 Bacteria 5634
952 Ga0307415_100041972 3300032126 Bacteria 3041
953 Ga0307415_100079332 3300032126 Bacteria 2338
954 Ga0316212_1008675 3300033547 Bacteria 1460
955 Ga0373926_0000176 3300035083 Bacteria 14340
956 Ga0373926_0004885 3300035083 Bacteria 4406
957 Ga0373929_0000003 3300035085 Bacteria 575058
958 Ga0373934_0001676 3300035086 Bacteria 8135
959 Ga0373949_0005553 3300035090 Bacteria 2812
960 Ga0373923_0022394 3300035111 Bacteria 2478
961 Ga0373932_0000061 3300035112 Bacteria 26428
962 Ga0373939_0011753 3300035114 Bacteria 2217
963 Ga0373945_0081489 3300035116 Bacteria 1240
964 Ga0373953_0028136 3300035117 Bacteria 2165
965 Ga0373954_0000648 3300035118 Bacteria 13316
966 Ga0373956_0001011 3300035119 Bacteria 11600
967 Ga0373956_0052747 3300035119 Bacteria 1829
968 Ga0373943_0093778 3300035170 Bacteria 1559
969 Ga0373946_0003193 3300035171 Bacteria 5812
970 Ga0373946_0041329 3300035171 Bacteria 1891
971 Ga0373946_0043801 3300035171 Bacteria 1845
972 Ga0373946_0073681 3300035171 Bacteria 1481
973 Ga0373955_0001645 3300035172 Bacteria 9559
974 Ga0373955_0014880 3300035172 Bacteria 3796
975 Ga0373955_0033421 3300035172 Bacteria 2709
976 Ga0373955_0087608 3300035172 Bacteria 1770
977 Ga0373961_0029778 3300035241 Bacteria 1514
978 Ga0373924_0017810 3300035410 Bacteria 2731
979 Ga0373924_0106313 3300035410 Bacteria 1210
980 Ga0373935_0000906 3300035692 Bacteria 16014
981 Ga0373927_0002502 3300035695 Bacteria 13413
982 Ga0373927_0023331 3300035695 Bacteria 4051
983 Ga0373927_0073760 3300035695 Bacteria 2210
984 Ga0373933_0001863 3300035724 Bacteria 12192
985 Ga0373933_0003491 3300035724 Bacteria 8752
986 Ga0373933_0129955 3300035724 Bacteria 1583
987 Ga0373947_0006424 3300035725 Bacteria 6830
988 Ga0373947_0044879 3300035725 Bacteria 2644
989 Ga0373947_0193851 3300035725 Bacteria 1327
990 Ga0373937_0000001 3300036401 Bacteria 478903
991 Ga0373937_0002907 3300036401 Bacteria 14312
992 Ga0373937_0006161 3300036401 Bacteria 10328
993 Ga0373937_0075873 3300036401 Bacteria 3104
994 Ga0373937_0339566 3300036401 Bacteria 1422
995 Ga0373937_0517493 3300036401 Bacteria 1134
996 Ga0373925_0002897 3300037068 Bacteria 13553
997 Ga0373925_0016760 3300037068 Bacteria 5307
998 Ga0373925_0313476 3300037068 Bacteria 1268
999 Ga0395905_0201526 3300037471 Bacteria 1866
1000 Ga0400487_55885 3300039110 Bacteria 37403
1001 Ga0436365_1139438 3300039437 Bacteria 14911
1002 Ga0436365_1884859 3300039437 Bacteria 3301
1003 Ga0439453_0004367 3300041408 Bacteria 2099
1004 Ga0439453_0007620 3300041408 Bacteria 1722
1005 Ga0439431_0009100 3300041997 Bacteria 2239
1006 Ga0439433_0018593 3300041999 Bacteria 1548
1007 Ga0439441_005229 3300042001 Bacteria 2005
1008 Ga0450894_000401 3300042131 Bacteria 7413
1009 Ga0450898_003741 3300042134 Bacteria 2203
1010 Ga0439446_0007852 3300042156 Bacteria 2815
1011 Ga0439434_0027623 3300042435 Bacteria 1716
1012 Ga0439434_0053512 3300042435 Bacteria 1254
1013 Ga0439435_0010606 3300042436 Bacteria 2192
1014 Ga0439435_0018526 3300042436 Bacteria 1773
1015 Ga0439444_0004188 3300042437 Bacteria 2082
1016 Ga0439464_0014996 3300042439 Bacteria 2089
1017 Ga0439460_0021550 3300042461 Bacteria 1762
1018 Ga0451577_0003196 3300042876 Bacteria 18409
1019 Ga0451577_0005031 3300042876 Bacteria 13669
1020 Ga0451577_0029633 3300042876 Bacteria 4947
1021 Ga0451577_0049163 3300042876 Bacteria 3766
1022 Ga0451577_0128653 3300042876 Bacteria 2271
1023 Ga0451577_0210331 3300042876 Bacteria 1757
1024 Ga0451577_0253283 3300042876 Bacteria 1594
1025 Ga0453683_0004141 3300044673 Bacteria 10399
1026 Ga0453683_0011579 3300044673 Bacteria 5810
1027 Ga0453683_0012309 3300044673 Bacteria 5608
1028 Ga0453683_0025434 3300044673 Bacteria 3761
1029 Ga0453684_0018139 3300044712 Bacteria 10832
1030 Ga0453684_0023641 3300044712 Bacteria 9032
1031 Ga0453684_0048534 3300044712 Bacteria 5611
1032 Ga0453684_0138370 3300044712 Bacteria 2912
1033 Ga0451576_0007133 3300045051 Bacteria 13485
1034 Ga0451576_0011820 3300045051 Bacteria 9882
1035 Ga0451576_0013194 3300045051 Bacteria 9246
1036 Ga0451576_0013267 3300045051 Bacteria 9220
1037 Ga0451576_0013998 3300045051 Bacteria 8945
1038 Ga0451576_0017863 3300045051 Bacteria 7792
1039 Ga0451576_0063613 3300045051 Bacteria 3845
1040 Ga0451576_0133886 3300045051 Bacteria 2584
1041 Ga0451576_0166417 3300045051 Bacteria 2301
1042 Ga0495592_0033147 3300046454 Unclassified 3897
1043 Ga0495592_0037134 3300046454 Bacteria 3668
1044 Ga0495592_0044739 3300046454 Bacteria 3306
1045 Ga0495603_0021187 3300046455 Bacteria 3936
1046 Ga0495629_0009367 3300046459 Bacteria 7162
1047 Ga0495629_0131506 3300046459 Bacteria 1743
1048 Ga0495638_0001740 3300046460 Bacteria 19123
1049 Ga0495638_0047352 3300046460 Bacteria 2695
1050 Ga0495651_0000059 3300046462 Bacteria 81986
1051 Ga0495651_0001481 3300046462 Bacteria 18160
1052 Ga0495651_0010905 3300046462 Bacteria 6991
1053 Ga0495651_0045238 3300046462 Bacteria 3410
1054 Ga0495653_0005508 3300046463 Bacteria 10313
1055 Ga0495653_0018250 3300046463 Bacteria 5701
1056 Ga0495653_0053917 3300046463 Bacteria 3074
1057 Ga0495653_0060335 3300046463 Bacteria 2874
1058 Ga0495653_0091792 3300046463 Bacteria 2219
1059 Ga0495653_0159876 3300046463 Bacteria 1565
1060 Ga0495580_0007354 3300046472 Bacteria 8856
1061 Ga0495580_0017978 3300046472 Bacteria 5271
1062 Ga0495580_0029073 3300046472 Bacteria 4013
1063 Ga0495580_0075697 3300046472 Bacteria 2348
1064 Ga0495582_0008789 3300046473 Bacteria 5570
1065 Ga0495582_0009955 3300046473 Bacteria 5234
1066 Ga0495582_0039499 3300046473 Bacteria 2598
1067 Ga0495582_0044965 3300046473 Bacteria 2432
1068 Ga0495639_0006368 3300046475 Bacteria 5074
1069 Ga0495662_0070371 3300046476 Bacteria 1695
1070 Ga0495664_0022141 3300046477 Unclassified 3680
1071 Ga0495664_0048340 3300046477 Bacteria 2525
1072 Ga0495664_0146681 3300046477 Bacteria 1431
1073 Ga0495584_0074747 3300046491 Bacteria 1703
1074 Ga0495584_0189663 3300046491 Bacteria 1045
1075 Ga0495594_0013813 3300046499 Bacteria 4221
1076 Ga0495594_0018400 3300046499 Bacteria 3700
1077 Ga0495594_0020639 3300046499 Bacteria 3510
1078 Ga0495608_0006754 3300046511 Bacteria 8135
1079 Ga0495608_0011876 3300046511 Bacteria 6059
1080 Ga0495608_0023053 3300046511 Bacteria 4268
1081 Ga0495608_0126526 3300046511 Bacteria 1636
1082 Ga0495618_0032478 3300046514 Bacteria 3269
1083 Ga0495618_0050503 3300046514 Bacteria 2627
1084 Ga0495618_0145286 3300046514 Bacteria 1516
1085 Ga0495618_0172507 3300046514 Bacteria 1376
1086 Ga0495628_0000167 3300046516 Bacteria 57173
1087 Ga0495628_0006133 3300046516 Bacteria 10513
1088 Ga0495628_0023006 3300046516 Bacteria 5116
1089 Ga0495628_0026102 3300046516 Bacteria 4769
1090 Ga0495628_0034713 3300046516 Bacteria 4056
1091 Ga0495628_0174473 3300046516 Bacteria 1629
1092 Ga0495630_0012486 3300046517 Bacteria 6168
1093 Ga0495630_0039810 3300046517 Bacteria 3513
1094 Ga0495630_0060214 3300046517 Bacteria 2849
1095 Ga0495630_0097031 3300046517 Bacteria 2229
1096 Ga0495630_0239205 3300046517 Bacteria 1387
1097 Ga0495643_0039860 3300046522 Bacteria 2567
1098 Ga0495663_0012376 3300046525 Bacteria 2377
1099 Ga0495666_0015665 3300046526 Bacteria 3776
1100 Ga0495666_0034741 3300046526 Bacteria 2459
1101 Ga0495666_0121370 3300046526 Bacteria 1224
1102 Ga0495652_0004609 3300046529 Bacteria 13141
1103 Ga0495652_0022463 3300046529 Bacteria 5598
1104 Ga0495652_0028614 3300046529 Unclassified 4901
1105 Ga0495652_0229127 3300046529 Bacteria 1391
1106 Ga0495665_0002242 3300046531 Bacteria 10469
1107 Ga0495640_0013332 3300046533 Bacteria 6247
1108 Ga0495640_0137294 3300046533 Bacteria 1578
1109 Ga0495640_0155162 3300046533 Bacteria 1469
1110 Ga0495586_0015110 3300046535 Bacteria 4107
1111 Ga0495586_0091128 3300046535 Bacteria 1684
1112 Ga0495587_0000433 3300046536 Bacteria 29356
1113 Ga0495587_0002851 3300046536 Bacteria 11583
1114 Ga0495587_0003324 3300046536 Bacteria 10734
1115 Ga0495587_0009418 3300046536 Bacteria 6259
1116 Ga0495587_0017789 3300046536 Bacteria 4409
1117 Ga0495587_0126171 3300046536 Bacteria 1464
1118 Ga0495587_0200610 3300046536 Bacteria 1128
1119 Ga0495598_0026235 3300046537 Bacteria 1596
1120 Ga0495621_0039227 3300046539 Bacteria 1656
1121 Ga0495645_0001627 3300046543 Bacteria 15209
1122 Ga0495645_0008122 3300046543 Bacteria 7317
1123 Ga0495645_0012788 3300046543 Bacteria 5922
1124 Ga0495645_0067573 3300046543 Bacteria 2581
1125 Ga0495667_0015159 3300046559 Bacteria 5203
1126 Ga0495667_0026551 3300046559 Bacteria 3903
1127 Ga0495667_0070065 3300046559 Bacteria 2288
1128 Ga0495634_0008535 3300046642 Bacteria 7615
1129 Ga0495634_0088712 3300046642 Bacteria 2011
1130 Ga0495634_0149287 3300046642 Bacteria 1479
1131 Ga0495635_0019091 3300046663 Bacteria 4786
1132 Ga0495588_0007178 3300046674 Bacteria 5054
1133 Ga0495588_0139565 3300046674 Bacteria 1280
1134 Ga0495657_0024248 3300046675 Bacteria 4323
1135 Ga0495657_0031177 3300046675 Bacteria 3728
1136 Ga0495657_0058349 3300046675 Bacteria 2563
1137 Ga0495657_0137593 3300046675 Bacteria 1525
1138 Ga0495623_0001017 3300046679 Bacteria 18952
1139 Ga0495623_0064206 3300046679 Bacteria 2298
1140 Ga0495646_0008681 3300046680 Bacteria 6460
1141 Ga0495647_0017713 3300046681 Bacteria 2524
1142 Ga0495658_0016100 3300046683 Bacteria 3847
1143 Ga0495658_0020937 3300046683 Bacteria 3441
1144 Ga0495658_0155381 3300046683 Bacteria 1408
1145 Ga0495669_0001134 3300046684 Bacteria 11020
1146 Ga0495613_0006297 3300046689 Bacteria 8877
1147 Ga0495613_0020315 3300046689 Bacteria 4952
1148 Ga0495613_0143099 3300046689 Bacteria 1707
1149 Ga0495624_0032778 3300046690 Bacteria 3366
1150 Ga0495624_0065425 3300046690 Bacteria 2271
1151 Ga0495670_0057819 3300046691 Bacteria 1947
1152 Ga0495670_0121659 3300046691 Bacteria 1356
1153 Ga0495600_0001754 3300046809 Bacteria 12130
1154 Ga0495581_0167760 3300047315 Bacteria 1284
1155 Ga0495604_0000934 3300047317 Bacteria 24332
1156 Ga0495604_0006656 3300047317 Bacteria 9155
1157 Ga0495604_0010097 3300047317 Bacteria 7478
1158 Ga0495604_0045587 3300047317 Bacteria 3421
1159 Ga0495604_0197137 3300047317 Bacteria 1399
1160 Ga0495636_0010751 3300047318 Bacteria 3619
1161 Ga0495674_0010778 3300047319 Bacteria 8648
1162 Ga0495674_0015359 3300047319 Bacteria 7162
1163 Ga0495674_0034699 3300047319 Bacteria 4558
1164 Ga0495674_0141469 3300047319 Bacteria 2022
1165 Ga0495676_0005978 3300047321 Bacteria 11182
1166 Ga0495676_0061862 3300047321 Bacteria 2926
1167 Ga0495680_0003912 3300047322 Bacteria 14410
1168 Ga0495680_0007293 3300047322 Bacteria 10176
1169 Ga0495680_0039676 3300047322 Bacteria 3754
1170 Ga0495680_0058882 3300047322 Bacteria 2967
1171 Ga0495675_0000289 3300047444 Bacteria 36410
1172 Ga0495675_0003236 3300047444 Bacteria 9789
1173 Ga0495675_0035585 3300047444 Bacteria 3179
1174 Ga0495675_0067611 3300047444 Bacteria 2258
1175 Ga0495679_022289 3300047446 Bacteria 2170
1176 Ga0495684_0000504 3300047471 Bacteria 31616
1177 Ga0495684_0006592 3300047471 Bacteria 9007
1178 Ga0495684_0008127 3300047471 Bacteria 8114
1179 Ga0495684_0137297 3300047471 Bacteria 1835
1180 Ga0495684_0249058 3300047471 Bacteria 1293
1181 Ga0495593_0008338 3300047673 Bacteria 6030
1182 Ga0495593_0103662 3300047673 Bacteria 1457
1183 Ga0495593_0138100 3300047673 Bacteria 1235
1184 Ga0495602_0000056 3300048088 Bacteria 109741
1185 Ga0495602_0004170 3300048088 Bacteria 15040
1186 Ga0495602_0011475 3300048088 Bacteria 9158
1187 Ga0495602_0015880 3300048088 Bacteria 7585
1188 Ga0495602_0054834 3300048088 Bacteria 3516
1189 Ga0495602_0143378 3300048088 Bacteria 1888
1190 Ga0495614_0020037 3300048089 Bacteria 2893
1191 Ga0495614_0021255 3300048089 Bacteria 2803
1192 Ga0496100_0012885 3300048903 Bacteria 4807
1193 Ga0496100_0043019 3300048903 Bacteria 2887
1194 Ga0496100_0049289 3300048903 Bacteria 2723
1195 Ga0496100_0098137 3300048903 Bacteria 2013
1196 Ga0496101_0006912 3300048904 Bacteria 7325
1197 Ga0496101_0087788 3300048904 Bacteria 2309
1198 Ga0496102_0010134 3300048905 Bacteria 8105
1199 Ga0496102_0012507 3300048905 Bacteria 7349
1200 Ga0496102_0021614 3300048905 Bacteria 5692
1201 Ga0496103_0029718 3300048906 Bacteria 3322
1202 Ga0496104_0000157 3300048907 Bacteria 61755
1203 Ga0496104_0097552 3300048907 Bacteria 2813
1204 Ga0496104_0115609 3300048907 Bacteria 2574
1205 Ga0496104_0130858 3300048907 Bacteria 2410
1206 Ga0496105_0083326 3300048908 Bacteria 2641
1207 Ga0496105_0100535 3300048908 Bacteria 2388
1208 Ga0496105_0129031 3300048908 Bacteria 2085
1209 Ga0496106_0015998 3300048909 Bacteria 5548
1210 Ga0496106_0028722 3300048909 Bacteria 4143
1211 Ga0496106_0046663 3300048909 Bacteria 3258
1212 Ga0496106_0222372 3300048909 Bacteria 1506
1213 Ga0496107_0038246 3300048910 Bacteria 3444
1214 Ga0496107_0045403 3300048910 Bacteria 3160
1215 Ga0496108_0003499 3300048911 Bacteria 12586
1216 Ga0496108_0148824 3300048911 Bacteria 2020
1217 Ga0496108_0421290 3300048911 Bacteria 1166
1218 Ga0496109_0009476 3300048912 Bacteria 8302
1219 Ga0496109_0047093 3300048912 Bacteria 3919
1220 Ga0496110_0000063 3300048913 Bacteria 53033
1221 Ga0496110_0377941 3300048913 Bacteria 1291
1222 Ga0496111_0004348 3300048914 Bacteria 8942
1223 Ga0496111_0073612 3300048914 Bacteria 2488
1224 Ga0496112_0000245 3300048915 Bacteria 34580
1225 Ga0496112_0024556 3300048915 Bacteria 5774
1226 Ga0496112_0031622 3300048915 Bacteria 5135
1227 Ga0496112_0045209 3300048915 Bacteria 4316
1228 Ga0496112_0060475 3300048915 Bacteria 3734
1229 Ga0496112_0131460 3300048915 Bacteria 2474
1230 Ga0496113_0009126 3300048916 Bacteria 6498
1231 Ga0496113_0245604 3300048916 Bacteria 1428
1232 Ga0496113_0264357 3300048916 Bacteria 1375
1233 Ga0496114_0000005 3300048917 Bacteria 564262
1234 Ga0496114_0000371 3300048917 Bacteria 33092
1235 Ga0496114_0017463 3300048917 Bacteria 5790
1236 Ga0496114_0048633 3300048917 Bacteria 3528
1237 Ga0496114_0079649 3300048917 Bacteria 2766
1238 Ga0496115_0017958 3300048918 Bacteria 5420
1239 Ga0496115_0038548 3300048918 Bacteria 3792
1240 Ga0496115_0050776 3300048918 Bacteria 3324
1241 Ga0501031_0081626 3300049568 Bacteria 2108
1242 Ga0501032_0063932 3300049569 Bacteria 2463
1243 Ga0501033_0001797 3300049570 Bacteria 18718
1244 Ga0501033_0108440 3300049570 Bacteria 2022
1245 Ga0501034_0014607 3300049571 Bacteria 8085
1246 Ga0501034_0015307 3300049571 Bacteria 7884
1247 Ga0501034_0029877 3300049571 Bacteria 5540
1248 Ga0501034_0083279 3300049571 Bacteria 3200
1249 Ga0501034_0087907 3300049571 Bacteria 3106
1250 Ga0501036_0005695 3300049572 Bacteria 10106
1251 Ga0501036_0014261 3300049572 Bacteria 6613
1252 Ga0501036_0020670 3300049572 Bacteria 5530
1253 Ga0501036_0023391 3300049572 Bacteria 5206
1254 Ga0501036_0097060 3300049572 Bacteria 2491
1255 Ga0501036_0185089 3300049572 Bacteria 1753
1256 Ga0501036_0218816 3300049572 Bacteria 1599
1257 Ga0501036_0285531 3300049572 Bacteria 1381
1258 Ga0501037_0001960 3300049573 Bacteria 14869
1259 Ga0501037_0021899 3300049573 Bacteria 4731
1260 Ga0501037_0054273 3300049573 Bacteria 2930
1261 Ga0501038_0043872 3300049574 Bacteria 3887
1262 Ga0501038_0075827 3300049574 Bacteria 2842
1263 Ga0501038_0110687 3300049574 Bacteria 2275
1264 Ga0501038_0117291 3300049574 Bacteria 2199
1265 Ga0501039_0003641 3300049575 Bacteria 11550
1266 Ga0501039_0024578 3300049575 Bacteria 4628
1267 Ga0501040_0009429 3300049576 Bacteria 6364
1268 Ga0501040_0047419 3300049576 Bacteria 2934
1269 Ga0501040_0059430 3300049576 Bacteria 2626
1270 Ga0501040_0198859 3300049576 Bacteria 1423
1271 Ga0501041_0010123 3300049577 Bacteria 5557
1272 Ga0501041_0018828 3300049577 Bacteria 4112
1273 Ga0501041_0133848 3300049577 Bacteria 1544
1274 Ga0501042_0025593 3300049578 Bacteria 4146
1275 Ga0501042_0028146 3300049578 Bacteria 3956
1276 Ga0501042_0034060 3300049578 Bacteria 3612
1277 Ga0501042_0038051 3300049578 Bacteria 3416
1278 Ga0501042_0058854 3300049578 Bacteria 2743
1279 Ga0501042_0063708 3300049578 Bacteria 2635
1280 Ga0501042_0084812 3300049578 Bacteria 2272
1281 Ga0501042_0181805 3300049578 Bacteria 1517
1282 Ga0501042_0195047 3300049578 Bacteria 1460
1283 Ga0501042_0224376 3300049578 Bacteria 1355
1284 Ga0501043_0013132 3300049579 Bacteria 6476
1285 Ga0501043_0118058 3300049579 Bacteria 2081
1286 Ga0501043_0146656 3300049579 Bacteria 1848
1287 Ga0501046_0014479 3300049580 Bacteria 6654
1288 Ga0501046_0014990 3300049580 Bacteria 6520
1289 Ga0501046_0046634 3300049580 Bacteria 3438
1290 Ga0501046_0368956 3300049580 Bacteria 1040
1291 Ga0501047_0006564 3300049581 Bacteria 10952
1292 Ga0501047_0088501 3300049581 Bacteria 2973
1293 Ga0501047_0139369 3300049581 Bacteria 2304
1294 Ga0501047_0147499 3300049581 Bacteria 2229
1295 Ga0501047_0250265 3300049581 Bacteria 1620
1296 Ga0501048_0004103 3300049582 Bacteria 11093
1297 Ga0501048_0008075 3300049582 Bacteria 7966
1298 Ga0501048_0033095 3300049582 Bacteria 3736
1299 Ga0501048_0037754 3300049582 Bacteria 3469
1300 Ga0501048_0082182 3300049582 Bacteria 2272
1301 Ga0501048_0140527 3300049582 Bacteria 1707
1302 Ga0501067_0001385 3300049583 Bacteria 13146
1303 Ga0501068_0012541 3300049584 Bacteria 4810
1304 Ga0501068_0015357 3300049584 Bacteria 4395
1305 Ga0501069_0022414 3300049585 Bacteria 3435
1306 Ga0501069_0027751 3300049585 Bacteria 3103
1307 Ga0501069_0147209 3300049585 Bacteria 1352
1308 Ga0501070_0005646 3300049586 Bacteria 10669
1309 Ga0501070_0022268 3300049586 Bacteria 5309
1310 Ga0501071_0019087 3300049587 Bacteria 4757
1311 Ga0501071_0019377 3300049587 Bacteria 4721
1312 Ga0501071_0024253 3300049587 Bacteria 4241
1313 Ga0501071_0136639 3300049587 Bacteria 1824
1314 Ga0501071_0196801 3300049587 Bacteria 1513
1315 Ga0501071_0286187 3300049587 Bacteria 1248
1316 Ga0501072_0015475 3300049588 Bacteria 5848
1317 Ga0501072_0026441 3300049588 Bacteria 4525
1318 Ga0501072_0052203 3300049588 Bacteria 3219
1319 Ga0501072_0108375 3300049588 Bacteria 2210
1320 Ga0501072_0110579 3300049588 Bacteria 2187
1321 Ga0501072_0233175 3300049588 Bacteria 1466
1322 Ga0501072_0357101 3300049588 Bacteria 1160
1323 Ga0501073_0003168 3300049589 Bacteria 12344
1324 Ga0501073_0008693 3300049589 Bacteria 7520
1325 Ga0501073_0039425 3300049589 Bacteria 3347
1326 Ga0501073_0062776 3300049589 Bacteria 2591
1327 Ga0501074_0003931 3300049590 Bacteria 10589
1328 Ga0501074_0044209 3300049590 Bacteria 3225
1329 Ga0501074_0055892 3300049590 Bacteria 2844
1330 Ga0501074_0079253 3300049590 Bacteria 2357
1331 Ga0501074_0098437 3300049590 Bacteria 2093
1332 Ga0501074_0143634 3300049590 Bacteria 1707
1333 Ga0501075_0001850 3300049591 Bacteria 13973
1334 Ga0501075_0005672 3300049591 Bacteria 8543
1335 Ga0501075_0014357 3300049591 Bacteria 5675
1336 Ga0501075_0034386 3300049591 Bacteria 3774
1337 Ga0501075_0078796 3300049591 Bacteria 2494
1338 Ga0501075_0096760 3300049591 Bacteria 2240
1339 Ga0501075_0128859 3300049591 Bacteria 1927
1340 Ga0501075_0203219 3300049591 Bacteria 1511
1341 Ga0501076_0000633 3300049592 Bacteria 22451
1342 Ga0501076_0005874 3300049592 Bacteria 8852
1343 Ga0501076_0041328 3300049592 Bacteria 3627
1344 Ga0501076_0050221 3300049592 Bacteria 3299
1345 Ga0501076_0072157 3300049592 Bacteria 2763
1346 Ga0501076_0091921 3300049592 Bacteria 2441
1347 Ga0501076_0143057 3300049592 Bacteria 1944
1348 Ga0501076_0145643 3300049592 Bacteria 1926
1349 Ga0501076_0214337 3300049592 Bacteria 1574
1350 Ga0501076_0286645 3300049592 Bacteria 1349
1351 Ga0501076_0303554 3300049592 Bacteria 1309
1352 Ga0501077_0021021 3300049593 Bacteria 4129
1353 Ga0501249_011801 3300049679 Bacteria 1840
1354 Ga0501079_0009681 3300049741 Bacteria 7306
1355 Ga0501079_0015604 3300049741 Bacteria 5800
1356 Ga0501079_0017966 3300049741 Bacteria 5399
1357 Ga0501079_0021979 3300049741 Bacteria 4887
1358 Ga0501079_0136919 3300049741 Bacteria 1907
1359 Ga0501079_0202661 3300049741 Bacteria 1550
1360 Ga0501079_0211349 3300049741 Bacteria 1515
1361 Ga0501079_0297257 3300049741 Bacteria 1263
1362 Ga0501080_0001466 3300049742 Bacteria 19854
1363 Ga0501080_0046033 3300049742 Bacteria 4063
1364 Ga0501080_0128544 3300049742 Bacteria 2346
1365 Ga0501080_0141101 3300049742 Bacteria 2227
1366 Ga0501080_0209310 3300049742 Bacteria 1787
1367 Ga0501080_0249396 3300049742 Bacteria 1619
1368 Ga0501080_0304333 3300049742 Bacteria 1445
1369 Ga0501081_0007223 3300049743 Bacteria 7222
1370 Ga0501081_0018947 3300049743 Bacteria 4575
1371 Ga0501081_0040573 3300049743 Bacteria 3187
1372 Ga0501081_0073426 3300049743 Bacteria 2386
1373 Ga0501081_0083342 3300049743 Bacteria 2241
1374 Ga0501081_0085253 3300049743 Bacteria 2217
1375 Ga0501081_0085428 3300049743 Bacteria 2215
1376 Ga0501081_0155177 3300049743 Bacteria 1647
1377 Ga0501081_0184799 3300049743 Bacteria 1508
1378 Ga0501083_0011031 3300049744 Bacteria 6349
1379 Ga0501083_0026727 3300049744 Bacteria 3987
1380 Ga0501083_0028261 3300049744 Bacteria 3866
1381 Ga0501035_0027160 3300049822 Bacteria 5233
1382 Ga0501035_0098220 3300049822 Bacteria 2571
1383 Ga0501044_0009040 3300049823 Bacteria 10890
1384 Ga0501044_0063277 3300049823 Bacteria 3780
1385 Ga0501044_0092305 3300049823 Bacteria 3053
1386 Ga0501044_0105112 3300049823 Bacteria 2836
1387 Ga0501045_0006147 3300049824 Bacteria 8319
1388 Ga0501045_0008164 3300049824 Bacteria 7293
1389 Ga0501045_0015928 3300049824 Bacteria 5333
1390 Ga0501045_0018451 3300049824 Bacteria 4963
1391 Ga0501045_0021060 3300049824 Bacteria 4661
1392 Ga0501045_0069439 3300049824 Bacteria 2590
1393 Ga0501045_0095660 3300049824 Bacteria 2197
1394 nmdc:mga00v17_132837_c1 3300050491 Bacteria 1592
1395 nmdc:mga0k408_24845_c1 3300050493 Bacteria 3389
1396 nmdc:mga0k408_25943_c1 3300050493 Bacteria 3321
1397 nmdc:mga0k408_70841_c1 3300050493 Bacteria 2034
1398 nmdc:mga06z11_85054_c1 3300050494 Bacteria 1706
1399 nmdc:mga05p37_11748_c1 3300050507 Bacteria 10439
1400 nmdc:mga05p37_13533_c1 3300050507 Bacteria 9781
1401 nmdc:mga05p37_167522_c1 3300050507 Bacteria 2681
1402 nmdc:mga05p37_18779_c1 3300050507 Bacteria 8355
1403 nmdc:mga05p37_22849_c1 3300050507 Bacteria 7584
1404 nmdc:mga05p37_2888_c1 3300050507 Bacteria 19926
1405 nmdc:mga05p37_29_c1 3300050507 Bacteria 114400
1406 nmdc:mga05p37_351913_c1 3300050507 Bacteria 1734
1407 nmdc:mga05p37_357395_c1 3300050507 Bacteria 1718
1408 nmdc:mga05p37_368307_c1 3300050507 Unclassified 1687
1409 nmdc:mga05p37_39052_c1 3300050507 Bacteria 5824
1410 nmdc:mga05p37_39487_c2 3300050507 Bacteria 4017
1411 nmdc:mga05p37_39668_c1 3300050507 Bacteria 5782
1412 nmdc:mga05p37_416935_c1 3300050507 Bacteria 1564
1413 nmdc:mga05p37_420241_c1 3300050507 Bacteria 1556
1414 nmdc:mga05p37_56321_c1 3300050507 Bacteria 4840
1415 nmdc:mga05p37_569_c2 3300050507 Bacteria 24307
1416 nmdc:mga05p37_610996_c1 3300050507 Bacteria 1229
1417 nmdc:mga05p37_73587_c1 3300050507 Bacteria 4205
1418 nmdc:mga05p37_90897_c1 3300050507 Bacteria 3762
1419 nmdc:mga09592_10035_c1 3300050508 Bacteria 7699
1420 nmdc:mga09592_12714_c1 3300050508 Bacteria 6861
1421 nmdc:mga09592_14921_c1 3300050508 Bacteria 6346
1422 nmdc:mga09592_15438_c1 3300050508 Bacteria 6240
1423 nmdc:mga09592_1848_c1 3300050508 Bacteria 17028
1424 nmdc:mga09592_20949_c1 3300050508 Bacteria 5383
1425 nmdc:mga09592_25857_c1 3300050508 Bacteria 4861
1426 nmdc:mga09592_33010_c1 3300050508 Bacteria 4318
1427 nmdc:mga0qj67_118605_c2 3300050509 Bacteria 1822
1428 nmdc:mga0qj67_122428_c1 3300050509 Bacteria 2104
1429 nmdc:mga0qj67_171285_c1 3300050509 Bacteria 1763
1430 nmdc:mga0qj67_21098_c1 3300050509 Bacteria 4995
1431 nmdc:mga0qj67_234549_c1 3300050509 Bacteria 1489
1432 nmdc:mga0qj67_32771_c1 3300050509 Bacteria 4053
1433 nmdc:mga0qj67_397745_c1 3300050509 Bacteria 1112
1434 nmdc:mga0qj67_41245_c1 3300050509 Bacteria 3630
1435 nmdc:mga0qj67_7069_c1 3300050509 Bacteria 8281
1436 nmdc:mga0qj67_88608_c1 3300050509 Bacteria 2484
1437 nmdc:mga06r32_101775_c1 3300050510 Bacteria 2820
1438 nmdc:mga06r32_107864_c1 3300050510 Bacteria 2737
1439 nmdc:mga06r32_23263_c1 3300050510 Bacteria 5731
1440 nmdc:mga06r32_310264_c1 3300050510 Bacteria 1563
1441 nmdc:mga06r32_33345_c1 3300050510 Bacteria 4850
1442 nmdc:mga06r32_34703_c1 3300050510 Bacteria 4758
1443 nmdc:mga06r32_46528_c1 3300050510 Bacteria 4140
1444 nmdc:mga06r32_58764_c1 3300050510 Bacteria 3696
1445 nmdc:mga06r32_82552_c1 3300050510 Bacteria 3131
1446 nmdc:mga08y16_120436_c1 3300050511 Bacteria 2731
1447 nmdc:mga08y16_148914_c1 3300050511 Bacteria 2433
1448 nmdc:mga08y16_154608_c1 3300050511 Bacteria 2384
1449 nmdc:mga08y16_158977_c1 3300050511 Bacteria 2348
1450 nmdc:mga08y16_164841_c1 3300050511 Bacteria 2302
1451 nmdc:mga08y16_173829_c1 3300050511 Bacteria 2237
1452 nmdc:mga08y16_178964_c1 3300050511 Bacteria 2202
1453 nmdc:mga08y16_17_c1 3300050511 Bacteria 382598
1454 nmdc:mga08y16_182208_c1 3300050511 Bacteria 2181
1455 nmdc:mga08y16_212203_c1 3300050511 Bacteria 2005
1456 nmdc:mga08y16_242780_c1 3300050511 Bacteria 1862
1457 nmdc:mga08y16_252016_c1 3300050511 Bacteria 1824
1458 nmdc:mga08y16_338041_c1 3300050511 Bacteria 1548
1459 nmdc:mga08y16_4308_c1 3300050511 Bacteria 14860
1460 nmdc:mga08y16_46776_c1 3300050511 Bacteria 4529
1461 nmdc:mga08y16_513071_c1 3300050511 Bacteria 1217
1462 nmdc:mga08y16_54011_c1 3300050511 Bacteria 4199
1463 nmdc:mga08y16_57474_c1 3300050511 Bacteria 4065
1464 nmdc:mga08y16_65734_c1 3300050511 Bacteria 3785
1465 nmdc:mga08y16_6614_c1 3300050511 Bacteria 12156
1466 nmdc:mga08y16_82537_c1 3300050511 Bacteria 3351
1467 nmdc:mga0n895_1110_c1 3300050512 Bacteria 19640
1468 nmdc:mga0n895_116876_c1 3300050512 Bacteria 2686
1469 nmdc:mga0n895_123625_c1 3300050512 Bacteria 2610
1470 nmdc:mga0n895_123811_c1 3300050512 Bacteria 2608
1471 nmdc:mga0n895_135327_c1 3300050512 Bacteria 2491
1472 nmdc:mga0n895_13860_c1 3300050512 Bacteria 7297
1473 nmdc:mga0n895_145362_c1 3300050512 Bacteria 2401
1474 nmdc:mga0n895_148879_c1 3300050512 Bacteria 2370
1475 nmdc:mga0n895_209668_c1 3300050512 Bacteria 1979
1476 nmdc:mga0n895_287087_c1 3300050512 Bacteria 1668
1477 nmdc:mga0n895_36785_c1 3300050512 Bacteria 4730
1478 nmdc:mga0n895_69859_c1 3300050512 Bacteria 3480
1479 nmdc:mga0n895_79259_c1 3300050512 Bacteria 3271
1480 nmdc:mga0n895_84092_c1 3300050512 Bacteria 3175
1481 nmdc:mga0rr50_134599_c1 3300050513 Bacteria 1982
1482 nmdc:mga0rr50_2215_c1 3300050513 Bacteria 10908
1483 nmdc:mga0rr50_282787_c1 3300050513 Bacteria 1384
1484 nmdc:mga0rr50_56489_c1 3300050513 Bacteria 2933
1485 nmdc:mga0rr50_58092_c1 3300050513 Bacteria 2897
1486 nmdc:mga0rr50_716_c1 3300050513 Bacteria 17853
1487 nmdc:mga0rr50_76530_c1 3300050513 Bacteria 2569
1488 nmdc:mga0rr50_97048_c1 3300050513 Bacteria 2307
1489 nmdc:mga08x19_10017_c1 3300050514 Bacteria 5682
1490 nmdc:mga08x19_1347_c1 3300050514 Bacteria 15247
1491 nmdc:mga08x19_524_c1 3300050514 Bacteria 25566
1492 nmdc:mga08x19_54222_c1 3300050514 Bacteria 2580
1493 nmdc:mga0a205_104560_c1 3300050515 Bacteria 2731
1494 nmdc:mga0a205_118219_c1 3300050515 Bacteria 2549
1495 nmdc:mga0a205_1412_c1 3300050515 Bacteria 20378
1496 nmdc:mga0a205_174619_c1 3300050515 Bacteria 2044
1497 nmdc:mga0a205_2103_c1 3300050515 Bacteria 17454
1498 nmdc:mga0a205_219952_c1 3300050515 Bacteria 1785
1499 nmdc:mga0a205_22925_c1 3300050515 Bacteria 5920
1500 nmdc:mga0a205_249144_c1 3300050515 Bacteria 1656
1501 nmdc:mga0a205_3073_c1 3300050515 Bacteria 14819
1502 nmdc:mga0a205_428009_c1 3300050515 Bacteria 1185
1503 nmdc:mga0a205_5662_c1 3300050515 Bacteria 11257
1504 nmdc:mga0a205_60956_c1 3300050515 Bacteria 3644
1505 Ga0495601_0009838 3300053077 Bacteria 5659
1506 Ga0495601_0079319 3300053077 Bacteria 2105
1507 Ga0495612_0000398 3300053078 Bacteria 17397
1508 Ga0495655_0000574 3300053083 Bacteria 6053
1509 Ga0495595_0048976 3300053084 Bacteria 1953
1510 Ga0495619_0007406 3300053085 Bacteria 6956
1511 Ga0495619_0113876 3300053085 Bacteria 1850
1512 Ga0495619_0144885 3300053085 Bacteria 1637
1513 Ga0495619_0158037 3300053085 Bacteria 1565
1514 Ga0495619_0242434 3300053085 Bacteria 1249
1515 Ga0500628_003394 3300053129 Bacteria 2630
1516 Ga0500628_007908 3300053129 Bacteria 1834
1517 Ga0501084_0030447 3300054114 Bacteria 4513
1518 Ga0501084_0044927 3300054114 Bacteria 3699
1519 Ga0501084_0054785 3300054114 Bacteria 3336
1520 Ga0501084_0212131 3300054114 Bacteria 1634
1521 Ga0501084_0268347 3300054114 Bacteria 1441
1522 Ga0501084_0291544 3300054114 Bacteria 1378
1523 Ga0501084_0322180 3300054114 Bacteria 1305
1524 Ga0590071_000359 3300059421 Bacteria 13451
1525 Ga0590071_008116 3300059421 Bacteria 2479
1526 Ga0590071_023051 3300059421 Bacteria 1470
1527 Ga0590074_006216 3300059423 Bacteria 1982
1528 Ga0590075_000139 3300059424 Bacteria 19073
1529 Ga0590075_001920 3300059424 Bacteria 5035
1530 Ga0590075_011912 3300059424 Bacteria 2107
1531 Ga0590077_000011 3300059426 Bacteria 41505
1532 Ga0590077_005365 3300059426 Bacteria 2628
1533 Ga0501082_0003063 3300060353 Bacteria 14588
1534 Ga0501082_0019848 3300060353 Bacteria 5796
1535 Ga0501082_0036375 3300060353 Bacteria 4241
1536 Ga0501082_0072004 3300060353 Bacteria 2977
1537 Ga0501082_0132483 3300060353 Bacteria 2163
1538 Ga0501082_0198994 3300060353 Bacteria 1743
1539 Ga0501082_0263380 3300060353 Bacteria 1500
1540 Ga0530510_0005554 3300061734 Bacteria 8740
1541 Ga0530510_0082052 3300061734 Bacteria 2348
1542 Ga0530510_0145796 3300061734 Bacteria 1746
1543 Ga0530510_0353601 3300061734 Bacteria 1104

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031711 Ga0265314_10023524 Ga0265314_100235244 311
2 3300013297 Ga0157378_10281354 Ga0157378_102813542 319
3 3300005354 Ga0070675_100001024 Ga0070675_10000102410 322
4 3300005364 Ga0070673_100058579 Ga0070673_1000585793 322
5 3300005365 Ga0070688_100021012 Ga0070688_1000210124 322
6 3300005530 Ga0070679_100124285 Ga0070679_1001242852 322
7 3300005843 Ga0068860_100015659 Ga0068860_1000156594 322
8 3300014745 Ga0157377_10008196 Ga0157377_100081966 322
9 3300014968 Ga0157379_10207188 Ga0157379_102071882 322
10 3300025926 Ga0207659_10003555 Ga0207659_100035552 322
11 3300025936 Ga0207670_10051766 Ga0207670_100517662 322
12 3300028381 Ga0268264_10001966 Ga0268264_100019664 322
13 3300031239 Ga0265328_10028844 Ga0265328_100288442 322
14 3300031240 Ga0265320_10028961 Ga0265320_100289612 322
15 3300031250 Ga0265331_10026792 Ga0265331_100267923 322
16 3300031344 Ga0265316_10088298 Ga0265316_100882983 322
17 3300050513 nmdc:mga0rr50_97048_c1 nmdc:mga0rr50_97048_c1_1287_2261 324
18 3300005471 Ga0070698_100015006 Ga0070698_1000150062 325
19 3300048910 Ga0496107_0038246 Ga0496107_0038246_985_1962 325
20 3300049572 Ga0501036_0218816 Ga0501036_0218816_33_1013 326
21 3300047318 Ga0495636_0010751 Ga0495636_0010751_786_1808 327
22 3300005331 Ga0070670_100117557 Ga0070670_1001175572 328
23 3300005353 Ga0070669_100040428 Ga0070669_1000404282 328
24 3300009553 Ga0105249_10549398 Ga0105249_105493981 328
25 3300025908 Ga0207643_10038368 Ga0207643_100383682 328
26 3300046529 Ga0495652_0229127 Ga0495652_0229127_26_1012 328
27 3300046691 Ga0495670_0057819 Ga0495670_0057819_648_1634 328
28 3300048907 Ga0496104_0115609 Ga0496104_0115609_1505_2491 328
29 3300048915 Ga0496112_0024556 Ga0496112_0024556_2401_3387 328
30 3300048916 Ga0496113_0264357 Ga0496113_0264357_89_1075 328
31 3300049580 Ga0501046_0368956 Ga0501046_0368956_34_1020 328
32 3300047319 Ga0495674_0141469 Ga0495674_0141469_1007_1996 329
33 3300050508 nmdc:mga09592_25857_c1 nmdc:mga09592_25857_c1_889_1881 329
34 iso_pu_bacteria 8054357960 8054359959 330
35 3300049588 Ga0501072_0110579 Ga0501072_0110579_302_1315 331
36 3300009147 Ga0114129_10057984 Ga0114129_100579844 332
37 3300025981 Ga0207640_10053034 Ga0207640_100530344 332
38 3300009098 Ga0105245_10033714 Ga0105245_100337143 333
39 3300009176 Ga0105242_10142896 Ga0105242_101428962 333
40 3300014326 Ga0157380_10204107 Ga0157380_102041072 333
41 3300014969 Ga0157376_10055323 Ga0157376_100553232 333
42 3300027671 Ga0209588_1013432 Ga0209588_10134322 333
43 3300039110 Ga0400487_55885 Ga0400487_55885_2798_3832 333
44 3300005328 Ga0070676_10042457 Ga0070676_100424572 334
45 3300005341 Ga0070691_10005391 Ga0070691_100053912 334
46 3300005353 Ga0070669_100058689 Ga0070669_1000586892 334
47 3300005354 Ga0070675_100106845 Ga0070675_1001068453 334
48 3300005441 Ga0070700_100003978 Ga0070700_1000039787 334
49 3300005457 Ga0070662_100050184 Ga0070662_1000501843 334
50 3300005459 Ga0068867_100012153 Ga0068867_1000121536 334
51 3300005459 Ga0068867_100235012 Ga0068867_1002350121 334
52 3300005543 Ga0070672_100104885 Ga0070672_1001048853 334
53 3300005545 Ga0070695_100008733 Ga0070695_1000087337 334
54 3300005546 Ga0070696_100033671 Ga0070696_1000336712 334
55 3300005549 Ga0070704_100012700 Ga0070704_1000127002 334
56 3300005564 Ga0070664_100054162 Ga0070664_1000541623 334
57 3300005615 Ga0070702_100002550 Ga0070702_1000025508 334
58 3300005719 Ga0068861_100004253 Ga0068861_1000042539 334
59 3300005844 Ga0068862_100167988 Ga0068862_1001679882 334
60 3300005844 Ga0068862_100312083 Ga0068862_1003120831 334
61 3300006058 Ga0075432_10055177 Ga0075432_100551772 334
62 3300009148 Ga0105243_10013883 Ga0105243_100138834 334
63 3300009553 Ga0105249_10032539 Ga0105249_100325392 334
64 3300025315 Ga0207697_10025607 Ga0207697_100256072 334
65 3300025907 Ga0207645_10000374 Ga0207645_1000037439 334
66 3300025923 Ga0207681_10164773 Ga0207681_101647732 334
67 3300025926 Ga0207659_10064234 Ga0207659_100642342 334
68 3300025933 Ga0207706_10075480 Ga0207706_100754803 334
69 3300025935 Ga0207709_10058837 Ga0207709_100588372 334
70 3300025936 Ga0207670_10317870 Ga0207670_103178702 334
71 3300025937 Ga0207669_10010275 Ga0207669_100102754 334
72 3300025937 Ga0207669_10177867 Ga0207669_101778672 334
73 3300025938 Ga0207704_10261912 Ga0207704_102619122 334
74 3300025940 Ga0207691_10043122 Ga0207691_100431224 334
75 3300025945 Ga0207679_10466302 Ga0207679_104663021 334
76 3300025961 Ga0207712_10135594 Ga0207712_101355942 334
77 3300025986 Ga0207658_10085333 Ga0207658_100853332 334
78 3300026075 Ga0207708_10087996 Ga0207708_100879963 334
79 3300026075 Ga0207708_10109996 Ga0207708_101099962 334
80 3300026089 Ga0207648_10026662 Ga0207648_100266624 334
81 3300026089 Ga0207648_10037009 Ga0207648_100370092 334
82 3300026118 Ga0207675_100001961 Ga0207675_1000019612 334
83 3300026118 Ga0207675_100179457 Ga0207675_1001794572 334
84 3300026118 Ga0207675_100281120 Ga0207675_1002811202 334
85 3300026118 Ga0207675_100302616 Ga0207675_1003026162 334
86 3300028380 Ga0268265_10010217 Ga0268265_100102176 334
87 3300046491 Ga0495584_0189663 Ga0495584_0189663_17_1021 334
88 3300050491 nmdc:mga00v17_132837_c1 nmdc:mga00v17_132837_c1_446_1489 334
89 3300050493 nmdc:mga0k408_25943_c1 nmdc:mga0k408_25943_c1_1837_2880 334
90 3300050494 nmdc:mga06z11_85054_c1 nmdc:mga06z11_85054_c1_380_1423 334
91 3300050508 nmdc:mga09592_20949_c1 nmdc:mga09592_20949_c1_753_1757 334
92 3300050510 nmdc:mga06r32_82552_c1 nmdc:mga06r32_82552_c1_1717_2721 334
93 3300050511 nmdc:mga08y16_338041_c1 nmdc:mga08y16_338041_c1_508_1512 334
94 3300005843 Ga0068860_100000658 Ga0068860_10000065818 335
95 3300009094 Ga0111539_10017849 Ga0111539_100178497 335
96 3300025942 Ga0207689_10148118 Ga0207689_101481182 335
97 3300028381 Ga0268264_10001337 Ga0268264_100013372 335
98 3300050511 nmdc:mga08y16_6614_c1 nmdc:mga08y16_6614_c1_3385_4410 335
99 3300060353 Ga0501082_0263380 Ga0501082_0263380_465_1481 335
100 3300005290 Ga0065712_10096909 Ga0065712_100969092 336
101 3300005293 Ga0065715_10090135 Ga0065715_100901356 336
102 3300005295 Ga0065707_10082300 Ga0065707_1008230014 336
103 3300005295 Ga0065707_10114653 Ga0065707_101146533 336
104 3300005340 Ga0070689_100059391 Ga0070689_1000593912 336
105 3300005353 Ga0070669_100103009 Ga0070669_1001030093 336
106 3300005354 Ga0070675_100031700 Ga0070675_1000317003 336
107 3300005354 Ga0070675_100159643 Ga0070675_1001596432 336
108 3300005355 Ga0070671_100359700 Ga0070671_1003597001 336
109 3300005356 Ga0070674_100016261 Ga0070674_1000162615 336
110 3300005365 Ga0070688_100101264 Ga0070688_1001012641 336
111 3300005367 Ga0070667_100156520 Ga0070667_1001565202 336
112 3300005438 Ga0070701_10025882 Ga0070701_100258822 336
113 3300005466 Ga0070685_10002548 Ga0070685_100025483 336
114 3300005468 Ga0070707_100045214 Ga0070707_1000452143 336
115 3300005471 Ga0070698_100072730 Ga0070698_1000727302 336
116 3300005548 Ga0070665_100000122 Ga0070665_10000012290 336
117 3300005549 Ga0070704_100012627 Ga0070704_1000126273 336
118 3300005617 Ga0068859_100007450 Ga0068859_1000074509 336
119 3300005843 Ga0068860_100276596 Ga0068860_1002765962 336
120 3300005844 Ga0068862_100006398 Ga0068862_1000063989 336
121 3300006844 Ga0075428_100000005 Ga0075428_10000000515 336
122 3300006844 Ga0075428_100057559 Ga0075428_1000575594 336
123 3300006871 Ga0075434_100176521 Ga0075434_1001765211 336
124 3300006871 Ga0075434_100271683 Ga0075434_1002716832 336
125 3300006931 Ga0097620_100007450 Ga0097620_1000074509 336
126 3300009094 Ga0111539_10000008 Ga0111539_10000008297 336
127 3300009553 Ga0105249_10021476 Ga0105249_100214766 336
128 3300014326 Ga0157380_10007520 Ga0157380_100075206 336
129 3300014969 Ga0157376_10610909 Ga0157376_106109091 336
130 3300025893 Ga0207682_10035209 Ga0207682_100352092 336
131 3300025922 Ga0207646_10044362 Ga0207646_100443624 336
132 3300025926 Ga0207659_10073756 Ga0207659_100737562 336
133 3300025936 Ga0207670_10048147 Ga0207670_100481473 336
134 3300025937 Ga0207669_10010135 Ga0207669_100101352 336
135 3300025945 Ga0207679_10345999 Ga0207679_103459992 336
136 3300025960 Ga0207651_10093640 Ga0207651_100936402 336
137 3300025961 Ga0207712_10033799 Ga0207712_100337992 336
138 3300026118 Ga0207675_100196272 Ga0207675_1001962722 336
139 3300027907 Ga0207428_10000285 Ga0207428_1000028553 336
140 3300028379 Ga0268266_10000217 Ga0268266_1000021790 336
141 3300031616 Ga0307508_10019767 Ga0307508_100197674 336
142 3300032002 Ga0307416_100423376 Ga0307416_1004233762 336
143 3300035085 Ga0373929_0000003 Ga0373929_0000003_289752_290783 336
144 3300035692 Ga0373935_0000906 Ga0373935_0000906_11325_12359 336
145 3300041999 Ga0439433_0018593 Ga0439433_0018593_439_1452 336
146 3300042436 Ga0439435_0018526 Ga0439435_0018526_568_1581 336
147 3300042876 Ga0451577_0253283 Ga0451577_0253283_166_1194 336
148 3300048917 Ga0496114_0000005 Ga0496114_0000005_251577_252611 336
149 3300049572 Ga0501036_0023391 Ga0501036_0023391_4086_5099 336
150 3300049576 Ga0501040_0059430 Ga0501040_0059430_903_1916 336
151 3300049577 Ga0501041_0018828 Ga0501041_0018828_1960_2973 336
152 3300049578 Ga0501042_0058854 Ga0501042_0058854_1125_2138 336
153 3300049578 Ga0501042_0224376 Ga0501042_0224376_303_1316 336
154 3300049587 Ga0501071_0019377 Ga0501071_0019377_954_1967 336
155 3300049588 Ga0501072_0026441 Ga0501072_0026441_547_1560 336
156 3300049591 Ga0501075_0034386 Ga0501075_0034386_1108_2121 336
157 3300049591 Ga0501075_0096760 Ga0501075_0096760_255_1268 336
158 3300049592 Ga0501076_0005874 Ga0501076_0005874_4939_5952 336
159 3300049592 Ga0501076_0214337 Ga0501076_0214337_275_1288 336
160 3300049592 Ga0501076_0286645 Ga0501076_0286645_192_1205 336
161 3300049592 Ga0501076_0303554 Ga0501076_0303554_138_1151 336
162 3300049743 Ga0501081_0085428 Ga0501081_0085428_690_1715 336
163 3300049824 Ga0501045_0015928 Ga0501045_0015928_842_1855 336
164 3300050511 nmdc:mga08y16_17_c1 nmdc:mga08y16_17_c1_317088_318104 336
165 3300050512 nmdc:mga0n895_145362_c1 nmdc:mga0n895_145362_c1_322_1350 336
166 3300050512 nmdc:mga0n895_287087_c1 nmdc:mga0n895_287087_c1_359_1381 336
167 3300054114 Ga0501084_0212131 Ga0501084_0212131_539_1552 336
168 3300054114 Ga0501084_0268347 Ga0501084_0268347_215_1228 336
169 3300060353 Ga0501082_0072004 Ga0501082_0072004_984_1997 336
170 3300005354 Ga0070675_100064924 Ga0070675_1000649242 337
171 3300005364 Ga0070673_100272439 Ga0070673_1002724392 337
172 3300005365 Ga0070688_100085427 Ga0070688_1000854272 337
173 3300005367 Ga0070667_100106411 Ga0070667_1001064112 337
174 3300005436 Ga0070713_100097566 Ga0070713_1000975662 337
175 3300005445 Ga0070708_100205444 Ga0070708_1002054442 337
176 3300005466 Ga0070685_10191722 Ga0070685_101917222 337
177 3300005549 Ga0070704_100153527 Ga0070704_1001535272 337
178 3300005618 Ga0068864_100067698 Ga0068864_1000676983 337
179 3300006028 Ga0070717_10000160 Ga0070717_1000016044 337
180 3300006358 Ga0068871_100117926 Ga0068871_1001179262 337
181 3300006846 Ga0075430_100034120 Ga0075430_1000341202 337
182 3300006847 Ga0075431_100198791 Ga0075431_1001987912 337
183 3300006852 Ga0075433_10097299 Ga0075433_100972992 337
184 3300006880 Ga0075429_100112122 Ga0075429_1001121223 337
185 3300006880 Ga0075429_100116987 Ga0075429_1001169872 337
186 3300006914 Ga0075436_100007865 Ga0075436_1000078652 337
187 3300006914 Ga0075436_100042530 Ga0075436_1000425302 337
188 3300007076 Ga0075435_100000185 Ga0075435_1000001855 337
189 3300007076 Ga0075435_100336062 Ga0075435_1003360622 337
190 3300009094 Ga0111539_10015435 Ga0111539_100154355 337
191 3300009094 Ga0111539_10162093 Ga0111539_101620931 337
192 3300009094 Ga0111539_10259101 Ga0111539_102591012 337
193 3300009094 Ga0111539_10385603 Ga0111539_103856032 337
194 3300009094 Ga0111539_10505083 Ga0111539_105050832 337
195 3300009094 Ga0111539_10531179 Ga0111539_105311792 337
196 3300009147 Ga0114129_10000574 Ga0114129_1000057419 337
197 3300009147 Ga0114129_10400489 Ga0114129_104004892 337
198 3300009177 Ga0105248_10084089 Ga0105248_100840892 337
199 3300009177 Ga0105248_10207658 Ga0105248_102076582 337
200 3300013297 Ga0157378_10000678 Ga0157378_1000067811 337
201 3300013297 Ga0157378_10001262 Ga0157378_1000126214 337
202 3300013306 Ga0163162_10072255 Ga0163162_100722555 337
203 3300013308 Ga0157375_10000010 Ga0157375_1000001072 337
204 3300014325 Ga0163163_10000023 Ga0163163_1000002387 337
205 3300014326 Ga0157380_10013898 Ga0157380_100138986 337
206 3300014326 Ga0157380_10068673 Ga0157380_100686734 337
207 3300014326 Ga0157380_10196324 Ga0157380_101963242 337
208 3300014326 Ga0157380_10331615 Ga0157380_103316152 337
209 3300025922 Ga0207646_10089322 Ga0207646_100893221 337
210 3300025923 Ga0207681_10095641 Ga0207681_100956412 337
211 3300025928 Ga0207700_10078610 Ga0207700_100786101 337
212 3300025932 Ga0207690_10134218 Ga0207690_101342182 337
213 3300025934 Ga0207686_10106152 Ga0207686_101061523 337
214 3300025941 Ga0207711_10121043 Ga0207711_101210432 337
215 3300025942 Ga0207689_10006874 Ga0207689_1000687411 337
216 3300025942 Ga0207689_10094010 Ga0207689_100940103 337
217 3300026075 Ga0207708_10077717 Ga0207708_100777173 337
218 3300026095 Ga0207676_10272370 Ga0207676_102723702 337
219 3300027907 Ga0207428_10009579 Ga0207428_100095798 337
220 3300027907 Ga0207428_10253670 Ga0207428_102536702 337
221 3300030521 Ga0307511_10003746 Ga0307511_1000374611 337
222 3300031548 Ga0307408_100228101 Ga0307408_1002281012 337
223 3300031852 Ga0307410_10013809 Ga0307410_100138097 337
224 3300031903 Ga0307407_10047429 Ga0307407_100474293 337
225 3300031995 Ga0307409_100065126 Ga0307409_1000651264 337
226 3300032002 Ga0307416_100046391 Ga0307416_1000463912 337
227 3300032002 Ga0307416_100495620 Ga0307416_1004956202 337
228 3300032005 Ga0307411_10026725 Ga0307411_100267253 337
229 3300032126 Ga0307415_100079332 Ga0307415_1000793322 337
230 3300041408 Ga0439453_0004367 Ga0439453_0004367_662_1675 337
231 3300042437 Ga0439444_0004188 Ga0439444_0004188_1050_2063 337
232 3300042876 Ga0451577_0003196 Ga0451577_0003196_11866_12897 337
233 3300044673 Ga0453683_0025434 Ga0453683_0025434_53_1084 337
234 3300044712 Ga0453684_0048534 Ga0453684_0048534_3039_4070 337
235 3300045051 Ga0451576_0013267 Ga0451576_0013267_7186_8217 337
236 3300045051 Ga0451576_0013998 Ga0451576_0013998_5979_6995 337
237 3300045051 Ga0451576_0063613 Ga0451576_0063613_1526_2557 337
238 3300046463 Ga0495653_0005508 Ga0495653_0005508_5556_6572 337
239 3300046522 Ga0495643_0039860 Ga0495643_0039860_1087_2100 337
240 3300046642 Ga0495634_0088712 Ga0495634_0088712_857_1876 337
241 3300047446 Ga0495679_022289 Ga0495679_022289_434_1459 337
242 3300048915 Ga0496112_0060475 Ga0496112_0060475_1457_2470 337
243 3300049569 Ga0501032_0063932 Ga0501032_0063932_1176_2192 337
244 3300049570 Ga0501033_0108440 Ga0501033_0108440_346_1362 337
245 3300049571 Ga0501034_0014607 Ga0501034_0014607_1152_2168 337
246 3300049571 Ga0501034_0083279 Ga0501034_0083279_1426_2442 337
247 3300049574 Ga0501038_0110687 Ga0501038_0110687_83_1099 337
248 3300049575 Ga0501039_0003641 Ga0501039_0003641_9949_10965 337
249 3300049576 Ga0501040_0198859 Ga0501040_0198859_309_1325 337
250 3300049578 Ga0501042_0181805 Ga0501042_0181805_261_1277 337
251 3300049580 Ga0501046_0014479 Ga0501046_0014479_1453_2469 337
252 3300049581 Ga0501047_0088501 Ga0501047_0088501_1902_2918 337
253 3300049584 Ga0501068_0015357 Ga0501068_0015357_1014_2030 337
254 3300049585 Ga0501069_0027751 Ga0501069_0027751_1567_2583 337
255 3300049585 Ga0501069_0147209 Ga0501069_0147209_32_1045 337
256 3300049588 Ga0501072_0233175 Ga0501072_0233175_18_1034 337
257 3300049589 Ga0501073_0062776 Ga0501073_0062776_590_1606 337
258 3300049591 Ga0501075_0005672 Ga0501075_0005672_3898_4914 337
259 3300049591 Ga0501075_0203219 Ga0501075_0203219_297_1310 337
260 3300049592 Ga0501076_0091921 Ga0501076_0091921_1157_2179 337
261 3300049741 Ga0501079_0021979 Ga0501079_0021979_3740_4756 337
262 3300049741 Ga0501079_0297257 Ga0501079_0297257_144_1157 337
263 3300049742 Ga0501080_0128544 Ga0501080_0128544_729_1742 337
264 3300049742 Ga0501080_0209310 Ga0501080_0209310_692_1708 337
265 3300049743 Ga0501081_0007223 Ga0501081_0007223_791_1807 337
266 3300050507 nmdc:mga05p37_29_c1 nmdc:mga05p37_29_c1_58881_59897 337
267 3300050507 nmdc:mga05p37_569_c2 nmdc:mga05p37_569_c2_7409_8422 337
268 3300050510 nmdc:mga06r32_33345_c1 nmdc:mga06r32_33345_c1_2612_3628 337
269 3300050511 nmdc:mga08y16_158977_c1 nmdc:mga08y16_158977_c1_1187_2203 337
270 3300050511 nmdc:mga08y16_178964_c1 nmdc:mga08y16_178964_c1_1022_2038 337
271 3300050511 nmdc:mga08y16_182208_c1 nmdc:mga08y16_182208_c1_17_1033 337
272 3300050511 nmdc:mga08y16_212203_c1 nmdc:mga08y16_212203_c1_14_1030 337
273 3300050511 nmdc:mga08y16_252016_c1 nmdc:mga08y16_252016_c1_145_1161 337
274 3300050511 nmdc:mga08y16_65734_c1 nmdc:mga08y16_65734_c1_2355_3371 337
275 3300050512 nmdc:mga0n895_148879_c1 nmdc:mga0n895_148879_c1_411_1430 337
276 3300050513 nmdc:mga0rr50_134599_c1 nmdc:mga0rr50_134599_c1_772_1791 337
277 3300050513 nmdc:mga0rr50_716_c1 nmdc:mga0rr50_716_c1_4652_5674 337
278 3300050514 nmdc:mga08x19_524_c1 nmdc:mga08x19_524_c1_18386_19408 337
279 3300050515 nmdc:mga0a205_174619_c1 nmdc:mga0a205_174619_c1_546_1565 337
280 3300050515 nmdc:mga0a205_249144_c1 nmdc:mga0a205_249144_c1_22_1038 337
281 3300053083 Ga0495655_0000574 Ga0495655_0000574_740_1762 337
282 3300053085 Ga0495619_0158037 Ga0495619_0158037_505_1521 337
283 3300054114 Ga0501084_0291544 Ga0501084_0291544_103_1116 337
284 3300059421 Ga0590071_000359 Ga0590071_000359_12227_13249 337
285 3300059421 Ga0590071_023051 Ga0590071_023051_251_1264 337
286 3300059423 Ga0590074_006216 Ga0590074_006216_170_1192 337
287 3300059424 Ga0590075_000139 Ga0590075_000139_14595_15617 337
288 3300059424 Ga0590075_011912 Ga0590075_011912_113_1126 337
289 3300059426 Ga0590077_000011 Ga0590077_000011_39422_40444 337
290 3300059426 Ga0590077_005365 Ga0590077_005365_521_1534 337
291 3300061734 Ga0530510_0082052 Ga0530510_0082052_1044_2060 337
292 3300061734 Ga0530510_0145796 Ga0530510_0145796_66_1079 337
293 3300005290 Ga0065712_10003117 Ga0065712_100031173 338
294 3300005290 Ga0065712_10067822 Ga0065712_100678222 338
295 3300005290 Ga0065712_10068256 Ga0065712_100682566 338
296 3300005290 Ga0065712_10069647 Ga0065712_100696478 338
297 3300005290 Ga0065712_10092300 Ga0065712_100923002 338
298 3300005290 Ga0065712_10117705 Ga0065712_101177052 338
299 3300005293 Ga0065715_10010472 Ga0065715_100104722 338
300 3300005293 Ga0065715_10093135 Ga0065715_100931353 338
301 3300005293 Ga0065715_10094425 Ga0065715_100944252 338
302 3300005293 Ga0065715_10113341 Ga0065715_101133412 338
303 3300005293 Ga0065715_10117987 Ga0065715_101179872 338
304 3300005295 Ga0065707_10001479 Ga0065707_100014798 338
305 3300005295 Ga0065707_10132595 Ga0065707_101325952 338
306 3300005295 Ga0065707_10162560 Ga0065707_101625601 338
307 3300005295 Ga0065707_10167462 Ga0065707_101674622 338
308 3300005328 Ga0070676_10007541 Ga0070676_100075417 338
309 3300005328 Ga0070676_10026430 Ga0070676_100264303 338
310 3300005329 Ga0070683_100000767 Ga0070683_10000076718 338
311 3300005329 Ga0070683_100200920 Ga0070683_1002009203 338
312 3300005330 Ga0070690_100016845 Ga0070690_1000168452 338
313 3300005330 Ga0070690_100047784 Ga0070690_1000477842 338
314 3300005330 Ga0070690_100137999 Ga0070690_1001379992 338
315 3300005331 Ga0070670_100004018 Ga0070670_1000040187 338
316 3300005331 Ga0070670_100005693 Ga0070670_10000569310 338
317 3300005331 Ga0070670_100006799 Ga0070670_10000679911 338
318 3300005331 Ga0070670_100053037 Ga0070670_1000530373 338
319 3300005331 Ga0070670_100068457 Ga0070670_1000684573 338
320 3300005331 Ga0070670_100082316 Ga0070670_1000823162 338
321 3300005333 Ga0070677_10001941 Ga0070677_100019415 338
322 3300005333 Ga0070677_10016182 Ga0070677_100161823 338
323 3300005333 Ga0070677_10051067 Ga0070677_100510671 338
324 3300005334 Ga0068869_100001962 Ga0068869_10000196210 338
325 3300005334 Ga0068869_100019703 Ga0068869_1000197036 338
326 3300005335 Ga0070666_10016269 Ga0070666_100162692 338
327 3300005335 Ga0070666_10063651 Ga0070666_100636512 338
328 3300005335 Ga0070666_10112771 Ga0070666_101127712 338
329 3300005337 Ga0070682_100000035 Ga0070682_100000035108 338
330 3300005338 Ga0068868_100043851 Ga0068868_1000438512 338
331 3300005338 Ga0068868_100141734 Ga0068868_1001417342 338
332 3300005338 Ga0068868_100144848 Ga0068868_1001448482 338
333 3300005338 Ga0068868_100194443 Ga0068868_1001944432 338
334 3300005339 Ga0070660_100154479 Ga0070660_1001544792 338
335 3300005340 Ga0070689_100016312 Ga0070689_1000163123 338
336 3300005340 Ga0070689_100020541 Ga0070689_1000205416 338
337 3300005340 Ga0070689_100023685 Ga0070689_1000236855 338
338 3300005340 Ga0070689_100100302 Ga0070689_1001003022 338
339 3300005340 Ga0070689_100172345 Ga0070689_1001723452 338
340 3300005343 Ga0070687_100003542 Ga0070687_1000035424 338
341 3300005343 Ga0070687_100006797 Ga0070687_1000067976 338
342 3300005343 Ga0070687_100186401 Ga0070687_1001864012 338
343 3300005343 Ga0070687_100246111 Ga0070687_1002461111 338
344 3300005344 Ga0070661_100023235 Ga0070661_1000232355 338
345 3300005344 Ga0070661_100032912 Ga0070661_1000329122 338
346 3300005347 Ga0070668_100025473 Ga0070668_1000254732 338
347 3300005353 Ga0070669_100002591 Ga0070669_1000025917 338
348 3300005353 Ga0070669_100027676 Ga0070669_1000276763 338
349 3300005353 Ga0070669_100136306 Ga0070669_1001363063 338
350 3300005353 Ga0070669_100189810 Ga0070669_1001898102 338
351 3300005354 Ga0070675_100000442 Ga0070675_10000044222 338
352 3300005354 Ga0070675_100012826 Ga0070675_1000128264 338
353 3300005354 Ga0070675_100024303 Ga0070675_1000243034 338
354 3300005354 Ga0070675_100035531 Ga0070675_1000355312 338
355 3300005354 Ga0070675_100037927 Ga0070675_1000379274 338
356 3300005354 Ga0070675_100049232 Ga0070675_1000492325 338
357 3300005354 Ga0070675_100072539 Ga0070675_1000725392 338
358 3300005354 Ga0070675_100126641 Ga0070675_1001266411 338
359 3300005354 Ga0070675_100171016 Ga0070675_1001710162 338
360 3300005354 Ga0070675_100254623 Ga0070675_1002546232 338
361 3300005355 Ga0070671_100022132 Ga0070671_1000221322 338
362 3300005356 Ga0070674_100004110 Ga0070674_1000041102 338
363 3300005356 Ga0070674_100052750 Ga0070674_1000527502 338
364 3300005356 Ga0070674_100071144 Ga0070674_1000711443 338
365 3300005356 Ga0070674_100080733 Ga0070674_1000807332 338
366 3300005356 Ga0070674_100098405 Ga0070674_1000984052 338
367 3300005356 Ga0070674_100100078 Ga0070674_1001000781 338
368 3300005364 Ga0070673_100007497 Ga0070673_1000074977 338
369 3300005364 Ga0070673_100008711 Ga0070673_1000087114 338
370 3300005364 Ga0070673_100011429 Ga0070673_1000114295 338
371 3300005364 Ga0070673_100039289 Ga0070673_1000392893 338
372 3300005364 Ga0070673_100045756 Ga0070673_1000457562 338
373 3300005364 Ga0070673_100052057 Ga0070673_1000520572 338
374 3300005364 Ga0070673_100054726 Ga0070673_1000547262 338
375 3300005364 Ga0070673_100074909 Ga0070673_1000749092 338
376 3300005365 Ga0070688_100009725 Ga0070688_1000097254 338
377 3300005365 Ga0070688_100118249 Ga0070688_1001182492 338
378 3300005365 Ga0070688_100206141 Ga0070688_1002061412 338
379 3300005367 Ga0070667_100014780 Ga0070667_1000147808 338
380 3300005367 Ga0070667_100207474 Ga0070667_1002074741 338
381 3300005367 Ga0070667_100262386 Ga0070667_1002623862 338
382 3300005406 Ga0070703_10003911 Ga0070703_100039114 338
383 3300005406 Ga0070703_10019537 Ga0070703_100195372 338
384 3300005434 Ga0070709_10069154 Ga0070709_100691541 338
385 3300005435 Ga0070714_100165808 Ga0070714_1001658082 338
386 3300005436 Ga0070713_100028719 Ga0070713_1000287191 338
387 3300005438 Ga0070701_10007445 Ga0070701_100074455 338
388 3300005438 Ga0070701_10025421 Ga0070701_100254213 338
389 3300005440 Ga0070705_100026756 Ga0070705_1000267564 338
390 3300005440 Ga0070705_100057794 Ga0070705_1000577941 338
391 3300005440 Ga0070705_100115577 Ga0070705_1001155772 338
392 3300005441 Ga0070700_100010664 Ga0070700_1000106644 338
393 3300005441 Ga0070700_100011740 Ga0070700_1000117404 338
394 3300005444 Ga0070694_100020020 Ga0070694_1000200203 338
395 3300005444 Ga0070694_100028490 Ga0070694_1000284904 338
396 3300005444 Ga0070694_100180103 Ga0070694_1001801031 338
397 3300005445 Ga0070708_100019182 Ga0070708_1000191826 338
398 3300005445 Ga0070708_100048944 Ga0070708_1000489444 338
399 3300005445 Ga0070708_100293505 Ga0070708_1002935052 338
400 3300005445 Ga0070708_100325323 Ga0070708_1003253231 338
401 3300005455 Ga0070663_100009691 Ga0070663_1000096916 338
402 3300005456 Ga0070678_100237450 Ga0070678_1002374502 338
403 3300005457 Ga0070662_100036324 Ga0070662_1000363242 338
404 3300005457 Ga0070662_100076829 Ga0070662_1000768293 338
405 3300005458 Ga0070681_10000926 Ga0070681_1000092615 338
406 3300005459 Ga0068867_100004543 Ga0068867_1000045434 338
407 3300005459 Ga0068867_100007110 Ga0068867_1000071103 338
408 3300005459 Ga0068867_100015273 Ga0068867_1000152733 338
409 3300005459 Ga0068867_100040773 Ga0068867_1000407734 338
410 3300005459 Ga0068867_100068142 Ga0068867_1000681423 338
411 3300005459 Ga0068867_100110181 Ga0068867_1001101813 338
412 3300005459 Ga0068867_100129921 Ga0068867_1001299212 338
413 3300005459 Ga0068867_100414885 Ga0068867_1004148851 338
414 3300005466 Ga0070685_10003010 Ga0070685_100030108 338
415 3300005467 Ga0070706_100017811 Ga0070706_1000178115 338
416 3300005468 Ga0070707_100052066 Ga0070707_1000520662 338
417 3300005468 Ga0070707_100103657 Ga0070707_1001036572 338
418 3300005468 Ga0070707_100211057 Ga0070707_1002110571 338
419 3300005471 Ga0070698_100002474 Ga0070698_1000024743 338
420 3300005471 Ga0070698_100163544 Ga0070698_1001635442 338
421 3300005518 Ga0070699_100042605 Ga0070699_1000426052 338
422 3300005518 Ga0070699_100060971 Ga0070699_1000609715 338
423 3300005518 Ga0070699_100063016 Ga0070699_1000630162 338
424 3300005518 Ga0070699_100091306 Ga0070699_1000913062 338
425 3300005518 Ga0070699_100421623 Ga0070699_1004216231 338
426 3300005530 Ga0070679_100011918 Ga0070679_1000119188 338
427 3300005535 Ga0070684_100004962 Ga0070684_1000049624 338
428 3300005535 Ga0070684_100010485 Ga0070684_1000104852 338
429 3300005535 Ga0070684_100122918 Ga0070684_1001229182 338
430 3300005536 Ga0070697_100057979 Ga0070697_1000579792 338
431 3300005536 Ga0070697_100267488 Ga0070697_1002674882 338
432 3300005539 Ga0068853_100174627 Ga0068853_1001746272 338
433 3300005543 Ga0070672_100000360 Ga0070672_1000003605 338
434 3300005543 Ga0070672_100037705 Ga0070672_1000377052 338
435 3300005543 Ga0070672_100066328 Ga0070672_1000663283 338
436 3300005543 Ga0070672_100115218 Ga0070672_1001152182 338
437 3300005543 Ga0070672_100144402 Ga0070672_1001444022 338
438 3300005543 Ga0070672_100247639 Ga0070672_1002476392 338
439 3300005544 Ga0070686_100006747 Ga0070686_1000067477 338
440 3300005544 Ga0070686_100147924 Ga0070686_1001479242 338
441 3300005548 Ga0070665_100002388 Ga0070665_1000023887 338
442 3300005548 Ga0070665_100166571 Ga0070665_1001665712 338
443 3300005549 Ga0070704_100000802 Ga0070704_1000008027 338
444 3300005549 Ga0070704_100020062 Ga0070704_1000200624 338
445 3300005549 Ga0070704_100049606 Ga0070704_1000496063 338
446 3300005549 Ga0070704_100197329 Ga0070704_1001973292 338
447 3300005564 Ga0070664_100009155 Ga0070664_1000091555 338
448 3300005564 Ga0070664_100040446 Ga0070664_1000404464 338
449 3300005564 Ga0070664_100050239 Ga0070664_1000502393 338
450 3300005564 Ga0070664_100128131 Ga0070664_1001281312 338
451 3300005564 Ga0070664_100147749 Ga0070664_1001477492 338
452 3300005577 Ga0068857_100031800 Ga0068857_1000318005 338
453 3300005577 Ga0068857_100041841 Ga0068857_1000418414 338
454 3300005577 Ga0068857_100043627 Ga0068857_1000436273 338
455 3300005577 Ga0068857_100124417 Ga0068857_1001244172 338
456 3300005578 Ga0068854_100011543 Ga0068854_1000115435 338
457 3300005615 Ga0070702_100041188 Ga0070702_1000411882 338
458 3300005615 Ga0070702_100105012 Ga0070702_1001050121 338
459 3300005615 Ga0070702_100153084 Ga0070702_1001530842 338
460 3300005616 Ga0068852_100026364 Ga0068852_1000263645 338
461 3300005616 Ga0068852_100176540 Ga0068852_1001765402 338
462 3300005617 Ga0068859_100004358 Ga0068859_10000435812 338
463 3300005617 Ga0068859_100023926 Ga0068859_1000239267 338
464 3300005617 Ga0068859_100034044 Ga0068859_1000340443 338
465 3300005617 Ga0068859_100053436 Ga0068859_1000534362 338
466 3300005617 Ga0068859_100098046 Ga0068859_1000980463 338
467 3300005618 Ga0068864_100000007 Ga0068864_100000007139 338
468 3300005618 Ga0068864_100008459 Ga0068864_10000845910 338
469 3300005618 Ga0068864_100008524 Ga0068864_1000085242 338
470 3300005618 Ga0068864_100022414 Ga0068864_1000224141 338
471 3300005618 Ga0068864_100037340 Ga0068864_1000373403 338
472 3300005618 Ga0068864_100066381 Ga0068864_1000663812 338
473 3300005618 Ga0068864_100486886 Ga0068864_1004868861 338
474 3300005718 Ga0068866_10010430 Ga0068866_100104303 338
475 3300005719 Ga0068861_100001024 Ga0068861_10000102412 338
476 3300005719 Ga0068861_100011191 Ga0068861_1000111917 338
477 3300005719 Ga0068861_100018977 Ga0068861_1000189774 338
478 3300005719 Ga0068861_100092894 Ga0068861_1000928942 338
479 3300005719 Ga0068861_100346505 Ga0068861_1003465051 338
480 3300005719 Ga0068861_100383676 Ga0068861_1003836762 338
481 3300005834 Ga0068851_10012457 Ga0068851_100124572 338
482 3300005840 Ga0068870_10002841 Ga0068870_100028415 338
483 3300005840 Ga0068870_10006109 Ga0068870_100061094 338
484 3300005840 Ga0068870_10006855 Ga0068870_100068553 338
485 3300005840 Ga0068870_10014126 Ga0068870_100141264 338
486 3300005840 Ga0068870_10066587 Ga0068870_100665872 338
487 3300005840 Ga0068870_10183760 Ga0068870_101837601 338
488 3300005841 Ga0068863_100089191 Ga0068863_1000891912 338
489 3300005841 Ga0068863_100135370 Ga0068863_1001353702 338
490 3300005842 Ga0068858_100000717 Ga0068858_10000071711 338
491 3300005842 Ga0068858_100010084 Ga0068858_1000100844 338
492 3300005842 Ga0068858_100059383 Ga0068858_1000593835 338
493 3300005842 Ga0068858_100096421 Ga0068858_1000964213 338
494 3300005842 Ga0068858_100098730 Ga0068858_1000987302 338
495 3300005843 Ga0068860_100095866 Ga0068860_1000958662 338
496 3300005843 Ga0068860_100185812 Ga0068860_1001858122 338
497 3300005844 Ga0068862_100002475 Ga0068862_10000247510 338
498 3300005844 Ga0068862_100016709 Ga0068862_1000167093 338
499 3300005844 Ga0068862_100018886 Ga0068862_1000188863 338
500 3300005844 Ga0068862_100169822 Ga0068862_1001698222 338
501 3300005844 Ga0068862_100172065 Ga0068862_1001720653 338
502 3300005844 Ga0068862_100484977 Ga0068862_1004849772 338
503 3300005985 Ga0081539_10004230 Ga0081539_100042307 338
504 3300006042 Ga0075368_10006201 Ga0075368_100062015 338
505 3300006178 Ga0075367_10003716 Ga0075367_100037164 338
506 3300006237 Ga0097621_100005430 Ga0097621_1000054307 338
507 3300006237 Ga0097621_100058986 Ga0097621_1000589863 338
508 3300006237 Ga0097621_100059085 Ga0097621_1000590853 338
509 3300006237 Ga0097621_100089132 Ga0097621_1000891324 338
510 3300006353 Ga0075370_10076812 Ga0075370_100768123 338
511 3300006358 Ga0068871_100001401 Ga0068871_10000140113 338
512 3300006358 Ga0068871_100016049 Ga0068871_1000160492 338
513 3300006358 Ga0068871_100060151 Ga0068871_1000601514 338
514 3300006358 Ga0068871_100075412 Ga0068871_1000754123 338
515 3300006844 Ga0075428_100002473 Ga0075428_10000247312 338
516 3300006844 Ga0075428_100003359 Ga0075428_1000033592 338
517 3300006844 Ga0075428_100009431 Ga0075428_1000094316 338
518 3300006844 Ga0075428_100016154 Ga0075428_1000161546 338
519 3300006844 Ga0075428_100027209 Ga0075428_1000272092 338
520 3300006844 Ga0075428_100048327 Ga0075428_1000483276 338
521 3300006844 Ga0075428_100166741 Ga0075428_1001667413 338
522 3300006844 Ga0075428_100442094 Ga0075428_1004420942 338
523 3300006846 Ga0075430_100002136 Ga0075430_1000021368 338
524 3300006846 Ga0075430_100005588 Ga0075430_10000558811 338
525 3300006846 Ga0075430_100014486 Ga0075430_1000144863 338
526 3300006846 Ga0075430_100020148 Ga0075430_1000201485 338
527 3300006846 Ga0075430_100095682 Ga0075430_1000956822 338
528 3300006846 Ga0075430_100175267 Ga0075430_1001752672 338
529 3300006846 Ga0075430_100314349 Ga0075430_1003143491 338
530 3300006847 Ga0075431_100000575 Ga0075431_10000057512 338
531 3300006847 Ga0075431_100005566 Ga0075431_1000055665 338
532 3300006847 Ga0075431_100007412 Ga0075431_1000074125 338
533 3300006847 Ga0075431_100010853 Ga0075431_1000108536 338
534 3300006847 Ga0075431_100032234 Ga0075431_1000322342 338
535 3300006847 Ga0075431_100074509 Ga0075431_1000745095 338
536 3300006847 Ga0075431_100177433 Ga0075431_1001774332 338
537 3300006847 Ga0075431_100192911 Ga0075431_1001929112 338
538 3300006847 Ga0075431_100330244 Ga0075431_1003302442 338
539 3300006852 Ga0075433_10003019 Ga0075433_1000301911 338
540 3300006852 Ga0075433_10050195 Ga0075433_100501952 338
541 3300006852 Ga0075433_10067923 Ga0075433_100679234 338
542 3300006852 Ga0075433_10083058 Ga0075433_100830582 338
543 3300006852 Ga0075433_10088168 Ga0075433_100881682 338
544 3300006871 Ga0075434_100025674 Ga0075434_1000256745 338
545 3300006871 Ga0075434_100037402 Ga0075434_1000374026 338
546 3300006871 Ga0075434_100051482 Ga0075434_1000514825 338
547 3300006871 Ga0075434_100062148 Ga0075434_1000621485 338
548 3300006871 Ga0075434_100100251 Ga0075434_1001002512 338
549 3300006871 Ga0075434_100127023 Ga0075434_1001270232 338
550 3300006871 Ga0075434_100166250 Ga0075434_1001662502 338
551 3300006871 Ga0075434_100396614 Ga0075434_1003966142 338
552 3300006880 Ga0075429_100003923 Ga0075429_10000392310 338
553 3300006880 Ga0075429_100013537 Ga0075429_1000135378 338
554 3300006880 Ga0075429_100016751 Ga0075429_1000167516 338
555 3300006880 Ga0075429_100035327 Ga0075429_1000353276 338
556 3300006880 Ga0075429_100036989 Ga0075429_1000369894 338
557 3300006880 Ga0075429_100068908 Ga0075429_1000689085 338
558 3300006880 Ga0075429_100091401 Ga0075429_1000914012 338
559 3300006881 Ga0068865_100105696 Ga0068865_1001056962 338
560 3300006914 Ga0075436_100008907 Ga0075436_1000089078 338
561 3300006914 Ga0075436_100090348 Ga0075436_1000903483 338
562 3300006931 Ga0097620_100004358 Ga0097620_1000043586 338
563 3300006931 Ga0097620_100023926 Ga0097620_1000239267 338
564 3300006931 Ga0097620_100034044 Ga0097620_1000340443 338
565 3300006931 Ga0097620_100053435 Ga0097620_1000534355 338
566 3300006931 Ga0097620_100098046 Ga0097620_1000980462 338
567 3300007076 Ga0075435_100006977 Ga0075435_1000069778 338
568 3300009093 Ga0105240_10045142 Ga0105240_100451426 338
569 3300009093 Ga0105240_10118771 Ga0105240_101187712 338
570 3300009094 Ga0111539_10010233 Ga0111539_100102333 338
571 3300009094 Ga0111539_10053056 Ga0111539_100530562 338
572 3300009094 Ga0111539_10069612 Ga0111539_100696122 338
573 3300009094 Ga0111539_10120056 Ga0111539_101200564 338
574 3300009094 Ga0111539_10172713 Ga0111539_101727133 338
575 3300009094 Ga0111539_10237395 Ga0111539_102373953 338
576 3300009094 Ga0111539_10419146 Ga0111539_104191462 338
577 3300009094 Ga0111539_10428901 Ga0111539_104289012 338
578 3300009098 Ga0105245_10004535 Ga0105245_100045355 338
579 3300009098 Ga0105245_10005359 Ga0105245_100053593 338
580 3300009098 Ga0105245_10050297 Ga0105245_100502973 338
581 3300009098 Ga0105245_10152435 Ga0105245_101524353 338
582 3300009147 Ga0114129_10002431 Ga0114129_1000243120 338
583 3300009147 Ga0114129_10007344 Ga0114129_1000734413 338
584 3300009147 Ga0114129_10008510 Ga0114129_1000851014 338
585 3300009147 Ga0114129_10020281 Ga0114129_100202816 338
586 3300009147 Ga0114129_10024870 Ga0114129_1002487011 338
587 3300009147 Ga0114129_10049166 Ga0114129_100491664 338
588 3300009147 Ga0114129_10103084 Ga0114129_101030842 338
589 3300009147 Ga0114129_10126427 Ga0114129_101264272 338
590 3300009147 Ga0114129_10147067 Ga0114129_101470674 338
591 3300009147 Ga0114129_10191633 Ga0114129_101916333 338
592 3300009147 Ga0114129_10413203 Ga0114129_104132032 338
593 3300009148 Ga0105243_10077158 Ga0105243_100771584 338
594 3300009148 Ga0105243_10118442 Ga0105243_101184422 338
595 3300009148 Ga0105243_10229795 Ga0105243_102297952 338
596 3300009174 Ga0105241_10033243 Ga0105241_100332431 338
597 3300009174 Ga0105241_10360000 Ga0105241_103600002 338
598 3300009176 Ga0105242_10007676 Ga0105242_100076769 338
599 3300009177 Ga0105248_10001544 Ga0105248_100015445 338
600 3300009177 Ga0105248_10039996 Ga0105248_100399963 338
601 3300009177 Ga0105248_10119465 Ga0105248_101194653 338
602 3300009177 Ga0105248_10128088 Ga0105248_101280883 338
603 3300009177 Ga0105248_10410839 Ga0105248_104108392 338
604 3300009551 Ga0105238_10000002 Ga0105238_10000002168 338
605 3300009551 Ga0105238_10203277 Ga0105238_102032772 338
606 3300009553 Ga0105249_10052119 Ga0105249_100521194 338
607 3300009553 Ga0105249_10104120 Ga0105249_101041203 338
608 3300011119 Ga0105246_10016281 Ga0105246_100162813 338
609 3300013296 Ga0157374_10000038 Ga0157374_100000385 338
610 3300013296 Ga0157374_10179131 Ga0157374_101791312 338
611 3300013296 Ga0157374_10200211 Ga0157374_102002112 338
612 3300013297 Ga0157378_10299363 Ga0157378_102993632 338
613 3300013306 Ga0163162_10006374 Ga0163162_100063749 338
614 3300013306 Ga0163162_10030754 Ga0163162_100307544 338
615 3300013308 Ga0157375_10000003 Ga0157375_10000003246 338
616 3300013308 Ga0157375_10006844 Ga0157375_1000684410 338
617 3300013308 Ga0157375_10046618 Ga0157375_100466184 338
618 3300013308 Ga0157375_10094436 Ga0157375_100944363 338
619 3300014325 Ga0163163_10007293 Ga0163163_100072934 338
620 3300014325 Ga0163163_10015982 Ga0163163_100159827 338
621 3300014325 Ga0163163_10347387 Ga0163163_103473872 338
622 3300014326 Ga0157380_10008698 Ga0157380_100086986 338
623 3300014326 Ga0157380_10011997 Ga0157380_100119972 338
624 3300014326 Ga0157380_10015991 Ga0157380_100159917 338
625 3300014326 Ga0157380_10044711 Ga0157380_100447112 338
626 3300014326 Ga0157380_10049170 Ga0157380_100491703 338
627 3300014326 Ga0157380_10084766 Ga0157380_100847664 338
628 3300014326 Ga0157380_10303700 Ga0157380_103037002 338
629 3300014745 Ga0157377_10000004 Ga0157377_10000004255 338
630 3300014745 Ga0157377_10000074 Ga0157377_1000007450 338
631 3300014745 Ga0157377_10002734 Ga0157377_100027343 338
632 3300014968 Ga0157379_10005070 Ga0157379_100050709 338
633 3300014969 Ga0157376_10000003 Ga0157376_1000000331 338
634 3300014969 Ga0157376_10138252 Ga0157376_101382522 338
635 3300014969 Ga0157376_10325007 Ga0157376_103250072 338
636 3300017792 Ga0163161_10024629 Ga0163161_100246292 338
637 3300017792 Ga0163161_10072790 Ga0163161_100727902 338
638 3300025315 Ga0207697_10007162 Ga0207697_100071623 338
639 3300025893 Ga0207682_10002808 Ga0207682_100028088 338
640 3300025893 Ga0207682_10008627 Ga0207682_100086275 338
641 3300025893 Ga0207682_10026000 Ga0207682_100260002 338
642 3300025899 Ga0207642_10002113 Ga0207642_100021135 338
643 3300025899 Ga0207642_10072235 Ga0207642_100722352 338
644 3300025901 Ga0207688_10000078 Ga0207688_1000007839 338
645 3300025901 Ga0207688_10023905 Ga0207688_100239053 338
646 3300025901 Ga0207688_10122377 Ga0207688_101223772 338
647 3300025906 Ga0207699_10044858 Ga0207699_100448582 338
648 3300025906 Ga0207699_10060540 Ga0207699_100605402 338
649 3300025907 Ga0207645_10001092 Ga0207645_1000109214 338
650 3300025907 Ga0207645_10010985 Ga0207645_100109856 338
651 3300025907 Ga0207645_10034102 Ga0207645_100341024 338
652 3300025907 Ga0207645_10047816 Ga0207645_100478162 338
653 3300025908 Ga0207643_10003058 Ga0207643_100030587 338
654 3300025908 Ga0207643_10006513 Ga0207643_100065134 338
655 3300025908 Ga0207643_10064690 Ga0207643_100646903 338
656 3300025908 Ga0207643_10101174 Ga0207643_101011742 338
657 3300025908 Ga0207643_10168825 Ga0207643_101688252 338
658 3300025908 Ga0207643_10186244 Ga0207643_101862441 338
659 3300025910 Ga0207684_10048144 Ga0207684_100481444 338
660 3300025912 Ga0207707_10008909 Ga0207707_100089095 338
661 3300025913 Ga0207695_10034283 Ga0207695_100342832 338
662 3300025917 Ga0207660_10108613 Ga0207660_101086132 338
663 3300025918 Ga0207662_10007437 Ga0207662_100074375 338
664 3300025918 Ga0207662_10034763 Ga0207662_100347633 338
665 3300025918 Ga0207662_10056672 Ga0207662_100566722 338
666 3300025918 Ga0207662_10068771 Ga0207662_100687712 338
667 3300025919 Ga0207657_10131981 Ga0207657_101319812 338
668 3300025920 Ga0207649_10005573 Ga0207649_100055739 338
669 3300025920 Ga0207649_10085622 Ga0207649_100856222 338
670 3300025921 Ga0207652_10015551 Ga0207652_100155515 338
671 3300025922 Ga0207646_10051322 Ga0207646_100513224 338
672 3300025923 Ga0207681_10000705 Ga0207681_1000070516 338
673 3300025923 Ga0207681_10030851 Ga0207681_100308512 338
674 3300025923 Ga0207681_10048185 Ga0207681_100481852 338
675 3300025923 Ga0207681_10048216 Ga0207681_100482162 338
676 3300025923 Ga0207681_10049316 Ga0207681_100493164 338
677 3300025923 Ga0207681_10057761 Ga0207681_100577612 338
678 3300025923 Ga0207681_10080337 Ga0207681_100803372 338
679 3300025923 Ga0207681_10167476 Ga0207681_101674762 338
680 3300025923 Ga0207681_10372897 Ga0207681_103728971 338
681 3300025924 Ga0207694_10000001 Ga0207694_10000001169 338
682 3300025925 Ga0207650_10010475 Ga0207650_100104752 338
683 3300025925 Ga0207650_10015200 Ga0207650_100152004 338
684 3300025925 Ga0207650_10017612 Ga0207650_100176122 338
685 3300025925 Ga0207650_10019816 Ga0207650_100198161 338
686 3300025925 Ga0207650_10119526 Ga0207650_101195262 338
687 3300025925 Ga0207650_10223524 Ga0207650_102235242 338
688 3300025926 Ga0207659_10000501 Ga0207659_1000050113 338
689 3300025926 Ga0207659_10014754 Ga0207659_100147544 338
690 3300025926 Ga0207659_10020760 Ga0207659_100207604 338
691 3300025926 Ga0207659_10098749 Ga0207659_100987493 338
692 3300025926 Ga0207659_10139943 Ga0207659_101399432 338
693 3300025927 Ga0207687_10000771 Ga0207687_1000077119 338
694 3300025927 Ga0207687_10008609 Ga0207687_100086093 338
695 3300025927 Ga0207687_10067081 Ga0207687_100670812 338
696 3300025927 Ga0207687_10067321 Ga0207687_100673212 338
697 3300025928 Ga0207700_10063685 Ga0207700_100636852 338
698 3300025931 Ga0207644_10050148 Ga0207644_100501483 338
699 3300025931 Ga0207644_10078777 Ga0207644_100787772 338
700 3300025931 Ga0207644_10181615 Ga0207644_101816152 338
701 3300025932 Ga0207690_10010646 Ga0207690_100106462 338
702 3300025932 Ga0207690_10082194 Ga0207690_100821942 338
703 3300025932 Ga0207690_10106393 Ga0207690_101063932 338
704 3300025933 Ga0207706_10005517 Ga0207706_100055177 338
705 3300025933 Ga0207706_10039316 Ga0207706_100393165 338
706 3300025933 Ga0207706_10042267 Ga0207706_100422672 338
707 3300025933 Ga0207706_10075776 Ga0207706_100757762 338
708 3300025934 Ga0207686_10017235 Ga0207686_100172355 338
709 3300025934 Ga0207686_10085013 Ga0207686_100850132 338
710 3300025934 Ga0207686_10099192 Ga0207686_100991921 338
711 3300025935 Ga0207709_10007327 Ga0207709_100073273 338
712 3300025935 Ga0207709_10025497 Ga0207709_100254974 338
713 3300025935 Ga0207709_10040623 Ga0207709_100406232 338
714 3300025935 Ga0207709_10125183 Ga0207709_101251832 338
715 3300025936 Ga0207670_10011233 Ga0207670_100112333 338
716 3300025936 Ga0207670_10022933 Ga0207670_100229334 338
717 3300025936 Ga0207670_10051749 Ga0207670_100517492 338
718 3300025936 Ga0207670_10068660 Ga0207670_100686602 338
719 3300025936 Ga0207670_10113522 Ga0207670_101135222 338
720 3300025936 Ga0207670_10240256 Ga0207670_102402561 338
721 3300025937 Ga0207669_10022027 Ga0207669_100220275 338
722 3300025937 Ga0207669_10139147 Ga0207669_101391472 338
723 3300025938 Ga0207704_10011415 Ga0207704_100114152 338
724 3300025938 Ga0207704_10225874 Ga0207704_102258741 338
725 3300025939 Ga0207665_10197299 Ga0207665_101972992 338
726 3300025939 Ga0207665_10246000 Ga0207665_102460002 338
727 3300025940 Ga0207691_10006666 Ga0207691_100066668 338
728 3300025940 Ga0207691_10008868 Ga0207691_100088684 338
729 3300025940 Ga0207691_10010705 Ga0207691_100107055 338
730 3300025940 Ga0207691_10036965 Ga0207691_100369653 338
731 3300025940 Ga0207691_10040373 Ga0207691_100403734 338
732 3300025940 Ga0207691_10064984 Ga0207691_100649842 338
733 3300025940 Ga0207691_10067224 Ga0207691_100672244 338
734 3300025940 Ga0207691_10104004 Ga0207691_101040042 338
735 3300025940 Ga0207691_10200543 Ga0207691_102005432 338
736 3300025941 Ga0207711_10070974 Ga0207711_100709743 338
737 3300025941 Ga0207711_10076066 Ga0207711_100760662 338
738 3300025942 Ga0207689_10004769 Ga0207689_1000476910 338
739 3300025942 Ga0207689_10023079 Ga0207689_100230794 338
740 3300025942 Ga0207689_10066454 Ga0207689_100664542 338
741 3300025942 Ga0207689_10136530 Ga0207689_101365301 338
742 3300025942 Ga0207689_10300848 Ga0207689_103008482 338
743 3300025944 Ga0207661_10000567 Ga0207661_1000056713 338
744 3300025944 Ga0207661_10076026 Ga0207661_100760262 338
745 3300025944 Ga0207661_10225408 Ga0207661_102254081 338
746 3300025945 Ga0207679_10002887 Ga0207679_100028875 338
747 3300025945 Ga0207679_10008110 Ga0207679_100081105 338
748 3300025945 Ga0207679_10038680 Ga0207679_100386804 338
749 3300025945 Ga0207679_10061002 Ga0207679_100610021 338
750 3300025945 Ga0207679_10080569 Ga0207679_100805693 338
751 3300025945 Ga0207679_10195768 Ga0207679_101957682 338
752 3300025960 Ga0207651_10003088 Ga0207651_100030889 338
753 3300025960 Ga0207651_10013243 Ga0207651_100132434 338
754 3300025960 Ga0207651_10017893 Ga0207651_100178932 338
755 3300025960 Ga0207651_10017894 Ga0207651_100178942 338
756 3300025960 Ga0207651_10025651 Ga0207651_100256513 338
757 3300025960 Ga0207651_10068350 Ga0207651_100683503 338
758 3300025960 Ga0207651_10079593 Ga0207651_100795933 338
759 3300025960 Ga0207651_10136320 Ga0207651_101363202 338
760 3300025960 Ga0207651_10164201 Ga0207651_101642012 338
761 3300025960 Ga0207651_10328403 Ga0207651_103284032 338
762 3300025961 Ga0207712_10020761 Ga0207712_100207613 338
763 3300025961 Ga0207712_10026599 Ga0207712_100265994 338
764 3300025961 Ga0207712_10179426 Ga0207712_101794262 338
765 3300025972 Ga0207668_10172199 Ga0207668_101721992 338
766 3300025981 Ga0207640_10005632 Ga0207640_100056325 338
767 3300025981 Ga0207640_10018088 Ga0207640_100180881 338
768 3300026023 Ga0207677_10030076 Ga0207677_100300762 338
769 3300026023 Ga0207677_10112640 Ga0207677_101126402 338
770 3300026035 Ga0207703_10111147 Ga0207703_101111473 338
771 3300026035 Ga0207703_10183813 Ga0207703_101838132 338
772 3300026035 Ga0207703_10251546 Ga0207703_102515462 338
773 3300026035 Ga0207703_10365100 Ga0207703_103651002 338
774 3300026041 Ga0207639_10000028 Ga0207639_10000028179 338
775 3300026041 Ga0207639_10078745 Ga0207639_100787452 338
776 3300026067 Ga0207678_10019603 Ga0207678_100196033 338
777 3300026067 Ga0207678_10064943 Ga0207678_100649432 338
778 3300026075 Ga0207708_10030417 Ga0207708_100304174 338
779 3300026075 Ga0207708_10052944 Ga0207708_100529443 338
780 3300026075 Ga0207708_10060418 Ga0207708_100604183 338
781 3300026075 Ga0207708_10352092 Ga0207708_103520922 338
782 3300026088 Ga0207641_10068952 Ga0207641_100689524 338
783 3300026088 Ga0207641_10176334 Ga0207641_101763342 338
784 3300026089 Ga0207648_10003537 Ga0207648_1000353710 338
785 3300026089 Ga0207648_10006736 Ga0207648_1000673610 338
786 3300026089 Ga0207648_10014255 Ga0207648_100142554 338
787 3300026089 Ga0207648_10040076 Ga0207648_100400762 338
788 3300026089 Ga0207648_10055320 Ga0207648_100553203 338
789 3300026089 Ga0207648_10061425 Ga0207648_100614252 338
790 3300026095 Ga0207676_10000015 Ga0207676_10000015191 338
791 3300026095 Ga0207676_10036130 Ga0207676_100361302 338
792 3300026095 Ga0207676_10082326 Ga0207676_100823262 338
793 3300026095 Ga0207676_10082601 Ga0207676_100826012 338
794 3300026095 Ga0207676_10084144 Ga0207676_100841442 338
795 3300026095 Ga0207676_10130061 Ga0207676_101300612 338
796 3300026116 Ga0207674_10035104 Ga0207674_100351045 338
797 3300026116 Ga0207674_10067461 Ga0207674_100674614 338
798 3300026116 Ga0207674_10137541 Ga0207674_101375411 338
799 3300026116 Ga0207674_10197575 Ga0207674_101975751 338
800 3300026116 Ga0207674_10288408 Ga0207674_102884082 338
801 3300026118 Ga0207675_100002780 Ga0207675_10000278012 338
802 3300026118 Ga0207675_100023842 Ga0207675_1000238424 338
803 3300026118 Ga0207675_100027174 Ga0207675_1000271744 338
804 3300026118 Ga0207675_100034443 Ga0207675_1000344432 338
805 3300026118 Ga0207675_100048944 Ga0207675_1000489443 338
806 3300026118 Ga0207675_100321919 Ga0207675_1003219192 338
807 3300026121 Ga0207683_10048058 Ga0207683_100480584 338
808 3300026121 Ga0207683_10072444 Ga0207683_100724444 338
809 3300026121 Ga0207683_10116065 Ga0207683_101160652 338
810 3300026121 Ga0207683_10200125 Ga0207683_102001252 338
811 3300026121 Ga0207683_10220060 Ga0207683_102200602 338
812 3300026121 Ga0207683_10490057 Ga0207683_104900571 338
813 3300027682 Ga0209971_1006519 Ga0209971_10065194 338
814 3300027907 Ga0207428_10005347 Ga0207428_100053475 338
815 3300027907 Ga0207428_10019994 Ga0207428_100199944 338
816 3300027907 Ga0207428_10049425 Ga0207428_100494254 338
817 3300027907 Ga0207428_10104509 Ga0207428_101045092 338
818 3300027907 Ga0207428_10246372 Ga0207428_102463722 338
819 3300028016 Ga0265354_1001565 Ga0265354_10015652 338
820 3300028016 Ga0265354_1001601 Ga0265354_10016012 338
821 3300028379 Ga0268266_10357377 Ga0268266_103573772 338
822 3300028380 Ga0268265_10000714 Ga0268265_1000071420 338
823 3300028380 Ga0268265_10100882 Ga0268265_101008822 338
824 3300028380 Ga0268265_10201002 Ga0268265_102010022 338
825 3300028380 Ga0268265_10214148 Ga0268265_102141482 338
826 3300028380 Ga0268265_10292863 Ga0268265_102928632 338
827 3300028380 Ga0268265_10316410 Ga0268265_103164102 338
828 3300028381 Ga0268264_10092137 Ga0268264_100921372 338
829 3300030878 Ga0265770_1001477 Ga0265770_10014772 338
830 3300030879 Ga0265765_1001239 Ga0265765_10012392 338
831 3300031090 Ga0265760_10018513 Ga0265760_100185132 338
832 3300031239 Ga0265328_10062127 Ga0265328_100621271 338
833 3300031548 Ga0307408_100019683 Ga0307408_1000196834 338
834 3300031548 Ga0307408_100061025 Ga0307408_1000610252 338
835 3300031548 Ga0307408_100130347 Ga0307408_1001303472 338
836 3300031711 Ga0265314_10060442 Ga0265314_100604422 338
837 3300031727 Ga0316576_10076797 Ga0316576_100767972 338
838 3300031824 Ga0307413_10002032 Ga0307413_100020329 338
839 3300031852 Ga0307410_10005377 Ga0307410_100053772 338
840 3300031852 Ga0307410_10026539 Ga0307410_100265395 338
841 3300031901 Ga0307406_10033035 Ga0307406_100330352 338
842 3300031903 Ga0307407_10010616 Ga0307407_100106162 338
843 3300031903 Ga0307407_10066880 Ga0307407_100668802 338
844 3300031903 Ga0307407_10188770 Ga0307407_101887702 338
845 3300031911 Ga0307412_10155456 Ga0307412_101554562 338
846 3300031911 Ga0307412_10330698 Ga0307412_103306982 338
847 3300031995 Ga0307409_100179543 Ga0307409_1001795432 338
848 3300032002 Ga0307416_100024508 Ga0307416_1000245083 338
849 3300032002 Ga0307416_100027297 Ga0307416_1000272976 338
850 3300032002 Ga0307416_100033527 Ga0307416_1000335272 338
851 3300032002 Ga0307416_100046069 Ga0307416_1000460694 338
852 3300032002 Ga0307416_100129459 Ga0307416_1001294593 338
853 3300032002 Ga0307416_100452523 Ga0307416_1004525232 338
854 3300032004 Ga0307414_10022618 Ga0307414_100226185 338
855 3300032004 Ga0307414_10030123 Ga0307414_100301234 338
856 3300032004 Ga0307414_10047654 Ga0307414_100476543 338
857 3300032005 Ga0307411_10069895 Ga0307411_100698952 338
858 3300032005 Ga0307411_10127043 Ga0307411_101270432 338
859 3300032005 Ga0307411_10171712 Ga0307411_101717122 338
860 3300032126 Ga0307415_100041972 Ga0307415_1000419723 338
861 3300033547 Ga0316212_1008675 Ga0316212_10086752 338
862 3300035090 Ga0373949_0005553 Ga0373949_0005553_1671_2687 338
863 3300035112 Ga0373932_0000061 Ga0373932_0000061_19624_20658 338
864 3300035114 Ga0373939_0011753 Ga0373939_0011753_1038_2054 338
865 3300035116 Ga0373945_0081489 Ga0373945_0081489_177_1208 338
866 3300035170 Ga0373943_0093778 Ga0373943_0093778_48_1064 338
867 3300035171 Ga0373946_0003193 Ga0373946_0003193_2561_3592 338
868 3300035171 Ga0373946_0041329 Ga0373946_0041329_389_1417 338
869 3300035171 Ga0373946_0073681 Ga0373946_0073681_86_1117 338
870 3300035172 Ga0373955_0087608 Ga0373955_0087608_251_1270 338
871 3300035241 Ga0373961_0029778 Ga0373961_0029778_62_1078 338
872 3300035695 Ga0373927_0073760 Ga0373927_0073760_964_1983 338
873 3300035725 Ga0373947_0006424 Ga0373947_0006424_4690_5706 338
874 3300035725 Ga0373947_0193851 Ga0373947_0193851_199_1227 338
875 3300036401 Ga0373937_0075873 Ga0373937_0075873_275_1294 338
876 3300036401 Ga0373937_0517493 Ga0373937_0517493_57_1088 338
877 3300037068 Ga0373925_0016760 Ga0373925_0016760_4186_5217 338
878 3300037068 Ga0373925_0313476 Ga0373925_0313476_177_1196 338
879 3300037471 Ga0395905_0201526 Ga0395905_0201526_466_1482 338
880 3300039437 Ga0436365_1139438 Ga0436365_1139438_4138_5157 338
881 3300039437 Ga0436365_1884859 Ga0436365_1884859_1668_2699 338
882 3300041408 Ga0439453_0007620 Ga0439453_0007620_525_1550 338
883 3300041997 Ga0439431_0009100 Ga0439431_0009100_657_1673 338
884 3300042001 Ga0439441_005229 Ga0439441_005229_144_1160 338
885 3300042131 Ga0450894_000401 Ga0450894_000401_752_1771 338
886 3300042134 Ga0450898_003741 Ga0450898_003741_237_1256 338
887 3300042156 Ga0439446_0007852 Ga0439446_0007852_1019_2035 338
888 3300042435 Ga0439434_0027623 Ga0439434_0027623_289_1305 338
889 3300042436 Ga0439435_0010606 Ga0439435_0010606_552_1577 338
890 3300042439 Ga0439464_0014996 Ga0439464_0014996_612_1631 338
891 3300042461 Ga0439460_0021550 Ga0439460_0021550_436_1455 338
892 3300042876 Ga0451577_0029633 Ga0451577_0029633_2320_3339 338
893 3300042876 Ga0451577_0049163 Ga0451577_0049163_2179_3195 338
894 3300042876 Ga0451577_0128653 Ga0451577_0128653_245_1264 338
895 3300044712 Ga0453684_0023641 Ga0453684_0023641_2560_3582 338
896 3300045051 Ga0451576_0013194 Ga0451576_0013194_630_1646 338
897 3300045051 Ga0451576_0166417 Ga0451576_0166417_469_1485 338
898 3300046454 Ga0495592_0044739 Ga0495592_0044739_270_1301 338
899 3300046455 Ga0495603_0021187 Ga0495603_0021187_2150_3166 338
900 3300046459 Ga0495629_0009367 Ga0495629_0009367_710_1726 338
901 3300046459 Ga0495629_0131506 Ga0495629_0131506_405_1421 338
902 3300046460 Ga0495638_0047352 Ga0495638_0047352_745_1773 338
903 3300046472 Ga0495580_0075697 Ga0495580_0075697_1066_2097 338
904 3300046473 Ga0495582_0044965 Ga0495582_0044965_457_1488 338
905 3300046499 Ga0495594_0013813 Ga0495594_0013813_2674_3690 338
906 3300046499 Ga0495594_0018400 Ga0495594_0018400_362_1378 338
907 3300046511 Ga0495608_0006754 Ga0495608_0006754_6474_7505 338
908 3300046514 Ga0495618_0172507 Ga0495618_0172507_265_1296 338
909 3300046516 Ga0495628_0026102 Ga0495628_0026102_2973_4004 338
910 3300046516 Ga0495628_0174473 Ga0495628_0174473_517_1548 338
911 3300046517 Ga0495630_0239205 Ga0495630_0239205_321_1352 338
912 3300046536 Ga0495587_0200610 Ga0495587_0200610_95_1114 338
913 3300046537 Ga0495598_0026235 Ga0495598_0026235_301_1317 338
914 3300046539 Ga0495621_0039227 Ga0495621_0039227_250_1266 338
915 3300046543 Ga0495645_0008122 Ga0495645_0008122_360_1391 338
916 3300046543 Ga0495645_0012788 Ga0495645_0012788_4726_5757 338
917 3300046642 Ga0495634_0149287 Ga0495634_0149287_158_1177 338
918 3300046674 Ga0495588_0007178 Ga0495588_0007178_1441_2457 338
919 3300046675 Ga0495657_0137593 Ga0495657_0137593_317_1348 338
920 3300046683 Ga0495658_0016100 Ga0495658_0016100_2412_3443 338
921 3300046683 Ga0495658_0155381 Ga0495658_0155381_56_1072 338
922 3300046684 Ga0495669_0001134 Ga0495669_0001134_7146_8177 338
923 3300046691 Ga0495670_0121659 Ga0495670_0121659_328_1344 338
924 3300047315 Ga0495581_0167760 Ga0495581_0167760_137_1168 338
925 3300047317 Ga0495604_0045587 Ga0495604_0045587_1998_3029 338
926 3300047319 Ga0495674_0015359 Ga0495674_0015359_3357_4388 338
927 3300047321 Ga0495676_0005978 Ga0495676_0005978_3193_4209 338
928 3300047471 Ga0495684_0137297 Ga0495684_0137297_414_1433 338
929 3300047471 Ga0495684_0249058 Ga0495684_0249058_99_1118 338
930 3300048903 Ga0496100_0043019 Ga0496100_0043019_504_1532 338
931 3300048903 Ga0496100_0049289 Ga0496100_0049289_170_1189 338
932 3300048903 Ga0496100_0098137 Ga0496100_0098137_277_1422 338
933 3300048904 Ga0496101_0006912 Ga0496101_0006912_6069_7097 338
934 3300048904 Ga0496101_0087788 Ga0496101_0087788_59_1075 338
935 3300048905 Ga0496102_0010134 Ga0496102_0010134_2378_3394 338
936 3300048905 Ga0496102_0012507 Ga0496102_0012507_1593_2621 338
937 3300048906 Ga0496103_0029718 Ga0496103_0029718_1911_2927 338
938 3300048907 Ga0496104_0000157 Ga0496104_0000157_54356_55372 338
939 3300048907 Ga0496104_0097552 Ga0496104_0097552_786_1814 338
940 3300048907 Ga0496104_0130858 Ga0496104_0130858_735_1763 338
941 3300048908 Ga0496105_0083326 Ga0496105_0083326_739_1770 338
942 3300048908 Ga0496105_0100535 Ga0496105_0100535_1067_2095 338
943 3300048908 Ga0496105_0129031 Ga0496105_0129031_1004_2032 338
944 3300048909 Ga0496106_0015998 Ga0496106_0015998_2615_3643 338
945 3300048909 Ga0496106_0028722 Ga0496106_0028722_2220_3236 338
946 3300048909 Ga0496106_0222372 Ga0496106_0222372_311_1327 338
947 3300048910 Ga0496107_0045403 Ga0496107_0045403_1408_2436 338
948 3300048911 Ga0496108_0003499 Ga0496108_0003499_3467_4483 338
949 3300048911 Ga0496108_0148824 Ga0496108_0148824_489_1517 338
950 3300048911 Ga0496108_0421290 Ga0496108_0421290_28_1047 338
951 3300048912 Ga0496109_0009476 Ga0496109_0009476_3577_4593 338
952 3300048912 Ga0496109_0047093 Ga0496109_0047093_2328_3344 338
953 3300048913 Ga0496110_0000063 Ga0496110_0000063_1126_2142 338
954 3300048914 Ga0496111_0004348 Ga0496111_0004348_5300_6316 338
955 3300048914 Ga0496111_0073612 Ga0496111_0073612_345_1364 338
956 3300048915 Ga0496112_0000245 Ga0496112_0000245_8245_9261 338
957 3300048915 Ga0496112_0045209 Ga0496112_0045209_3093_4109 338
958 3300048916 Ga0496113_0009126 Ga0496113_0009126_891_1907 338
959 3300048916 Ga0496113_0245604 Ga0496113_0245604_52_1068 338
960 3300048917 Ga0496114_0000371 Ga0496114_0000371_26626_27654 338
961 3300048917 Ga0496114_0017463 Ga0496114_0017463_3967_4986 338
962 3300048918 Ga0496115_0050776 Ga0496115_0050776_2071_3090 338
963 3300049568 Ga0501031_0081626 Ga0501031_0081626_387_1403 338
964 3300049570 Ga0501033_0001797 Ga0501033_0001797_8339_9361 338
965 3300049571 Ga0501034_0015307 Ga0501034_0015307_4260_5276 338
966 3300049571 Ga0501034_0029877 Ga0501034_0029877_4042_5064 338
967 3300049571 Ga0501034_0087907 Ga0501034_0087907_255_1277 338
968 3300049572 Ga0501036_0005695 Ga0501036_0005695_2708_3730 338
969 3300049572 Ga0501036_0020670 Ga0501036_0020670_2720_3736 338
970 3300049572 Ga0501036_0097060 Ga0501036_0097060_138_1160 338
971 3300049572 Ga0501036_0185089 Ga0501036_0185089_77_1105 338
972 3300049573 Ga0501037_0001960 Ga0501037_0001960_8435_9457 338
973 3300049573 Ga0501037_0021899 Ga0501037_0021899_1506_2528 338
974 3300049573 Ga0501037_0054273 Ga0501037_0054273_163_1185 338
975 3300049574 Ga0501038_0043872 Ga0501038_0043872_43_1065 338
976 3300049574 Ga0501038_0117291 Ga0501038_0117291_240_1256 338
977 3300049575 Ga0501039_0024578 Ga0501039_0024578_2883_3905 338
978 3300049576 Ga0501040_0009429 Ga0501040_0009429_995_2011 338
979 3300049577 Ga0501041_0133848 Ga0501041_0133848_435_1451 338
980 3300049578 Ga0501042_0028146 Ga0501042_0028146_44_1060 338
981 3300049578 Ga0501042_0038051 Ga0501042_0038051_1268_2284 338
982 3300049578 Ga0501042_0063708 Ga0501042_0063708_1297_2313 338
983 3300049578 Ga0501042_0084812 Ga0501042_0084812_225_1241 338
984 3300049578 Ga0501042_0195047 Ga0501042_0195047_187_1209 338
985 3300049579 Ga0501043_0013132 Ga0501043_0013132_2676_3698 338
986 3300049579 Ga0501043_0118058 Ga0501043_0118058_412_1428 338
987 3300049579 Ga0501043_0146656 Ga0501043_0146656_605_1621 338
988 3300049580 Ga0501046_0046634 Ga0501046_0046634_965_1987 338
989 3300049581 Ga0501047_0006564 Ga0501047_0006564_2813_3829 338
990 3300049581 Ga0501047_0139369 Ga0501047_0139369_193_1215 338
991 3300049581 Ga0501047_0147499 Ga0501047_0147499_472_1488 338
992 3300049581 Ga0501047_0250265 Ga0501047_0250265_445_1467 338
993 3300049582 Ga0501048_0004103 Ga0501048_0004103_2347_3369 338
994 3300049582 Ga0501048_0008075 Ga0501048_0008075_2565_3587 338
995 3300049582 Ga0501048_0033095 Ga0501048_0033095_1644_2660 338
996 3300049582 Ga0501048_0037754 Ga0501048_0037754_592_1608 338
997 3300049582 Ga0501048_0140527 Ga0501048_0140527_632_1648 338
998 3300049583 Ga0501067_0001385 Ga0501067_0001385_7670_8692 338
999 3300049584 Ga0501068_0012541 Ga0501068_0012541_2784_3806 338
1000 3300049585 Ga0501069_0022414 Ga0501069_0022414_2314_3336 338
1001 3300049586 Ga0501070_0005646 Ga0501070_0005646_6111_7133 338
1002 3300049586 Ga0501070_0022268 Ga0501070_0022268_86_1108 338
1003 3300049587 Ga0501071_0019087 Ga0501071_0019087_1388_2410 338
1004 3300049587 Ga0501071_0024253 Ga0501071_0024253_808_1824 338
1005 3300049587 Ga0501071_0136639 Ga0501071_0136639_148_1164 338
1006 3300049587 Ga0501071_0196801 Ga0501071_0196801_25_1041 338
1007 3300049587 Ga0501071_0286187 Ga0501071_0286187_139_1155 338
1008 3300049588 Ga0501072_0052203 Ga0501072_0052203_1958_2974 338
1009 3300049588 Ga0501072_0108375 Ga0501072_0108375_724_1740 338
1010 3300049588 Ga0501072_0357101 Ga0501072_0357101_114_1142 338
1011 3300049589 Ga0501073_0003168 Ga0501073_0003168_9493_10515 338
1012 3300049589 Ga0501073_0008693 Ga0501073_0008693_4409_5431 338
1013 3300049589 Ga0501073_0039425 Ga0501073_0039425_869_1885 338
1014 3300049590 Ga0501074_0003931 Ga0501074_0003931_8342_9364 338
1015 3300049590 Ga0501074_0044209 Ga0501074_0044209_887_1903 338
1016 3300049590 Ga0501074_0079253 Ga0501074_0079253_487_1503 338
1017 3300049590 Ga0501074_0098437 Ga0501074_0098437_167_1189 338
1018 3300049590 Ga0501074_0143634 Ga0501074_0143634_451_1467 338
1019 3300049591 Ga0501075_0014357 Ga0501075_0014357_2386_3402 338
1020 3300049591 Ga0501075_0078796 Ga0501075_0078796_1259_2275 338
1021 3300049591 Ga0501075_0128859 Ga0501075_0128859_700_1716 338
1022 3300049592 Ga0501076_0050221 Ga0501076_0050221_757_1773 338
1023 3300049592 Ga0501076_0072157 Ga0501076_0072157_545_1564 338
1024 3300049592 Ga0501076_0143057 Ga0501076_0143057_779_1795 338
1025 3300049592 Ga0501076_0145643 Ga0501076_0145643_663_1682 338
1026 3300049679 Ga0501249_011801 Ga0501249_011801_107_1123 338
1027 3300049741 Ga0501079_0009681 Ga0501079_0009681_4195_5217 338
1028 3300049741 Ga0501079_0017966 Ga0501079_0017966_95_1117 338
1029 3300049741 Ga0501079_0136919 Ga0501079_0136919_148_1164 338
1030 3300049741 Ga0501079_0202661 Ga0501079_0202661_378_1397 338
1031 3300049741 Ga0501079_0211349 Ga0501079_0211349_474_1490 338
1032 3300049742 Ga0501080_0001466 Ga0501080_0001466_13247_14269 338
1033 3300049742 Ga0501080_0141101 Ga0501080_0141101_1015_2037 338
1034 3300049742 Ga0501080_0249396 Ga0501080_0249396_293_1309 338
1035 3300049742 Ga0501080_0304333 Ga0501080_0304333_150_1166 338
1036 3300049743 Ga0501081_0073426 Ga0501081_0073426_733_1749 338
1037 3300049743 Ga0501081_0083342 Ga0501081_0083342_764_1780 338
1038 3300049743 Ga0501081_0085253 Ga0501081_0085253_720_1736 338
1039 3300049743 Ga0501081_0155177 Ga0501081_0155177_453_1469 338
1040 3300049743 Ga0501081_0184799 Ga0501081_0184799_72_1088 338
1041 3300049744 Ga0501083_0011031 Ga0501083_0011031_3868_4890 338
1042 3300049744 Ga0501083_0026727 Ga0501083_0026727_1015_2037 338
1043 3300049744 Ga0501083_0028261 Ga0501083_0028261_1015_2037 338
1044 3300049822 Ga0501035_0027160 Ga0501035_0027160_1015_2037 338
1045 3300049823 Ga0501044_0009040 Ga0501044_0009040_2182_3204 338
1046 3300049823 Ga0501044_0063277 Ga0501044_0063277_70_1086 338
1047 3300049823 Ga0501044_0092305 Ga0501044_0092305_1010_2032 338
1048 3300049823 Ga0501044_0105112 Ga0501044_0105112_725_1747 338
1049 3300049824 Ga0501045_0006147 Ga0501045_0006147_6652_7674 338
1050 3300049824 Ga0501045_0008164 Ga0501045_0008164_3565_4581 338
1051 3300049824 Ga0501045_0069439 Ga0501045_0069439_990_2006 338
1052 3300049824 Ga0501045_0095660 Ga0501045_0095660_750_1766 338
1053 3300050493 nmdc:mga0k408_24845_c1 nmdc:mga0k408_24845_c1_191_1207 338
1054 3300050493 nmdc:mga0k408_70841_c1 nmdc:mga0k408_70841_c1_670_1698 338
1055 3300050507 nmdc:mga05p37_11748_c1 nmdc:mga05p37_11748_c1_7845_8861 338
1056 3300050507 nmdc:mga05p37_13533_c1 nmdc:mga05p37_13533_c1_4635_5663 338
1057 3300050507 nmdc:mga05p37_167522_c1 nmdc:mga05p37_167522_c1_58_1086 338
1058 3300050507 nmdc:mga05p37_18779_c1 nmdc:mga05p37_18779_c1_5066_6082 338
1059 3300050507 nmdc:mga05p37_22849_c1 nmdc:mga05p37_22849_c1_2866_3882 338
1060 3300050507 nmdc:mga05p37_351913_c1 nmdc:mga05p37_351913_c1_335_1360 338
1061 3300050507 nmdc:mga05p37_357395_c1 nmdc:mga05p37_357395_c1_386_1402 338
1062 3300050507 nmdc:mga05p37_368307_c1 nmdc:mga05p37_368307_c1_404_1423 338
1063 3300050507 nmdc:mga05p37_39052_c1 nmdc:mga05p37_39052_c1_885_1901 338
1064 3300050507 nmdc:mga05p37_39487_c2 nmdc:mga05p37_39487_c2_543_1571 338
1065 3300050507 nmdc:mga05p37_39668_c1 nmdc:mga05p37_39668_c1_734_1753 338
1066 3300050507 nmdc:mga05p37_416935_c1 nmdc:mga05p37_416935_c1_216_1232 338
1067 3300050507 nmdc:mga05p37_420241_c1 nmdc:mga05p37_420241_c1_305_1345 338
1068 3300050507 nmdc:mga05p37_610996_c1 nmdc:mga05p37_610996_c1_101_1135 338
1069 3300050507 nmdc:mga05p37_73587_c1 nmdc:mga05p37_73587_c1_643_1659 338
1070 3300050507 nmdc:mga05p37_90897_c1 nmdc:mga05p37_90897_c1_2198_3214 338
1071 3300050508 nmdc:mga09592_10035_c1 nmdc:mga09592_10035_c1_3941_4957 338
1072 3300050508 nmdc:mga09592_12714_c1 nmdc:mga09592_12714_c1_5152_6180 338
1073 3300050508 nmdc:mga09592_14921_c1 nmdc:mga09592_14921_c1_3250_4266 338
1074 3300050508 nmdc:mga09592_15438_c1 nmdc:mga09592_15438_c1_2731_3759 338
1075 3300050508 nmdc:mga09592_1848_c1 nmdc:mga09592_1848_c1_4171_5187 338
1076 3300050508 nmdc:mga09592_33010_c1 nmdc:mga09592_33010_c1_2569_3585 338
1077 3300050509 nmdc:mga0qj67_118605_c2 nmdc:mga0qj67_118605_c2_176_1192 338
1078 3300050509 nmdc:mga0qj67_171285_c1 nmdc:mga0qj67_171285_c1_478_1494 338
1079 3300050509 nmdc:mga0qj67_21098_c1 nmdc:mga0qj67_21098_c1_3088_4104 338
1080 3300050509 nmdc:mga0qj67_234549_c1 nmdc:mga0qj67_234549_c1_293_1309 338
1081 3300050509 nmdc:mga0qj67_32771_c1 nmdc:mga0qj67_32771_c1_332_1348 338
1082 3300050509 nmdc:mga0qj67_397745_c1 nmdc:mga0qj67_397745_c1_17_1045 338
1083 3300050509 nmdc:mga0qj67_41245_c1 nmdc:mga0qj67_41245_c1_75_1091 338
1084 3300050509 nmdc:mga0qj67_7069_c1 nmdc:mga0qj67_7069_c1_4215_5231 338
1085 3300050509 nmdc:mga0qj67_88608_c1 nmdc:mga0qj67_88608_c1_1167_2183 338
1086 3300050510 nmdc:mga06r32_101775_c1 nmdc:mga06r32_101775_c1_1163_2179 338
1087 3300050510 nmdc:mga06r32_107864_c1 nmdc:mga06r32_107864_c1_1681_2697 338
1088 3300050510 nmdc:mga06r32_23263_c1 nmdc:mga06r32_23263_c1_915_1931 338
1089 3300050510 nmdc:mga06r32_310264_c1 nmdc:mga06r32_310264_c1_100_1119 338
1090 3300050510 nmdc:mga06r32_34703_c1 nmdc:mga06r32_34703_c1_3604_4620 338
1091 3300050510 nmdc:mga06r32_46528_c1 nmdc:mga06r32_46528_c1_1005_2024 338
1092 3300050510 nmdc:mga06r32_58764_c1 nmdc:mga06r32_58764_c1_2613_3641 338
1093 3300050511 nmdc:mga08y16_120436_c1 nmdc:mga08y16_120436_c1_857_1873 338
1094 3300050511 nmdc:mga08y16_148914_c1 nmdc:mga08y16_148914_c1_43_1059 338
1095 3300050511 nmdc:mga08y16_154608_c1 nmdc:mga08y16_154608_c1_309_1331 338
1096 3300050511 nmdc:mga08y16_164841_c1 nmdc:mga08y16_164841_c1_1163_2179 338
1097 3300050511 nmdc:mga08y16_173829_c1 nmdc:mga08y16_173829_c1_903_1919 338
1098 3300050511 nmdc:mga08y16_242780_c1 nmdc:mga08y16_242780_c1_241_1257 338
1099 3300050511 nmdc:mga08y16_4308_c1 nmdc:mga08y16_4308_c1_3364_4380 338
1100 3300050511 nmdc:mga08y16_46776_c1 nmdc:mga08y16_46776_c1_3386_4402 338
1101 3300050511 nmdc:mga08y16_513071_c1 nmdc:mga08y16_513071_c1_112_1128 338
1102 3300050511 nmdc:mga08y16_54011_c1 nmdc:mga08y16_54011_c1_580_1599 338
1103 3300050511 nmdc:mga08y16_82537_c1 nmdc:mga08y16_82537_c1_1320_2336 338
1104 3300050512 nmdc:mga0n895_116876_c1 nmdc:mga0n895_116876_c1_476_1492 338
1105 3300050512 nmdc:mga0n895_123625_c1 nmdc:mga0n895_123625_c1_1004_2020 338
1106 3300050512 nmdc:mga0n895_135327_c1 nmdc:mga0n895_135327_c1_638_1672 338
1107 3300050512 nmdc:mga0n895_13860_c1 nmdc:mga0n895_13860_c1_5050_6066 338
1108 3300050512 nmdc:mga0n895_209668_c1 nmdc:mga0n895_209668_c1_656_1672 338
1109 3300050512 nmdc:mga0n895_36785_c1 nmdc:mga0n895_36785_c1_1062_2078 338
1110 3300050512 nmdc:mga0n895_69859_c1 nmdc:mga0n895_69859_c1_542_1570 338
1111 3300050513 nmdc:mga0rr50_282787_c1 nmdc:mga0rr50_282787_c1_180_1196 338
1112 3300050513 nmdc:mga0rr50_56489_c1 nmdc:mga0rr50_56489_c1_986_2002 338
1113 3300050513 nmdc:mga0rr50_58092_c1 nmdc:mga0rr50_58092_c1_465_1481 338
1114 3300050513 nmdc:mga0rr50_76530_c1 nmdc:mga0rr50_76530_c1_546_1562 338
1115 3300050514 nmdc:mga08x19_54222_c1 nmdc:mga08x19_54222_c1_514_1548 338
1116 3300050515 nmdc:mga0a205_1412_c1 nmdc:mga0a205_1412_c1_5692_6708 338
1117 3300050515 nmdc:mga0a205_219952_c1 nmdc:mga0a205_219952_c1_81_1097 338
1118 3300050515 nmdc:mga0a205_22925_c1 nmdc:mga0a205_22925_c1_1486_2520 338
1119 3300050515 nmdc:mga0a205_3073_c1 nmdc:mga0a205_3073_c1_13030_14046 338
1120 3300050515 nmdc:mga0a205_5662_c1 nmdc:mga0a205_5662_c1_487_1515 338
1121 3300050515 nmdc:mga0a205_60956_c1 nmdc:mga0a205_60956_c1_166_1182 338
1122 3300053077 Ga0495601_0009838 Ga0495601_0009838_4074_5105 338
1123 3300053077 Ga0495601_0079319 Ga0495601_0079319_351_1370 338
1124 3300053085 Ga0495619_0007406 Ga0495619_0007406_4911_5942 338
1125 3300053085 Ga0495619_0113876 Ga0495619_0113876_659_1678 338
1126 3300053085 Ga0495619_0144885 Ga0495619_0144885_301_1320 338
1127 3300053129 Ga0500628_007908 Ga0500628_007908_556_1572 338
1128 3300054114 Ga0501084_0044927 Ga0501084_0044927_1718_2734 338
1129 3300054114 Ga0501084_0054785 Ga0501084_0054785_1247_2263 338
1130 3300054114 Ga0501084_0322180 Ga0501084_0322180_188_1210 338
1131 3300059421 Ga0590071_008116 Ga0590071_008116_184_1200 338
1132 3300059424 Ga0590075_001920 Ga0590075_001920_96_1112 338
1133 3300060353 Ga0501082_0003063 Ga0501082_0003063_8200_9222 338
1134 3300060353 Ga0501082_0019848 Ga0501082_0019848_354_1370 338
1135 3300060353 Ga0501082_0132483 Ga0501082_0132483_332_1348 338
1136 3300060353 Ga0501082_0198994 Ga0501082_0198994_42_1058 338
1137 3300005290 Ga0065712_10086315 Ga0065712_100863152 339
1138 3300005293 Ga0065715_10093168 Ga0065715_100931685 339
1139 3300005331 Ga0070670_100014101 Ga0070670_1000141015 339
1140 3300005467 Ga0070706_100070232 Ga0070706_1000702323 339
1141 3300005518 Ga0070699_100104888 Ga0070699_1001048882 339
1142 3300005536 Ga0070697_100004983 Ga0070697_10000498311 339
1143 3300005546 Ga0070696_100070820 Ga0070696_1000708202 339
1144 3300005618 Ga0068864_100166898 Ga0068864_1001668982 339
1145 3300006844 Ga0075428_100006386 Ga0075428_10000638614 339
1146 3300006846 Ga0075430_100002239 Ga0075430_10000223918 339
1147 3300006847 Ga0075431_100001153 Ga0075431_10000115320 339
1148 3300006871 Ga0075434_100204784 Ga0075434_1002047842 339
1149 3300025925 Ga0207650_10030655 Ga0207650_100306555 339
1150 3300025934 Ga0207686_10046039 Ga0207686_100460394 339
1151 3300025942 Ga0207689_10365401 Ga0207689_103654011 339
1152 3300026095 Ga0207676_10116410 Ga0207676_101164102 339
1153 3300032002 Ga0307416_100252380 Ga0307416_1002523802 339
1154 3300042876 Ga0451577_0005031 Ga0451577_0005031_1516_2556 339
1155 3300045051 Ga0451576_0133886 Ga0451576_0133886_454_1485 339
1156 3300046462 Ga0495651_0000059 Ga0495651_0000059_41764_42789 339
1157 3300046543 Ga0495645_0067573 Ga0495645_0067573_702_1727 339
1158 3300046559 Ga0495667_0015159 Ga0495667_0015159_63_1082 339
1159 3300046674 Ga0495588_0139565 Ga0495588_0139565_241_1260 339
1160 3300046675 Ga0495657_0058349 Ga0495657_0058349_1404_2429 339
1161 3300047322 Ga0495680_0007293 Ga0495680_0007293_3012_4037 339
1162 3300047444 Ga0495675_0067611 Ga0495675_0067611_151_1176 339
1163 3300048915 Ga0496112_0131460 Ga0496112_0131460_105_1124 339
1164 3300049572 Ga0501036_0285531 Ga0501036_0285531_302_1330 339
1165 3300049578 Ga0501042_0025593 Ga0501042_0025593_393_1412 339
1166 3300049592 Ga0501076_0041328 Ga0501076_0041328_900_1919 339
1167 3300049743 Ga0501081_0040573 Ga0501081_0040573_888_1907 339
1168 3300049824 Ga0501045_0018451 Ga0501045_0018451_3193_4212 339
1169 3300050507 nmdc:mga05p37_56321_c1 nmdc:mga05p37_56321_c1_2866_3885 339
1170 3300050509 nmdc:mga0qj67_122428_c1 nmdc:mga0qj67_122428_c1_974_1996 339
1171 3300050515 nmdc:mga0a205_104560_c1 nmdc:mga0a205_104560_c1_757_1776 339
1172 3300053129 Ga0500628_003394 Ga0500628_003394_1457_2476 339
1173 3300061734 Ga0530510_0353601 Ga0530510_0353601_10_1029 339
1174 3300006871 Ga0075434_100487985 Ga0075434_1004879851 340
1175 3300007076 Ga0075435_100004809 Ga0075435_1000048095 340
1176 3300009147 Ga0114129_10001790 Ga0114129_1000179020 340
1177 3300031090 Ga0265760_10000020 Ga0265760_1000002016 340
1178 3300050507 nmdc:mga05p37_2888_c1 nmdc:mga05p37_2888_c1_4131_5153 340
1179 3300050512 nmdc:mga0n895_84092_c1 nmdc:mga0n895_84092_c1_1272_2294 340
1180 3300050513 nmdc:mga0rr50_2215_c1 nmdc:mga0rr50_2215_c1_4334_5371 340
1181 3300050515 nmdc:mga0a205_2103_c1 nmdc:mga0a205_2103_c1_10557_11579 340
1182 3300005344 Ga0070661_100067305 Ga0070661_1000673053 341
1183 3300005356 Ga0070674_100052135 Ga0070674_1000521352 341
1184 3300005364 Ga0070673_100082692 Ga0070673_1000826922 341
1185 3300005439 Ga0070711_100083557 Ga0070711_1000835572 341
1186 3300005467 Ga0070706_100062834 Ga0070706_1000628342 341
1187 3300005468 Ga0070707_100000011 Ga0070707_10000001140 341
1188 3300005468 Ga0070707_100049961 Ga0070707_1000499612 341
1189 3300005518 Ga0070699_100217634 Ga0070699_1002176341 341
1190 3300005536 Ga0070697_100162709 Ga0070697_1001627092 341
1191 3300005548 Ga0070665_100003370 Ga0070665_1000033702 341
1192 3300005563 Ga0068855_100345507 Ga0068855_1003455072 341
1193 3300005618 Ga0068864_100276282 Ga0068864_1002762822 341
1194 3300005841 Ga0068863_100131497 Ga0068863_1001314973 341
1195 3300006028 Ga0070717_10288392 Ga0070717_102883922 341
1196 3300006178 Ga0075367_10060288 Ga0075367_100602883 341
1197 3300007076 Ga0075435_100035383 Ga0075435_1000353833 341
1198 3300007265 Ga0099794_10049428 Ga0099794_100494282 341
1199 3300007788 Ga0099795_10011684 Ga0099795_100116842 341
1200 3300009093 Ga0105240_10018260 Ga0105240_100182605 341
1201 3300009093 Ga0105240_10024901 Ga0105240_100249014 341
1202 3300009098 Ga0105245_10009963 Ga0105245_100099637 341
1203 3300009177 Ga0105248_10100342 Ga0105248_101003422 341
1204 3300010159 Ga0099796_10002341 Ga0099796_100023414 341
1205 3300013296 Ga0157374_10001975 Ga0157374_1000197514 341
1206 3300013297 Ga0157378_10003083 Ga0157378_100030839 341
1207 3300014325 Ga0163163_10074644 Ga0163163_100746443 341
1208 3300024227 Ga0228598_1000166 Ga0228598_100016613 341
1209 3300025910 Ga0207684_10051922 Ga0207684_100519224 341
1210 3300025913 Ga0207695_10119515 Ga0207695_101195153 341
1211 3300025915 Ga0207693_10015404 Ga0207693_100154044 341
1212 3300025915 Ga0207693_10194445 Ga0207693_101944451 341
1213 3300025922 Ga0207646_10000055 Ga0207646_1000005539 341
1214 3300025922 Ga0207646_10000122 Ga0207646_1000012290 341
1215 3300025922 Ga0207646_10001764 Ga0207646_1000176420 341
1216 3300025927 Ga0207687_10034362 Ga0207687_100343622 341
1217 3300025928 Ga0207700_10097605 Ga0207700_100976052 341
1218 3300025931 Ga0207644_10067758 Ga0207644_100677583 341
1219 3300025933 Ga0207706_10054366 Ga0207706_100543662 341
1220 3300025934 Ga0207686_10235655 Ga0207686_102356552 341
1221 3300025939 Ga0207665_10136108 Ga0207665_101361083 341
1222 3300026023 Ga0207677_10259951 Ga0207677_102599512 341
1223 3300026121 Ga0207683_10075713 Ga0207683_100757133 341
1224 3300027512 Ga0209179_1015421 Ga0209179_10154212 341
1225 3300028379 Ga0268266_10000153 Ga0268266_1000015363 341
1226 3300028563 Ga0265319_1002464 Ga0265319_10024646 341
1227 3300028577 Ga0265318_10000320 Ga0265318_1000032017 341
1228 3300028800 Ga0265338_10032726 Ga0265338_100327262 341
1229 3300031240 Ga0265320_10000139 Ga0265320_100001399 341
1230 3300031241 Ga0265325_10019621 Ga0265325_100196213 341
1231 3300031242 Ga0265329_10000050 Ga0265329_1000005033 341
1232 3300031242 Ga0265329_10013066 Ga0265329_100130663 341
1233 3300031247 Ga0265340_10025923 Ga0265340_100259232 341
1234 3300031249 Ga0265339_10004465 Ga0265339_1000446510 341
1235 3300031249 Ga0265339_10156312 Ga0265339_101563122 341
1236 3300031250 Ga0265331_10000135 Ga0265331_1000013572 341
1237 3300031250 Ga0265331_10006194 Ga0265331_100061946 341
1238 3300031250 Ga0265331_10017191 Ga0265331_100171914 341
1239 3300031344 Ga0265316_10000531 Ga0265316_1000053118 341
1240 3300031344 Ga0265316_10000752 Ga0265316_1000075215 341
1241 3300031344 Ga0265316_10031452 Ga0265316_100314526 341
1242 3300031344 Ga0265316_10067052 Ga0265316_100670523 341
1243 3300031595 Ga0265313_10001857 Ga0265313_1000185711 341
1244 3300031595 Ga0265313_10017309 Ga0265313_100173093 341
1245 3300031711 Ga0265314_10029100 Ga0265314_100291003 341
1246 3300031712 Ga0265342_10000694 Ga0265342_1000069427 341
1247 3300035083 Ga0373926_0000176 Ga0373926_0000176_13177_14202 341
1248 3300035111 Ga0373923_0022394 Ga0373923_0022394_908_1972 341
1249 3300035119 Ga0373956_0052747 Ga0373956_0052747_510_1538 341
1250 3300035172 Ga0373955_0014880 Ga0373955_0014880_2521_3549 341
1251 3300035410 Ga0373924_0017810 Ga0373924_0017810_1326_2351 341
1252 3300035695 Ga0373927_0002502 Ga0373927_0002502_10931_11956 341
1253 3300035724 Ga0373933_0001863 Ga0373933_0001863_8633_9661 341
1254 3300035724 Ga0373933_0129955 Ga0373933_0129955_333_1358 341
1255 3300035725 Ga0373947_0044879 Ga0373947_0044879_48_1073 341
1256 3300036401 Ga0373937_0000001 Ga0373937_0000001_343989_345017 341
1257 3300036401 Ga0373937_0339566 Ga0373937_0339566_240_1304 341
1258 3300042876 Ga0451577_0210331 Ga0451577_0210331_230_1255 341
1259 3300044673 Ga0453683_0004141 Ga0453683_0004141_7779_8819 341
1260 3300044673 Ga0453683_0011579 Ga0453683_0011579_3706_4731 341
1261 3300044673 Ga0453683_0012309 Ga0453683_0012309_3571_4596 341
1262 3300044712 Ga0453684_0018139 Ga0453684_0018139_6283_7323 341
1263 3300044712 Ga0453684_0138370 Ga0453684_0138370_798_1823 341
1264 3300045051 Ga0451576_0011820 Ga0451576_0011820_3588_4628 341
1265 3300046454 Ga0495592_0033147 Ga0495592_0033147_2796_3821 341
1266 3300046454 Ga0495592_0037134 Ga0495592_0037134_649_1674 341
1267 3300046460 Ga0495638_0001740 Ga0495638_0001740_13610_14710 341
1268 3300046462 Ga0495651_0001481 Ga0495651_0001481_15463_16488 341
1269 3300046462 Ga0495651_0010905 Ga0495651_0010905_538_1566 341
1270 3300046462 Ga0495651_0045238 Ga0495651_0045238_285_1310 341
1271 3300046463 Ga0495653_0018250 Ga0495653_0018250_4270_5295 341
1272 3300046463 Ga0495653_0053917 Ga0495653_0053917_567_1592 341
1273 3300046463 Ga0495653_0060335 Ga0495653_0060335_739_1767 341
1274 3300046463 Ga0495653_0159876 Ga0495653_0159876_108_1136 341
1275 3300046472 Ga0495580_0007354 Ga0495580_0007354_346_1371 341
1276 3300046472 Ga0495580_0029073 Ga0495580_0029073_2328_3374 341
1277 3300046473 Ga0495582_0009955 Ga0495582_0009955_3281_4327 341
1278 3300046473 Ga0495582_0039499 Ga0495582_0039499_712_1737 341
1279 3300046477 Ga0495664_0022141 Ga0495664_0022141_686_1711 341
1280 3300046477 Ga0495664_0048340 Ga0495664_0048340_532_1557 341
1281 3300046477 Ga0495664_0146681 Ga0495664_0146681_350_1408 341
1282 3300046511 Ga0495608_0011876 Ga0495608_0011876_4759_5784 341
1283 3300046511 Ga0495608_0023053 Ga0495608_0023053_629_1654 341
1284 3300046511 Ga0495608_0126526 Ga0495608_0126526_117_1142 341
1285 3300046514 Ga0495618_0032478 Ga0495618_0032478_455_1480 341
1286 3300046514 Ga0495618_0145286 Ga0495618_0145286_191_1216 341
1287 3300046516 Ga0495628_0000167 Ga0495628_0000167_22670_23695 341
1288 3300046516 Ga0495628_0006133 Ga0495628_0006133_5321_6346 341
1289 3300046516 Ga0495628_0034713 Ga0495628_0034713_2470_3495 341
1290 3300046517 Ga0495630_0012486 Ga0495630_0012486_1228_2253 341
1291 3300046517 Ga0495630_0039810 Ga0495630_0039810_1150_2175 341
1292 3300046517 Ga0495630_0097031 Ga0495630_0097031_740_1765 341
1293 3300046529 Ga0495652_0004609 Ga0495652_0004609_9137_10162 341
1294 3300046529 Ga0495652_0022463 Ga0495652_0022463_3212_4240 341
1295 3300046529 Ga0495652_0028614 Ga0495652_0028614_673_1698 341
1296 3300046531 Ga0495665_0002242 Ga0495665_0002242_366_1391 341
1297 3300046533 Ga0495640_0137294 Ga0495640_0137294_530_1555 341
1298 3300046533 Ga0495640_0155162 Ga0495640_0155162_133_1332 341
1299 3300046535 Ga0495586_0015110 Ga0495586_0015110_2945_3970 341
1300 3300046536 Ga0495587_0000433 Ga0495587_0000433_8335_9363 341
1301 3300046536 Ga0495587_0002851 Ga0495587_0002851_6745_7770 341
1302 3300046536 Ga0495587_0009418 Ga0495587_0009418_2997_4022 341
1303 3300046536 Ga0495587_0126171 Ga0495587_0126171_402_1427 341
1304 3300046543 Ga0495645_0001627 Ga0495645_0001627_238_1263 341
1305 3300046559 Ga0495667_0026551 Ga0495667_0026551_2745_3770 341
1306 3300046642 Ga0495634_0008535 Ga0495634_0008535_2127_3326 341
1307 3300046663 Ga0495635_0019091 Ga0495635_0019091_740_1765 341
1308 3300046675 Ga0495657_0024248 Ga0495657_0024248_2087_3112 341
1309 3300046675 Ga0495657_0031177 Ga0495657_0031177_733_1758 341
1310 3300046679 Ga0495623_0001017 Ga0495623_0001017_16161_17186 341
1311 3300046680 Ga0495646_0008681 Ga0495646_0008681_2298_3323 341
1312 3300046689 Ga0495613_0006297 Ga0495613_0006297_7375_8400 341
1313 3300046689 Ga0495613_0020315 Ga0495613_0020315_633_1658 341
1314 3300046690 Ga0495624_0032778 Ga0495624_0032778_1064_2089 341
1315 3300046809 Ga0495600_0001754 Ga0495600_0001754_4376_5401 341
1316 3300047317 Ga0495604_0000934 Ga0495604_0000934_14324_15349 341
1317 3300047317 Ga0495604_0006656 Ga0495604_0006656_4075_5100 341
1318 3300047317 Ga0495604_0010097 Ga0495604_0010097_2598_3626 341
1319 3300047319 Ga0495674_0010778 Ga0495674_0010778_4669_5694 341
1320 3300047319 Ga0495674_0034699 Ga0495674_0034699_2470_3495 341
1321 3300047322 Ga0495680_0003912 Ga0495680_0003912_6900_7925 341
1322 3300047322 Ga0495680_0039676 Ga0495680_0039676_2096_3298 341
1323 3300047444 Ga0495675_0000289 Ga0495675_0000289_10313_11338 341
1324 3300047444 Ga0495675_0003236 Ga0495675_0003236_4840_5865 341
1325 3300047444 Ga0495675_0035585 Ga0495675_0035585_1097_2125 341
1326 3300047471 Ga0495684_0000504 Ga0495684_0000504_15609_16634 341
1327 3300047471 Ga0495684_0008127 Ga0495684_0008127_6783_7808 341
1328 3300047673 Ga0495593_0008338 Ga0495593_0008338_3123_4148 341
1329 3300047673 Ga0495593_0103662 Ga0495593_0103662_411_1436 341
1330 3300048088 Ga0495602_0000056 Ga0495602_0000056_8319_9347 341
1331 3300048088 Ga0495602_0004170 Ga0495602_0004170_1264_2289 341
1332 3300048088 Ga0495602_0015880 Ga0495602_0015880_1497_2522 341
1333 3300048088 Ga0495602_0054834 Ga0495602_0054834_1797_2822 341
1334 3300048088 Ga0495602_0143378 Ga0495602_0143378_844_1869 341
1335 3300048089 Ga0495614_0020037 Ga0495614_0020037_48_1073 341
1336 3300048913 Ga0496110_0377941 Ga0496110_0377941_43_1080 341
1337 3300048915 Ga0496112_0031622 Ga0496112_0031622_3456_4481 341
1338 3300050512 nmdc:mga0n895_123811_c1 nmdc:mga0n895_123811_c1_461_1507 341
1339 3300050515 nmdc:mga0a205_428009_c1 nmdc:mga0a205_428009_c1_27_1073 341
1340 3300053078 Ga0495612_0000398 Ga0495612_0000398_3607_4632 341
1341 3300053085 Ga0495619_0242434 Ga0495619_0242434_182_1207 341
1342 3300049572 Ga0501036_0014261 Ga0501036_0014261_805_1836 342
1343 3300049574 Ga0501038_0075827 Ga0501038_0075827_196_1227 342
1344 3300049576 Ga0501040_0047419 Ga0501040_0047419_768_1799 342
1345 3300049577 Ga0501041_0010123 Ga0501041_0010123_3014_4045 342
1346 3300049578 Ga0501042_0034060 Ga0501042_0034060_719_1750 342
1347 3300049580 Ga0501046_0014990 Ga0501046_0014990_2558_3589 342
1348 3300049582 Ga0501048_0082182 Ga0501048_0082182_1043_2074 342
1349 3300049588 Ga0501072_0015475 Ga0501072_0015475_2429_3460 342
1350 3300049590 Ga0501074_0055892 Ga0501074_0055892_1177_2208 342
1351 3300049591 Ga0501075_0001850 Ga0501075_0001850_1382_2413 342
1352 3300049592 Ga0501076_0000633 Ga0501076_0000633_18884_19915 342
1353 3300049593 Ga0501077_0021021 Ga0501077_0021021_1041_2072 342
1354 3300049741 Ga0501079_0015604 Ga0501079_0015604_2418_3449 342
1355 3300049742 Ga0501080_0046033 Ga0501080_0046033_2389_3420 342
1356 3300049743 Ga0501081_0018947 Ga0501081_0018947_2790_3821 342
1357 3300049822 Ga0501035_0098220 Ga0501035_0098220_633_1664 342
1358 3300049824 Ga0501045_0021060 Ga0501045_0021060_2479_3510 342
1359 3300054114 Ga0501084_0030447 Ga0501084_0030447_2707_3738 342
1360 3300060353 Ga0501082_0036375 Ga0501082_0036375_748_1779 342
1361 3300061734 Ga0530510_0005554 Ga0530510_0005554_895_1926 342
1362 3300025922 Ga0207646_10407768 Ga0207646_104077682 343
1363 3300025928 Ga0207700_10044131 Ga0207700_100441313 343
1364 3300035410 Ga0373924_0106313 Ga0373924_0106313_66_1097 343
1365 3300036401 Ga0373937_0002907 Ga0373937_0002907_304_1335 343
1366 3300005434 Ga0070709_10037201 Ga0070709_100372012 344
1367 3300005436 Ga0070713_100031212 Ga0070713_1000312121 344
1368 3300005439 Ga0070711_100009831 Ga0070711_1000098315 344
1369 3300005440 Ga0070705_100000449 Ga0070705_1000004496 344
1370 3300005444 Ga0070694_100000762 Ga0070694_1000007629 344
1371 3300005467 Ga0070706_100007364 Ga0070706_1000073645 344
1372 3300005467 Ga0070706_100201483 Ga0070706_1002014832 344
1373 3300005471 Ga0070698_100014002 Ga0070698_1000140028 344
1374 3300005518 Ga0070699_100009920 Ga0070699_1000099203 344
1375 3300005545 Ga0070695_100000582 Ga0070695_10000058213 344
1376 3300005546 Ga0070696_100003257 Ga0070696_10000325712 344
1377 3300005547 Ga0070693_100000004 Ga0070693_10000000451 344
1378 3300005547 Ga0070693_100005655 Ga0070693_1000056555 344
1379 3300005843 Ga0068860_100002851 Ga0068860_1000028519 344
1380 3300006173 Ga0070716_100004009 Ga0070716_1000040096 344
1381 3300006173 Ga0070716_100042123 Ga0070716_1000421232 344
1382 3300006173 Ga0070716_100201173 Ga0070716_1002011731 344
1383 3300006175 Ga0070712_100021014 Ga0070712_1000210142 344
1384 3300006175 Ga0070712_100112029 Ga0070712_1001120293 344
1385 3300006914 Ga0075436_100011225 Ga0075436_1000112257 344
1386 3300006914 Ga0075436_100037045 Ga0075436_1000370452 344
1387 3300007265 Ga0099794_10010639 Ga0099794_100106394 344
1388 3300007265 Ga0099794_10012772 Ga0099794_100127724 344
1389 3300007265 Ga0099794_10019314 Ga0099794_100193142 344
1390 3300007265 Ga0099794_10050745 Ga0099794_100507452 344
1391 3300009176 Ga0105242_10074387 Ga0105242_100743873 344
1392 3300009177 Ga0105248_10093304 Ga0105248_100933044 344
1393 3300010375 Ga0105239_10051109 Ga0105239_100511095 344
1394 3300013297 Ga0157378_10000044 Ga0157378_1000004415 344
1395 3300013306 Ga0163162_10031743 Ga0163162_100317433 344
1396 3300025885 Ga0207653_10000691 Ga0207653_1000069112 344
1397 3300025906 Ga0207699_10021854 Ga0207699_100218542 344
1398 3300025906 Ga0207699_10056021 Ga0207699_100560212 344
1399 3300025910 Ga0207684_10002227 Ga0207684_1000222713 344
1400 3300025914 Ga0207671_10147123 Ga0207671_101471232 344
1401 3300025915 Ga0207693_10003389 Ga0207693_100033897 344
1402 3300025915 Ga0207693_10015622 Ga0207693_100156224 344
1403 3300025916 Ga0207663_10006081 Ga0207663_100060815 344
1404 3300025929 Ga0207664_10109716 Ga0207664_101097162 344
1405 3300025939 Ga0207665_10000008 Ga0207665_10000008120 344
1406 3300025939 Ga0207665_10052689 Ga0207665_100526892 344
1407 3300025939 Ga0207665_10080243 Ga0207665_100802432 344
1408 3300025941 Ga0207711_10078675 Ga0207711_100786752 344
1409 3300027671 Ga0209588_1005892 Ga0209588_10058922 344
1410 3300028381 Ga0268264_10032193 Ga0268264_100321933 344
1411 3300028800 Ga0265338_10038545 Ga0265338_100385457 344
1412 3300031240 Ga0265320_10059973 Ga0265320_100599732 344
1413 3300035083 Ga0373926_0004885 Ga0373926_0004885_1878_2933 344
1414 3300035086 Ga0373934_0001676 Ga0373934_0001676_4247_5320 344
1415 3300035117 Ga0373953_0028136 Ga0373953_0028136_331_1404 344
1416 3300035118 Ga0373954_0000648 Ga0373954_0000648_7517_8590 344
1417 3300035119 Ga0373956_0001011 Ga0373956_0001011_6940_8013 344
1418 3300035171 Ga0373946_0043801 Ga0373946_0043801_537_1592 344
1419 3300035172 Ga0373955_0001645 Ga0373955_0001645_931_2004 344
1420 3300035172 Ga0373955_0033421 Ga0373955_0033421_870_1940 344
1421 3300035695 Ga0373927_0023331 Ga0373927_0023331_1687_2742 344
1422 3300035724 Ga0373933_0003491 Ga0373933_0003491_4533_5606 344
1423 3300036401 Ga0373937_0006161 Ga0373937_0006161_7618_8691 344
1424 3300037068 Ga0373925_0002897 Ga0373925_0002897_10812_11867 344
1425 3300046463 Ga0495653_0091792 Ga0495653_0091792_838_1887 344
1426 3300046516 Ga0495628_0023006 Ga0495628_0023006_277_1326 344
1427 3300046517 Ga0495630_0060214 Ga0495630_0060214_1528_2583 344
1428 3300046526 Ga0495666_0015665 Ga0495666_0015665_2048_3103 344
1429 3300046536 Ga0495587_0003324 Ga0495587_0003324_9190_10245 344
1430 3300046536 Ga0495587_0017789 Ga0495587_0017789_1327_2400 344
1431 3300046559 Ga0495667_0070065 Ga0495667_0070065_336_1409 344
1432 3300046679 Ga0495623_0064206 Ga0495623_0064206_584_1657 344
1433 3300047317 Ga0495604_0197137 Ga0495604_0197137_190_1254 344
1434 3300047471 Ga0495684_0006592 Ga0495684_0006592_3425_4498 344
1435 3300048088 Ga0495602_0011475 Ga0495602_0011475_1677_2750 344
1436 3300048905 Ga0496102_0021614 Ga0496102_0021614_4620_5675 344
1437 3300048909 Ga0496106_0046663 Ga0496106_0046663_653_1708 344
1438 3300050514 nmdc:mga08x19_10017_c1 nmdc:mga08x19_10017_c1_65_1120 344
1439 3300050514 nmdc:mga08x19_1347_c1 nmdc:mga08x19_1347_c1_1165_2220 344
1440 3300053084 Ga0495595_0048976 Ga0495595_0048976_625_1674 344
1441 3300005440 Ga0070705_100000288 Ga0070705_10000028816 345
1442 3300005444 Ga0070694_100335306 Ga0070694_1003353061 345
1443 3300005545 Ga0070695_100296084 Ga0070695_1002960842 345
1444 3300005546 Ga0070696_100001518 Ga0070696_10000151812 345
1445 3300005549 Ga0070704_100133034 Ga0070704_1001330341 345
1446 3300006871 Ga0075434_100084179 Ga0075434_1000841792 345
1447 3300046491 Ga0495584_0074747 Ga0495584_0074747_188_1225 345
1448 3300046525 Ga0495663_0012376 Ga0495663_0012376_989_2026 345
1449 3300050512 nmdc:mga0n895_79259_c1 nmdc:mga0n895_79259_c1_1318_2382 345
1450 3300005441 Ga0070700_100153909 Ga0070700_1001539092 346
1451 3300005518 Ga0070699_100026285 Ga0070699_1000262851 346
1452 3300006852 Ga0075433_10065855 Ga0075433_100658554 346
1453 3300006871 Ga0075434_100110857 Ga0075434_1001108573 346
1454 3300009094 Ga0111539_10366046 Ga0111539_103660461 346
1455 3300026075 Ga0207708_10078793 Ga0207708_100787932 346
1456 3300042435 Ga0439434_0053512 Ga0439434_0053512_162_1205 346
1457 3300045051 Ga0451576_0007133 Ga0451576_0007133_11010_12071 346
1458 3300045051 Ga0451576_0017863 Ga0451576_0017863_5706_6767 346
1459 3300003203 JGI25406J46586_10013078 JGI25406J46586_100130784 347
1460 3300005434 Ga0070709_10004268 Ga0070709_100042686 347
1461 3300005436 Ga0070713_100199094 Ga0070713_1001990943 347
1462 3300005439 Ga0070711_100212492 Ga0070711_1002124921 347
1463 3300005444 Ga0070694_100032377 Ga0070694_1000323774 347
1464 3300005445 Ga0070708_100028160 Ga0070708_1000281603 347
1465 3300005445 Ga0070708_100057244 Ga0070708_1000572443 347
1466 3300005458 Ga0070681_10005093 Ga0070681_100050932 347
1467 3300005468 Ga0070707_100002468 Ga0070707_10000246811 347
1468 3300005468 Ga0070707_100060347 Ga0070707_1000603473 347
1469 3300005471 Ga0070698_100001654 Ga0070698_1000016544 347
1470 3300005518 Ga0070699_100000558 Ga0070699_10000055829 347
1471 3300005518 Ga0070699_100152609 Ga0070699_1001526091 347
1472 3300005536 Ga0070697_100097400 Ga0070697_1000974002 347
1473 3300005536 Ga0070697_100162949 Ga0070697_1001629492 347
1474 3300005545 Ga0070695_100165990 Ga0070695_1001659902 347
1475 3300005546 Ga0070696_100018392 Ga0070696_1000183924 347
1476 3300005719 Ga0068861_100130396 Ga0068861_1001303962 347
1477 3300005842 Ga0068858_100182368 Ga0068858_1001823682 347
1478 3300005843 Ga0068860_100196091 Ga0068860_1001960912 347
1479 3300005985 Ga0081539_10000025 Ga0081539_1000002510 347
1480 3300005985 Ga0081539_10000134 Ga0081539_1000013457 347
1481 3300006163 Ga0070715_10063972 Ga0070715_100639722 347
1482 3300006173 Ga0070716_100219253 Ga0070716_1002192531 347
1483 3300006175 Ga0070712_100077573 Ga0070712_1000775732 347
1484 3300006237 Ga0097621_100100594 Ga0097621_1001005942 347
1485 3300006844 Ga0075428_100395198 Ga0075428_1003951982 347
1486 3300006871 Ga0075434_100000919 Ga0075434_1000009198 347
1487 3300006871 Ga0075434_100193417 Ga0075434_1001934173 347
1488 3300009176 Ga0105242_10129741 Ga0105242_101297413 347
1489 3300009177 Ga0105248_10029775 Ga0105248_100297753 347
1490 3300009177 Ga0105248_10182129 Ga0105248_101821291 347
1491 3300013297 Ga0157378_10002388 Ga0157378_1000238815 347
1492 3300014969 Ga0157376_10000008 Ga0157376_10000008302 347
1493 3300014969 Ga0157376_10000231 Ga0157376_1000023134 347
1494 3300025905 Ga0207685_10048472 Ga0207685_100484722 347
1495 3300025906 Ga0207699_10001243 Ga0207699_100012439 347
1496 3300025912 Ga0207707_10022422 Ga0207707_100224226 347
1497 3300025915 Ga0207693_10034863 Ga0207693_100348635 347
1498 3300025916 Ga0207663_10059865 Ga0207663_100598652 347
1499 3300025916 Ga0207663_10066980 Ga0207663_100669802 347
1500 3300025922 Ga0207646_10115678 Ga0207646_101156782 347
1501 3300025928 Ga0207700_10141252 Ga0207700_101412523 347
1502 3300025928 Ga0207700_10178810 Ga0207700_101788102 347
1503 3300025931 Ga0207644_10046516 Ga0207644_100465162 347
1504 3300025939 Ga0207665_10008235 Ga0207665_100082356 347
1505 3300025939 Ga0207665_10050032 Ga0207665_100500322 347
1506 3300025939 Ga0207665_10260036 Ga0207665_102600361 347
1507 3300028381 Ga0268264_10225569 Ga0268264_102255692 347
1508 3300028381 Ga0268264_10355430 Ga0268264_103554302 347
1509 3300031731 Ga0307405_10000638 Ga0307405_100006388 347
1510 3300031824 Ga0307413_10017654 Ga0307413_100176543 347
1511 3300031852 Ga0307410_10005295 Ga0307410_100052958 347
1512 3300031901 Ga0307406_10023741 Ga0307406_100237413 347
1513 3300031903 Ga0307407_10010455 Ga0307407_100104554 347
1514 3300031911 Ga0307412_10022746 Ga0307412_100227463 347
1515 3300031995 Ga0307409_100003656 Ga0307409_1000036569 347
1516 3300032002 Ga0307416_100003391 Ga0307416_1000033916 347
1517 3300032005 Ga0307411_10025874 Ga0307411_100258742 347
1518 3300032126 Ga0307415_100008737 Ga0307415_1000087375 347
1519 3300046472 Ga0495580_0017978 Ga0495580_0017978_1165_2247 347
1520 3300046473 Ga0495582_0008789 Ga0495582_0008789_1916_2998 347
1521 3300046475 Ga0495639_0006368 Ga0495639_0006368_3476_4558 347
1522 3300046476 Ga0495662_0070371 Ga0495662_0070371_158_1240 347
1523 3300046499 Ga0495594_0020639 Ga0495594_0020639_2371_3453 347
1524 3300046514 Ga0495618_0050503 Ga0495618_0050503_762_1844 347
1525 3300046526 Ga0495666_0034741 Ga0495666_0034741_777_1859 347
1526 3300046526 Ga0495666_0121370 Ga0495666_0121370_120_1193 347
1527 3300046533 Ga0495640_0013332 Ga0495640_0013332_4217_5299 347
1528 3300046535 Ga0495586_0091128 Ga0495586_0091128_561_1643 347
1529 3300046681 Ga0495647_0017713 Ga0495647_0017713_447_1529 347
1530 3300046683 Ga0495658_0020937 Ga0495658_0020937_1270_2352 347
1531 3300046689 Ga0495613_0143099 Ga0495613_0143099_66_1148 347
1532 3300046690 Ga0495624_0065425 Ga0495624_0065425_752_1834 347
1533 3300047321 Ga0495676_0061862 Ga0495676_0061862_1377_2459 347
1534 3300047322 Ga0495680_0058882 Ga0495680_0058882_820_1902 347
1535 3300047673 Ga0495593_0138100 Ga0495593_0138100_129_1211 347
1536 3300048089 Ga0495614_0021255 Ga0495614_0021255_1009_2091 347
1537 3300048903 Ga0496100_0012885 Ga0496100_0012885_3263_4345 347
1538 3300048917 Ga0496114_0048633 Ga0496114_0048633_868_1950 347
1539 3300048917 Ga0496114_0079649 Ga0496114_0079649_471_1541 347
1540 3300048918 Ga0496115_0017958 Ga0496115_0017958_3061_4131 347
1541 3300048918 Ga0496115_0038548 Ga0496115_0038548_410_1492 347
1542 3300050511 nmdc:mga08y16_57474_c1 nmdc:mga08y16_57474_c1_1359_2408 347
1543 3300050512 nmdc:mga0n895_1110_c1 nmdc:mga0n895_1110_c1_13846_14952 347
1544 3300050515 nmdc:mga0a205_118219_c1 nmdc:mga0a205_118219_c1_835_1941 347

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05496

RuvB_N

Holliday junction DNA helicase RuvB P-loop domain

82

240

0.99

PF17864

AAA_lid_4

RuvB AAA lid domain

243

316

0.99

PF05491

RuvB_C

RuvB C-terminal winged helix domain

317

388

0.98

PF00004

AAA

ATPase family associated with various cellular activities (AAA)

117

242

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j7k-assembly1.cif.gz_A thermotoga maritima ruvb p216g mutant 0.9718 31 340
1in5-assembly1.cif.gz_A thermogota maritima ruvb a156s mutant 0.9713 29 340
1in8-assembly1.cif.gz_A thermotoga maritima ruvb t158v 0.9712 30 340
1in4-assembly1.cif.gz_A thermotoga maritima ruvb holliday junction branch migration motor 0.9712 30 340
1in7-assembly1.cif.gz_A thermotoga maritima ruvb r170a 0.9712 30 340
ID Description Score Start End Superfamily
6blbA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9889 191 265 1.10.8.60
6blbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9887 31 190 3.40.50.300
1in5A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9803 267 337 1.10.10.10
6blbA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9709 267 342 1.10.10.10
6blbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9701 31 190 3.40.50.300
ID Description Score Start End GO Terms
AF-X1G2L0-F1-model_v4 AAA+ ATPase domain-containing protein 0.9976 49 208 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
GO:0016887
AF-A0A6M1X791-F1-model_v4 deleted 0.9963 31 126
AF-A0A349UQX2-F1-model_v4 Holliday junction branch migration DNA helicase RuvB 0.992 64 227 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
GO:0016887
AF-A0A7Y2ISW1-F1-model_v4 AAA family ATPase 0.9918 36 145 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
AF-A0A6G2DWS7-F1-model_v4 AAA family ATPase 0.9911 38 144 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378

Feature Viewer

pLDDT pTM Quality
88.32 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map