F494654

General Info

Members Datasets Scaffolds Average Seq Length
1541 673 1275 255

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10211171|rootH1_102111712
Length 260
Sequence MSKTQLFDLDGKIAFVSGASRGIGEAIAKLLAQQGAHVIVSSRKLEGCQHVADAIIAAGGKATAIACHIGEMEQISQVFAGIKEQFGRLDILVNNAAVATSAETAHPVAGVSYADWQRIWRRTLDVNLAGAANLSYCVARHLIGRGAPGRIVNIGSRGAFKGEPDHPAYGASKAALHALGQSLAVSLAPHGISVTSVAPGFTATERVADRIDDTLRAQSPFGRVGTPEEVAAAVVYLASAEATWASGTILDLNGASHLRM

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2511231004 Pseudomonas sp. GM102 Isolate Nodule
3 2511231006 Pseudomonas sp. GM17 Isolate Nodule
4 2511231007 Pseudomonas sp. GM18 Isolate Nodule
5 2511231008 Pseudomonas sp. GM21 Isolate Nodule
6 2511231010 Pseudomonas sp. GM25 Isolate Nodule
7 2511231011 Pseudomonas sp. GM30 Isolate Nodule
8 2511231012 Pseudomonas sp. GM33 Isolate Nodule
9 2511231014 Pseudomonas sp. GM48 Isolate Nodule
10 2511231015 Pseudomonas sp. GM49 Isolate Nodule
11 2511231016 Pseudomonas sp. GM50 Isolate Nodule
12 2511231017 Pseudomonas sp. GM55 Isolate Nodule
13 2511231018 Pseudomonas sp. GM60 Isolate Nodule
14 2511231019 Pseudomonas sp. GM67 Isolate Nodule
15 2511231020 Pseudomonas sp. GM74 Isolate Nodule
16 2511231021 Pseudomonas sp. GM78 Isolate Nodule
17 2511231022 Pseudomonas sp. GM79 Isolate Nodule
18 2511231023 Pseudomonas sp. GM80 Isolate Nodule
19 2511231024 Pseudomonas sp. GM84 Isolate Nodule
20 2511231031 Pseudomonas sp. GM16 Isolate Nodule
21 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
22 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
23 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
24 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
25 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
26 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
27 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
28 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
29 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
30 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
31 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
32 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
33 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
34 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
35 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
36 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
37 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
38 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
39 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
40 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
41 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
42 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
43 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
44 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
45 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
46 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
47 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
48 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
49 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
50 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
51 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
52 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
53 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
54 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
55 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
56 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
57 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
58 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
59 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
60 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
61 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
62 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
63 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
64 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
65 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
66 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
67 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
68 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
69 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
70 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
71 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
72 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
73 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
74 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
75 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
76 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
77 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
78 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
79 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
80 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
81 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
82 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
83 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
84 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
85 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
86 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
87 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
88 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
89 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
90 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
91 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
92 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
93 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
94 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
95 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
96 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
97 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
98 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
99 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
100 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
101 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
102 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
103 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
104 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
105 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
106 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
107 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
108 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
109 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
110 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
111 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
112 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
113 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
114 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
115 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
116 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
117 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
118 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
119 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
120 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
121 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
122 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
123 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
124 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
125 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
126 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
127 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
128 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
129 2739367700 Dyella sp. YR388 Isolate Unclassified
130 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
131 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
132 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
133 2765235841 Pseudomonas putida AA7 Isolate Unclassified
134 2773857670 Pseudomonas sp. 478 Isolate Unclassified
135 2773857673 Pseudomonas sp. 443 Isolate Unclassified
136 2784132063 Pseudomonas sp. 424 Isolate Unclassified
137 2784132072 Pseudomonas sp. 460 Isolate Unclassified
138 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
139 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
140 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
141 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
142 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
143 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
144 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
145 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
146 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
147 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
148 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
149 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
150 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
151 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
152 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
153 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
154 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
155 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
156 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
157 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
158 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
159 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
160 2818991436 Collimonas arenae 515 Isolate Unclassified
161 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
162 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
163 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
164 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
165 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
166 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
167 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
168 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
169 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
170 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
171 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
172 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
173 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
174 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
175 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
176 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
177 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
178 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
179 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
180 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
181 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
182 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
183 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
184 2884411467 Dyella sp. AD56 Isolate Rhizosphere
185 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
186 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
187 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
188 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
189 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
190 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
191 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
192 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
193 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
194 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
195 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
196 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
197 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
198 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
199 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
200 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
201 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
202 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
203 2928963466 Dyella japonica 1073 Isolate Unclassified
204 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
205 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
206 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
207 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
208 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
209 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
210 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
211 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
212 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
213 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
214 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
215 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
216 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
217 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
218 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
219 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
220 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
221 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
222 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
223 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
224 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
225 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
226 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
227 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
228 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
229 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
230 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
231 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
232 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
233 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
234 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
235 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
236 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
237 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
238 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
239 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
240 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
241 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
242 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
243 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
244 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
245 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
246 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
247 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
248 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
249 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
250 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
251 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
252 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
253 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
254 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
255 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
256 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
257 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
258 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
259 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
260 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
261 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
262 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
263 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
264 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
265 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
266 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
267 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
268 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
269 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
270 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
271 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
272 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
273 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
274 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
275 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
276 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
277 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
278 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
279 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
280 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
281 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
282 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
283 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
284 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
285 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
286 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
287 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
288 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
289 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
290 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
291 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
292 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
293 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
294 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
295 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
296 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
297 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
298 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
299 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
300 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
301 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
302 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
303 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
304 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
305 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
306 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
307 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
308 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
309 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
310 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
311 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
312 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
313 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
314 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
315 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
316 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
317 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
318 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
319 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
320 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
321 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
322 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
323 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
324 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
325 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
326 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
327 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
328 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
329 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
330 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
331 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
332 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
333 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
334 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
335 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
336 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
337 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
338 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
339 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
340 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
341 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
342 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
343 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
344 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
345 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
346 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
348 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
349 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
350 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
351 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
352 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
353 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
354 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
355 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
356 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
357 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
358 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
359 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
360 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
361 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
362 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
363 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
364 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
365 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
366 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
367 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
368 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
369 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
370 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
371 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
372 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
373 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
374 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
375 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
413 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
415 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
417 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
418 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
419 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
421 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
422 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
423 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
424 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
425 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
426 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
427 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
428 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
429 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
430 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
431 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
432 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
433 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
435 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
436 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
437 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
438 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
439 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
440 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
441 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
442 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
443 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
444 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
445 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
446 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
447 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
448 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
449 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
450 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
451 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
452 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
453 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
454 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
455 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
456 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
457 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
458 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
459 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
460 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
461 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
462 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
463 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
464 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
465 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
466 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
467 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
468 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
469 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
470 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
471 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
472 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
473 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
474 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
475 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
476 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
477 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
478 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
479 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
480 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
481 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
482 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
483 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
484 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
485 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
486 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
487 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
488 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
489 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
490 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
491 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
492 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
493 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
494 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
495 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
496 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
497 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
498 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
499 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
500 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
501 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
502 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
503 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
504 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
505 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
506 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
507 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
508 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
509 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
510 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
511 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
512 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
513 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
514 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
515 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
516 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
517 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
518 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
519 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
520 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
521 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
522 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
523 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
524 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
525 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
526 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
527 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
528 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
529 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
530 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
531 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
532 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
533 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
534 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
535 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
536 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
537 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
538 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
539 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
540 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
541 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
542 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
543 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
544 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
545 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
546 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
547 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
548 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
549 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
550 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
551 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
552 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
553 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
554 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
555 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
556 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
557 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
558 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
559 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
560 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
561 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
562 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
563 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
564 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
565 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
566 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
567 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
568 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
569 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
570 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
571 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
572 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
573 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
574 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
575 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
576 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
577 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
578 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
579 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
580 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
581 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
582 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
583 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
584 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
585 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
586 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
587 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
588 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
589 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
590 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
591 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
592 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
593 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
594 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
595 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
596 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
597 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
598 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
599 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
600 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
601 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
602 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
603 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
604 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
605 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
606 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
607 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
608 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
609 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
610 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
611 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
612 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
613 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
614 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
615 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
616 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
617 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
618 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
619 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
620 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
621 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
622 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
623 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
624 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
625 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
626 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
627 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
628 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
629 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
630 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
631 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
632 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
633 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
634 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
635 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
636 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
637 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
638 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
639 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
640 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
641 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
642 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
643 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
644 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
645 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
646 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
647 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
648 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
649 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
650 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
651 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
652 8052494512 Pseudomonas putida LD6 Isolate Unclassified
653 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
654 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
655 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
656 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
657 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
658 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
659 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
660 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
661 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
662 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
663 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
664 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
665 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
666 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
667 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
668 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
669 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
670 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
671 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
672 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
673 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.54
Metatranscriptomes 0.19
Isolates 17.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.03
Nodule 2.01
Rhizoplane 7.01
Rhizosphere 67.36
Stem 0
Stem Tuber 0
Unclassified 12.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_32 2124908027 Bacteria 30020
2 MRS2a_Contig_6316 2124908027 Bacteria 27178
3 MRS2a_Contig_9068 2124908027 Bacteria 5702
4 JGI24741J21665_1000469 3300001915 Bacteria 12321
5 JGI24740J21852_10000476 3300001979 Bacteria 17260
6 JGI24740J21852_10002829 3300001979 Bacteria 7759
7 JGI24740J21852_10002831 3300001979 Bacteria 7756
8 JGI24740J21852_10002832 3300001979 Bacteria 7754
9 JGI24739J22299_10041945 3300001989 Bacteria 1520
10 JGI25156J39149_1001919 3300002705 Bacteria 8077
11 JGI25156J39149_1006956 3300002705 Bacteria 3032
12 JGI25162J39368_1000014 3300002737 Bacteria 328873
13 JGI25162J39368_1000060 3300002737 Bacteria 137745
14 JGI25162J39368_1000189 3300002737 Bacteria 64599
15 JGI25162J39368_1000284 3300002737 Bacteria 47815
16 JGI25162J39368_1003095 3300002737 Bacteria 5312
17 JGI25154J39366_1000302 3300002738 Bacteria 29186
18 JGI25154J39366_1008122 3300002738 Bacteria 1376
19 JGI25157J39369_1000343 3300002741 Bacteria 32869
20 JGI25163J39215_1000363 3300002771 Bacteria 14691
21 JGI25163J39215_1000821 3300002771 Bacteria 7471
22 JGI25163J39215_1001950 3300002771 Bacteria 2589
23 JGI25164J39214_1000037 3300002772 Bacteria 137530
24 JGI25164J39214_1000059 3300002772 Bacteria 111483
25 JGI25164J39214_1000093 3300002772 Bacteria 89262
26 JGI25165J46597_1000027 3300003214 Bacteria 328873
27 JGI25165J46597_1000118 3300003214 Bacteria 137530
28 JGI25165J46597_1000283 3300003214 Bacteria 64612
29 JGI25165J46597_1000384 3300003214 Bacteria 47815
30 rootL2_10014661 3300003322 Bacteria 3717
31 rootH1_10211171 3300003323 Bacteria 2055
32 JGI25160J50197_1000416 3300003354 Bacteria 27052
33 Ga0006562J51391_1092972 3300003578 Bacteria 1200
34 Ga0055538_1000007 3300003751 Bacteria 399715
35 Ga0055538_1000149 3300003751 Bacteria 47815
36 Ga0055538_1002760 3300003751 Bacteria 2435
37 Ga0055539_1000011 3300003752 Bacteria 399747
38 Ga0055539_1000104 3300003752 Bacteria 95182
39 Ga0055539_1000199 3300003752 Bacteria 47773
40 Ga0055533_1000014 3300003756 Bacteria 399747
41 Ga0055533_1000200 3300003756 Bacteria 47815
42 Ga0055533_1000423 3300003756 Bacteria 16250
43 Ga0055533_1004789 3300003756 Bacteria 2336
44 Ga0055532_1000009 3300003758 Bacteria 399537
45 Ga0055532_1000054 3300003758 Bacteria 161617
46 Ga0055532_1000113 3300003758 Bacteria 86629
47 Ga0055532_1000298 3300003758 Bacteria 30615
48 Ga0055532_1000320 3300003758 Bacteria 27644
49 Ga0055525_1000016 3300003759 Bacteria 399724
50 Ga0055525_1000245 3300003759 Bacteria 54959
51 Ga0055525_1000276 3300003759 Bacteria 47773
52 Ga0055527_1000280 3300003760 Bacteria 30042
53 Ga0055527_1002225 3300003760 Bacteria 3400
54 Ga0055527_1003792 3300003760 Bacteria 2175
55 Ga0055535_1000037 3300003761 Bacteria 161617
56 Ga0055535_1000070 3300003761 Bacteria 114467
57 Ga0055535_1000099 3300003761 Bacteria 93955
58 Ga0055535_1000152 3300003761 Bacteria 73843
59 Ga0055535_1000591 3300003761 Bacteria 30042
60 Ga0055535_1007800 3300003761 Bacteria 1998
61 Ga0055542_1000135 3300003762 Bacteria 93970
62 Ga0055542_1000232 3300003762 Bacteria 64691
63 Ga0055542_1000428 3300003762 Bacteria 40570
64 Ga0055542_1000676 3300003762 Bacteria 27432
65 Ga0055542_1002218 3300003762 Bacteria 6863
66 Ga0055529_1000024 3300003763 Bacteria 305218
67 Ga0055529_1000070 3300003763 Bacteria 161617
68 Ga0055529_1000082 3300003763 Bacteria 146912
69 Ga0055529_1000115 3300003763 Bacteria 118392
70 Ga0055529_1003717 3300003763 Bacteria 2463
71 Ga0055536_1000128 3300003781 Bacteria 64931
72 Ga0055536_1016936 3300003781 Bacteria 2411
73 Ga0055528_1002312 3300003790 Bacteria 10324
74 Ga0055530_10000133 3300003791 Bacteria 65211
75 Ga0055530_10000136 3300003791 Bacteria 64931
76 Ga0055530_10019242 3300003791 Bacteria 2073
77 Ga0055540_1000168 3300003792 Bacteria 65211
78 Ga0055540_1001628 3300003792 Bacteria 13043
79 Ga0055540_1014046 3300003792 Bacteria 2411
80 Ga0055531_10000660 3300003794 Bacteria 29672
81 Ga0055541_1000008 3300003841 Bacteria 399724
82 Ga0055541_1000130 3300003841 Bacteria 47815
83 Ga0055541_1010696 3300003841 Bacteria 1370
84 Ga0058692_1000051 3300003856 Bacteria 107880
85 Ga0058692_1001263 3300003856 Bacteria 9632
86 Ga0065165_1001317 3300005262 Bacteria 27699
87 Ga0065703_1000517 3300005272 Bacteria 17808
88 Ga0065714_10000609 3300005288 Bacteria 3474
89 Ga0065714_10003622 3300005288 Bacteria 7257
90 Ga0065714_10010402 3300005288 Bacteria 3520
91 Ga0065714_10023157 3300005288 Bacteria 1606
92 Ga0065714_10064921 3300005288 Bacteria 15447
93 Ga0065714_10065926 3300005288 Bacteria 8059
94 Ga0065704_10070431 3300005289 Bacteria 25069
95 Ga0065712_10069302 3300005290 Bacteria 7568
96 Ga0065712_10129971 3300005290 Bacteria 1561
97 Ga0070658_10001433 3300005327 Bacteria 20325
98 Ga0070658_10028542 3300005327 Bacteria 4481
99 Ga0070670_100005474 3300005331 Bacteria 10713
100 Ga0070670_100023096 3300005331 Bacteria 5352
101 Ga0070666_10000007 3300005335 Bacteria 293732
102 Ga0068868_100055157 3300005338 Bacteria 3135
103 Ga0070660_100000020 3300005339 Bacteria 98286
104 Ga0070660_100034070 3300005339 Bacteria 3845
105 Ga0070660_100363792 3300005339 Bacteria 1192
106 Ga0070689_100002849 3300005340 Bacteria 11367
107 Ga0070661_100000086 3300005344 Bacteria 74801
108 Ga0070661_100000829 3300005344 Bacteria 22251
109 Ga0070661_100117539 3300005344 Bacteria 1989
110 Ga0070661_100129858 3300005344 Bacteria 1892
111 Ga0070668_100162427 3300005347 Bacteria 1813
112 Ga0070668_100465503 3300005347 Bacteria 1089
113 Ga0070669_100048105 3300005353 Bacteria 3112
114 Ga0070669_100073076 3300005353 Bacteria 2540
115 Ga0070669_100141168 3300005353 Bacteria 1857
116 Ga0070669_100529420 3300005353 Bacteria 980
117 Ga0070675_100010237 3300005354 Bacteria 7315
118 Ga0070674_100000400 3300005356 Bacteria 21808
119 Ga0070659_100000047 3300005366 Bacteria 98286
120 Ga0070659_100002517 3300005366 Bacteria 13013
121 Ga0070667_100015049 3300005367 Bacteria 6392
122 Ga0070667_100401119 3300005367 Bacteria 1248
123 Ga0070714_100057484 3300005435 Bacteria 3330
124 Ga0070705_100021094 3300005440 Bacteria 3460
125 Ga0070663_100000008 3300005455 Bacteria 188775
126 Ga0070663_100001087 3300005455 Bacteria 14899
127 Ga0070663_100019634 3300005455 Bacteria 4461
128 Ga0070678_100300313 3300005456 Bacteria 1364
129 Ga0070662_100140361 3300005457 Bacteria 1871
130 Ga0070681_10103314 3300005458 Bacteria 2794
131 Ga0068867_100143095 3300005459 Bacteria 1871
132 Ga0070707_100243264 3300005468 Bacteria 1751
133 Ga0070696_100082822 3300005546 Bacteria 2275
134 Ga0070665_100122866 3300005548 Bacteria 2598
135 Ga0070665_100136281 3300005548 Bacteria 2458
136 Ga0070665_100336234 3300005548 Bacteria 1515
137 Ga0068855_100380711 3300005563 Bacteria 1549
138 Ga0070664_100000009 3300005564 Bacteria 166396
139 Ga0070664_100000878 3300005564 Bacteria 23328
140 Ga0068857_100084566 3300005577 Bacteria 2835
141 Ga0068854_100000024 3300005578 Bacteria 124310
142 Ga0068854_100305779 3300005578 Bacteria 1288
143 Ga0068856_100000019 3300005614 Bacteria 150500
144 Ga0068856_100072782 3300005614 Bacteria 3403
145 Ga0068852_100010338 3300005616 Bacteria 6969
146 Ga0068852_100413498 3300005616 Bacteria 1329
147 Ga0068859_100515418 3300005617 Bacteria 1291
148 Ga0068861_100027045 3300005719 Bacteria 4174
149 Ga0068861_100169270 3300005719 Bacteria 1809
150 Ga0068851_10000316 3300005834 Bacteria 21838
151 Ga0068863_100024270 3300005841 Bacteria 5783
152 Ga0068860_100040783 3300005843 Bacteria 4435
153 Ga0068862_100021113 3300005844 Bacteria 5443
154 Ga0068862_100071366 3300005844 Bacteria 2998
155 Ga0075364_10313726 3300006051 Bacteria 1068
156 Ga0075432_10019203 3300006058 Bacteria 2333
157 Ga0075432_10034377 3300006058 Bacteria 1760
158 Ga0075432_10062344 3300006058 Bacteria 1329
159 Ga0075432_10067352 3300006058 Bacteria 1282
160 Ga0075369_10006176 3300006186 Bacteria 4521
161 Ga0075430_100015636 3300006846 Bacteria 6463
162 Ga0075430_100404067 3300006846 Bacteria 1127
163 Ga0075431_100107231 3300006847 Bacteria 2882
164 Ga0075433_10355595 3300006852 Bacteria 1294
165 Ga0075429_100057724 3300006880 Bacteria 3379
166 Ga0068865_100012002 3300006881 Bacteria 5442
167 Ga0097620_100515450 3300006931 Bacteria 1291
168 Ga0099823_1000006 3300006944 Bacteria 135028
169 Ga0079104_1000634 3300006946 Bacteria 34222
170 Ga0079104_1001392 3300006946 Bacteria 16345
171 Ga0079104_1018251 3300006946 Bacteria 1993
172 Ga0079104_1030544 3300006946 Bacteria 1343
173 Ga0099826_10001093 3300006948 Bacteria 15434
174 Ga0105251_10000102 3300009011 Bacteria 84026
175 Ga0105251_10001137 3300009011 Bacteria 23139
176 Ga0105251_10001655 3300009011 Bacteria 18854
177 Ga0105251_10004803 3300009011 Bacteria 9043
178 Ga0105251_10006832 3300009011 Bacteria 7178
179 Ga0105251_10019253 3300009011 Bacteria 3610
180 Ga0105251_10039419 3300009011 Bacteria 2309
181 Ga0105251_10059661 3300009011 Bacteria 1798
182 Ga0105251_10071372 3300009011 Bacteria 1616
183 Ga0105244_10000214 3300009036 Bacteria 59852
184 Ga0105244_10000747 3300009036 Bacteria 27831
185 Ga0105244_10001830 3300009036 Bacteria 16634
186 Ga0105244_10003046 3300009036 Bacteria 12298
187 Ga0105244_10004643 3300009036 Bacteria 9387
188 Ga0105244_10004788 3300009036 Bacteria 9198
189 Ga0105244_10010816 3300009036 Bacteria 5509
190 Ga0105244_10025880 3300009036 Bacteria 3182
191 Ga0105244_10051542 3300009036 Bacteria 2097
192 Ga0105244_10152504 3300009036 Bacteria 1107
193 Ga0105244_10167117 3300009036 Bacteria 1048
194 Ga0105250_10000134 3300009092 Bacteria 64187
195 Ga0105250_10000871 3300009092 Bacteria 17836
196 Ga0105250_10003991 3300009092 Bacteria 6883
197 Ga0105250_10018201 3300009092 Bacteria 2848
198 Ga0105250_10021889 3300009092 Bacteria 2579
199 Ga0105250_10027038 3300009092 Bacteria 2312
200 Ga0105250_10031697 3300009092 Bacteria 2122
201 Ga0105250_10035765 3300009092 Bacteria 1993
202 Ga0105250_10087034 3300009092 Bacteria 1269
203 Ga0105240_10000236 3300009093 Bacteria 110204
204 Ga0105240_10000477 3300009093 Bacteria 74075
205 Ga0105240_10022047 3300009093 Bacteria 8455
206 Ga0105240_10477220 3300009093 Bacteria 1391
207 Ga0105240_10554818 3300009093 Bacteria 1271
208 Ga0111539_10000654 3300009094 Bacteria 44760
209 Ga0111539_10384601 3300009094 Bacteria 1634
210 Ga0114129_10891258 3300009147 Bacteria 1128
211 Ga0105243_10000005 3300009148 Bacteria 576265
212 Ga0105243_10000237 3300009148 Bacteria 63061
213 Ga0105243_10157258 3300009148 Bacteria 1956
214 Ga0105243_10622962 3300009148 Bacteria 1042
215 Ga0105242_10225453 3300009176 Bacteria 1677
216 Ga0105248_10119368 3300009177 Bacteria 2974
217 Ga0105237_10000093 3300009545 Bacteria 122006
218 Ga0105237_10947131 3300009545 Bacteria 868
219 Ga0105238_10000173 3300009551 Bacteria 70523
220 Ga0105238_10057069 3300009551 Bacteria 3916
221 Ga0105238_10282271 3300009551 Bacteria 1642
222 Ga0105239_10000110 3300010375 Bacteria 115508
223 Ga0105239_10042288 3300010375 Bacteria 4994
224 Ga0105246_10004388 3300011119 Bacteria 8586
225 Ga0105246_10016271 3300011119 Bacteria 4707
226 Ga0157345_1000846 3300012498 Bacteria 2303
227 Ga0157373_10005588 3300013100 Bacteria 9427
228 Ga0157373_10006561 3300013100 Bacteria 8683
229 Ga0157373_10012693 3300013100 Bacteria 6192
230 Ga0157373_10040261 3300013100 Bacteria 3344
231 Ga0157373_10045939 3300013100 Bacteria 3117
232 Ga0157373_10059024 3300013100 Bacteria 2719
233 Ga0157373_10102782 3300013100 Bacteria 2010
234 Ga0157373_10140220 3300013100 Bacteria 1700
235 Ga0157373_10154908 3300013100 Bacteria 1612
236 Ga0157371_10000047 3300013102 Bacteria 185590
237 Ga0157371_10000063 3300013102 Bacteria 169490
238 Ga0157371_10000771 3300013102 Bacteria 36847
239 Ga0157371_10008264 3300013102 Bacteria 8313
240 Ga0157371_10008628 3300013102 Bacteria 8096
241 Ga0157371_10046641 3300013102 Bacteria 3082
242 Ga0157371_10070503 3300013102 Bacteria 2474
243 Ga0157370_10000004 3300013104 Bacteria 366426
244 Ga0157370_10002828 3300013104 Bacteria 20744
245 Ga0157370_10005705 3300013104 Bacteria 13915
246 Ga0157370_10018040 3300013104 Bacteria 7103
247 Ga0157370_10027112 3300013104 Bacteria 5649
248 Ga0157370_10402870 3300013104 Bacteria 1259
249 Ga0157370_10414173 3300013104 Bacteria 1240
250 Ga0157369_10000665 3300013105 Bacteria 44336
251 Ga0157369_10003070 3300013105 Bacteria 19938
252 Ga0157369_10005410 3300013105 Bacteria 14863
253 Ga0157369_10008111 3300013105 Bacteria 12037
254 Ga0157369_10013986 3300013105 Bacteria 9069
255 Ga0157369_10090126 3300013105 Bacteria 3274
256 Ga0157369_10595675 3300013105 Bacteria 1141
257 Ga0163162_10000060 3300013306 Bacteria 106982
258 Ga0163162_10003289 3300013306 Bacteria 15465
259 Ga0163162_10004520 3300013306 Bacteria 13396
260 Ga0157372_10000221 3300013307 Bacteria 63545
261 Ga0157372_10049320 3300013307 Bacteria 4681
262 Ga0157372_10143375 3300013307 Bacteria 2754
263 Ga0157375_10006434 3300013308 Bacteria 10235
264 Ga0157375_10008932 3300013308 Bacteria 8769
265 Ga0157375_10072211 3300013308 Bacteria 3467
266 Ga0157380_10100090 3300014326 Bacteria 2412
267 Ga0182008_10005509 3300014497 Bacteria 7199
268 Ga0182008_10006760 3300014497 Bacteria 6381
269 Ga0182008_10016833 3300014497 Bacteria 3794
270 Ga0182008_10018532 3300014497 Bacteria 3604
271 Ga0182008_10019436 3300014497 Bacteria 3506
272 Ga0182008_10189968 3300014497 Bacteria 1042
273 Ga0157376_10367650 3300014969 Bacteria 1381
274 Ga0157376_11100812 3300014969 Bacteria 820
275 Ga0182006_1000879 3300015261 Bacteria 20208
276 Ga0182006_1001712 3300015261 Bacteria 12774
277 Ga0182006_1005449 3300015261 Bacteria 6069
278 Ga0182006_1006193 3300015261 Bacteria 5584
279 Ga0182006_1039233 3300015261 Bacteria 1869
280 Ga0182006_1042491 3300015261 Bacteria 1781
281 Ga0182007_10000071 3300015262 Bacteria 81966
282 Ga0182007_10001058 3300015262 Bacteria 15039
283 Ga0182007_10004004 3300015262 Bacteria 6797
284 Ga0182007_10018500 3300015262 Bacteria 2522
285 Ga0182007_10026296 3300015262 Bacteria 2019
286 Ga0182005_1000589 3300015265 Bacteria 17823
287 Ga0182005_1000811 3300015265 Bacteria 14151
288 Ga0182005_1002153 3300015265 Bacteria 7274
289 Ga0182005_1010978 3300015265 Bacteria 2593
290 Ga0163161_10001354 3300017792 Bacteria 18221
291 Ga0163161_10003740 3300017792 Bacteria 10661
292 Ga0163161_10015978 3300017792 Bacteria 5238
293 Ga0163161_10031234 3300017792 Bacteria 3794
294 Ga0163161_10209933 3300017792 Bacteria 1504
295 Ga0154015_1213905 3300020610 Bacteria 2656
296 Ga0209435_106550 3300025206 Bacteria 1296
297 Ga0209760_100023 3300025207 Bacteria 159144
298 Ga0209760_100025 3300025207 Bacteria 156628
299 Ga0209760_100303 3300025207 Bacteria 16658
300 Ga0209784_100011 3300025224 Bacteria 546770
301 Ga0209784_100023 3300025224 Bacteria 399841
302 Ga0209784_100029 3300025224 Bacteria 347315
303 Ga0209784_100191 3300025224 Bacteria 48497
304 Ga0209784_100392 3300025224 Bacteria 20018
305 Ga0209784_101831 3300025224 Bacteria 2479
306 Ga0209566_100019 3300025225 Bacteria 414836
307 Ga0209566_100030 3300025225 Bacteria 347329
308 Ga0209566_100136 3300025225 Bacteria 90096
309 Ga0209566_100143 3300025225 Bacteria 84572
310 Ga0209566_100252 3300025225 Bacteria 51250
311 Ga0209566_104354 3300025225 Bacteria 1950
312 Ga0209674_100034 3300025226 Bacteria 414903
313 Ga0209674_100069 3300025226 Bacteria 243948
314 Ga0209674_100075 3300025226 Bacteria 216004
315 Ga0209674_100281 3300025226 Bacteria 37935
316 Ga0209674_100929 3300025226 Bacteria 9358
317 Ga0209672_100012 3300025228 Bacteria 795742
318 Ga0209672_100086 3300025228 Bacteria 128901
319 Ga0209672_100178 3300025228 Bacteria 52778
320 Ga0209672_100932 3300025228 Bacteria 13176
321 Ga0209672_102818 3300025228 Bacteria 3956
322 Ga0209672_103204 3300025228 Bacteria 3492
323 Ga0209147_100007 3300025229 Bacteria 795684
324 Ga0209147_100008 3300025229 Bacteria 777096
325 Ga0209147_100027 3300025229 Bacteria 414610
326 Ga0209147_100064 3300025229 Bacteria 234181
327 Ga0209147_100148 3300025229 Bacteria 103421
328 Ga0209563_100037 3300025230 Bacteria 414903
329 Ga0209563_100117 3300025230 Bacteria 132048
330 Ga0209563_100167 3300025230 Bacteria 47867
331 Ga0209563_101923 3300025230 Bacteria 5014
332 Ga0207427_100003 3300025231 Bacteria 1035004
333 Ga0207427_100018 3300025231 Bacteria 530735
334 Ga0207427_100026 3300025231 Bacteria 412764
335 Ga0207427_100965 3300025231 Bacteria 12203
336 Ga0207427_101377 3300025231 Bacteria 8915
337 Ga0209437_100002 3300025233 Bacteria 1574801
338 Ga0209437_100031 3300025233 Bacteria 530871
339 Ga0209437_100076 3300025233 Bacteria 295194
340 Ga0209437_100091 3300025233 Bacteria 243344
341 Ga0209437_100241 3300025233 Bacteria 89459
342 Ga0209258_100013 3300025242 Bacteria 777096
343 Ga0209258_100014 3300025242 Bacteria 720132
344 Ga0209258_100027 3300025242 Bacteria 518449
345 Ga0209258_100114 3300025242 Bacteria 191036
346 Ga0209258_100268 3300025242 Bacteria 89701
347 Ga0209646_1000046 3300025246 Bacteria 332737
348 Ga0209646_1000373 3300025246 Bacteria 29552
349 Ga0209646_1000483 3300025246 Bacteria 19670
350 Ga0209026_1000018 3300025250 Bacteria 381351
351 Ga0209026_1001624 3300025250 Bacteria 9575
352 Ga0209026_1002499 3300025250 Bacteria 6831
353 Ga0209677_100021 3300025253 Bacteria 414954
354 Ga0209677_100030 3300025253 Bacteria 347314
355 Ga0209677_100039 3300025253 Bacteria 243974
356 Ga0209677_107025 3300025253 Bacteria 2501
357 Ga0209148_1000001 3300025254 Bacteria 2545271
358 Ga0209148_1000002 3300025254 Bacteria 2399500
359 Ga0209148_1000110 3300025254 Bacteria 203536
360 Ga0209148_1000115 3300025254 Bacteria 191036
361 Ga0209148_1000337 3300025254 Bacteria 63295
362 Ga0209148_1003337 3300025254 Bacteria 4513
363 Ga0209759_1001805 3300025256 Bacteria 10815
364 Ga0209759_1001928 3300025256 Bacteria 10117
365 Ga0209759_1002261 3300025256 Bacteria 8751
366 Ga0209759_1015631 3300025256 Bacteria 1950
367 Ga0209759_1015643 3300025256 Bacteria 1949
368 Ga0209233_1000002 3300025261 Bacteria 2501366
369 Ga0209233_1000004 3300025261 Bacteria 1574798
370 Ga0209233_1000012 3300025261 Bacteria 1019519
371 Ga0209233_1000115 3300025261 Bacteria 243344
372 Ga0209233_1022203 3300025261 Bacteria 1629
373 Ga0209565_1026067 3300025263 Bacteria 1176
374 Ga0209455_1000019 3300025272 Bacteria 705658
375 Ga0209455_1000109 3300025272 Bacteria 191036
376 Ga0209455_1000130 3300025272 Bacteria 161669
377 Ga0209455_1000138 3300025272 Bacteria 141021
378 Ga0209455_1011627 3300025272 Bacteria 2155
379 Ga0209673_1000101 3300025273 Bacteria 190230
380 Ga0209130_1003020 3300025284 Bacteria 7604
381 Ga0209675_1008356 3300025291 Bacteria 3819
382 Ga0209676_1000002 3300025292 Bacteria 1732948
383 Ga0209676_1000003 3300025292 Bacteria 1454178
384 Ga0209676_1000154 3300025292 Bacteria 166013
385 Ga0209676_1000292 3300025292 Bacteria 101778
386 Ga0209676_1002683 3300025292 Bacteria 12065
387 Ga0209564_1015144 3300025295 Bacteria 3155
388 Ga0209564_1020982 3300025295 Bacteria 2371
389 Ga0209050_1000004 3300025298 Bacteria 1600040
390 Ga0209050_1000006 3300025298 Bacteria 1359702
391 Ga0209050_1000043 3300025298 Bacteria 398654
392 Ga0209050_1002777 3300025298 Bacteria 14032
393 Ga0207426_1000987 3300025302 Bacteria 27912
394 Ga0209051_1000001 3300025303 Bacteria 1732974
395 Ga0209051_1000030 3300025303 Bacteria 398654
396 Ga0209051_1000052 3300025303 Bacteria 283346
397 Ga0209051_1007183 3300025303 Bacteria 6133
398 Ga0209257_1000056 3300025304 Bacteria 403132
399 Ga0209257_1068343 3300025304 Bacteria 944
400 Ga0207656_10003183 3300025321 Bacteria 5612
401 Ga0207696_1000018 3300025711 Bacteria 478605
402 Ga0207696_1000051 3300025711 Bacteria 276833
403 Ga0207696_1000075 3300025711 Bacteria 210629
404 Ga0207696_1000091 3300025711 Bacteria 187999
405 Ga0207696_1004919 3300025711 Bacteria 5655
406 Ga0207696_1012298 3300025711 Bacteria 3031
407 Ga0207696_1012432 3300025711 Bacteria 3009
408 Ga0207696_1020971 3300025711 Bacteria 2098
409 Ga0207696_1029363 3300025711 Bacteria 1680
410 Ga0207696_1035654 3300025711 Bacteria 1480
411 Ga0207696_1043445 3300025711 Bacteria 1306
412 Ga0207655_1000006 3300025728 Bacteria 861092
413 Ga0207655_1000081 3300025728 Bacteria 214272
414 Ga0207655_1000118 3300025728 Bacteria 159617
415 Ga0207655_1000169 3300025728 Bacteria 119331
416 Ga0207655_1000180 3300025728 Bacteria 112767
417 Ga0207655_1000438 3300025728 Bacteria 55557
418 Ga0207655_1000905 3300025728 Bacteria 30964
419 Ga0207655_1004687 3300025728 Bacteria 9583
420 Ga0207655_1007309 3300025728 Bacteria 7179
421 Ga0207655_1017319 3300025728 Bacteria 3892
422 Ga0207655_1021413 3300025728 Bacteria 3282
423 Ga0207655_1021464 3300025728 Bacteria 3278
424 Ga0207655_1028561 3300025728 Bacteria 2629
425 Ga0207655_1046160 3300025728 Bacteria 1812
426 Ga0207655_1087567 3300025728 Bacteria 1105
427 Ga0207655_1100278 3300025728 Bacteria 999
428 Ga0207713_1000071 3300025735 Bacteria 186255
429 Ga0207713_1000107 3300025735 Bacteria 137841
430 Ga0207713_1000348 3300025735 Bacteria 50677
431 Ga0207713_1000668 3300025735 Bacteria 32600
432 Ga0207713_1001525 3300025735 Bacteria 18242
433 Ga0207713_1002582 3300025735 Bacteria 13079
434 Ga0207713_1002782 3300025735 Bacteria 12357
435 Ga0207713_1007142 3300025735 Bacteria 6667
436 Ga0207713_1010455 3300025735 Bacteria 5133
437 Ga0207713_1011683 3300025735 Bacteria 4752
438 Ga0207713_1023710 3300025735 Bacteria 2880
439 Ga0207713_1024231 3300025735 Bacteria 2835
440 Ga0207713_1046780 3300025735 Bacteria 1757
441 Ga0207713_1050192 3300025735 Bacteria 1667
442 Ga0207682_10046615 3300025893 Bacteria 1782
443 Ga0207680_10000002 3300025903 Bacteria 1018646
444 Ga0207647_10024046 3300025904 Bacteria 4020
445 Ga0207645_10000608 3300025907 Bacteria 29643
446 Ga0207643_10073347 3300025908 Bacteria 1973
447 Ga0207705_10004525 3300025909 Bacteria 10505
448 Ga0207707_10110341 3300025912 Bacteria 2404
449 Ga0207695_10000368 3300025913 Bacteria 103176
450 Ga0207695_10000422 3300025913 Bacteria 93814
451 Ga0207695_10000699 3300025913 Bacteria 65747
452 Ga0207695_10002935 3300025913 Bacteria 24608
453 Ga0207695_10043283 3300025913 Bacteria 4800
454 Ga0207671_10000604 3300025914 Bacteria 47638
455 Ga0207671_10116181 3300025914 Bacteria 2041
456 Ga0207657_10000390 3300025919 Bacteria 46278
457 Ga0207657_10063844 3300025919 Bacteria 3146
458 Ga0207649_10000030 3300025920 Bacteria 154458
459 Ga0207649_10000639 3300025920 Bacteria 23386
460 Ga0207649_10076740 3300025920 Bacteria 2151
461 Ga0207649_10160463 3300025920 Bacteria 1557
462 Ga0207652_10167369 3300025921 Bacteria 1971
463 Ga0207646_10443141 3300025922 Bacteria 1172
464 Ga0207681_10122042 3300025923 Bacteria 1912
465 Ga0207681_10248234 3300025923 Bacteria 1388
466 Ga0207694_10000237 3300025924 Bacteria 52878
467 Ga0207694_10074889 3300025924 Bacteria 2649
468 Ga0207650_10000248 3300025925 Bacteria 58658
469 Ga0207650_10001620 3300025925 Bacteria 16061
470 Ga0207650_10035921 3300025925 Bacteria 3602
471 Ga0207659_10058526 3300025926 Bacteria 2766
472 Ga0207664_10095236 3300025929 Bacteria 2449
473 Ga0207664_10546531 3300025929 Bacteria 1039
474 Ga0207690_10000037 3300025932 Bacteria 142658
475 Ga0207690_10002224 3300025932 Bacteria 11831
476 Ga0207706_10005132 3300025933 Bacteria 12222
477 Ga0207706_10148059 3300025933 Bacteria 2065
478 Ga0207686_10007977 3300025934 Bacteria 5709
479 Ga0207709_10000001 3300025935 Bacteria 2228154
480 Ga0207709_10000014 3300025935 Bacteria 526302
481 Ga0207709_10003799 3300025935 Bacteria 8866
482 Ga0207709_10099027 3300025935 Bacteria 1923
483 Ga0207670_10004252 3300025936 Bacteria 7684
484 Ga0207669_10012471 3300025937 Bacteria 4181
485 Ga0207704_10068548 3300025938 Bacteria 2237
486 Ga0207691_10033938 3300025940 Bacteria 4750
487 Ga0207679_10000004 3300025945 Bacteria 589021
488 Ga0207679_10000021 3300025945 Bacteria 221630
489 Ga0207667_10010980 3300025949 Bacteria 10553
490 Ga0207651_10285024 3300025960 Bacteria 1367
491 Ga0207712_10232989 3300025961 Bacteria 1479
492 Ga0207668_10113561 3300025972 Bacteria 2037
493 Ga0207668_10428251 3300025972 Bacteria 1124
494 Ga0207640_10000066 3300025981 Bacteria 86479
495 Ga0207658_10027816 3300025986 Bacteria 3977
496 Ga0207677_10048554 3300026023 Bacteria 2859
497 Ga0207678_10000006 3300026067 Bacteria 188733
498 Ga0207678_10000620 3300026067 Bacteria 32501
499 Ga0207678_10079080 3300026067 Bacteria 2816
500 Ga0207702_10000206 3300026078 Bacteria 70068
501 Ga0207702_10313941 3300026078 Bacteria 1491
502 Ga0207641_10091737 3300026088 Bacteria 2659
503 Ga0207648_10261507 3300026089 Bacteria 1544
504 Ga0207648_10281850 3300026089 Bacteria 1486
505 Ga0207674_10027534 3300026116 Bacteria 6011
506 Ga0207675_100005199 3300026118 Bacteria 12529
507 Ga0207683_10500914 3300026121 Bacteria 1122
508 Ga0207698_10117627 3300026142 Bacteria 2243
509 Ga0209281_1000009 3300027111 Bacteria 771717
510 Ga0209281_1000063 3300027111 Bacteria 288465
511 Ga0209281_1009821 3300027111 Bacteria 2224
512 Ga0209389_1000030 3300027296 Bacteria 139329
513 Ga0209371_1000008 3300027312 Bacteria 1024606
514 Ga0209371_1000080 3300027312 Bacteria 185771
515 Ga0209371_1000648 3300027312 Bacteria 30465
516 Ga0209371_1000987 3300027312 Bacteria 21893
517 Ga0209981_1015241 3300027378 Bacteria 1076
518 Ga0209984_1009884 3300027424 Bacteria 1217
519 Ga0210000_1023212 3300027462 Bacteria 954
520 Ga0209982_1010569 3300027552 Bacteria 1368
521 Ga0210002_1000967 3300027617 Bacteria 3966
522 Ga0209983_1000166 3300027665 Bacteria 12416
523 Ga0209983_1025614 3300027665 Bacteria 1245
524 Ga0209282_1020026 3300027666 Bacteria 4240
525 Ga0209974_10016587 3300027876 Bacteria 2445
526 Ga0207428_10008088 3300027907 Bacteria 9537
527 Ga0207428_10011066 3300027907 Bacteria 8015
528 Ga0207428_10016200 3300027907 Bacteria 6417
529 Ga0207428_10032793 3300027907 Bacteria 4272
530 Ga0207428_10038833 3300027907 Bacteria 3868
531 Ga0207428_10128151 3300027907 Bacteria 1943
532 Ga0207428_10291326 3300027907 Bacteria 1210
533 Ga0268266_10000004 3300028379 Bacteria 1495817
534 Ga0268266_10048303 3300028379 Bacteria 3648
535 Ga0268266_10067515 3300028379 Bacteria 3095
536 Ga0268264_10070533 3300028381 Bacteria 2958
537 Ga0268264_10341899 3300028381 Bacteria 1422
538 Ga0307517_10088658 3300028786 Bacteria 2555
539 Ga0268256_1000009 3300030500 Bacteria 1022625
540 Ga0268256_1000336 3300030500 Bacteria 46023
541 Ga0268256_1000554 3300030500 Bacteria 30465
542 Ga0268256_1000937 3300030500 Bacteria 20042
543 Ga0307511_10043985 3300030521 Bacteria 3719
544 Ga0307511_10149906 3300030521 Bacteria 1342
545 Ga0316177_1205272 3300030731 Bacteria 1469
546 Ga0316178_1064394 3300030735 Bacteria 7969
547 Ga0316183_1196296 3300030742 Bacteria 4192
548 Ga0265316_10000115 3300031344 Bacteria 86934
549 Ga0307513_10416043 3300031456 Bacteria 1075
550 Ga0307509_10113887 3300031507 Bacteria 2701
551 Ga0307408_100000004 3300031548 Bacteria 572889
552 Ga0316576_10006727 3300031727 Bacteria 7185
553 Ga0316576_10163453 3300031727 Bacteria 1679
554 Ga0316576_10280582 3300031727 Bacteria 1247
555 Ga0316576_10280606 3300031727 Bacteria 1247
556 Ga0316578_10017237 3300031728 Bacteria 3928
557 Ga0316577_10015732 3300031733 Bacteria 4163
558 Ga0307413_10048852 3300031824 Bacteria 2532
559 Ga0307413_10184566 3300031824 Bacteria 1491
560 Ga0307413_10296524 3300031824 Bacteria 1224
561 Ga0307412_10095497 3300031911 Bacteria 2090
562 Ga0307409_100213872 3300031995 Bacteria 1735
563 Ga0307409_100233180 3300031995 Bacteria 1670
564 Ga0307409_100758865 3300031995 Bacteria 974
565 Ga0307414_10013367 3300032004 Bacteria 4885
566 Ga0307414_10079658 3300032004 Bacteria 2392
567 Ga0307414_10152001 3300032004 Bacteria 1827
568 Ga0307510_10000690 3300033180 Bacteria 34549
569 Ga0307510_10027986 3300033180 Bacteria 6445
570 Ga0307510_10072696 3300033180 Bacteria 3415
571 Ga0307510_10171312 3300033180 Bacteria 1749
572 Ga0316574_0003503 3300035398 Bacteria 8101
573 Ga0316574_0046219 3300035398 Bacteria 2699
574 Ga0373927_0005765 3300035695 Bacteria 8501
575 Ga0373927_0016180 3300035695 Bacteria 4922
576 Ga0316584_0029326 3300036712 Bacteria 4061
577 Ga0395899_0003484 3300037312 Bacteria 12465
578 Ga0395900_0000375 3300037418 Bacteria 64534
579 Ga0395900_0035249 3300037418 Bacteria 5154
580 Ga0395900_0274434 3300037418 Bacteria 1680
581 Ga0395898_0000629 3300037466 Bacteria 64534
582 Ga0395905_0000057 3300037471 Bacteria 203452
583 Ga0395905_0000361 3300037471 Bacteria 64517
584 Ga0395905_0011731 3300037471 Bacteria 8460
585 Ga0395901_0000273 3300038443 Bacteria 64425
586 Ga0395901_0113177 3300038443 Bacteria 2850
587 Ga0436365_1320010 3300039437 Bacteria 1316
588 Ga0436360_0164946 3300039438 Bacteria 1198
589 Ga0439436_0000106 3300041404 Bacteria 19535
590 Ga0439438_001974 3300041405 Bacteria 8961
591 Ga0439438_004830 3300041405 Bacteria 5079
592 Ga0439438_024782 3300041405 Bacteria 1640
593 Ga0439447_000525 3300041407 Bacteria 14186
594 Ga0439447_001903 3300041407 Bacteria 7644
595 Ga0439447_003996 3300041407 Bacteria 5159
596 Ga0439447_023578 3300041407 Bacteria 1601
597 Ga0439466_0000300 3300041411 Bacteria 19150
598 Ga0451791_0841832 3300041451 Bacteria 1073
599 Ga0451793_1469259 3300041452 Bacteria 1205
600 Ga0451807_0076174 3300041486 Bacteria 6188
601 Ga0451853_0125673 3300041512 Bacteria 1365
602 Ga0439437_000014 3300042000 Bacteria 17570
603 Ga0439448_0034522 3300042005 Bacteria 1617
604 Ga0439432_000827 3300042006 Bacteria 11540
605 Ga0439432_001518 3300042006 Bacteria 8720
606 Ga0439432_015687 3300042006 Bacteria 2554
607 Ga0439432_048533 3300042006 Bacteria 1329
608 Ga0439452_000111 3300042010 Bacteria 65396
609 Ga0439452_000746 3300042010 Bacteria 15587
610 Ga0439452_000965 3300042010 Bacteria 12923
611 Ga0439452_001703 3300042010 Bacteria 8650
612 Ga0439452_003775 3300042010 Bacteria 5212
613 Ga0439456_000056 3300042013 Bacteria 41897
614 Ga0439456_001125 3300042013 Bacteria 5286
615 Ga0439456_008397 3300042013 Bacteria 2131
616 Ga0439463_001085 3300042016 Bacteria 7348
617 Ga0439463_001174 3300042016 Bacteria 6995
618 Ga0439463_006427 3300042016 Bacteria 2915
619 Ga0450911_000031 3300042115 Bacteria 75252
620 Ga0450911_001025 3300042115 Bacteria 7118
621 Ga0450911_002258 3300042115 Bacteria 3869
622 Ga0450914_000846 3300042118 Bacteria 1682
623 Ga0450902_000106 3300042137 Bacteria 8586
624 Ga0450904_000050 3300042139 Bacteria 27147
625 Ga0450905_006341 3300042142 Bacteria 1599
626 Ga0450906_000469 3300042145 Bacteria 8478
627 Ga0450906_001776 3300042145 Bacteria 4727
628 Ga0450907_000230 3300042146 Bacteria 19540
629 Ga0450907_000552 3300042146 Bacteria 10181
630 Ga0439446_0002938 3300042156 Bacteria 4163
631 Ga0450908_016309 3300042184 Bacteria 1325
632 Ga0450909_000726 3300042185 Bacteria 4439
633 Ga0439464_0004397 3300042439 Bacteria 3606
634 Ga0451577_0006876 3300042876 Bacteria 11253
635 Ga0451577_0082230 3300042876 Bacteria 2872
636 Ga0451577_0416651 3300042876 Bacteria 1219
637 Ga0466969_0008517 3300044656 Bacteria 5444
638 Ga0466972_0025380 3300044658 Bacteria 2938
639 Ga0466972_0036572 3300044658 Bacteria 2401
640 Ga0466978_0067892 3300044671 Bacteria 2224
641 Ga0453683_0001494 3300044673 Bacteria 20028
642 Ga0453683_0017633 3300044673 Bacteria 4596
643 Ga0466965_0008290 3300044683 Bacteria 4803
644 Ga0466966_0324427 3300044684 Bacteria 925
645 Ga0466961_0000452 3300044693 Bacteria 26070
646 Ga0466964_0018702 3300044706 Bacteria 2660
647 Ga0453684_0025585 3300044712 Bacteria 8564
648 Ga0453684_0234247 3300044712 Bacteria 2117
649 Ga0466968_0002968 3300044735 Bacteria 6267
650 Ga0466970_0004146 3300044765 Bacteria 7129
651 Ga0466957_0170456 3300044842 Bacteria 1417
652 Ga0466959_0014519 3300045049 Bacteria 5727
653 Ga0466959_0146698 3300045049 Bacteria 1664
654 Ga0451576_0022215 3300045051 Bacteria 6883
655 Ga0451576_0038910 3300045051 Bacteria 5034
656 Ga0451576_0045380 3300045051 Bacteria 4629
657 Ga0466967_0024390 3300045976 Bacteria 4972
658 Ga0466967_0208356 3300045976 Bacteria 1853
659 Ga0495617_000229 3300046452 Bacteria 34030
660 Ga0495617_000375 3300046452 Bacteria 24753
661 Ga0495617_004404 3300046452 Bacteria 5130
662 Ga0495617_024238 3300046452 Bacteria 2048
663 Ga0495627_000010 3300046453 Bacteria 381168
664 Ga0495627_000349 3300046453 Bacteria 43540
665 Ga0495627_000726 3300046453 Bacteria 24918
666 Ga0495627_001494 3300046453 Bacteria 13525
667 Ga0495627_001955 3300046453 Bacteria 10675
668 Ga0495627_006251 3300046453 Bacteria 4684
669 Ga0495627_013710 3300046453 Bacteria 2848
670 Ga0495627_015638 3300046453 Bacteria 2614
671 Ga0495592_0016909 3300046454 Bacteria 5538
672 Ga0495592_0040008 3300046454 Bacteria 3519
673 Ga0495603_0032999 3300046455 Bacteria 3115
674 Ga0495603_0036845 3300046455 Bacteria 2935
675 Ga0495603_0082235 3300046455 Bacteria 1886
676 Ga0495590_0004974 3300046457 Bacteria 5305
677 Ga0495590_0006739 3300046457 Bacteria 4466
678 Ga0495590_0143957 3300046457 Bacteria 861
679 Ga0495591_000002 3300046458 Bacteria 455013
680 Ga0495591_000552 3300046458 Bacteria 28749
681 Ga0495591_000716 3300046458 Bacteria 24079
682 Ga0495591_001132 3300046458 Bacteria 17598
683 Ga0495591_001302 3300046458 Bacteria 15784
684 Ga0495591_001713 3300046458 Bacteria 13084
685 Ga0495591_003220 3300046458 Bacteria 8590
686 Ga0495591_003419 3300046458 Bacteria 8217
687 Ga0495591_005256 3300046458 Bacteria 6046
688 Ga0495591_016746 3300046458 Bacteria 2538
689 Ga0495591_020183 3300046458 Bacteria 2207
690 Ga0495591_062398 3300046458 Bacteria 986
691 Ga0495629_0027963 3300046459 Bacteria 4005
692 Ga0495638_0000082 3300046460 Bacteria 153986
693 Ga0495638_0000104 3300046460 Bacteria 135059
694 Ga0495638_0001346 3300046460 Bacteria 22542
695 Ga0495638_0003851 3300046460 Bacteria 11653
696 Ga0495638_0007301 3300046460 Bacteria 7943
697 Ga0495638_0022636 3300046460 Bacteria 4123
698 Ga0495638_0032471 3300046460 Bacteria 3346
699 Ga0495638_0059842 3300046460 Bacteria 2357
700 Ga0495638_0064539 3300046460 Bacteria 2255
701 Ga0495638_0157314 3300046460 Bacteria 1313
702 Ga0495651_0011284 3300046462 Bacteria 6868
703 Ga0495653_0000286 3300046463 Bacteria 40964
704 Ga0495653_0007198 3300046463 Bacteria 9117
705 Ga0495653_0008489 3300046463 Bacteria 8422
706 Ga0495653_0030419 3300046463 Bacteria 4301
707 Ga0495653_0036906 3300046463 Bacteria 3845
708 Ga0495653_0121827 3300046463 Bacteria 1857
709 Ga0495650_0000253 3300046471 Bacteria 104338
710 Ga0495650_0000308 3300046471 Bacteria 88853
711 Ga0495650_0000443 3300046471 Bacteria 66631
712 Ga0495650_0004320 3300046471 Bacteria 9801
713 Ga0495650_0005314 3300046471 Bacteria 8417
714 Ga0495650_0007802 3300046471 Bacteria 6364
715 Ga0495650_0009372 3300046471 Bacteria 5574
716 Ga0495650_0023541 3300046471 Bacteria 2929
717 Ga0495650_0023911 3300046471 Bacteria 2897
718 Ga0495650_0047827 3300046471 Bacteria 1786
719 Ga0495580_0037064 3300046472 Bacteria 3501
720 Ga0495580_0086639 3300046472 Bacteria 2181
721 Ga0495582_0017768 3300046473 Bacteria 3887
722 Ga0495605_0000002 3300046474 Bacteria 522417
723 Ga0495605_0000200 3300046474 Bacteria 73721
724 Ga0495605_0000566 3300046474 Bacteria 30114
725 Ga0495605_0001105 3300046474 Bacteria 17966
726 Ga0495605_0006139 3300046474 Bacteria 6929
727 Ga0495605_0013008 3300046474 Bacteria 4600
728 Ga0495605_0015511 3300046474 Bacteria 4140
729 Ga0495605_0025554 3300046474 Bacteria 3076
730 Ga0495605_0044991 3300046474 Bacteria 2178
731 Ga0495639_0000046 3300046475 Bacteria 54327
732 Ga0495662_0037440 3300046476 Bacteria 2343
733 Ga0495584_0001071 3300046491 Bacteria 16991
734 Ga0495584_0001367 3300046491 Bacteria 14741
735 Ga0495584_0003878 3300046491 Bacteria 8104
736 Ga0495584_0011160 3300046491 Bacteria 4605
737 Ga0495584_0023129 3300046491 Bacteria 3151
738 Ga0495584_0062819 3300046491 Bacteria 1866
739 Ga0495584_0094078 3300046491 Bacteria 1512
740 Ga0495585_0001725 3300046492 Bacteria 16655
741 Ga0495585_0003977 3300046492 Bacteria 9753
742 Ga0495585_0004411 3300046492 Bacteria 9128
743 Ga0495585_0005258 3300046492 Bacteria 8187
744 Ga0495585_0009917 3300046492 Bacteria 5690
745 Ga0495585_0010681 3300046492 Bacteria 5454
746 Ga0495585_0013111 3300046492 Bacteria 4859
747 Ga0495585_0043151 3300046492 Bacteria 2523
748 Ga0495585_0049073 3300046492 Bacteria 2345
749 Ga0495585_0064229 3300046492 Bacteria 2013
750 Ga0495585_0232308 3300046492 Bacteria 926
751 Ga0495594_0004046 3300046499 Bacteria 7540
752 Ga0495594_0016851 3300046499 Bacteria 3854
753 Ga0495596_0001239 3300046500 Bacteria 14850
754 Ga0495596_0001407 3300046500 Bacteria 13802
755 Ga0495596_0029160 3300046500 Bacteria 2213
756 Ga0495607_0000118 3300046501 Bacteria 83429
757 Ga0495607_0000126 3300046501 Bacteria 80886
758 Ga0495607_0000258 3300046501 Bacteria 56810
759 Ga0495607_0000667 3300046501 Bacteria 33255
760 Ga0495607_0000863 3300046501 Bacteria 28384
761 Ga0495607_0001252 3300046501 Bacteria 22751
762 Ga0495607_0002334 3300046501 Bacteria 15530
763 Ga0495607_0003109 3300046501 Bacteria 12889
764 Ga0495607_0005159 3300046501 Bacteria 9428
765 Ga0495607_0017338 3300046501 Bacteria 4624
766 Ga0495607_0019022 3300046501 Bacteria 4366
767 Ga0495607_0020688 3300046501 Bacteria 4153
768 Ga0495607_0036674 3300046501 Bacteria 2951
769 Ga0495607_0108636 3300046501 Bacteria 1473
770 Ga0495607_0142011 3300046501 Bacteria 1237
771 Ga0495583_0000211 3300046506 Bacteria 98257
772 Ga0495583_0000522 3300046506 Bacteria 54517
773 Ga0495583_0001552 3300046506 Bacteria 22749
774 Ga0495583_0001557 3300046506 Bacteria 22698
775 Ga0495583_0003333 3300046506 Bacteria 12422
776 Ga0495583_0032104 3300046506 Bacteria 2537
777 Ga0495606_0000028 3300046507 Bacteria 251032
778 Ga0495606_0000113 3300046507 Bacteria 136805
779 Ga0495606_0001112 3300046507 Bacteria 38418
780 Ga0495606_0002242 3300046507 Bacteria 23003
781 Ga0495606_0002270 3300046507 Bacteria 22760
782 Ga0495606_0004017 3300046507 Bacteria 15010
783 Ga0495606_0007618 3300046507 Bacteria 9624
784 Ga0495606_0019668 3300046507 Bacteria 5011
785 Ga0495606_0020238 3300046507 Bacteria 4915
786 Ga0495606_0030772 3300046507 Bacteria 3742
787 Ga0495606_0043564 3300046507 Bacteria 2991
788 Ga0495606_0076229 3300046507 Bacteria 2096
789 Ga0495606_0122544 3300046507 Bacteria 1554
790 Ga0495606_0209619 3300046507 Bacteria 1104
791 Ga0495608_0009640 3300046511 Bacteria 6738
792 Ga0495608_0016255 3300046511 Bacteria 5147
793 Ga0495610_0001319 3300046512 Bacteria 22040
794 Ga0495610_0004838 3300046512 Bacteria 9810
795 Ga0495610_0006567 3300046512 Bacteria 7960
796 Ga0495610_0009489 3300046512 Bacteria 6146
797 Ga0495610_0023193 3300046512 Bacteria 3378
798 Ga0495610_0024089 3300046512 Bacteria 3290
799 Ga0495610_0031470 3300046512 Bacteria 2767
800 Ga0495610_0033156 3300046512 Bacteria 2673
801 Ga0495610_0048220 3300046512 Bacteria 2092
802 Ga0495610_0125203 3300046512 Bacteria 1121
803 Ga0495616_0000857 3300046513 Bacteria 22149
804 Ga0495616_0003179 3300046513 Bacteria 10597
805 Ga0495616_0004131 3300046513 Bacteria 9203
806 Ga0495616_0006210 3300046513 Bacteria 7262
807 Ga0495616_0016223 3300046513 Bacteria 4125
808 Ga0495616_0016324 3300046513 Bacteria 4113
809 Ga0495616_0032625 3300046513 Bacteria 2718
810 Ga0495616_0042372 3300046513 Bacteria 2317
811 Ga0495616_0043723 3300046513 Bacteria 2274
812 Ga0495616_0066626 3300046513 Bacteria 1751
813 Ga0495616_0090913 3300046513 Bacteria 1445
814 Ga0495616_0177100 3300046513 Bacteria 950
815 Ga0495618_0033456 3300046514 Bacteria 3223
816 Ga0495618_0093572 3300046514 Bacteria 1922
817 Ga0495618_0172499 3300046514 Bacteria 1376
818 Ga0495620_0000037 3300046515 Bacteria 114491
819 Ga0495620_0000159 3300046515 Bacteria 54696
820 Ga0495620_0000286 3300046515 Bacteria 36451
821 Ga0495620_0002349 3300046515 Bacteria 10970
822 Ga0495620_0003981 3300046515 Bacteria 8397
823 Ga0495620_0011932 3300046515 Bacteria 4513
824 Ga0495620_0033675 3300046515 Bacteria 2323
825 Ga0495620_0053522 3300046515 Bacteria 1708
826 Ga0495628_0000554 3300046516 Bacteria 34331
827 Ga0495628_0266441 3300046516 Bacteria 1275
828 Ga0495630_0035043 3300046517 Bacteria 3750
829 Ga0495630_0066785 3300046517 Bacteria 2704
830 Ga0495630_0084314 3300046517 Bacteria 2399
831 Ga0495631_0000659 3300046518 Bacteria 22313
832 Ga0495631_0001210 3300046518 Bacteria 15922
833 Ga0495631_0001434 3300046518 Bacteria 14488
834 Ga0495631_0016452 3300046518 Bacteria 3525
835 Ga0495631_0024924 3300046518 Bacteria 2758
836 Ga0495632_0000376 3300046519 Bacteria 42540
837 Ga0495632_0001014 3300046519 Bacteria 24330
838 Ga0495632_0001667 3300046519 Bacteria 18191
839 Ga0495632_0002534 3300046519 Bacteria 13844
840 Ga0495632_0002865 3300046519 Bacteria 12726
841 Ga0495632_0003761 3300046519 Bacteria 10608
842 Ga0495632_0012555 3300046519 Bacteria 4880
843 Ga0495632_0013838 3300046519 Bacteria 4586
844 Ga0495632_0029997 3300046519 Bacteria 2826
845 Ga0495632_0031234 3300046519 Bacteria 2755
846 Ga0495632_0061828 3300046519 Bacteria 1816
847 Ga0495637_0000070 3300046520 Bacteria 83331
848 Ga0495637_0000480 3300046520 Bacteria 29118
849 Ga0495637_0001066 3300046520 Bacteria 17105
850 Ga0495637_0001438 3300046520 Bacteria 14039
851 Ga0495637_0002500 3300046520 Bacteria 10149
852 Ga0495637_0008240 3300046520 Bacteria 5124
853 Ga0495637_0029929 3300046520 Bacteria 2419
854 Ga0495637_0030627 3300046520 Bacteria 2385
855 Ga0495637_0041938 3300046520 Bacteria 1960
856 Ga0495637_0050288 3300046520 Bacteria 1748
857 Ga0495637_0053228 3300046520 Bacteria 1685
858 Ga0495637_0098048 3300046520 Bacteria 1149
859 Ga0495643_0000508 3300046522 Bacteria 48532
860 Ga0495643_0000775 3300046522 Bacteria 35686
861 Ga0495643_0002114 3300046522 Bacteria 16408
862 Ga0495643_0002267 3300046522 Bacteria 15552
863 Ga0495643_0011762 3300046522 Bacteria 5309
864 Ga0495643_0034725 3300046522 Bacteria 2780
865 Ga0495643_0043335 3300046522 Bacteria 2449
866 Ga0495644_0001961 3300046523 Bacteria 8261
867 Ga0495644_0003535 3300046523 Bacteria 6178
868 Ga0495644_0084409 3300046523 Bacteria 1197
869 Ga0495648_0000585 3300046524 Bacteria 39042
870 Ga0495648_0002364 3300046524 Bacteria 17532
871 Ga0495648_0006757 3300046524 Bacteria 9276
872 Ga0495648_0008005 3300046524 Bacteria 8381
873 Ga0495648_0018080 3300046524 Bacteria 5011
874 Ga0495648_0026956 3300046524 Bacteria 3856
875 Ga0495648_0033316 3300046524 Bacteria 3365
876 Ga0495648_0050715 3300046524 Bacteria 2533
877 Ga0495648_0078512 3300046524 Bacteria 1887
878 Ga0495648_0105556 3300046524 Bacteria 1544
879 Ga0495648_0118737 3300046524 Bacteria 1425
880 Ga0495648_0127264 3300046524 Bacteria 1359
881 Ga0495663_0001381 3300046525 Bacteria 7655
882 Ga0495663_0013124 3300046525 Bacteria 2315
883 Ga0495666_0001988 3300046526 Bacteria 10095
884 Ga0495666_0153601 3300046526 Bacteria 1069
885 Ga0495642_0000719 3300046528 Bacteria 16465
886 Ga0495642_0001818 3300046528 Bacteria 9133
887 Ga0495652_0005628 3300046529 Bacteria 11737
888 Ga0495652_0023066 3300046529 Bacteria 5518
889 Ga0495652_0106278 3300046529 Bacteria 2267
890 Ga0495654_0000460 3300046530 Bacteria 34082
891 Ga0495654_0000878 3300046530 Bacteria 22561
892 Ga0495654_0001059 3300046530 Bacteria 20156
893 Ga0495654_0001481 3300046530 Bacteria 16083
894 Ga0495654_0002512 3300046530 Bacteria 11790
895 Ga0495654_0004342 3300046530 Bacteria 8442
896 Ga0495654_0006554 3300046530 Bacteria 6596
897 Ga0495654_0011185 3300046530 Bacteria 4870
898 Ga0495654_0014457 3300046530 Bacteria 4201
899 Ga0495654_0023396 3300046530 Bacteria 3200
900 Ga0495654_0037069 3300046530 Bacteria 2448
901 Ga0495654_0066281 3300046530 Bacteria 1721
902 Ga0495654_0077797 3300046530 Bacteria 1560
903 Ga0495654_0106438 3300046530 Bacteria 1284
904 Ga0495654_0139064 3300046530 Bacteria 1084
905 Ga0495665_0000097 3300046531 Bacteria 40415
906 Ga0495665_0053844 3300046531 Bacteria 2127
907 Ga0495586_0016517 3300046535 Bacteria 3926
908 Ga0495587_0003103 3300046536 Bacteria 11107
909 Ga0495587_0026423 3300046536 Bacteria 3541
910 Ga0495609_0000018 3300046538 Bacteria 302609
911 Ga0495609_0000027 3300046538 Bacteria 234661
912 Ga0495609_0000203 3300046538 Bacteria 59251
913 Ga0495609_0005152 3300046538 Bacteria 6957
914 Ga0495609_0012822 3300046538 Bacteria 3969
915 Ga0495609_0047131 3300046538 Bacteria 1929
916 Ga0495609_0080469 3300046538 Bacteria 1424
917 Ga0495609_0127798 3300046538 Bacteria 1090
918 Ga0495597_0000011 3300046542 Bacteria 221377
919 Ga0495597_0002435 3300046542 Bacteria 11805
920 Ga0495597_0004978 3300046542 Bacteria 7134
921 Ga0495597_0005427 3300046542 Bacteria 6748
922 Ga0495597_0007525 3300046542 Bacteria 5524
923 Ga0495597_0057326 3300046542 Bacteria 1704
924 Ga0495645_0017273 3300046543 Bacteria 5168
925 Ga0495645_0039510 3300046543 Bacteria 3441
926 Ga0495645_0043938 3300046543 Bacteria 3259
927 Ga0495645_0098163 3300046543 Bacteria 2085
928 Ga0495622_0000933 3300046557 Bacteria 15792
929 Ga0495622_0001271 3300046557 Bacteria 12952
930 Ga0495622_0004847 3300046557 Bacteria 6231
931 Ga0495633_0000590 3300046558 Bacteria 35117
932 Ga0495633_0001470 3300046558 Bacteria 18275
933 Ga0495633_0007695 3300046558 Bacteria 6165
934 Ga0495633_0019796 3300046558 Bacteria 3397
935 Ga0495656_0118511 3300046615 Bacteria 1246
936 Ga0495668_0002608 3300046616 Bacteria 14577
937 Ga0495668_0016845 3300046616 Bacteria 4245
938 Ga0495668_0129995 3300046616 Bacteria 1378
939 Ga0495634_0011631 3300046642 Bacteria 6401
940 Ga0495634_0079201 3300046642 Bacteria 2152
941 Ga0495611_0000085 3300046648 Bacteria 66763
942 Ga0495611_0001385 3300046648 Bacteria 12131
943 Ga0495611_0001392 3300046648 Bacteria 12111
944 Ga0495611_0133755 3300046648 Bacteria 1157
945 Ga0495611_0136983 3300046648 Bacteria 1143
946 Ga0495625_0000302 3300046660 Bacteria 76059
947 Ga0495625_0004976 3300046660 Bacteria 12343
948 Ga0495625_0008154 3300046660 Bacteria 8971
949 Ga0495625_0010749 3300046660 Bacteria 7535
950 Ga0495625_0012686 3300046660 Bacteria 6815
951 Ga0495625_0027715 3300046660 Bacteria 4257
952 Ga0495625_0031341 3300046660 Bacteria 3957
953 Ga0495625_0058975 3300046660 Bacteria 2725
954 Ga0495625_0137755 3300046660 Bacteria 1648
955 Ga0495625_0177299 3300046660 Bacteria 1419
956 Ga0495625_0264960 3300046660 Bacteria 1111
957 Ga0495635_0010398 3300046663 Bacteria 6509
958 Ga0495635_0037815 3300046663 Bacteria 3341
959 Ga0495635_0144878 3300046663 Bacteria 1617
960 Ga0495659_0000102 3300046664 Bacteria 37943
961 Ga0495659_0006217 3300046664 Bacteria 3775
962 Ga0495661_0000039 3300046665 Bacteria 153539
963 Ga0495661_0000056 3300046665 Bacteria 138115
964 Ga0495661_0000136 3300046665 Bacteria 86706
965 Ga0495661_0000250 3300046665 Bacteria 61854
966 Ga0495661_0001455 3300046665 Bacteria 19817
967 Ga0495661_0002686 3300046665 Bacteria 13566
968 Ga0495661_0005867 3300046665 Bacteria 8677
969 Ga0495661_0036160 3300046665 Bacteria 3094
970 Ga0495661_0094241 3300046665 Bacteria 1697
971 Ga0495599_0059176 3300046678 Bacteria 2396
972 Ga0495599_0278112 3300046678 Bacteria 1014
973 Ga0495623_0029755 3300046679 Bacteria 3514
974 Ga0495623_0107512 3300046679 Bacteria 1694
975 Ga0495623_0110046 3300046679 Bacteria 1670
976 Ga0495646_0005191 3300046680 Bacteria 8215
977 Ga0495646_0012415 3300046680 Bacteria 5415
978 Ga0495646_0015969 3300046680 Bacteria 4765
979 Ga0495646_0056540 3300046680 Bacteria 2352
980 Ga0495646_0210352 3300046680 Bacteria 1055
981 Ga0495669_0026790 3300046684 Bacteria 2519
982 Ga0495624_0005176 3300046690 Bacteria 9424
983 Ga0495624_0005850 3300046690 Bacteria 8795
984 Ga0495624_0015579 3300046690 Bacteria 5130
985 Ga0495670_0005401 3300046691 Bacteria 6276
986 Ga0495670_0015335 3300046691 Bacteria 3767
987 Ga0495670_0045191 3300046691 Bacteria 2199
988 Ga0495670_0058006 3300046691 Bacteria 1943
989 Ga0495671_0000395 3300046692 Bacteria 35847
990 Ga0495671_0001434 3300046692 Bacteria 16010
991 Ga0495671_0001650 3300046692 Bacteria 14609
992 Ga0495671_0006375 3300046692 Bacteria 6818
993 Ga0495671_0012741 3300046692 Bacteria 4581
994 Ga0495671_0015534 3300046692 Bacteria 4078
995 Ga0495671_0022009 3300046692 Bacteria 3343
996 Ga0495671_0028077 3300046692 Bacteria 2901
997 Ga0495671_0034964 3300046692 Bacteria 2553
998 Ga0495671_0105040 3300046692 Bacteria 1379
999 Ga0495671_0112015 3300046692 Bacteria 1332
1000 Ga0495671_0122298 3300046692 Bacteria 1269
1001 Ga0495649_0000421 3300046694 Bacteria 36857
1002 Ga0495649_0000605 3300046694 Bacteria 29893
1003 Ga0495649_0001939 3300046694 Bacteria 15062
1004 Ga0495649_0002337 3300046694 Bacteria 13423
1005 Ga0495649_0006156 3300046694 Bacteria 7497
1006 Ga0495649_0010341 3300046694 Bacteria 5510
1007 Ga0495649_0018580 3300046694 Bacteria 3909
1008 Ga0495649_0020926 3300046694 Bacteria 3666
1009 Ga0495649_0128334 3300046694 Bacteria 1339
1010 Ga0495649_0159551 3300046694 Bacteria 1182
1011 Ga0495649_0230731 3300046694 Bacteria 955
1012 Ga0495649_0234795 3300046694 Bacteria 945
1013 Ga0495649_0247433 3300046694 Bacteria 916
1014 Ga0495589_0000220 3300046794 Bacteria 48490
1015 Ga0495589_0001551 3300046794 Bacteria 13238
1016 Ga0495589_0004523 3300046794 Bacteria 7391
1017 Ga0495589_0013343 3300046794 Bacteria 4239
1018 Ga0495600_0016863 3300046809 Bacteria 4643
1019 Ga0495600_0028740 3300046809 Bacteria 3599
1020 Ga0495600_0059767 3300046809 Bacteria 2489
1021 Ga0495600_0079361 3300046809 Bacteria 2143
1022 Ga0495660_0000111 3300046810 Bacteria 87624
1023 Ga0495660_0000699 3300046810 Bacteria 25742
1024 Ga0495660_0003672 3300046810 Bacteria 9444
1025 Ga0495660_0013394 3300046810 Bacteria 4753
1026 Ga0495660_0026613 3300046810 Bacteria 3277
1027 Ga0495660_0028980 3300046810 Bacteria 3125
1028 Ga0495660_0035926 3300046810 Bacteria 2765
1029 Ga0495660_0042786 3300046810 Bacteria 2501
1030 Ga0495660_0095897 3300046810 Bacteria 1533
1031 Ga0495660_0100742 3300046810 Bacteria 1487
1032 Ga0495660_0199782 3300046810 Bacteria 955
1033 Ga0495581_0013521 3300047315 Bacteria 4734
1034 Ga0495581_0054117 3300047315 Bacteria 2316
1035 Ga0495604_0032086 3300047317 Bacteria 4164
1036 Ga0495604_0096573 3300047317 Bacteria 2180
1037 Ga0495604_0104427 3300047317 Bacteria 2076
1038 Ga0495636_0000802 3300047318 Bacteria 11566
1039 Ga0495636_0068453 3300047318 Bacteria 1511
1040 Ga0495674_0005430 3300047319 Bacteria 12242
1041 Ga0495674_0026678 3300047319 Bacteria 5284
1042 Ga0495674_0102752 3300047319 Bacteria 2430
1043 Ga0495674_0618696 3300047319 Bacteria 856
1044 Ga0495672_0001422 3300047320 Bacteria 23537
1045 Ga0495672_0003520 3300047320 Bacteria 13342
1046 Ga0495672_0011661 3300047320 Bacteria 6186
1047 Ga0495672_0015110 3300047320 Bacteria 5254
1048 Ga0495672_0015748 3300047320 Bacteria 5122
1049 Ga0495672_0040684 3300047320 Bacteria 2816
1050 Ga0495672_0057619 3300047320 Bacteria 2255
1051 Ga0495672_0097064 3300047320 Bacteria 1605
1052 Ga0495676_0000003 3300047321 Bacteria 318463
1053 Ga0495676_0004919 3300047321 Bacteria 12252
1054 Ga0495676_0011857 3300047321 Bacteria 7863
1055 Ga0495676_0084297 3300047321 Bacteria 2398
1056 Ga0495680_0006432 3300047322 Bacteria 10918
1057 Ga0495680_0010754 3300047322 Bacteria 8153
1058 Ga0495680_0010884 3300047322 Bacteria 8087
1059 Ga0495683_0000191 3300047323 Bacteria 58418
1060 Ga0495683_0000374 3300047323 Bacteria 36566
1061 Ga0495683_0001219 3300047323 Bacteria 17512
1062 Ga0495683_0002206 3300047323 Bacteria 11928
1063 Ga0495683_0004057 3300047323 Bacteria 8396
1064 Ga0495683_0004074 3300047323 Bacteria 8371
1065 Ga0495683_0036727 3300047323 Bacteria 2486
1066 Ga0495683_0040090 3300047323 Bacteria 2366
1067 Ga0495687_003083 3300047443 Bacteria 12485
1068 Ga0495687_011073 3300047443 Bacteria 4880
1069 Ga0495675_0025774 3300047444 Bacteria 3746
1070 Ga0495675_0113807 3300047444 Bacteria 1687
1071 Ga0495677_0022510 3300047445 Bacteria 2286
1072 Ga0495679_000027 3300047446 Bacteria 193794
1073 Ga0495679_002945 3300047446 Bacteria 8407
1074 Ga0495679_003659 3300047446 Bacteria 7338
1075 Ga0495679_007096 3300047446 Bacteria 4725
1076 Ga0495679_078665 3300047446 Bacteria 939
1077 Ga0495673_0001072 3300047469 Bacteria 23989
1078 Ga0495673_0001962 3300047469 Bacteria 15241
1079 Ga0495673_0002752 3300047469 Bacteria 12041
1080 Ga0495673_0002840 3300047469 Bacteria 11800
1081 Ga0495673_0002856 3300047469 Bacteria 11745
1082 Ga0495673_0006100 3300047469 Bacteria 7157
1083 Ga0495673_0011185 3300047469 Bacteria 4843
1084 Ga0495673_0015390 3300047469 Bacteria 3943
1085 Ga0495673_0018986 3300047469 Bacteria 3452
1086 Ga0495673_0020578 3300047469 Bacteria 3282
1087 Ga0495673_0028282 3300047469 Bacteria 2656
1088 Ga0495673_0059525 3300047469 Bacteria 1641
1089 Ga0495681_0000739 3300047470 Bacteria 25118
1090 Ga0495681_0001919 3300047470 Bacteria 15243
1091 Ga0495681_0001989 3300047470 Bacteria 14927
1092 Ga0495681_0006748 3300047470 Bacteria 7479
1093 Ga0495681_0007990 3300047470 Bacteria 6681
1094 Ga0495681_0011451 3300047470 Bacteria 5281
1095 Ga0495681_0018673 3300047470 Bacteria 3812
1096 Ga0495681_0027983 3300047470 Bacteria 2908
1097 Ga0495681_0036883 3300047470 Bacteria 2413
1098 Ga0495681_0090103 3300047470 Bacteria 1356
1099 Ga0495684_0135259 3300047471 Bacteria 1850
1100 Ga0495686_0007047 3300047472 Bacteria 8481
1101 Ga0495686_0092931 3300047472 Bacteria 1829
1102 Ga0495686_0283218 3300047472 Bacteria 920
1103 Ga0495593_0020320 3300047673 Bacteria 3719
1104 Ga0495593_0086517 3300047673 Bacteria 1616
1105 Ga0495602_0015213 3300048088 Bacteria 7775
1106 Ga0495602_0025650 3300048088 Bacteria 5700
1107 Ga0495615_0010446 3300048090 Bacteria 1856
1108 Ga0495626_0000245 3300048091 Bacteria 63067
1109 Ga0495626_0000502 3300048091 Bacteria 39258
1110 Ga0495626_0000647 3300048091 Bacteria 33586
1111 Ga0495626_0000727 3300048091 Bacteria 30796
1112 Ga0495626_0001965 3300048091 Bacteria 15237
1113 Ga0495626_0002785 3300048091 Bacteria 11727
1114 Ga0495626_0003678 3300048091 Bacteria 9721
1115 Ga0495626_0004355 3300048091 Bacteria 8719
1116 Ga0495626_0013753 3300048091 Bacteria 4197
1117 Ga0496100_0000388 3300048903 Bacteria 21359
1118 Ga0496100_0298585 3300048903 Bacteria 1205
1119 Ga0496100_0474564 3300048903 Bacteria 961
1120 Ga0496101_0000718 3300048904 Bacteria 19794
1121 Ga0496101_0062832 3300048904 Bacteria 2701
1122 Ga0496101_0070971 3300048904 Bacteria 2552
1123 Ga0496101_0077334 3300048904 Bacteria 2452
1124 Ga0496102_0000927 3300048905 Bacteria 27608
1125 Ga0496103_0003687 3300048906 Bacteria 9310
1126 Ga0496104_0013762 3300048907 Bacteria 7297
1127 Ga0496104_0101978 3300048907 Bacteria 2748
1128 Ga0496104_0184728 3300048907 Bacteria 1996
1129 Ga0496104_0320738 3300048907 Bacteria 1462
1130 Ga0496105_0009045 3300048908 Bacteria 7773
1131 Ga0496105_0014555 3300048908 Bacteria 6263
1132 Ga0496105_0125351 3300048908 Bacteria 2117
1133 Ga0496106_0211364 3300048909 Bacteria 1546
1134 Ga0496106_0447064 3300048909 Bacteria 1038
1135 Ga0496107_0016365 3300048910 Bacteria 5205
1136 Ga0496107_0251562 3300048910 Bacteria 1315
1137 Ga0496108_0027781 3300048911 Bacteria 4677
1138 Ga0496109_0184128 3300048912 Bacteria 1962
1139 Ga0496110_0137111 3300048913 Bacteria 2212
1140 Ga0496110_0184653 3300048913 Bacteria 1893
1141 Ga0496110_0595775 3300048913 Bacteria 1003
1142 Ga0496111_0033977 3300048914 Bacteria 3639
1143 Ga0496111_0335261 3300048914 Bacteria 1120
1144 Ga0496112_0180081 3300048915 Bacteria 2077
1145 Ga0496113_0129578 3300048916 Bacteria 1978
1146 Ga0496114_0060145 3300048917 Bacteria 3175
1147 Ga0496114_0468946 3300048917 Bacteria 1114
1148 Ga0496115_0000846 3300048918 Bacteria 22323
1149 Ga0496115_0004466 3300048918 Bacteria 10136
1150 Ga0496115_0006657 3300048918 Bacteria 8480
1151 Ga0496115_0014788 3300048918 Bacteria 5917
1152 Ga0496115_0035357 3300048918 Bacteria 3952
1153 Ga0496116_0002726 3300048919 Bacteria 18166
1154 Ga0496116_0010317 3300048919 Bacteria 7844
1155 Ga0496116_0011956 3300048919 Bacteria 7131
1156 Ga0496116_0052398 3300048919 Bacteria 2704
1157 Ga0496117_0001244 3300048920 Bacteria 38098
1158 Ga0496117_0003521 3300048920 Bacteria 18127
1159 Ga0496117_0005256 3300048920 Bacteria 13737
1160 Ga0496117_0028601 3300048920 Bacteria 4314
1161 Ga0496117_0030689 3300048920 Bacteria 4118
1162 Ga0496117_0050851 3300048920 Bacteria 2935
1163 Ga0496117_0058539 3300048920 Bacteria 2667
1164 Ga0496117_0063433 3300048920 Bacteria 2526
1165 Ga0496117_0197363 3300048920 Bacteria 1140
1166 Ga0496118_0001044 3300048921 Bacteria 43186
1167 Ga0496118_0001316 3300048921 Bacteria 37710
1168 Ga0496118_0002113 3300048921 Bacteria 27843
1169 Ga0496118_0009231 3300048921 Bacteria 10016
1170 Ga0496118_0033930 3300048921 Bacteria 4175
1171 Ga0496118_0055221 3300048921 Bacteria 2999
1172 Ga0496118_0095070 3300048921 Bacteria 2035
1173 Ga0496118_0192512 3300048921 Bacteria 1218
1174 Ga0496118_0199138 3300048921 Bacteria 1188
1175 Ga0496119_0000011 3300048922 Bacteria 438315
1176 Ga0496119_0000029 3300048922 Bacteria 243194
1177 Ga0496119_0005007 3300048922 Bacteria 12918
1178 Ga0496119_0030938 3300048922 Bacteria 3599
1179 Ga0496119_0074524 3300048922 Bacteria 1976
1180 Ga0496120_0000015 3300048923 Bacteria 310795
1181 Ga0496120_0000039 3300048923 Bacteria 202237
1182 Ga0496120_0000627 3300048923 Bacteria 52784
1183 Ga0496120_0021585 3300048923 Bacteria 4067
1184 Ga0496120_0087082 3300048923 Bacteria 1678
1185 Ga0496121_0000063 3300048924 Bacteria 273080
1186 Ga0496121_0003288 3300048924 Bacteria 23207
1187 Ga0496121_0007678 3300048924 Bacteria 12955
1188 Ga0496121_0010938 3300048924 Bacteria 10135
1189 Ga0496121_0014515 3300048924 Bacteria 8351
1190 Ga0496121_0017061 3300048924 Bacteria 7446
1191 Ga0496121_0019230 3300048924 Bacteria 6841
1192 Ga0496121_0036543 3300048924 Bacteria 4376
1193 Ga0496121_0088839 3300048924 Bacteria 2421
1194 Ga0496121_0156581 3300048924 Bacteria 1671
1195 Ga0496122_0000834 3300048925 Bacteria 58431
1196 Ga0496122_0001785 3300048925 Bacteria 32973
1197 Ga0496122_0006982 3300048925 Bacteria 12712
1198 Ga0496122_0040138 3300048925 Bacteria 3724
1199 Ga0496122_0072407 3300048925 Bacteria 2450
1200 Ga0496122_0074854 3300048925 Bacteria 2393
1201 Ga0496123_0000136 3300048926 Bacteria 152399
1202 Ga0496123_0001361 3300048926 Bacteria 34420
1203 Ga0496123_0013636 3300048926 Bacteria 6798
1204 Ga0496123_0020506 3300048926 Bacteria 5167
1205 Ga0496123_0030565 3300048926 Bacteria 3940
1206 Ga0496123_0057074 3300048926 Bacteria 2545
1207 Ga0496123_0081645 3300048926 Bacteria 1963
1208 Ga0496124_0000118 3300048927 Bacteria 164259
1209 Ga0496124_0001317 3300048927 Bacteria 37470
1210 Ga0496124_0002425 3300048927 Bacteria 24458
1211 Ga0496124_0003299 3300048927 Bacteria 19894
1212 Ga0496124_0012045 3300048927 Bacteria 8591
1213 Ga0496124_0039101 3300048927 Bacteria 4114
1214 Ga0496124_0067352 3300048927 Bacteria 2979
1215 Ga0496124_0130670 3300048927 Bacteria 1995
1216 Ga0496124_0351225 3300048927 Bacteria 1043
1217 Ga0496124_0351925 3300048927 Bacteria 1042
1218 Ga0496125_0000536 3300048928 Bacteria 65389
1219 Ga0496125_0003132 3300048928 Bacteria 20535
1220 Ga0496125_0006213 3300048928 Bacteria 13004
1221 Ga0496125_0007271 3300048928 Bacteria 11793
1222 Ga0496125_0038556 3300048928 Bacteria 4132
1223 Ga0496125_0040786 3300048928 Bacteria 3977
1224 Ga0496125_0064756 3300048928 Bacteria 2902
1225 Ga0496125_0090612 3300048928 Bacteria 2294
1226 Ga0496126_0002573 3300048929 Bacteria 24212
1227 Ga0496126_0010547 3300048929 Bacteria 9672
1228 Ga0496126_0011099 3300048929 Bacteria 9358
1229 Ga0496126_0020370 3300048929 Bacteria 6505
1230 Ga0496126_0028240 3300048929 Bacteria 5349
1231 Ga0496126_0052567 3300048929 Bacteria 3701
1232 Ga0496126_0057676 3300048929 Bacteria 3504
1233 Ga0496126_0082783 3300048929 Bacteria 2834
1234 Ga0496126_0198877 3300048929 Bacteria 1693
1235 Ga0495678_000520 3300049459 Bacteria 37556
1236 Ga0495678_001322 3300049459 Bacteria 19872
1237 Ga0495678_003692 3300049459 Bacteria 9266
1238 Ga0495678_004394 3300049459 Bacteria 8174
1239 Ga0495678_004708 3300049459 Bacteria 7794
1240 Ga0495678_007558 3300049459 Bacteria 5612
1241 Ga0495678_009381 3300049459 Bacteria 4847
1242 Ga0495678_009532 3300049459 Bacteria 4796
1243 Ga0495678_012820 3300049459 Bacteria 3957
1244 Ga0495678_015698 3300049459 Bacteria 3478
1245 Ga0495678_020258 3300049459 Bacteria 2950
1246 Ga0495678_041879 3300049459 Bacteria 1829
1247 Ga0495678_087103 3300049459 Bacteria 1108
1248 Ga0495682_0000023 3300049460 Bacteria 158998
1249 Ga0495682_0001956 3300049460 Bacteria 10209
1250 Ga0495682_0004975 3300049460 Bacteria 5591
1251 Ga0495682_0009232 3300049460 Bacteria 3859
1252 Ga0495682_0013997 3300049460 Bacteria 3045
1253 Ga0495682_0069009 3300049460 Bacteria 1272
1254 Ga0495682_0084808 3300049460 Bacteria 1138
1255 Ga0501034_0006797 3300049571 Bacteria 12235
1256 Ga0501039_0306577 3300049575 Bacteria 1248
1257 Ga0501043_0284716 3300049579 Bacteria 1266
1258 Ga0501241_000310 3300049758 Bacteria 10646
1259 Ga0501035_0207615 3300049822 Bacteria 1677
1260 Ga0501226_000019 3300049853 Bacteria 143773
1261 nmdc:mga00v17_64322_c1 3300050491 Bacteria 2260
1262 nmdc:mga09592_76566_c1 3300050508 Bacteria 2845
1263 nmdc:mga06r32_7578_c1 3300050510 Bacteria 9755
1264 nmdc:mga08y16_1859_c1 3300050511 Bacteria 21453
1265 nmdc:mga0a205_411436_c1 3300050515 Bacteria 1215
1266 Ga0495601_0155660 3300053077 Bacteria 1492
1267 Ga0500646_0009422 3300053090 Bacteria 2500
1268 Ga0500651_0035034 3300053093 Bacteria 3164
1269 Ga0500572_008691 3300053111 Bacteria 2381
1270 Ga0500595_001997 3300053119 Bacteria 10453
1271 Ga0500618_033011 3300053125 Bacteria 1208
1272 Ga0500574_000315 3300053141 Bacteria 5952
1273 Ga0500619_000522 3300053154 Bacteria 6648
1274 Ga0500634_0006211 3300053161 Bacteria 5759
1275 Ga0587068_007681 3300059641 Bacteria 1544

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2751185734 2753071084 213
2 iso_pu_bacteria 2870721527 2870726310 213
3 iso_pu_bacteria 8003314358 8003318413 232
4 3300044658 Ga0466972_0036572 Ga0466972_0036572_1437_2186 235
5 3300005338 Ga0068868_100055157 Ga0068868_1000551574 236
6 3300026023 Ga0207677_10048554 Ga0207677_100485544 236
7 3300042005 Ga0439448_0034522 Ga0439448_0034522_50_805 244
8 3300042016 Ga0439463_006427 Ga0439463_006427_632_1387 245
9 3300042118 Ga0450914_000846 Ga0450914_000846_455_1210 245
10 3300042439 Ga0439464_0004397 Ga0439464_0004397_1921_2676 245
11 3300006058 Ga0075432_10034377 Ga0075432_100343773 247
12 3300031995 Ga0307409_100213872 Ga0307409_1002138722 247
13 3300003323 rootH1_10211171 rootH1_102111712 250
14 iso_pu_bacteria 2687453130 2687583493 250
15 iso_pu_bacteria 2511231004 2511254884 251
16 iso_pu_bacteria 2511231006 2511264464 251
17 iso_pu_bacteria 2511231007 2511271562 251
18 iso_pu_bacteria 2511231008 2511280314 251
19 iso_pu_bacteria 2511231010 2511292347 251
20 iso_pu_bacteria 2511231011 2511296490 251
21 iso_pu_bacteria 2511231012 2511302809 251
22 iso_pu_bacteria 2511231014 2511311796 251
23 iso_pu_bacteria 2511231015 2511323378 251
24 iso_pu_bacteria 2511231016 2511326350 251
25 iso_pu_bacteria 2511231017 2511331402 251
26 iso_pu_bacteria 2511231018 2511336155 251
27 iso_pu_bacteria 2511231019 2511342261 251
28 iso_pu_bacteria 2511231020 2511348459 251
29 iso_pu_bacteria 2511231021 2511356549 251
30 iso_pu_bacteria 2511231022 2511366370 251
31 iso_pu_bacteria 2511231023 2511370326 251
32 iso_pu_bacteria 2511231024 2511372850 251
33 iso_pu_bacteria 2511231031 2511412090 251
34 iso_pu_bacteria 2511231156 2511824394 251
35 iso_pu_bacteria 2512047018 2512328422 251
36 iso_pu_bacteria 2537561836 2538834276 251
37 iso_pu_bacteria 2554235132 2554815866 251
38 iso_pu_bacteria 2554235231 2555247349 251
39 iso_pu_bacteria 2554235341 2555669635 251
40 iso_pu_bacteria 2582580891 2583792893 251
41 iso_pu_bacteria 2597489887 2597857645 251
42 iso_pu_bacteria 2597489888 2597863626 251
43 iso_pu_bacteria 2597489889 2597869584 251
44 iso_pu_bacteria 2599185155 2599329823 251
45 iso_pu_bacteria 2599185160 2599353367 251
46 iso_pu_bacteria 2599185161 2599363760 251
47 iso_pu_bacteria 2599185162 2599370080 251
48 iso_pu_bacteria 2599185163 2599372387 251
49 iso_pu_bacteria 2599185164 2599378475 251
50 iso_pu_bacteria 2599185165 2599384148 251
51 iso_pu_bacteria 2599185166 2599391246 251
52 iso_pu_bacteria 2599185167 2599398605 251
53 iso_pu_bacteria 2599185168 2599407491 251
54 iso_pu_bacteria 2599185179 2599450659 251
55 iso_pu_bacteria 2599185181 2599460201 251
56 iso_pu_bacteria 2599185182 2599470593 251
57 iso_pu_bacteria 2599185185 2599484419 251
58 iso_pu_bacteria 2599185186 2599489222 251
59 iso_pu_bacteria 2599185188 2599500991 251
60 iso_pu_bacteria 2599185189 2599507096 251
61 iso_pu_bacteria 2599185190 2599513090 251
62 iso_pu_bacteria 2599185191 2599520782 251
63 iso_pu_bacteria 2599185212 2599616091 251
64 iso_pu_bacteria 2599185248 2599772634 251
65 iso_pu_bacteria 2599185257 2599802308 251
66 iso_pu_bacteria 2599185288 2599880258 251
67 iso_pu_bacteria 2599185289 2599885044 251
68 iso_pu_bacteria 2599185290 2599891767 251
69 iso_pu_bacteria 2599185291 2599899769 251
70 iso_pu_bacteria 2599185300 2599931571 251
71 iso_pu_bacteria 2599185302 2599945231 251
72 iso_pu_bacteria 2599185303 2599947034 251
73 iso_pu_bacteria 2599185304 2599955417 251
74 iso_pu_bacteria 2599185305 2599960860 251
75 iso_pu_bacteria 2599185306 2599965462 251
76 iso_pu_bacteria 2599185307 2599970306 251
77 iso_pu_bacteria 2599185308 2599976577 251
78 iso_pu_bacteria 2599185309 2599984406 251
79 iso_pu_bacteria 2599185310 2599990423 251
80 iso_pu_bacteria 2599185311 2599992804 251
81 iso_pu_bacteria 2599185312 2600001635 251
82 iso_pu_bacteria 2599185313 2600009293 251
83 iso_pu_bacteria 2599185314 2600010678 251
84 iso_pu_bacteria 2599185315 2600018354 251
85 iso_pu_bacteria 2599185316 2600023279 251
86 iso_pu_bacteria 2599185317 2600028197 251
87 iso_pu_bacteria 2599185318 2600034133 251
88 iso_pu_bacteria 2599185319 2600040354 251
89 iso_pu_bacteria 2599185320 2600049215 251
90 iso_pu_bacteria 2599185321 2600052874 251
91 iso_pu_bacteria 2599185322 2600056954 251
92 iso_pu_bacteria 2599185323 2600063367 251
93 iso_pu_bacteria 2599185324 2600074575 251
94 iso_pu_bacteria 2599185325 2600077564 251
95 iso_pu_bacteria 2599185356 2600212810 251
96 iso_pu_bacteria 2600254930 2600357354 251
97 iso_pu_bacteria 2600254931 2600366879 251
98 iso_pu_bacteria 2600254954 2600444453 251
99 iso_pu_bacteria 2600255283 2601623967 251
100 iso_pu_bacteria 2600255296 2601691727 251
101 iso_pu_bacteria 2600255313 2601772978 251
102 iso_pu_bacteria 2600255318 2601797078 251
103 iso_pu_bacteria 2600255389 2602011538 251
104 iso_pu_bacteria 2603880185 2606076191 251
105 iso_pu_bacteria 2603880199 2606131101 251
106 iso_pu_bacteria 2606217733 2608382245 251
107 iso_pu_bacteria 2619619299 2621300105 251
108 iso_pu_bacteria 2623620443 2624481351 251
109 iso_pu_bacteria 2623620446 2624492633 251
110 iso_pu_bacteria 2643221565 2643841617 251
111 iso_pu_bacteria 2643221571 2643870458 251
112 iso_pu_bacteria 2643221589 2643956931 251
113 iso_pu_bacteria 2643221602 2644024854 251
114 iso_pu_bacteria 2643221633 2644186786 251
115 iso_pu_bacteria 2643221650 2644285702 251
116 iso_pu_bacteria 2643221713 2644620950 251
117 iso_pu_bacteria 2651869719 2652546313 251
118 iso_pu_bacteria 2667528170 2671094601 251
119 iso_pu_bacteria 2667528171 2671095066 251
120 iso_pu_bacteria 2667528176 2671124846 251
121 iso_pu_bacteria 2671180172 2671770073 251
122 iso_pu_bacteria 2675903420 2677896145 251
123 iso_pu_bacteria 2675903515 2678263859 251
124 iso_pu_bacteria 2713897148 2715753453 251
125 iso_pu_bacteria 2713897149 2715755871 251
126 iso_pu_bacteria 2718217725 2718633640 251
127 iso_pu_bacteria 2721755607 2723248555 251
128 iso_pu_bacteria 2728369097 2729145806 251
129 iso_pu_bacteria 2738541265 2738670114 251
130 iso_pu_bacteria 2738541271 2738691660 251
131 iso_pu_bacteria 2738541282 2738748507 251
132 iso_pu_bacteria 2738541294 2738806479 251
133 iso_pu_bacteria 2738541303 2738857549 251
134 iso_pu_bacteria 2738541309 2738893839 251
135 iso_pu_bacteria 2738543004 2739197655 251
136 iso_pu_bacteria 2738543015 2739258625 251
137 iso_pu_bacteria 2738543016 2739267434 251
138 iso_pu_bacteria 2738543020 2739285080 251
139 iso_pu_bacteria 2738543021 2739290394 251
140 iso_pu_bacteria 2738543025 2739315374 251
141 iso_pu_bacteria 2739367700 2739732390 251
142 iso_pu_bacteria 2740892503 2743737078 251
143 iso_pu_bacteria 2744054620 2745004312 251
144 iso_pu_bacteria 2765235841 2765583126 251
145 iso_pu_bacteria 2773857670 2774123270 251
146 iso_pu_bacteria 2773857673 2774137937 251
147 iso_pu_bacteria 2784132063 2784264994 251
148 iso_pu_bacteria 2784132072 2784315794 251
149 iso_pu_bacteria 2791355520 2794596953 251
150 iso_pu_bacteria 2806310737 2807407700 251
151 iso_pu_bacteria 2806310745 2807456015 251
152 iso_pu_bacteria 2808606361 2808854916 251
153 iso_pu_bacteria 2808606373 2808904224 251
154 iso_pu_bacteria 2808606376 2808925877 251
155 iso_pu_bacteria 2808606377 2808932708 251
156 iso_pu_bacteria 2808606378 2808934889 251
157 iso_pu_bacteria 2808606379 2808941924 251
158 iso_pu_bacteria 2808606380 2808947978 251
159 iso_pu_bacteria 2808606381 2808954902 251
160 iso_pu_bacteria 2808606382 2808958337 251
161 iso_pu_bacteria 2808606383 2808963286 251
162 iso_pu_bacteria 2808606384 2808973616 251
163 iso_pu_bacteria 2808606385 2808978813 251
164 iso_pu_bacteria 2808606388 2808994545 251
165 iso_pu_bacteria 2808606389 2808998309 251
166 iso_pu_bacteria 2808606390 2809008465 251
167 iso_pu_bacteria 2808606391 2809015552 251
168 iso_pu_bacteria 2808606445 2809214496 251
169 iso_pu_bacteria 2811994881 2812365765 251
170 iso_pu_bacteria 2816332298 2817491452 251
171 iso_pu_bacteria 2818991436 2819543367 251
172 iso_pu_bacteria 2818991456 2819656786 251
173 iso_pu_bacteria 2818991464 2819705579 251
174 iso_pu_bacteria 2823421272 2823423945 251
175 iso_pu_bacteria 2825651385 2825657353 251
176 iso_pu_bacteria 2826581358 2826586600 251
177 iso_pu_bacteria 2834028612 2834033513 251
178 iso_pu_bacteria 2842805378 2842810121 251
179 iso_pu_bacteria 2842815866 2842816014 251
180 iso_pu_bacteria 2842826826 2842827173 251
181 iso_pu_bacteria 2842832357 2842836142 251
182 iso_pu_bacteria 2842837860 2842843264 251
183 iso_pu_bacteria 2842843487 2842844075 251
184 iso_pu_bacteria 2842849001 2842851180 251
185 iso_pu_bacteria 2842854478 2842858411 251
186 iso_pu_bacteria 2844665904 2844670136 251
187 iso_pu_bacteria 2852612431 2852614200 251
188 iso_pu_bacteria 2852657418 2852659563 251
189 iso_pu_bacteria 2852667396 2852668063 251
190 iso_pu_bacteria 2860339153 2860342310 251
191 iso_pu_bacteria 2860867994 2860870830 251
192 iso_pu_bacteria 2878029506 2878033325 251
193 iso_pu_bacteria 2880230671 2880232965 251
194 iso_pu_bacteria 2884411467 2884411623 251
195 iso_pu_bacteria 2904518522 2904520315 251
196 iso_pu_bacteria 2904550169 2904550542 251
197 iso_pu_bacteria 2908446538 2908449362 251
198 iso_pu_bacteria 2912963787 2912966819 251
199 iso_pu_bacteria 2913036834 2913039319 251
200 iso_pu_bacteria 2917070673 2917073449 251
201 iso_pu_bacteria 2919063839 2919066973 251
202 iso_pu_bacteria 2919155634 2919157120 251
203 iso_pu_bacteria 2919385768 2919387453 251
204 iso_pu_bacteria 2919456309 2919458984 251
205 iso_pu_bacteria 2919481497 2919485314 251
206 iso_pu_bacteria 2919487758 2919492172 251
207 iso_pu_bacteria 2919501602 2919503207 251
208 iso_pu_bacteria 2919697872 2919702683 251
209 iso_pu_bacteria 2923153595 2923156111 251
210 iso_pu_bacteria 2923519811 2923525732 251
211 iso_pu_bacteria 2923586266 2923586559 251
212 iso_pu_bacteria 2926063275 2926066222 251
213 iso_pu_bacteria 2928963466 2928965067 251
214 iso_pu_bacteria 2929144301 2929147858 251
215 iso_pu_bacteria 2929189879 2929192284 251
216 iso_pu_bacteria 2931369376 2931369723 251
217 iso_pu_bacteria 2931390751 2931393651 251
218 iso_pu_bacteria 2931396565 2931402393 251
219 iso_pu_bacteria 2935353572 2935357553 251
220 iso_pu_bacteria 2939636861 2939638519 251
221 iso_pu_bacteria 2939651529 2939651564 251
222 iso_pu_bacteria 2945928738 2945933199 251
223 iso_pu_bacteria 2945961074 2945964165 251
224 iso_pu_bacteria 2946006987 2946009424 251
225 iso_pu_bacteria 2946027586 2946030695 251
226 iso_pu_bacteria 2947233263 2947238081 251
227 iso_pu_bacteria 2969304461 2969306790 251
228 iso_pu_bacteria 2974289157 2974290475 251
229 iso_pu_bacteria 2984286254 2984289913 251
230 iso_pu_bacteria 2988728565 2988729443 251
231 iso_pu_bacteria 2990196909 2990199021 251
232 iso_pu_bacteria 2998139840 2998143372 251
233 iso_pu_bacteria 3007252601 3007252693 251
234 iso_pu_bacteria 3007315729 3007318659 251
235 iso_pu_bacteria 3007395558 3007401639 251
236 iso_pu_bacteria 3007419365 3007422877 251
237 iso_pu_bacteria 3007511990 3007514594 251
238 iso_pu_bacteria 3007614139 3007618964 251
239 iso_pu_bacteria 3007619802 3007621444 251
240 iso_pu_bacteria 3007718800 3007722649 251
241 iso_pu_bacteria 3007803356 3007808016 251
242 iso_pu_bacteria 3007855910 3007857407 251
243 iso_pu_bacteria 3007861166 3007861595 251
244 iso_pu_bacteria 3007866637 3007869718 251
245 iso_pu_bacteria 3007872151 3007876588 251
246 iso_pu_bacteria 637000220 637319965 251
247 iso_pu_bacteria 640427133 640488188 251
248 iso_pu_bacteria 651053060 651176141 251
249 iso_pu_bacteria 8011350971 8011357070 251
250 iso_pu_bacteria 8015687852 8015690315 251
251 iso_pu_bacteria 8019769354 8019772505 251
252 iso_pu_bacteria 8019775933 8019781670 251
253 iso_pu_bacteria 8029995093 8029997449 251
254 iso_pu_bacteria 8034962539 8034964948 251
255 iso_pu_bacteria 8052494512 8052498055 251
256 iso_pu_bacteria 8054285046 8054286670 251
257 iso_pu_bacteria 8054347763 8054352501 251
258 iso_pu_bacteria 8054503363 8054506602 251
259 iso_pu_bacteria 8054929484 8054930165 251
260 iso_pu_bacteria 8055770955 8055773459 251
261 iso_pu_bacteria 8055817908 8055821384 251
262 iso_pu_bacteria 8055878733 8055882085 251
263 iso_pu_bacteria 8056115690 8056118391 251
264 iso_pu_bacteria 8056120720 8056124080 251
265 iso_pu_bacteria 8056125926 8056129276 251
266 iso_pu_bacteria 8056131705 8056134490 251
267 iso_pu_bacteria 8056137416 8056139726 251
268 iso_pu_bacteria 8056143049 8056145563 251
269 iso_pu_bacteria 8056148874 8056154872 251
270 iso_pu_bacteria 8056155041 8056157652 251
271 iso_pu_bacteria 8056161164 8056166302 251
272 iso_pu_bacteria 8056166840 8056167844 251
273 iso_pu_bacteria 8056172158 8056173804 251
274 iso_pu_bacteria 8056177738 8056178501 251
275 iso_pu_bacteria 8056569372 8056574187 251
276 iso_pu_bacteria 8057798959 8057800851 251
277 3300005347 Ga0070668_100162427 Ga0070668_1001624272 252
278 3300005353 Ga0070669_100073076 Ga0070669_1000730763 252
279 3300005354 Ga0070675_100010237 Ga0070675_1000102374 252
280 3300005459 Ga0068867_100143095 Ga0068867_1001430952 252
281 3300005548 Ga0070665_100136281 Ga0070665_1001362813 252
282 3300005617 Ga0068859_100515418 Ga0068859_1005154181 252
283 3300005841 Ga0068863_100024270 Ga0068863_1000242702 252
284 3300006931 Ga0097620_100515450 Ga0097620_1005154501 252
285 3300014969 Ga0157376_11100812 Ga0157376_111008121 252
286 3300025925 Ga0207650_10035921 Ga0207650_100359213 252
287 3300025926 Ga0207659_10058526 Ga0207659_100585263 252
288 3300025960 Ga0207651_10285024 Ga0207651_102850242 252
289 3300025972 Ga0207668_10113561 Ga0207668_101135612 252
290 3300026088 Ga0207641_10091737 Ga0207641_100917373 252
291 3300026089 Ga0207648_10281850 Ga0207648_102818502 252
292 3300028379 Ga0268266_10048303 Ga0268266_100483032 252
293 3300028381 Ga0268264_10341899 Ga0268264_103418992 252
294 3300031727 Ga0316576_10280606 Ga0316576_102806061 252
295 3300031733 Ga0316577_10015732 Ga0316577_100157323 252
296 3300031824 Ga0307413_10296524 Ga0307413_102965241 252
297 3300031995 Ga0307409_100233180 Ga0307409_1002331802 252
298 3300005339 Ga0070660_100363792 Ga0070660_1003637922 253
299 3300005356 Ga0070674_100000400 Ga0070674_10000040015 253
300 3300005546 Ga0070696_100082822 Ga0070696_1000828223 253
301 3300005719 Ga0068861_100027045 Ga0068861_1000270452 253
302 3300005719 Ga0068861_100169270 Ga0068861_1001692704 253
303 3300005844 Ga0068862_100021113 Ga0068862_1000211133 253
304 3300006846 Ga0075430_100015636 Ga0075430_1000156365 253
305 3300006846 Ga0075430_100404067 Ga0075430_1004040672 253
306 3300006847 Ga0075431_100107231 Ga0075431_1001072313 253
307 3300006880 Ga0075429_100057724 Ga0075429_1000577243 253
308 3300006881 Ga0068865_100012002 Ga0068865_1000120022 253
309 3300009094 Ga0111539_10384601 Ga0111539_103846011 253
310 3300009147 Ga0114129_10891258 Ga0114129_108912582 253
311 3300014326 Ga0157380_10100090 Ga0157380_101000902 253
312 3300025893 Ga0207682_10046615 Ga0207682_100466152 253
313 3300025907 Ga0207645_10000608 Ga0207645_1000060823 253
314 3300025908 Ga0207643_10073347 Ga0207643_100733473 253
315 3300025922 Ga0207646_10443141 Ga0207646_104431412 253
316 3300025923 Ga0207681_10248234 Ga0207681_102482341 253
317 3300025933 Ga0207706_10005132 Ga0207706_100051327 253
318 3300025937 Ga0207669_10012471 Ga0207669_100124715 253
319 3300025938 Ga0207704_10068548 Ga0207704_100685484 253
320 3300025940 Ga0207691_10033938 Ga0207691_100339381 253
321 3300026089 Ga0207648_10261507 Ga0207648_102615072 253
322 3300026118 Ga0207675_100005199 Ga0207675_1000051997 253
323 3300027462 Ga0210000_1023212 Ga0210000_10232121 253
324 3300027617 Ga0210002_1000967 Ga0210002_10009674 253
325 3300027665 Ga0209983_1025614 Ga0209983_10256142 253
326 3300027907 Ga0207428_10032793 Ga0207428_100327931 253
327 3300037471 Ga0395905_0011731 Ga0395905_0011731_564_1328 253
328 3300042876 Ga0451577_0006876 Ga0451577_0006876_5785_6546 253
329 3300042876 Ga0451577_0082230 Ga0451577_0082230_553_1314 253
330 3300042876 Ga0451577_0416651 Ga0451577_0416651_370_1131 253
331 3300044673 Ga0453683_0017633 Ga0453683_0017633_1798_2559 253
332 3300044712 Ga0453684_0025585 Ga0453684_0025585_5873_6634 253
333 3300044712 Ga0453684_0234247 Ga0453684_0234247_1062_1823 253
334 3300045051 Ga0451576_0022215 Ga0451576_0022215_4413_5174 253
335 3300045051 Ga0451576_0045380 Ga0451576_0045380_985_1746 253
336 3300050508 nmdc:mga09592_76566_c1 nmdc:mga09592_76566_c1_522_1283 253
337 3300050510 nmdc:mga06r32_7578_c1 nmdc:mga06r32_7578_c1_2536_3297 253
338 3300001915 JGI24741J21665_1000469 JGI24741J21665_10004697 254
339 3300001979 JGI24740J21852_10000476 JGI24740J21852_1000047618 254
340 3300001979 JGI24740J21852_10002829 JGI24740J21852_100028292 254
341 3300001979 JGI24740J21852_10002831 JGI24740J21852_1000283111 254
342 3300001979 JGI24740J21852_10002832 JGI24740J21852_100028322 254
343 3300001989 JGI24739J22299_10041945 JGI24739J22299_100419452 254
344 3300002705 JGI25156J39149_1001919 JGI25156J39149_10019192 254
345 3300002705 JGI25156J39149_1006956 JGI25156J39149_10069563 254
346 3300002738 JGI25154J39366_1000302 JGI25154J39366_100030222 254
347 3300003322 rootL2_10014661 rootL2_100146614 254
348 3300003354 JGI25160J50197_1000416 JGI25160J50197_10004161 254
349 3300003578 Ga0006562J51391_1092972 Ga0006562J51391_10929721 254
350 3300003752 Ga0055539_1000104 Ga0055539_100010471 254
351 3300003756 Ga0055533_1000423 Ga0055533_100042314 254
352 3300003756 Ga0055533_1004789 Ga0055533_10047893 254
353 3300003758 Ga0055532_1000054 Ga0055532_100005473 254
354 3300003758 Ga0055532_1000113 Ga0055532_10001132 254
355 3300003758 Ga0055532_1000298 Ga0055532_10002982 254
356 3300003758 Ga0055532_1000320 Ga0055532_10003203 254
357 3300003759 Ga0055525_1000245 Ga0055525_100024553 254
358 3300003760 Ga0055527_1000280 Ga0055527_10002803 254
359 3300003760 Ga0055527_1002225 Ga0055527_10022252 254
360 3300003761 Ga0055535_1000037 Ga0055535_100003798 254
361 3300003761 Ga0055535_1000099 Ga0055535_10000993 254
362 3300003761 Ga0055535_1000591 Ga0055535_10005913 254
363 3300003762 Ga0055542_1000135 Ga0055542_100013591 254
364 3300003762 Ga0055542_1000676 Ga0055542_100067610 254
365 3300003762 Ga0055542_1002218 Ga0055542_10022183 254
366 3300003763 Ga0055529_1000070 Ga0055529_100007073 254
367 3300003763 Ga0055529_1000115 Ga0055529_100011528 254
368 3300003763 Ga0055529_1003717 Ga0055529_10037173 254
369 3300003790 Ga0055528_1002312 Ga0055528_10023129 254
370 3300003841 Ga0055541_1010696 Ga0055541_10106962 254
371 3300003856 Ga0058692_1000051 Ga0058692_100005128 254
372 3300003856 Ga0058692_1001263 Ga0058692_10012634 254
373 3300005262 Ga0065165_1001317 Ga0065165_100131731 254
374 3300005272 Ga0065703_1000517 Ga0065703_10005179 254
375 3300005327 Ga0070658_10001433 Ga0070658_100014338 254
376 3300005327 Ga0070658_10028542 Ga0070658_100285425 254
377 3300005335 Ga0070666_10000007 Ga0070666_100000074 254
378 3300005339 Ga0070660_100000020 Ga0070660_10000002037 254
379 3300005339 Ga0070660_100034070 Ga0070660_1000340701 254
380 3300005344 Ga0070661_100000086 Ga0070661_10000008615 254
381 3300005344 Ga0070661_100117539 Ga0070661_1001175392 254
382 3300005344 Ga0070661_100129858 Ga0070661_1001298582 254
383 3300005347 Ga0070668_100465503 Ga0070668_1004655032 254
384 3300005353 Ga0070669_100141168 Ga0070669_1001411682 254
385 3300005366 Ga0070659_100000047 Ga0070659_10000004737 254
386 3300005366 Ga0070659_100002517 Ga0070659_1000025175 254
387 3300005367 Ga0070667_100015049 Ga0070667_1000150495 254
388 3300005455 Ga0070663_100000008 Ga0070663_10000000888 254
389 3300005455 Ga0070663_100001087 Ga0070663_1000010873 254
390 3300005456 Ga0070678_100300313 Ga0070678_1003003132 254
391 3300005548 Ga0070665_100122866 Ga0070665_1001228662 254
392 3300005563 Ga0068855_100380711 Ga0068855_1003807111 254
393 3300005564 Ga0070664_100000009 Ga0070664_10000000987 254
394 3300005577 Ga0068857_100084566 Ga0068857_1000845663 254
395 3300005578 Ga0068854_100000024 Ga0068854_10000002461 254
396 3300005614 Ga0068856_100000019 Ga0068856_100000019100 254
397 3300005614 Ga0068856_100072782 Ga0068856_1000727822 254
398 3300005616 Ga0068852_100010338 Ga0068852_1000103386 254
399 3300005616 Ga0068852_100413498 Ga0068852_1004134982 254
400 3300006946 Ga0079104_1018251 Ga0079104_10182511 254
401 3300009011 Ga0105251_10071372 Ga0105251_100713722 254
402 3300009036 Ga0105244_10000214 Ga0105244_1000021431 254
403 3300009093 Ga0105240_10022047 Ga0105240_100220477 254
404 3300009093 Ga0105240_10477220 Ga0105240_104772202 254
405 3300009093 Ga0105240_10554818 Ga0105240_105548182 254
406 3300009148 Ga0105243_10000005 Ga0105243_10000005540 254
407 3300009545 Ga0105237_10947131 Ga0105237_109471311 254
408 3300009551 Ga0105238_10000173 Ga0105238_100001739 254
409 3300009551 Ga0105238_10057069 Ga0105238_100570694 254
410 3300010375 Ga0105239_10042288 Ga0105239_100422885 254
411 3300013102 Ga0157371_10000047 Ga0157371_1000004796 254
412 3300013102 Ga0157371_10008264 Ga0157371_100082646 254
413 3300013104 Ga0157370_10000004 Ga0157370_10000004244 254
414 3300013104 Ga0157370_10002828 Ga0157370_1000282811 254
415 3300013105 Ga0157369_10000665 Ga0157369_1000066518 254
416 3300013105 Ga0157369_10595675 Ga0157369_105956752 254
417 3300013306 Ga0163162_10000060 Ga0163162_1000006086 254
418 3300013307 Ga0157372_10000221 Ga0157372_1000022150 254
419 3300014497 Ga0182008_10018532 Ga0182008_100185323 254
420 3300014969 Ga0157376_10367650 Ga0157376_103676502 254
421 3300015261 Ga0182006_1005449 Ga0182006_10054492 254
422 3300015262 Ga0182007_10018500 Ga0182007_100185003 254
423 3300017792 Ga0163161_10001354 Ga0163161_100013549 254
424 3300020610 Ga0154015_1213905 Ga0154015_12139052 254
425 3300025224 Ga0209784_100029 Ga0209784_100029115 254
426 3300025224 Ga0209784_100392 Ga0209784_10039218 254
427 3300025224 Ga0209784_101831 Ga0209784_1018313 254
428 3300025225 Ga0209566_100030 Ga0209566_100030223 254
429 3300025225 Ga0209566_100136 Ga0209566_10013665 254
430 3300025225 Ga0209566_100143 Ga0209566_10014363 254
431 3300025225 Ga0209566_104354 Ga0209566_1043541 254
432 3300025226 Ga0209674_100075 Ga0209674_100075105 254
433 3300025226 Ga0209674_100281 Ga0209674_10028127 254
434 3300025226 Ga0209674_100929 Ga0209674_1009295 254
435 3300025228 Ga0209672_100012 Ga0209672_100012404 254
436 3300025228 Ga0209672_100086 Ga0209672_10008640 254
437 3300025228 Ga0209672_100178 Ga0209672_10017853 254
438 3300025229 Ga0209147_100007 Ga0209147_100007367 254
439 3300025229 Ga0209147_100008 Ga0209147_100008477 254
440 3300025229 Ga0209147_100064 Ga0209147_10006435 254
441 3300025229 Ga0209147_100148 Ga0209147_10014879 254
442 3300025230 Ga0209563_100117 Ga0209563_10011739 254
443 3300025242 Ga0209258_100013 Ga0209258_100013477 254
444 3300025242 Ga0209258_100014 Ga0209258_100014336 254
445 3300025242 Ga0209258_100114 Ga0209258_10011491 254
446 3300025246 Ga0209646_1000046 Ga0209646_1000046108 254
447 3300025250 Ga0209026_1001624 Ga0209026_10016247 254
448 3300025253 Ga0209677_100030 Ga0209677_100030223 254
449 3300025253 Ga0209677_107025 Ga0209677_1070251 254
450 3300025254 Ga0209148_1000110 Ga0209148_1000110101 254
451 3300025254 Ga0209148_1000115 Ga0209148_100011591 254
452 3300025254 Ga0209148_1000337 Ga0209148_100033727 254
453 3300025254 Ga0209148_1003337 Ga0209148_10033374 254
454 3300025256 Ga0209759_1001805 Ga0209759_10018058 254
455 3300025256 Ga0209759_1015631 Ga0209759_10156311 254
456 3300025256 Ga0209759_1015643 Ga0209759_10156431 254
457 3300025263 Ga0209565_1026067 Ga0209565_10260672 254
458 3300025272 Ga0209455_1000109 Ga0209455_100010991 254
459 3300025272 Ga0209455_1000130 Ga0209455_100013071 254
460 3300025272 Ga0209455_1000138 Ga0209455_1000138117 254
461 3300025273 Ga0209673_1000101 Ga0209673_100010142 254
462 3300025284 Ga0209130_1003020 Ga0209130_100302010 254
463 3300025295 Ga0209564_1015144 Ga0209564_10151444 254
464 3300025295 Ga0209564_1020982 Ga0209564_10209823 254
465 3300025302 Ga0207426_1000987 Ga0207426_100098731 254
466 3300025711 Ga0207696_1012298 Ga0207696_10122983 254
467 3300025728 Ga0207655_1000169 Ga0207655_100016968 254
468 3300025735 Ga0207713_1002782 Ga0207713_100278215 254
469 3300025903 Ga0207680_10000002 Ga0207680_10000002826 254
470 3300025909 Ga0207705_10004525 Ga0207705_100045254 254
471 3300025913 Ga0207695_10000368 Ga0207695_1000036893 254
472 3300025913 Ga0207695_10002935 Ga0207695_1000293530 254
473 3300025913 Ga0207695_10043283 Ga0207695_100432833 254
474 3300025914 Ga0207671_10116181 Ga0207671_101161812 254
475 3300025919 Ga0207657_10000390 Ga0207657_1000039037 254
476 3300025919 Ga0207657_10063844 Ga0207657_100638441 254
477 3300025920 Ga0207649_10000030 Ga0207649_1000003012 254
478 3300025920 Ga0207649_10076740 Ga0207649_100767402 254
479 3300025920 Ga0207649_10160463 Ga0207649_101604631 254
480 3300025923 Ga0207681_10122042 Ga0207681_101220422 254
481 3300025924 Ga0207694_10000237 Ga0207694_100002376 254
482 3300025924 Ga0207694_10074889 Ga0207694_100748893 254
483 3300025932 Ga0207690_10000037 Ga0207690_1000003768 254
484 3300025932 Ga0207690_10002224 Ga0207690_100022242 254
485 3300025935 Ga0207709_10000001 Ga0207709_10000001886 254
486 3300025945 Ga0207679_10000004 Ga0207679_1000000486 254
487 3300025949 Ga0207667_10010980 Ga0207667_100109806 254
488 3300025972 Ga0207668_10428251 Ga0207668_104282512 254
489 3300025981 Ga0207640_10000066 Ga0207640_1000006622 254
490 3300025986 Ga0207658_10027816 Ga0207658_100278163 254
491 3300026067 Ga0207678_10000006 Ga0207678_1000000686 254
492 3300026067 Ga0207678_10000620 Ga0207678_1000062018 254
493 3300026078 Ga0207702_10000206 Ga0207702_1000020623 254
494 3300026078 Ga0207702_10313941 Ga0207702_103139412 254
495 3300026116 Ga0207674_10027534 Ga0207674_100275347 254
496 3300026121 Ga0207683_10500914 Ga0207683_105009141 254
497 3300026142 Ga0207698_10117627 Ga0207698_101176273 254
498 3300027312 Ga0209371_1000008 Ga0209371_100000826 254
499 3300027312 Ga0209371_1000080 Ga0209371_1000080138 254
500 3300028379 Ga0268266_10000004 Ga0268266_10000004818 254
501 3300030500 Ga0268256_1000009 Ga0268256_100000926 254
502 3300030500 Ga0268256_1000336 Ga0268256_100033644 254
503 3300031727 Ga0316576_10006727 Ga0316576_100067276 254
504 3300031727 Ga0316576_10163453 Ga0316576_101634532 254
505 3300031727 Ga0316576_10280582 Ga0316576_102805821 254
506 3300031728 Ga0316578_10017237 Ga0316578_100172372 254
507 3300033180 Ga0307510_10000690 Ga0307510_1000069013 254
508 3300033180 Ga0307510_10171312 Ga0307510_101713122 254
509 3300035398 Ga0316574_0003503 Ga0316574_0003503_56_820 254
510 3300035398 Ga0316574_0046219 Ga0316574_0046219_1112_1876 254
511 3300036712 Ga0316584_0029326 Ga0316584_0029326_396_1160 254
512 3300037418 Ga0395900_0035249 Ga0395900_0035249_989_1804 254
513 3300037418 Ga0395900_0274434 Ga0395900_0274434_237_1019 254
514 3300037471 Ga0395905_0000057 Ga0395905_0000057_176399_177178 254
515 3300038443 Ga0395901_0113177 Ga0395901_0113177_1804_2586 254
516 3300039437 Ga0436365_1320010 Ga0436365_1320010_333_1115 254
517 3300042006 Ga0439432_001518 Ga0439432_001518_5893_6657 254
518 3300044656 Ga0466969_0008517 Ga0466969_0008517_1496_2275 254
519 3300044658 Ga0466972_0025380 Ga0466972_0025380_573_1352 254
520 3300044671 Ga0466978_0067892 Ga0466978_0067892_479_1258 254
521 3300044683 Ga0466965_0008290 Ga0466965_0008290_2435_3214 254
522 3300044684 Ga0466966_0324427 Ga0466966_0324427_52_831 254
523 3300044693 Ga0466961_0000452 Ga0466961_0000452_4807_5586 254
524 3300044706 Ga0466964_0018702 Ga0466964_0018702_426_1205 254
525 3300044735 Ga0466968_0002968 Ga0466968_0002968_508_1287 254
526 3300044765 Ga0466970_0004146 Ga0466970_0004146_4624_5403 254
527 3300044842 Ga0466957_0170456 Ga0466957_0170456_298_1077 254
528 3300045049 Ga0466959_0014519 Ga0466959_0014519_198_977 254
529 3300045049 Ga0466959_0146698 Ga0466959_0146698_535_1299 254
530 3300045976 Ga0466967_0024390 Ga0466967_0024390_3519_4283 254
531 3300045976 Ga0466967_0208356 Ga0466967_0208356_79_858 254
532 3300046453 Ga0495627_001955 Ga0495627_001955_4267_5031 254
533 3300046454 Ga0495592_0040008 Ga0495592_0040008_2243_3007 254
534 3300046455 Ga0495603_0036845 Ga0495603_0036845_301_1080 254
535 3300046460 Ga0495638_0001346 Ga0495638_0001346_17779_18543 254
536 3300046463 Ga0495653_0008489 Ga0495653_0008489_807_1571 254
537 3300046471 Ga0495650_0000253 Ga0495650_0000253_58663_59430 254
538 3300046472 Ga0495580_0037064 Ga0495580_0037064_2525_3289 254
539 3300046476 Ga0495662_0037440 Ga0495662_0037440_532_1296 254
540 3300046501 Ga0495607_0000126 Ga0495607_0000126_69504_70268 254
541 3300046507 Ga0495606_0019668 Ga0495606_0019668_2756_3520 254
542 3300046514 Ga0495618_0172499 Ga0495618_0172499_600_1364 254
543 3300046516 Ga0495628_0266441 Ga0495628_0266441_192_956 254
544 3300046517 Ga0495630_0084314 Ga0495630_0084314_19_783 254
545 3300046519 Ga0495632_0001014 Ga0495632_0001014_23136_23900 254
546 3300046519 Ga0495632_0061828 Ga0495632_0061828_431_1195 254
547 3300046522 Ga0495643_0002267 Ga0495643_0002267_13649_14413 254
548 3300046524 Ga0495648_0127264 Ga0495648_0127264_411_1190 254
549 3300046525 Ga0495663_0001381 Ga0495663_0001381_5594_6358 254
550 3300046525 Ga0495663_0013124 Ga0495663_0013124_1298_2062 254
551 3300046529 Ga0495652_0106278 Ga0495652_0106278_71_835 254
552 3300046530 Ga0495654_0023396 Ga0495654_0023396_29_793 254
553 3300046531 Ga0495665_0000097 Ga0495665_0000097_11066_11830 254
554 3300046531 Ga0495665_0053844 Ga0495665_0053844_510_1274 254
555 3300046536 Ga0495587_0026423 Ga0495587_0026423_2650_3414 254
556 3300046543 Ga0495645_0039510 Ga0495645_0039510_1066_1830 254
557 3300046543 Ga0495645_0043938 Ga0495645_0043938_1371_2138 254
558 3300046558 Ga0495633_0001470 Ga0495633_0001470_13850_14614 254
559 3300046642 Ga0495634_0079201 Ga0495634_0079201_892_1656 254
560 3300046648 Ga0495611_0136983 Ga0495611_0136983_34_813 254
561 3300046660 Ga0495625_0031341 Ga0495625_0031341_1883_2650 254
562 3300046663 Ga0495635_0037815 Ga0495635_0037815_2137_2901 254
563 3300046665 Ga0495661_0002686 Ga0495661_0002686_8784_9548 254
564 3300046678 Ga0495599_0278112 Ga0495599_0278112_208_972 254
565 3300046679 Ga0495623_0107512 Ga0495623_0107512_756_1520 254
566 3300046680 Ga0495646_0056540 Ga0495646_0056540_264_1028 254
567 3300046690 Ga0495624_0015579 Ga0495624_0015579_270_1034 254
568 3300046694 Ga0495649_0002337 Ga0495649_0002337_4130_4894 254
569 3300046694 Ga0495649_0128334 Ga0495649_0128334_467_1246 254
570 3300046809 Ga0495600_0028740 Ga0495600_0028740_1516_2280 254
571 3300046809 Ga0495600_0079361 Ga0495600_0079361_271_1035 254
572 3300047319 Ga0495674_0005430 Ga0495674_0005430_11414_12193 254
573 3300047319 Ga0495674_0026678 Ga0495674_0026678_736_1500 254
574 3300047319 Ga0495674_0102752 Ga0495674_0102752_1473_2237 254
575 3300047319 Ga0495674_0618696 Ga0495674_0618696_20_784 254
576 3300047321 Ga0495676_0084297 Ga0495676_0084297_22_786 254
577 3300047322 Ga0495680_0006432 Ga0495680_0006432_6276_7040 254
578 3300047470 Ga0495681_0000739 Ga0495681_0000739_10106_10870 254
579 3300048090 Ga0495615_0010446 Ga0495615_0010446_891_1655 254
580 3300048903 Ga0496100_0000388 Ga0496100_0000388_18327_19106 254
581 3300048903 Ga0496100_0298585 Ga0496100_0298585_19_783 254
582 3300048903 Ga0496100_0474564 Ga0496100_0474564_165_944 254
583 3300048904 Ga0496101_0000718 Ga0496101_0000718_18327_19106 254
584 3300048904 Ga0496101_0062832 Ga0496101_0062832_814_1578 254
585 3300048904 Ga0496101_0077334 Ga0496101_0077334_351_1130 254
586 3300048905 Ga0496102_0000927 Ga0496102_0000927_26163_26942 254
587 3300048906 Ga0496103_0003687 Ga0496103_0003687_8359_9138 254
588 3300048907 Ga0496104_0013762 Ga0496104_0013762_2359_3123 254
589 3300048908 Ga0496105_0009045 Ga0496105_0009045_6519_7298 254
590 3300048909 Ga0496106_0447064 Ga0496106_0447064_244_1023 254
591 3300048910 Ga0496107_0251562 Ga0496107_0251562_370_1149 254
592 3300048915 Ga0496112_0180081 Ga0496112_0180081_836_1615 254
593 3300048920 Ga0496117_0001244 Ga0496117_0001244_11181_11960 254
594 3300048920 Ga0496117_0197363 Ga0496117_0197363_183_947 254
595 3300048921 Ga0496118_0001316 Ga0496118_0001316_25319_26098 254
596 3300048921 Ga0496118_0192512 Ga0496118_0192512_201_968 254
597 3300048922 Ga0496119_0074524 Ga0496119_0074524_1021_1800 254
598 3300048924 Ga0496121_0003288 Ga0496121_0003288_689_1468 254
599 3300048924 Ga0496121_0014515 Ga0496121_0014515_244_1023 254
600 3300048924 Ga0496121_0156581 Ga0496121_0156581_200_967 254
601 3300048927 Ga0496124_0351925 Ga0496124_0351925_84_863 254
602 3300048928 Ga0496125_0006213 Ga0496125_0006213_7724_8539 254
603 3300048928 Ga0496125_0064756 Ga0496125_0064756_1839_2606 254
604 3300048929 Ga0496126_0011099 Ga0496126_0011099_5034_5801 254
605 3300048929 Ga0496126_0057676 Ga0496126_0057676_163_942 254
606 3300049460 Ga0495682_0084808 Ga0495682_0084808_260_1039 254
607 3300049575 Ga0501039_0306577 Ga0501039_0306577_34_798 254
608 3300049579 Ga0501043_0284716 Ga0501043_0284716_21_788 254
609 3300053090 Ga0500646_0009422 Ga0500646_0009422_619_1386 254
610 2124908027 MRS2a_Contig_32 MRS2a_00219030 255
611 2124908027 MRS2a_Contig_6316 MRS2a_00215840 255
612 2124908027 MRS2a_Contig_9068 MRS2a_00539670 255
613 3300002737 JGI25162J39368_1000014 JGI25162J39368_1000014311 255
614 3300002737 JGI25162J39368_1000060 JGI25162J39368_1000060126 255
615 3300002737 JGI25162J39368_1000189 JGI25162J39368_100018929 255
616 3300002737 JGI25162J39368_1000284 JGI25162J39368_100028441 255
617 3300002737 JGI25162J39368_1003095 JGI25162J39368_10030952 255
618 3300002738 JGI25154J39366_1008122 JGI25154J39366_10081222 255
619 3300002741 JGI25157J39369_1000343 JGI25157J39369_10003436 255
620 3300002771 JGI25163J39215_1000363 JGI25163J39215_10003635 255
621 3300002771 JGI25163J39215_1000821 JGI25163J39215_10008216 255
622 3300002771 JGI25163J39215_1001950 JGI25163J39215_10019503 255
623 3300002772 JGI25164J39214_1000037 JGI25164J39214_10000373 255
624 3300002772 JGI25164J39214_1000059 JGI25164J39214_100005999 255
625 3300002772 JGI25164J39214_1000093 JGI25164J39214_100009352 255
626 3300003214 JGI25165J46597_1000027 JGI25165J46597_10000279 255
627 3300003214 JGI25165J46597_1000118 JGI25165J46597_10001183 255
628 3300003214 JGI25165J46597_1000283 JGI25165J46597_100028329 255
629 3300003214 JGI25165J46597_1000384 JGI25165J46597_100038441 255
630 3300003751 Ga0055538_1000007 Ga0055538_100000718 255
631 3300003751 Ga0055538_1000149 Ga0055538_100014941 255
632 3300003751 Ga0055538_1002760 Ga0055538_10027602 255
633 3300003752 Ga0055539_1000011 Ga0055539_100001118 255
634 3300003752 Ga0055539_1000199 Ga0055539_10001997 255
635 3300003756 Ga0055533_1000014 Ga0055533_100001418 255
636 3300003756 Ga0055533_1000200 Ga0055533_100020041 255
637 3300003758 Ga0055532_1000009 Ga0055532_100000918 255
638 3300003759 Ga0055525_1000016 Ga0055525_100001618 255
639 3300003759 Ga0055525_1000276 Ga0055525_10002767 255
640 3300003760 Ga0055527_1003792 Ga0055527_10037922 255
641 3300003761 Ga0055535_1000070 Ga0055535_100007069 255
642 3300003761 Ga0055535_1000152 Ga0055535_100015220 255
643 3300003761 Ga0055535_1007800 Ga0055535_10078002 255
644 3300003762 Ga0055542_1000232 Ga0055542_100023230 255
645 3300003762 Ga0055542_1000428 Ga0055542_100042830 255
646 3300003763 Ga0055529_1000024 Ga0055529_1000024242 255
647 3300003763 Ga0055529_1000082 Ga0055529_100008277 255
648 3300003781 Ga0055536_1000128 Ga0055536_100012860 255
649 3300003781 Ga0055536_1016936 Ga0055536_10169362 255
650 3300003791 Ga0055530_10000133 Ga0055530_1000013348 255
651 3300003791 Ga0055530_10000136 Ga0055530_1000013660 255
652 3300003791 Ga0055530_10019242 Ga0055530_100192423 255
653 3300003792 Ga0055540_1000168 Ga0055540_100016848 255
654 3300003792 Ga0055540_1001628 Ga0055540_10016282 255
655 3300003792 Ga0055540_1014046 Ga0055540_10140462 255
656 3300003794 Ga0055531_10000660 Ga0055531_1000066026 255
657 3300003841 Ga0055541_1000008 Ga0055541_100000818 255
658 3300003841 Ga0055541_1000130 Ga0055541_100013041 255
659 3300005288 Ga0065714_10000609 Ga0065714_100006095 255
660 3300005288 Ga0065714_10003622 Ga0065714_100036228 255
661 3300005288 Ga0065714_10010402 Ga0065714_100104021 255
662 3300005288 Ga0065714_10023157 Ga0065714_100231572 255
663 3300005288 Ga0065714_10064921 Ga0065714_100649211 255
664 3300005288 Ga0065714_10065926 Ga0065714_100659265 255
665 3300005289 Ga0065704_10070431 Ga0065704_1007043129 255
666 3300005290 Ga0065712_10069302 Ga0065712_100693025 255
667 3300005290 Ga0065712_10129971 Ga0065712_101299712 255
668 3300005331 Ga0070670_100005474 Ga0070670_1000054747 255
669 3300005331 Ga0070670_100023096 Ga0070670_1000230967 255
670 3300005340 Ga0070689_100002849 Ga0070689_1000028497 255
671 3300005344 Ga0070661_100000829 Ga0070661_1000008297 255
672 3300005353 Ga0070669_100048105 Ga0070669_1000481052 255
673 3300005353 Ga0070669_100529420 Ga0070669_1005294202 255
674 3300005367 Ga0070667_100401119 Ga0070667_1004011191 255
675 3300005435 Ga0070714_100057484 Ga0070714_1000574842 255
676 3300005440 Ga0070705_100021094 Ga0070705_1000210944 255
677 3300005455 Ga0070663_100019634 Ga0070663_1000196344 255
678 3300005457 Ga0070662_100140361 Ga0070662_1001403612 255
679 3300005458 Ga0070681_10103314 Ga0070681_101033143 255
680 3300005468 Ga0070707_100243264 Ga0070707_1002432642 255
681 3300005548 Ga0070665_100336234 Ga0070665_1003362342 255
682 3300005564 Ga0070664_100000878 Ga0070664_10000087811 255
683 3300005578 Ga0068854_100305779 Ga0068854_1003057792 255
684 3300005834 Ga0068851_10000316 Ga0068851_100003162 255
685 3300005843 Ga0068860_100040783 Ga0068860_1000407833 255
686 3300005844 Ga0068862_100071366 Ga0068862_1000713662 255
687 3300006051 Ga0075364_10313726 Ga0075364_103137261 255
688 3300006058 Ga0075432_10019203 Ga0075432_100192033 255
689 3300006058 Ga0075432_10062344 Ga0075432_100623442 255
690 3300006058 Ga0075432_10067352 Ga0075432_100673522 255
691 3300006186 Ga0075369_10006176 Ga0075369_100061764 255
692 3300006852 Ga0075433_10355595 Ga0075433_103555952 255
693 3300006944 Ga0099823_1000006 Ga0099823_1000006110 255
694 3300006946 Ga0079104_1000634 Ga0079104_10006347 255
695 3300006946 Ga0079104_1001392 Ga0079104_10013929 255
696 3300006946 Ga0079104_1030544 Ga0079104_10305442 255
697 3300006948 Ga0099826_10001093 Ga0099826_100010936 255
698 3300009011 Ga0105251_10000102 Ga0105251_1000010260 255
699 3300009011 Ga0105251_10001137 Ga0105251_1000113714 255
700 3300009011 Ga0105251_10001655 Ga0105251_1000165511 255
701 3300009011 Ga0105251_10004803 Ga0105251_100048037 255
702 3300009011 Ga0105251_10006832 Ga0105251_100068322 255
703 3300009011 Ga0105251_10019253 Ga0105251_100192534 255
704 3300009011 Ga0105251_10039419 Ga0105251_100394192 255
705 3300009011 Ga0105251_10059661 Ga0105251_100596611 255
706 3300009036 Ga0105244_10000747 Ga0105244_1000074717 255
707 3300009036 Ga0105244_10001830 Ga0105244_1000183017 255
708 3300009036 Ga0105244_10003046 Ga0105244_1000304615 255
709 3300009036 Ga0105244_10004643 Ga0105244_100046437 255
710 3300009036 Ga0105244_10004788 Ga0105244_100047882 255
711 3300009036 Ga0105244_10010816 Ga0105244_100108162 255
712 3300009036 Ga0105244_10025880 Ga0105244_100258802 255
713 3300009036 Ga0105244_10051542 Ga0105244_100515423 255
714 3300009036 Ga0105244_10152504 Ga0105244_101525042 255
715 3300009036 Ga0105244_10167117 Ga0105244_101671171 255
716 3300009092 Ga0105250_10000134 Ga0105250_1000013445 255
717 3300009092 Ga0105250_10000871 Ga0105250_100008719 255
718 3300009092 Ga0105250_10003991 Ga0105250_100039916 255
719 3300009092 Ga0105250_10018201 Ga0105250_100182012 255
720 3300009092 Ga0105250_10021889 Ga0105250_100218892 255
721 3300009092 Ga0105250_10027038 Ga0105250_100270383 255
722 3300009092 Ga0105250_10031697 Ga0105250_100316973 255
723 3300009092 Ga0105250_10035765 Ga0105250_100357652 255
724 3300009092 Ga0105250_10087034 Ga0105250_100870342 255
725 3300009093 Ga0105240_10000236 Ga0105240_1000023646 255
726 3300009093 Ga0105240_10000477 Ga0105240_1000047748 255
727 3300009094 Ga0111539_10000654 Ga0111539_1000065425 255
728 3300009148 Ga0105243_10000237 Ga0105243_1000023735 255
729 3300009148 Ga0105243_10157258 Ga0105243_101572582 255
730 3300009148 Ga0105243_10622962 Ga0105243_106229621 255
731 3300009176 Ga0105242_10225453 Ga0105242_102254532 255
732 3300009177 Ga0105248_10119368 Ga0105248_101193682 255
733 3300009545 Ga0105237_10000093 Ga0105237_1000009387 255
734 3300009551 Ga0105238_10282271 Ga0105238_102822712 255
735 3300010375 Ga0105239_10000110 Ga0105239_1000011076 255
736 3300011119 Ga0105246_10004388 Ga0105246_100043883 255
737 3300011119 Ga0105246_10016271 Ga0105246_100162713 255
738 3300012498 Ga0157345_1000846 Ga0157345_10008462 255
739 3300013100 Ga0157373_10005588 Ga0157373_1000558810 255
740 3300013100 Ga0157373_10006561 Ga0157373_100065618 255
741 3300013100 Ga0157373_10012693 Ga0157373_100126933 255
742 3300013100 Ga0157373_10040261 Ga0157373_100402612 255
743 3300013100 Ga0157373_10045939 Ga0157373_100459391 255
744 3300013100 Ga0157373_10059024 Ga0157373_100590242 255
745 3300013100 Ga0157373_10102782 Ga0157373_101027822 255
746 3300013100 Ga0157373_10140220 Ga0157373_101402202 255
747 3300013100 Ga0157373_10154908 Ga0157373_101549082 255
748 3300013102 Ga0157371_10000063 Ga0157371_1000006371 255
749 3300013102 Ga0157371_10000771 Ga0157371_1000077127 255
750 3300013102 Ga0157371_10008628 Ga0157371_1000862810 255
751 3300013102 Ga0157371_10046641 Ga0157371_100466412 255
752 3300013102 Ga0157371_10070503 Ga0157371_100705031 255
753 3300013104 Ga0157370_10005705 Ga0157370_100057055 255
754 3300013104 Ga0157370_10018040 Ga0157370_100180404 255
755 3300013104 Ga0157370_10027112 Ga0157370_100271125 255
756 3300013104 Ga0157370_10402870 Ga0157370_104028702 255
757 3300013104 Ga0157370_10414173 Ga0157370_104141732 255
758 3300013105 Ga0157369_10003070 Ga0157369_100030707 255
759 3300013105 Ga0157369_10005410 Ga0157369_100054107 255
760 3300013105 Ga0157369_10008111 Ga0157369_100081118 255
761 3300013105 Ga0157369_10013986 Ga0157369_100139862 255
762 3300013105 Ga0157369_10090126 Ga0157369_100901262 255
763 3300013306 Ga0163162_10003289 Ga0163162_1000328914 255
764 3300013306 Ga0163162_10004520 Ga0163162_100045202 255
765 3300013307 Ga0157372_10049320 Ga0157372_100493204 255
766 3300013307 Ga0157372_10143375 Ga0157372_101433752 255
767 3300013308 Ga0157375_10006434 Ga0157375_100064347 255
768 3300013308 Ga0157375_10008932 Ga0157375_1000893210 255
769 3300013308 Ga0157375_10072211 Ga0157375_100722113 255
770 3300014497 Ga0182008_10005509 Ga0182008_100055096 255
771 3300014497 Ga0182008_10006760 Ga0182008_100067606 255
772 3300014497 Ga0182008_10016833 Ga0182008_100168334 255
773 3300014497 Ga0182008_10019436 Ga0182008_100194362 255
774 3300014497 Ga0182008_10189968 Ga0182008_101899681 255
775 3300015261 Ga0182006_1000879 Ga0182006_100087920 255
776 3300015261 Ga0182006_1001712 Ga0182006_10017126 255
777 3300015261 Ga0182006_1006193 Ga0182006_10061932 255
778 3300015261 Ga0182006_1039233 Ga0182006_10392332 255
779 3300015261 Ga0182006_1042491 Ga0182006_10424912 255
780 3300015262 Ga0182007_10000071 Ga0182007_1000007154 255
781 3300015262 Ga0182007_10001058 Ga0182007_1000105810 255
782 3300015262 Ga0182007_10004004 Ga0182007_100040046 255
783 3300015262 Ga0182007_10026296 Ga0182007_100262963 255
784 3300015265 Ga0182005_1000589 Ga0182005_100058912 255
785 3300015265 Ga0182005_1000811 Ga0182005_10008116 255
786 3300015265 Ga0182005_1002153 Ga0182005_10021532 255
787 3300015265 Ga0182005_1010978 Ga0182005_10109782 255
788 3300017792 Ga0163161_10003740 Ga0163161_100037405 255
789 3300017792 Ga0163161_10015978 Ga0163161_100159787 255
790 3300017792 Ga0163161_10031234 Ga0163161_100312344 255
791 3300017792 Ga0163161_10209933 Ga0163161_102099332 255
792 3300025206 Ga0209435_106550 Ga0209435_1065502 255
793 3300025207 Ga0209760_100023 Ga0209760_100023154 255
794 3300025207 Ga0209760_100025 Ga0209760_100025105 255
795 3300025207 Ga0209760_100303 Ga0209760_10030313 255
796 3300025224 Ga0209784_100011 Ga0209784_100011391 255
797 3300025224 Ga0209784_100023 Ga0209784_10002317 255
798 3300025224 Ga0209784_100191 Ga0209784_10019143 255
799 3300025225 Ga0209566_100019 Ga0209566_10001930 255
800 3300025225 Ga0209566_100252 Ga0209566_10025246 255
801 3300025226 Ga0209674_100034 Ga0209674_10003430 255
802 3300025226 Ga0209674_100069 Ga0209674_10006943 255
803 3300025228 Ga0209672_100932 Ga0209672_1009324 255
804 3300025228 Ga0209672_102818 Ga0209672_1028183 255
805 3300025228 Ga0209672_103204 Ga0209672_1032042 255
806 3300025229 Ga0209147_100027 Ga0209147_10002732 255
807 3300025230 Ga0209563_100037 Ga0209563_10003730 255
808 3300025230 Ga0209563_100167 Ga0209563_10016742 255
809 3300025230 Ga0209563_101923 Ga0209563_1019231 255
810 3300025231 Ga0207427_100003 Ga0207427_100003486 255
811 3300025231 Ga0207427_100018 Ga0207427_100018153 255
812 3300025231 Ga0207427_100026 Ga0207427_100026279 255
813 3300025231 Ga0207427_100965 Ga0207427_10096512 255
814 3300025231 Ga0207427_101377 Ga0207427_1013778 255
815 3300025233 Ga0209437_100002 Ga0209437_100002527 255
816 3300025233 Ga0209437_100031 Ga0209437_100031153 255
817 3300025233 Ga0209437_100076 Ga0209437_1000768 255
818 3300025233 Ga0209437_100091 Ga0209437_10009142 255
819 3300025233 Ga0209437_100241 Ga0209437_10024150 255
820 3300025242 Ga0209258_100027 Ga0209258_100027156 255
821 3300025242 Ga0209258_100268 Ga0209258_10026817 255
822 3300025246 Ga0209646_1000373 Ga0209646_10003735 255
823 3300025246 Ga0209646_1000483 Ga0209646_10004838 255
824 3300025250 Ga0209026_1000018 Ga0209026_100001850 255
825 3300025250 Ga0209026_1002499 Ga0209026_10024997 255
826 3300025253 Ga0209677_100021 Ga0209677_10002130 255
827 3300025253 Ga0209677_100039 Ga0209677_10003943 255
828 3300025254 Ga0209148_1000001 Ga0209148_1000001894 255
829 3300025254 Ga0209148_1000002 Ga0209148_10000021011 255
830 3300025256 Ga0209759_1001928 Ga0209759_10019284 255
831 3300025256 Ga0209759_1002261 Ga0209759_10022617 255
832 3300025261 Ga0209233_1000002 Ga0209233_10000021336 255
833 3300025261 Ga0209233_1000004 Ga0209233_1000004898 255
834 3300025261 Ga0209233_1000012 Ga0209233_1000012152 255
835 3300025261 Ga0209233_1000115 Ga0209233_100011542 255
836 3300025261 Ga0209233_1022203 Ga0209233_10222032 255
837 3300025272 Ga0209455_1000019 Ga0209455_1000019223 255
838 3300025272 Ga0209455_1011627 Ga0209455_10116272 255
839 3300025291 Ga0209675_1008356 Ga0209675_10083562 255
840 3300025292 Ga0209676_1000002 Ga0209676_1000002493 255
841 3300025292 Ga0209676_1000003 Ga0209676_10000031214 255
842 3300025292 Ga0209676_1000154 Ga0209676_1000154164 255
843 3300025292 Ga0209676_1000292 Ga0209676_100029212 255
844 3300025292 Ga0209676_1002683 Ga0209676_10026838 255
845 3300025298 Ga0209050_1000004 Ga0209050_10000041196 255
846 3300025298 Ga0209050_1000006 Ga0209050_10000061078 255
847 3300025298 Ga0209050_1000043 Ga0209050_1000043240 255
848 3300025298 Ga0209050_1002777 Ga0209050_10027778 255
849 3300025303 Ga0209051_1000001 Ga0209051_1000001493 255
850 3300025303 Ga0209051_1000030 Ga0209051_1000030110 255
851 3300025303 Ga0209051_1000052 Ga0209051_100005260 255
852 3300025303 Ga0209051_1007183 Ga0209051_10071835 255
853 3300025304 Ga0209257_1000056 Ga0209257_1000056162 255
854 3300025304 Ga0209257_1068343 Ga0209257_10683432 255
855 3300025321 Ga0207656_10003183 Ga0207656_100031837 255
856 3300025711 Ga0207696_1000018 Ga0207696_1000018370 255
857 3300025711 Ga0207696_1000051 Ga0207696_100005178 255
858 3300025711 Ga0207696_1000075 Ga0207696_1000075152 255
859 3300025711 Ga0207696_1000091 Ga0207696_100009172 255
860 3300025711 Ga0207696_1004919 Ga0207696_10049196 255
861 3300025711 Ga0207696_1012432 Ga0207696_10124323 255
862 3300025711 Ga0207696_1020971 Ga0207696_10209712 255
863 3300025711 Ga0207696_1029363 Ga0207696_10293631 255
864 3300025711 Ga0207696_1035654 Ga0207696_10356542 255
865 3300025711 Ga0207696_1043445 Ga0207696_10434451 255
866 3300025728 Ga0207655_1000006 Ga0207655_100000673 255
867 3300025728 Ga0207655_1000081 Ga0207655_1000081125 255
868 3300025728 Ga0207655_1000118 Ga0207655_1000118108 255
869 3300025728 Ga0207655_1000180 Ga0207655_100018038 255
870 3300025728 Ga0207655_1000438 Ga0207655_100043827 255
871 3300025728 Ga0207655_1000905 Ga0207655_10009054 255
872 3300025728 Ga0207655_1004687 Ga0207655_100468710 255
873 3300025728 Ga0207655_1007309 Ga0207655_10073097 255
874 3300025728 Ga0207655_1017319 Ga0207655_10173193 255
875 3300025728 Ga0207655_1021413 Ga0207655_10214132 255
876 3300025728 Ga0207655_1021464 Ga0207655_10214642 255
877 3300025728 Ga0207655_1028561 Ga0207655_10285613 255
878 3300025728 Ga0207655_1046160 Ga0207655_10461602 255
879 3300025728 Ga0207655_1087567 Ga0207655_10875671 255
880 3300025728 Ga0207655_1100278 Ga0207655_11002781 255
881 3300025735 Ga0207713_1000071 Ga0207713_100007196 255
882 3300025735 Ga0207713_1000107 Ga0207713_100010726 255
883 3300025735 Ga0207713_1000348 Ga0207713_10003486 255
884 3300025735 Ga0207713_1000668 Ga0207713_10006687 255
885 3300025735 Ga0207713_1001525 Ga0207713_10015255 255
886 3300025735 Ga0207713_1002582 Ga0207713_10025823 255
887 3300025735 Ga0207713_1007142 Ga0207713_10071424 255
888 3300025735 Ga0207713_1010455 Ga0207713_10104551 255
889 3300025735 Ga0207713_1011683 Ga0207713_10116833 255
890 3300025735 Ga0207713_1023710 Ga0207713_10237102 255
891 3300025735 Ga0207713_1024231 Ga0207713_10242312 255
892 3300025735 Ga0207713_1046780 Ga0207713_10467801 255
893 3300025735 Ga0207713_1050192 Ga0207713_10501921 255
894 3300025904 Ga0207647_10024046 Ga0207647_100240463 255
895 3300025912 Ga0207707_10110341 Ga0207707_101103411 255
896 3300025913 Ga0207695_10000422 Ga0207695_1000042233 255
897 3300025913 Ga0207695_10000699 Ga0207695_1000069946 255
898 3300025914 Ga0207671_10000604 Ga0207671_1000060425 255
899 3300025920 Ga0207649_10000639 Ga0207649_1000063912 255
900 3300025921 Ga0207652_10167369 Ga0207652_101673691 255
901 3300025925 Ga0207650_10000248 Ga0207650_100002483 255
902 3300025925 Ga0207650_10001620 Ga0207650_1000162012 255
903 3300025929 Ga0207664_10095236 Ga0207664_100952363 255
904 3300025929 Ga0207664_10546531 Ga0207664_105465311 255
905 3300025933 Ga0207706_10148059 Ga0207706_101480591 255
906 3300025934 Ga0207686_10007977 Ga0207686_100079775 255
907 3300025935 Ga0207709_10000014 Ga0207709_10000014227 255
908 3300025935 Ga0207709_10003799 Ga0207709_100037997 255
909 3300025935 Ga0207709_10099027 Ga0207709_100990272 255
910 3300025936 Ga0207670_10004252 Ga0207670_100042524 255
911 3300025945 Ga0207679_10000021 Ga0207679_10000021186 255
912 3300025961 Ga0207712_10232989 Ga0207712_102329892 255
913 3300026067 Ga0207678_10079080 Ga0207678_100790803 255
914 3300027111 Ga0209281_1000009 Ga0209281_1000009608 255
915 3300027111 Ga0209281_1000063 Ga0209281_100006384 255
916 3300027111 Ga0209281_1009821 Ga0209281_10098211 255
917 3300027296 Ga0209389_1000030 Ga0209389_1000030105 255
918 3300027312 Ga0209371_1000648 Ga0209371_100064815 255
919 3300027312 Ga0209371_1000987 Ga0209371_10009878 255
920 3300027378 Ga0209981_1015241 Ga0209981_10152411 255
921 3300027424 Ga0209984_1009884 Ga0209984_10098842 255
922 3300027552 Ga0209982_1010569 Ga0209982_10105692 255
923 3300027665 Ga0209983_1000166 Ga0209983_10001667 255
924 3300027666 Ga0209282_1020026 Ga0209282_10200263 255
925 3300027876 Ga0209974_10016587 Ga0209974_100165873 255
926 3300027907 Ga0207428_10008088 Ga0207428_100080882 255
927 3300027907 Ga0207428_10011066 Ga0207428_100110662 255
928 3300027907 Ga0207428_10016200 Ga0207428_100162003 255
929 3300027907 Ga0207428_10038833 Ga0207428_100388332 255
930 3300027907 Ga0207428_10128151 Ga0207428_101281512 255
931 3300027907 Ga0207428_10291326 Ga0207428_102913262 255
932 3300028379 Ga0268266_10067515 Ga0268266_100675152 255
933 3300028381 Ga0268264_10070533 Ga0268264_100705332 255
934 3300028786 Ga0307517_10088658 Ga0307517_100886583 255
935 3300030500 Ga0268256_1000554 Ga0268256_100055414 255
936 3300030500 Ga0268256_1000937 Ga0268256_100093722 255
937 3300030521 Ga0307511_10043985 Ga0307511_100439854 255
938 3300030521 Ga0307511_10149906 Ga0307511_101499062 255
939 3300030731 Ga0316177_1205272 Ga0316177_12052722 255
940 3300030735 Ga0316178_1064394 Ga0316178_10643945 255
941 3300030742 Ga0316183_1196296 Ga0316183_11962961 255
942 3300031344 Ga0265316_10000115 Ga0265316_1000011552 255
943 3300031456 Ga0307513_10416043 Ga0307513_104160432 255
944 3300031507 Ga0307509_10113887 Ga0307509_101138872 255
945 3300031548 Ga0307408_100000004 Ga0307408_10000000498 255
946 3300031824 Ga0307413_10048852 Ga0307413_100488523 255
947 3300031824 Ga0307413_10184566 Ga0307413_101845662 255
948 3300031911 Ga0307412_10095497 Ga0307412_100954974 255
949 3300031995 Ga0307409_100758865 Ga0307409_1007588652 255
950 3300032004 Ga0307414_10013367 Ga0307414_100133672 255
951 3300032004 Ga0307414_10079658 Ga0307414_100796582 255
952 3300032004 Ga0307414_10152001 Ga0307414_101520011 255
953 3300033180 Ga0307510_10027986 Ga0307510_100279861 255
954 3300033180 Ga0307510_10072696 Ga0307510_100726963 255
955 3300035695 Ga0373927_0005765 Ga0373927_0005765_3696_4472 255
956 3300035695 Ga0373927_0016180 Ga0373927_0016180_4028_4804 255
957 3300037312 Ga0395899_0003484 Ga0395899_0003484_8906_9676 255
958 3300037418 Ga0395900_0000375 Ga0395900_0000375_54859_55629 255
959 3300037466 Ga0395898_0000629 Ga0395898_0000629_8906_9676 255
960 3300037471 Ga0395905_0000361 Ga0395905_0000361_8889_9659 255
961 3300038443 Ga0395901_0000273 Ga0395901_0000273_8814_9584 255
962 3300039438 Ga0436360_0164946 Ga0436360_0164946_209_979 255
963 3300041404 Ga0439436_0000106 Ga0439436_0000106_12865_13632 255
964 3300041405 Ga0439438_001974 Ga0439438_001974_7707_8474 255
965 3300041405 Ga0439438_004830 Ga0439438_004830_1476_2243 255
966 3300041405 Ga0439438_024782 Ga0439438_024782_126_893 255
967 3300041407 Ga0439447_000525 Ga0439447_000525_3320_4087 255
968 3300041407 Ga0439447_001903 Ga0439447_001903_6662_7429 255
969 3300041407 Ga0439447_003996 Ga0439447_003996_4351_5118 255
970 3300041407 Ga0439447_023578 Ga0439447_023578_366_1133 255
971 3300041411 Ga0439466_0000300 Ga0439466_0000300_2246_3013 255
972 3300041451 Ga0451791_0841832 Ga0451791_0841832_193_963 255
973 3300041452 Ga0451793_1469259 Ga0451793_1469259_227_997 255
974 3300041486 Ga0451807_0076174 Ga0451807_0076174_851_1621 255
975 3300041512 Ga0451853_0125673 Ga0451853_0125673_574_1344 255
976 3300042000 Ga0439437_000014 Ga0439437_000014_4395_5162 255
977 3300042006 Ga0439432_000827 Ga0439432_000827_6578_7345 255
978 3300042006 Ga0439432_015687 Ga0439432_015687_1653_2420 255
979 3300042006 Ga0439432_048533 Ga0439432_048533_399_1166 255
980 3300042010 Ga0439452_000111 Ga0439452_000111_24201_24968 255
981 3300042010 Ga0439452_000746 Ga0439452_000746_9573_10340 255
982 3300042010 Ga0439452_000965 Ga0439452_000965_5419_6186 255
983 3300042010 Ga0439452_001703 Ga0439452_001703_292_1059 255
984 3300042010 Ga0439452_003775 Ga0439452_003775_664_1431 255
985 3300042013 Ga0439456_000056 Ga0439456_000056_19127_19894 255
986 3300042013 Ga0439456_001125 Ga0439456_001125_2237_3004 255
987 3300042013 Ga0439456_008397 Ga0439456_008397_1113_1880 255
988 3300042016 Ga0439463_001085 Ga0439463_001085_3587_4354 255
989 3300042016 Ga0439463_001174 Ga0439463_001174_5432_6199 255
990 3300042115 Ga0450911_000031 Ga0450911_000031_9564_10331 255
991 3300042115 Ga0450911_001025 Ga0450911_001025_5311_6078 255
992 3300042115 Ga0450911_002258 Ga0450911_002258_2282_3049 255
993 3300042137 Ga0450902_000106 Ga0450902_000106_7395_8162 255
994 3300042139 Ga0450904_000050 Ga0450904_000050_6568_7335 255
995 3300042142 Ga0450905_006341 Ga0450905_006341_628_1395 255
996 3300042145 Ga0450906_000469 Ga0450906_000469_7243_8010 255
997 3300042145 Ga0450906_001776 Ga0450906_001776_531_1298 255
998 3300042146 Ga0450907_000230 Ga0450907_000230_6791_7558 255
999 3300042146 Ga0450907_000552 Ga0450907_000552_997_1764 255
1000 3300042156 Ga0439446_0002938 Ga0439446_0002938_3304_4071 255
1001 3300042184 Ga0450908_016309 Ga0450908_016309_453_1220 255
1002 3300042185 Ga0450909_000726 Ga0450909_000726_3422_4189 255
1003 3300044673 Ga0453683_0001494 Ga0453683_0001494_19211_19981 255
1004 3300045051 Ga0451576_0038910 Ga0451576_0038910_2717_3487 255
1005 3300046452 Ga0495617_000229 Ga0495617_000229_19798_20565 255
1006 3300046452 Ga0495617_000375 Ga0495617_000375_6200_6967 255
1007 3300046452 Ga0495617_004404 Ga0495617_004404_249_1016 255
1008 3300046452 Ga0495617_024238 Ga0495617_024238_706_1476 255
1009 3300046453 Ga0495627_000010 Ga0495627_000010_101342_102109 255
1010 3300046453 Ga0495627_000349 Ga0495627_000349_22827_23600 255
1011 3300046453 Ga0495627_000726 Ga0495627_000726_11607_12374 255
1012 3300046453 Ga0495627_001494 Ga0495627_001494_7036_7803 255
1013 3300046453 Ga0495627_006251 Ga0495627_006251_3788_4555 255
1014 3300046453 Ga0495627_013710 Ga0495627_013710_150_917 255
1015 3300046453 Ga0495627_015638 Ga0495627_015638_92_859 255
1016 3300046454 Ga0495592_0016909 Ga0495592_0016909_2213_2983 255
1017 3300046455 Ga0495603_0032999 Ga0495603_0032999_525_1292 255
1018 3300046455 Ga0495603_0082235 Ga0495603_0082235_401_1168 255
1019 3300046457 Ga0495590_0004974 Ga0495590_0004974_4422_5189 255
1020 3300046457 Ga0495590_0006739 Ga0495590_0006739_551_1318 255
1021 3300046457 Ga0495590_0143957 Ga0495590_0143957_17_784 255
1022 3300046458 Ga0495591_000002 Ga0495591_000002_399241_400008 255
1023 3300046458 Ga0495591_000552 Ga0495591_000552_5981_6748 255
1024 3300046458 Ga0495591_000716 Ga0495591_000716_15676_16443 255
1025 3300046458 Ga0495591_001132 Ga0495591_001132_4988_5755 255
1026 3300046458 Ga0495591_001302 Ga0495591_001302_7737_8504 255
1027 3300046458 Ga0495591_001713 Ga0495591_001713_12281_13072 255
1028 3300046458 Ga0495591_003220 Ga0495591_003220_7351_8118 255
1029 3300046458 Ga0495591_003419 Ga0495591_003419_110_877 255
1030 3300046458 Ga0495591_005256 Ga0495591_005256_1311_2078 255
1031 3300046458 Ga0495591_016746 Ga0495591_016746_1539_2306 255
1032 3300046458 Ga0495591_020183 Ga0495591_020183_163_930 255
1033 3300046458 Ga0495591_062398 Ga0495591_062398_63_830 255
1034 3300046459 Ga0495629_0027963 Ga0495629_0027963_3054_3821 255
1035 3300046460 Ga0495638_0000082 Ga0495638_0000082_102458_103228 255
1036 3300046460 Ga0495638_0000104 Ga0495638_0000104_83046_83816 255
1037 3300046460 Ga0495638_0003851 Ga0495638_0003851_2505_3272 255
1038 3300046460 Ga0495638_0007301 Ga0495638_0007301_172_939 255
1039 3300046460 Ga0495638_0022636 Ga0495638_0022636_3338_4105 255
1040 3300046460 Ga0495638_0032471 Ga0495638_0032471_2399_3166 255
1041 3300046460 Ga0495638_0059842 Ga0495638_0059842_1136_1903 255
1042 3300046460 Ga0495638_0064539 Ga0495638_0064539_147_914 255
1043 3300046460 Ga0495638_0157314 Ga0495638_0157314_223_990 255
1044 3300046462 Ga0495651_0011284 Ga0495651_0011284_2310_3080 255
1045 3300046463 Ga0495653_0000286 Ga0495653_0000286_12811_13641 255
1046 3300046463 Ga0495653_0007198 Ga0495653_0007198_630_1400 255
1047 3300046463 Ga0495653_0030419 Ga0495653_0030419_3034_3801 255
1048 3300046463 Ga0495653_0036906 Ga0495653_0036906_431_1198 255
1049 3300046463 Ga0495653_0121827 Ga0495653_0121827_169_936 255
1050 3300046471 Ga0495650_0000308 Ga0495650_0000308_68046_68813 255
1051 3300046471 Ga0495650_0000443 Ga0495650_0000443_12922_13692 255
1052 3300046471 Ga0495650_0004320 Ga0495650_0004320_8878_9645 255
1053 3300046471 Ga0495650_0005314 Ga0495650_0005314_1482_2249 255
1054 3300046471 Ga0495650_0007802 Ga0495650_0007802_2532_3299 255
1055 3300046471 Ga0495650_0009372 Ga0495650_0009372_4692_5459 255
1056 3300046471 Ga0495650_0023541 Ga0495650_0023541_2099_2866 255
1057 3300046471 Ga0495650_0023911 Ga0495650_0023911_276_1043 255
1058 3300046471 Ga0495650_0047827 Ga0495650_0047827_967_1734 255
1059 3300046472 Ga0495580_0086639 Ga0495580_0086639_184_960 255
1060 3300046473 Ga0495582_0017768 Ga0495582_0017768_205_972 255
1061 3300046474 Ga0495605_0000002 Ga0495605_0000002_446927_447694 255
1062 3300046474 Ga0495605_0000200 Ga0495605_0000200_5210_6004 255
1063 3300046474 Ga0495605_0000566 Ga0495605_0000566_6075_6842 255
1064 3300046474 Ga0495605_0001105 Ga0495605_0001105_11588_12355 255
1065 3300046474 Ga0495605_0006139 Ga0495605_0006139_555_1322 255
1066 3300046474 Ga0495605_0013008 Ga0495605_0013008_3574_4341 255
1067 3300046474 Ga0495605_0015511 Ga0495605_0015511_1153_1920 255
1068 3300046474 Ga0495605_0025554 Ga0495605_0025554_664_1431 255
1069 3300046474 Ga0495605_0044991 Ga0495605_0044991_126_893 255
1070 3300046475 Ga0495639_0000046 Ga0495639_0000046_27367_28134 255
1071 3300046491 Ga0495584_0001071 Ga0495584_0001071_6695_7462 255
1072 3300046491 Ga0495584_0001367 Ga0495584_0001367_4824_5591 255
1073 3300046491 Ga0495584_0003878 Ga0495584_0003878_6336_7103 255
1074 3300046491 Ga0495584_0011160 Ga0495584_0011160_3045_3812 255
1075 3300046491 Ga0495584_0023129 Ga0495584_0023129_98_865 255
1076 3300046491 Ga0495584_0062819 Ga0495584_0062819_142_909 255
1077 3300046491 Ga0495584_0094078 Ga0495584_0094078_305_1072 255
1078 3300046492 Ga0495585_0001725 Ga0495585_0001725_6191_6958 255
1079 3300046492 Ga0495585_0003977 Ga0495585_0003977_108_875 255
1080 3300046492 Ga0495585_0004411 Ga0495585_0004411_2130_2960 255
1081 3300046492 Ga0495585_0005258 Ga0495585_0005258_6714_7481 255
1082 3300046492 Ga0495585_0009917 Ga0495585_0009917_4757_5524 255
1083 3300046492 Ga0495585_0010681 Ga0495585_0010681_4304_5071 255
1084 3300046492 Ga0495585_0013111 Ga0495585_0013111_3827_4594 255
1085 3300046492 Ga0495585_0043151 Ga0495585_0043151_1649_2416 255
1086 3300046492 Ga0495585_0049073 Ga0495585_0049073_872_1639 255
1087 3300046492 Ga0495585_0064229 Ga0495585_0064229_1105_1872 255
1088 3300046492 Ga0495585_0232308 Ga0495585_0232308_60_827 255
1089 3300046499 Ga0495594_0004046 Ga0495594_0004046_140_907 255
1090 3300046499 Ga0495594_0016851 Ga0495594_0016851_2913_3680 255
1091 3300046500 Ga0495596_0001239 Ga0495596_0001239_7695_8462 255
1092 3300046500 Ga0495596_0001407 Ga0495596_0001407_10408_11175 255
1093 3300046500 Ga0495596_0029160 Ga0495596_0029160_1045_1812 255
1094 3300046501 Ga0495607_0000118 Ga0495607_0000118_35028_35795 255
1095 3300046501 Ga0495607_0000258 Ga0495607_0000258_51419_52186 255
1096 3300046501 Ga0495607_0000667 Ga0495607_0000667_25831_26598 255
1097 3300046501 Ga0495607_0000863 Ga0495607_0000863_23350_24117 255
1098 3300046501 Ga0495607_0001252 Ga0495607_0001252_8869_9636 255
1099 3300046501 Ga0495607_0002334 Ga0495607_0002334_9911_10678 255
1100 3300046501 Ga0495607_0003109 Ga0495607_0003109_5798_6565 255
1101 3300046501 Ga0495607_0005159 Ga0495607_0005159_2211_2978 255
1102 3300046501 Ga0495607_0017338 Ga0495607_0017338_3467_4234 255
1103 3300046501 Ga0495607_0019022 Ga0495607_0019022_96_863 255
1104 3300046501 Ga0495607_0020688 Ga0495607_0020688_772_1539 255
1105 3300046501 Ga0495607_0036674 Ga0495607_0036674_96_863 255
1106 3300046501 Ga0495607_0108636 Ga0495607_0108636_508_1299 255
1107 3300046501 Ga0495607_0142011 Ga0495607_0142011_331_1098 255
1108 3300046506 Ga0495583_0000211 Ga0495583_0000211_74659_75426 255
1109 3300046506 Ga0495583_0000522 Ga0495583_0000522_34008_34775 255
1110 3300046506 Ga0495583_0001552 Ga0495583_0001552_12815_13846 255
1111 3300046506 Ga0495583_0001557 Ga0495583_0001557_20346_21113 255
1112 3300046506 Ga0495583_0003333 Ga0495583_0003333_7385_8152 255
1113 3300046506 Ga0495583_0032104 Ga0495583_0032104_307_1074 255
1114 3300046507 Ga0495606_0000028 Ga0495606_0000028_101633_102400 255
1115 3300046507 Ga0495606_0000113 Ga0495606_0000113_85694_86464 255
1116 3300046507 Ga0495606_0001112 Ga0495606_0001112_15622_16389 255
1117 3300046507 Ga0495606_0002242 Ga0495606_0002242_10524_11291 255
1118 3300046507 Ga0495606_0002270 Ga0495606_0002270_19170_19937 255
1119 3300046507 Ga0495606_0004017 Ga0495606_0004017_8276_9043 255
1120 3300046507 Ga0495606_0007618 Ga0495606_0007618_1482_2249 255
1121 3300046507 Ga0495606_0020238 Ga0495606_0020238_834_1601 255
1122 3300046507 Ga0495606_0030772 Ga0495606_0030772_2803_3570 255
1123 3300046507 Ga0495606_0043564 Ga0495606_0043564_96_863 255
1124 3300046507 Ga0495606_0076229 Ga0495606_0076229_885_1652 255
1125 3300046507 Ga0495606_0122544 Ga0495606_0122544_471_1238 255
1126 3300046507 Ga0495606_0209619 Ga0495606_0209619_273_1040 255
1127 3300046511 Ga0495608_0009640 Ga0495608_0009640_715_1485 255
1128 3300046511 Ga0495608_0016255 Ga0495608_0016255_693_1463 255
1129 3300046512 Ga0495610_0001319 Ga0495610_0001319_6879_7646 255
1130 3300046512 Ga0495610_0004838 Ga0495610_0004838_8737_9504 255
1131 3300046512 Ga0495610_0006567 Ga0495610_0006567_6796_7563 255
1132 3300046512 Ga0495610_0009489 Ga0495610_0009489_5037_5804 255
1133 3300046512 Ga0495610_0023193 Ga0495610_0023193_331_1098 255
1134 3300046512 Ga0495610_0024089 Ga0495610_0024089_172_939 255
1135 3300046512 Ga0495610_0031470 Ga0495610_0031470_1347_2114 255
1136 3300046512 Ga0495610_0033156 Ga0495610_0033156_835_1602 255
1137 3300046512 Ga0495610_0048220 Ga0495610_0048220_343_1110 255
1138 3300046512 Ga0495610_0125203 Ga0495610_0125203_147_914 255
1139 3300046513 Ga0495616_0000857 Ga0495616_0000857_16366_17133 255
1140 3300046513 Ga0495616_0003179 Ga0495616_0003179_842_1609 255
1141 3300046513 Ga0495616_0004131 Ga0495616_0004131_7400_8167 255
1142 3300046513 Ga0495616_0006210 Ga0495616_0006210_6324_7091 255
1143 3300046513 Ga0495616_0016223 Ga0495616_0016223_3266_4033 255
1144 3300046513 Ga0495616_0016324 Ga0495616_0016324_292_1059 255
1145 3300046513 Ga0495616_0032625 Ga0495616_0032625_542_1309 255
1146 3300046513 Ga0495616_0042372 Ga0495616_0042372_93_860 255
1147 3300046513 Ga0495616_0043723 Ga0495616_0043723_1272_2039 255
1148 3300046513 Ga0495616_0066626 Ga0495616_0066626_594_1361 255
1149 3300046513 Ga0495616_0090913 Ga0495616_0090913_250_1017 255
1150 3300046513 Ga0495616_0177100 Ga0495616_0177100_101_868 255
1151 3300046514 Ga0495618_0033456 Ga0495618_0033456_2353_3123 255
1152 3300046514 Ga0495618_0093572 Ga0495618_0093572_261_1031 255
1153 3300046515 Ga0495620_0000037 Ga0495620_0000037_16879_17646 255
1154 3300046515 Ga0495620_0000159 Ga0495620_0000159_3008_3775 255
1155 3300046515 Ga0495620_0000286 Ga0495620_0000286_12806_13573 255
1156 3300046515 Ga0495620_0002349 Ga0495620_0002349_6562_7329 255
1157 3300046515 Ga0495620_0003981 Ga0495620_0003981_7532_8299 255
1158 3300046515 Ga0495620_0011932 Ga0495620_0011932_1724_2491 255
1159 3300046515 Ga0495620_0033675 Ga0495620_0033675_1227_1994 255
1160 3300046515 Ga0495620_0053522 Ga0495620_0053522_843_1610 255
1161 3300046516 Ga0495628_0000554 Ga0495628_0000554_4148_4918 255
1162 3300046517 Ga0495630_0035043 Ga0495630_0035043_2843_3610 255
1163 3300046517 Ga0495630_0066785 Ga0495630_0066785_285_1052 255
1164 3300046518 Ga0495631_0000659 Ga0495631_0000659_2344_3117 255
1165 3300046518 Ga0495631_0001210 Ga0495631_0001210_13853_14620 255
1166 3300046518 Ga0495631_0001434 Ga0495631_0001434_10050_10817 255
1167 3300046518 Ga0495631_0016452 Ga0495631_0016452_2558_3325 255
1168 3300046518 Ga0495631_0024924 Ga0495631_0024924_96_863 255
1169 3300046519 Ga0495632_0000376 Ga0495632_0000376_22624_23391 255
1170 3300046519 Ga0495632_0001667 Ga0495632_0001667_6786_7553 255
1171 3300046519 Ga0495632_0002534 Ga0495632_0002534_1336_2103 255
1172 3300046519 Ga0495632_0002865 Ga0495632_0002865_138_905 255
1173 3300046519 Ga0495632_0003761 Ga0495632_0003761_5184_5951 255
1174 3300046519 Ga0495632_0012555 Ga0495632_0012555_3585_4352 255
1175 3300046519 Ga0495632_0013838 Ga0495632_0013838_575_1342 255
1176 3300046519 Ga0495632_0029997 Ga0495632_0029997_1882_2649 255
1177 3300046519 Ga0495632_0031234 Ga0495632_0031234_151_918 255
1178 3300046520 Ga0495637_0000070 Ga0495637_0000070_61512_62279 255
1179 3300046520 Ga0495637_0000480 Ga0495637_0000480_13080_13847 255
1180 3300046520 Ga0495637_0001066 Ga0495637_0001066_7714_8481 255
1181 3300046520 Ga0495637_0001438 Ga0495637_0001438_4592_5359 255
1182 3300046520 Ga0495637_0002500 Ga0495637_0002500_5378_6145 255
1183 3300046520 Ga0495637_0008240 Ga0495637_0008240_2228_2995 255
1184 3300046520 Ga0495637_0029929 Ga0495637_0029929_207_974 255
1185 3300046520 Ga0495637_0030627 Ga0495637_0030627_189_956 255
1186 3300046520 Ga0495637_0041938 Ga0495637_0041938_353_1120 255
1187 3300046520 Ga0495637_0050288 Ga0495637_0050288_594_1361 255
1188 3300046520 Ga0495637_0053228 Ga0495637_0053228_111_878 255
1189 3300046520 Ga0495637_0098048 Ga0495637_0098048_187_954 255
1190 3300046522 Ga0495643_0000508 Ga0495643_0000508_32500_33267 255
1191 3300046522 Ga0495643_0000775 Ga0495643_0000775_13551_14318 255
1192 3300046522 Ga0495643_0002114 Ga0495643_0002114_11359_12126 255
1193 3300046522 Ga0495643_0011762 Ga0495643_0011762_125_892 255
1194 3300046522 Ga0495643_0034725 Ga0495643_0034725_1861_2628 255
1195 3300046522 Ga0495643_0043335 Ga0495643_0043335_72_839 255
1196 3300046523 Ga0495644_0001961 Ga0495644_0001961_180_947 255
1197 3300046523 Ga0495644_0003535 Ga0495644_0003535_2378_3145 255
1198 3300046523 Ga0495644_0084409 Ga0495644_0084409_118_885 255
1199 3300046524 Ga0495648_0000585 Ga0495648_0000585_7616_8383 255
1200 3300046524 Ga0495648_0002364 Ga0495648_0002364_15533_16300 255
1201 3300046524 Ga0495648_0006757 Ga0495648_0006757_7488_8255 255
1202 3300046524 Ga0495648_0008005 Ga0495648_0008005_130_897 255
1203 3300046524 Ga0495648_0018080 Ga0495648_0018080_4109_4876 255
1204 3300046524 Ga0495648_0026956 Ga0495648_0026956_93_860 255
1205 3300046524 Ga0495648_0033316 Ga0495648_0033316_19_786 255
1206 3300046524 Ga0495648_0050715 Ga0495648_0050715_1519_2286 255
1207 3300046524 Ga0495648_0078512 Ga0495648_0078512_992_1759 255
1208 3300046524 Ga0495648_0105556 Ga0495648_0105556_66_833 255
1209 3300046524 Ga0495648_0118737 Ga0495648_0118737_232_999 255
1210 3300046526 Ga0495666_0001988 Ga0495666_0001988_3889_4656 255
1211 3300046526 Ga0495666_0153601 Ga0495666_0153601_198_965 255
1212 3300046528 Ga0495642_0000719 Ga0495642_0000719_11575_12342 255
1213 3300046528 Ga0495642_0001818 Ga0495642_0001818_169_936 255
1214 3300046529 Ga0495652_0005628 Ga0495652_0005628_2255_3025 255
1215 3300046529 Ga0495652_0023066 Ga0495652_0023066_2544_3314 255
1216 3300046530 Ga0495654_0000460 Ga0495654_0000460_12828_13601 255
1217 3300046530 Ga0495654_0000878 Ga0495654_0000878_8717_9484 255
1218 3300046530 Ga0495654_0001059 Ga0495654_0001059_11843_12610 255
1219 3300046530 Ga0495654_0001481 Ga0495654_0001481_2968_3735 255
1220 3300046530 Ga0495654_0002512 Ga0495654_0002512_1019_1786 255
1221 3300046530 Ga0495654_0004342 Ga0495654_0004342_4599_5366 255
1222 3300046530 Ga0495654_0006554 Ga0495654_0006554_700_1467 255
1223 3300046530 Ga0495654_0011185 Ga0495654_0011185_608_1375 255
1224 3300046530 Ga0495654_0014457 Ga0495654_0014457_2260_3027 255
1225 3300046530 Ga0495654_0037069 Ga0495654_0037069_1386_2153 255
1226 3300046530 Ga0495654_0066281 Ga0495654_0066281_411_1178 255
1227 3300046530 Ga0495654_0077797 Ga0495654_0077797_648_1415 255
1228 3300046530 Ga0495654_0106438 Ga0495654_0106438_61_828 255
1229 3300046530 Ga0495654_0139064 Ga0495654_0139064_93_860 255
1230 3300046535 Ga0495586_0016517 Ga0495586_0016517_304_1071 255
1231 3300046536 Ga0495587_0003103 Ga0495587_0003103_5198_5965 255
1232 3300046538 Ga0495609_0000018 Ga0495609_0000018_74690_75457 255
1233 3300046538 Ga0495609_0000027 Ga0495609_0000027_21028_21795 255
1234 3300046538 Ga0495609_0000203 Ga0495609_0000203_48112_48879 255
1235 3300046538 Ga0495609_0005152 Ga0495609_0005152_6092_6859 255
1236 3300046538 Ga0495609_0012822 Ga0495609_0012822_99_866 255
1237 3300046538 Ga0495609_0047131 Ga0495609_0047131_613_1404 255
1238 3300046538 Ga0495609_0080469 Ga0495609_0080469_367_1134 255
1239 3300046538 Ga0495609_0127798 Ga0495609_0127798_109_876 255
1240 3300046542 Ga0495597_0000011 Ga0495597_0000011_1461_2228 255
1241 3300046542 Ga0495597_0002435 Ga0495597_0002435_1973_2740 255
1242 3300046542 Ga0495597_0004978 Ga0495597_0004978_483_1250 255
1243 3300046542 Ga0495597_0005427 Ga0495597_0005427_5825_6592 255
1244 3300046542 Ga0495597_0007525 Ga0495597_0007525_4525_5292 255
1245 3300046542 Ga0495597_0057326 Ga0495597_0057326_189_956 255
1246 3300046543 Ga0495645_0017273 Ga0495645_0017273_2110_2880 255
1247 3300046543 Ga0495645_0098163 Ga0495645_0098163_838_1608 255
1248 3300046557 Ga0495622_0000933 Ga0495622_0000933_1344_2111 255
1249 3300046557 Ga0495622_0001271 Ga0495622_0001271_1131_1898 255
1250 3300046557 Ga0495622_0004847 Ga0495622_0004847_332_1102 255
1251 3300046558 Ga0495633_0000590 Ga0495633_0000590_11510_12277 255
1252 3300046558 Ga0495633_0007695 Ga0495633_0007695_4135_4902 255
1253 3300046558 Ga0495633_0019796 Ga0495633_0019796_769_1536 255
1254 3300046615 Ga0495656_0118511 Ga0495656_0118511_372_1139 255
1255 3300046616 Ga0495668_0002608 Ga0495668_0002608_7435_8202 255
1256 3300046616 Ga0495668_0016845 Ga0495668_0016845_669_1436 255
1257 3300046616 Ga0495668_0129995 Ga0495668_0129995_142_909 255
1258 3300046642 Ga0495634_0011631 Ga0495634_0011631_92_859 255
1259 3300046648 Ga0495611_0000085 Ga0495611_0000085_13110_13877 255
1260 3300046648 Ga0495611_0001385 Ga0495611_0001385_11232_11999 255
1261 3300046648 Ga0495611_0001392 Ga0495611_0001392_2877_3644 255
1262 3300046648 Ga0495611_0133755 Ga0495611_0133755_239_1006 255
1263 3300046660 Ga0495625_0000302 Ga0495625_0000302_10759_11526 255
1264 3300046660 Ga0495625_0004976 Ga0495625_0004976_4323_5090 255
1265 3300046660 Ga0495625_0008154 Ga0495625_0008154_768_1535 255
1266 3300046660 Ga0495625_0010749 Ga0495625_0010749_451_1218 255
1267 3300046660 Ga0495625_0012686 Ga0495625_0012686_5961_6728 255
1268 3300046660 Ga0495625_0027715 Ga0495625_0027715_1438_2205 255
1269 3300046660 Ga0495625_0058975 Ga0495625_0058975_1115_1885 255
1270 3300046660 Ga0495625_0137755 Ga0495625_0137755_380_1147 255
1271 3300046660 Ga0495625_0177299 Ga0495625_0177299_493_1260 255
1272 3300046660 Ga0495625_0264960 Ga0495625_0264960_243_1010 255
1273 3300046663 Ga0495635_0010398 Ga0495635_0010398_525_1295 255
1274 3300046663 Ga0495635_0144878 Ga0495635_0144878_355_1122 255
1275 3300046664 Ga0495659_0000102 Ga0495659_0000102_25972_26739 255
1276 3300046664 Ga0495659_0006217 Ga0495659_0006217_2987_3754 255
1277 3300046665 Ga0495661_0000039 Ga0495661_0000039_19038_19868 255
1278 3300046665 Ga0495661_0000056 Ga0495661_0000056_114526_115293 255
1279 3300046665 Ga0495661_0000136 Ga0495661_0000136_64504_65271 255
1280 3300046665 Ga0495661_0000250 Ga0495661_0000250_20207_20974 255
1281 3300046665 Ga0495661_0001455 Ga0495661_0001455_11877_12644 255
1282 3300046665 Ga0495661_0005867 Ga0495661_0005867_7083_7850 255
1283 3300046665 Ga0495661_0036160 Ga0495661_0036160_86_853 255
1284 3300046665 Ga0495661_0094241 Ga0495661_0094241_125_892 255
1285 3300046678 Ga0495599_0059176 Ga0495599_0059176_1146_1916 255
1286 3300046679 Ga0495623_0029755 Ga0495623_0029755_1397_2167 255
1287 3300046679 Ga0495623_0110046 Ga0495623_0110046_580_1347 255
1288 3300046680 Ga0495646_0005191 Ga0495646_0005191_2814_3584 255
1289 3300046680 Ga0495646_0012415 Ga0495646_0012415_438_1205 255
1290 3300046680 Ga0495646_0015969 Ga0495646_0015969_164_931 255
1291 3300046680 Ga0495646_0210352 Ga0495646_0210352_166_933 255
1292 3300046684 Ga0495669_0026790 Ga0495669_0026790_459_1226 255
1293 3300046690 Ga0495624_0005176 Ga0495624_0005176_5999_6769 255
1294 3300046690 Ga0495624_0005850 Ga0495624_0005850_6950_7717 255
1295 3300046691 Ga0495670_0005401 Ga0495670_0005401_918_1685 255
1296 3300046691 Ga0495670_0015335 Ga0495670_0015335_2421_3188 255
1297 3300046691 Ga0495670_0045191 Ga0495670_0045191_164_931 255
1298 3300046691 Ga0495670_0058006 Ga0495670_0058006_348_1115 255
1299 3300046692 Ga0495671_0000395 Ga0495671_0000395_3549_4316 255
1300 3300046692 Ga0495671_0001434 Ga0495671_0001434_7619_8386 255
1301 3300046692 Ga0495671_0001650 Ga0495671_0001650_12967_13734 255
1302 3300046692 Ga0495671_0006375 Ga0495671_0006375_5971_6738 255
1303 3300046692 Ga0495671_0012741 Ga0495671_0012741_3574_4341 255
1304 3300046692 Ga0495671_0015534 Ga0495671_0015534_1140_1907 255
1305 3300046692 Ga0495671_0022009 Ga0495671_0022009_2359_3126 255
1306 3300046692 Ga0495671_0028077 Ga0495671_0028077_539_1306 255
1307 3300046692 Ga0495671_0034964 Ga0495671_0034964_1569_2336 255
1308 3300046692 Ga0495671_0105040 Ga0495671_0105040_81_848 255
1309 3300046692 Ga0495671_0112015 Ga0495671_0112015_501_1268 255
1310 3300046692 Ga0495671_0122298 Ga0495671_0122298_422_1189 255
1311 3300046694 Ga0495649_0000421 Ga0495649_0000421_12929_13696 255
1312 3300046694 Ga0495649_0000605 Ga0495649_0000605_16801_17568 255
1313 3300046694 Ga0495649_0001939 Ga0495649_0001939_7512_8282 255
1314 3300046694 Ga0495649_0006156 Ga0495649_0006156_259_1026 255
1315 3300046694 Ga0495649_0010341 Ga0495649_0010341_81_848 255
1316 3300046694 Ga0495649_0018580 Ga0495649_0018580_674_1441 255
1317 3300046694 Ga0495649_0020926 Ga0495649_0020926_2766_3533 255
1318 3300046694 Ga0495649_0159551 Ga0495649_0159551_238_1005 255
1319 3300046694 Ga0495649_0230731 Ga0495649_0230731_54_821 255
1320 3300046694 Ga0495649_0234795 Ga0495649_0234795_98_865 255
1321 3300046694 Ga0495649_0247433 Ga0495649_0247433_52_819 255
1322 3300046794 Ga0495589_0000220 Ga0495589_0000220_6201_6968 255
1323 3300046794 Ga0495589_0001551 Ga0495589_0001551_11344_12111 255
1324 3300046794 Ga0495589_0004523 Ga0495589_0004523_540_1307 255
1325 3300046794 Ga0495589_0013343 Ga0495589_0013343_392_1159 255
1326 3300046809 Ga0495600_0016863 Ga0495600_0016863_1071_1841 255
1327 3300046809 Ga0495600_0059767 Ga0495600_0059767_1406_2173 255
1328 3300046810 Ga0495660_0000111 Ga0495660_0000111_77578_78345 255
1329 3300046810 Ga0495660_0000699 Ga0495660_0000699_3107_3874 255
1330 3300046810 Ga0495660_0003672 Ga0495660_0003672_8539_9306 255
1331 3300046810 Ga0495660_0013394 Ga0495660_0013394_3841_4608 255
1332 3300046810 Ga0495660_0026613 Ga0495660_0026613_1411_2178 255
1333 3300046810 Ga0495660_0028980 Ga0495660_0028980_856_1623 255
1334 3300046810 Ga0495660_0035926 Ga0495660_0035926_1223_1990 255
1335 3300046810 Ga0495660_0042786 Ga0495660_0042786_1639_2406 255
1336 3300046810 Ga0495660_0095897 Ga0495660_0095897_668_1435 255
1337 3300046810 Ga0495660_0100742 Ga0495660_0100742_599_1366 255
1338 3300046810 Ga0495660_0199782 Ga0495660_0199782_96_863 255
1339 3300047315 Ga0495581_0013521 Ga0495581_0013521_116_883 255
1340 3300047315 Ga0495581_0054117 Ga0495581_0054117_1446_2213 255
1341 3300047317 Ga0495604_0032086 Ga0495604_0032086_2458_3228 255
1342 3300047317 Ga0495604_0096573 Ga0495604_0096573_1147_1914 255
1343 3300047317 Ga0495604_0104427 Ga0495604_0104427_1031_1798 255
1344 3300047318 Ga0495636_0000802 Ga0495636_0000802_1726_2493 255
1345 3300047318 Ga0495636_0068453 Ga0495636_0068453_422_1189 255
1346 3300047320 Ga0495672_0001422 Ga0495672_0001422_3689_4462 255
1347 3300047320 Ga0495672_0003520 Ga0495672_0003520_1226_1993 255
1348 3300047320 Ga0495672_0011661 Ga0495672_0011661_166_933 255
1349 3300047320 Ga0495672_0015110 Ga0495672_0015110_2844_3611 255
1350 3300047320 Ga0495672_0015748 Ga0495672_0015748_255_1022 255
1351 3300047320 Ga0495672_0040684 Ga0495672_0040684_958_1725 255
1352 3300047320 Ga0495672_0057619 Ga0495672_0057619_241_1008 255
1353 3300047320 Ga0495672_0097064 Ga0495672_0097064_792_1559 255
1354 3300047321 Ga0495676_0000003 Ga0495676_0000003_269395_270162 255
1355 3300047321 Ga0495676_0004919 Ga0495676_0004919_9338_10105 255
1356 3300047321 Ga0495676_0011857 Ga0495676_0011857_5340_6107 255
1357 3300047322 Ga0495680_0010754 Ga0495680_0010754_2238_3005 255
1358 3300047322 Ga0495680_0010884 Ga0495680_0010884_332_1099 255
1359 3300047323 Ga0495683_0000191 Ga0495683_0000191_18966_19739 255
1360 3300047323 Ga0495683_0000374 Ga0495683_0000374_22911_23678 255
1361 3300047323 Ga0495683_0001219 Ga0495683_0001219_16610_17377 255
1362 3300047323 Ga0495683_0002206 Ga0495683_0002206_615_1382 255
1363 3300047323 Ga0495683_0004057 Ga0495683_0004057_171_938 255
1364 3300047323 Ga0495683_0004074 Ga0495683_0004074_7553_8320 255
1365 3300047323 Ga0495683_0036727 Ga0495683_0036727_169_960 255
1366 3300047323 Ga0495683_0040090 Ga0495683_0040090_1492_2259 255
1367 3300047443 Ga0495687_003083 Ga0495687_003083_6546_7313 255
1368 3300047443 Ga0495687_011073 Ga0495687_011073_802_1569 255
1369 3300047444 Ga0495675_0025774 Ga0495675_0025774_401_1168 255
1370 3300047444 Ga0495675_0113807 Ga0495675_0113807_441_1208 255
1371 3300047445 Ga0495677_0022510 Ga0495677_0022510_985_1752 255
1372 3300047446 Ga0495679_000027 Ga0495679_000027_174311_175078 255
1373 3300047446 Ga0495679_002945 Ga0495679_002945_301_1068 255
1374 3300047446 Ga0495679_003659 Ga0495679_003659_6322_7089 255
1375 3300047446 Ga0495679_007096 Ga0495679_007096_2883_3650 255
1376 3300047446 Ga0495679_078665 Ga0495679_078665_79_846 255
1377 3300047469 Ga0495673_0001072 Ga0495673_0001072_3625_4392 255
1378 3300047469 Ga0495673_0001962 Ga0495673_0001962_8880_9647 255
1379 3300047469 Ga0495673_0002752 Ga0495673_0002752_193_960 255
1380 3300047469 Ga0495673_0002840 Ga0495673_0002840_8518_9285 255
1381 3300047469 Ga0495673_0002856 Ga0495673_0002856_6022_6789 255
1382 3300047469 Ga0495673_0006100 Ga0495673_0006100_953_1720 255
1383 3300047469 Ga0495673_0011185 Ga0495673_0011185_2006_2773 255
1384 3300047469 Ga0495673_0015390 Ga0495673_0015390_181_948 255
1385 3300047469 Ga0495673_0018986 Ga0495673_0018986_182_949 255
1386 3300047469 Ga0495673_0020578 Ga0495673_0020578_1676_2443 255
1387 3300047469 Ga0495673_0028282 Ga0495673_0028282_1561_2328 255
1388 3300047469 Ga0495673_0059525 Ga0495673_0059525_391_1158 255
1389 3300047470 Ga0495681_0001919 Ga0495681_0001919_528_1295 255
1390 3300047470 Ga0495681_0001989 Ga0495681_0001989_8863_9630 255
1391 3300047470 Ga0495681_0006748 Ga0495681_0006748_3288_4055 255
1392 3300047470 Ga0495681_0007990 Ga0495681_0007990_90_857 255
1393 3300047470 Ga0495681_0011451 Ga0495681_0011451_719_1486 255
1394 3300047470 Ga0495681_0018673 Ga0495681_0018673_2626_3393 255
1395 3300047470 Ga0495681_0027983 Ga0495681_0027983_154_921 255
1396 3300047470 Ga0495681_0036883 Ga0495681_0036883_53_820 255
1397 3300047470 Ga0495681_0090103 Ga0495681_0090103_181_948 255
1398 3300047471 Ga0495684_0135259 Ga0495684_0135259_285_1052 255
1399 3300047472 Ga0495686_0007047 Ga0495686_0007047_7524_8291 255
1400 3300047472 Ga0495686_0092931 Ga0495686_0092931_893_1660 255
1401 3300047472 Ga0495686_0283218 Ga0495686_0283218_69_836 255
1402 3300047673 Ga0495593_0020320 Ga0495593_0020320_1448_2215 255
1403 3300047673 Ga0495593_0086517 Ga0495593_0086517_433_1200 255
1404 3300048088 Ga0495602_0015213 Ga0495602_0015213_169_936 255
1405 3300048088 Ga0495602_0025650 Ga0495602_0025650_3284_4054 255
1406 3300048091 Ga0495626_0000245 Ga0495626_0000245_40938_41705 255
1407 3300048091 Ga0495626_0000502 Ga0495626_0000502_37842_38609 255
1408 3300048091 Ga0495626_0000647 Ga0495626_0000647_24997_25764 255
1409 3300048091 Ga0495626_0000727 Ga0495626_0000727_25863_26630 255
1410 3300048091 Ga0495626_0001965 Ga0495626_0001965_6763_7530 255
1411 3300048091 Ga0495626_0002785 Ga0495626_0002785_10641_11408 255
1412 3300048091 Ga0495626_0003678 Ga0495626_0003678_1232_1999 255
1413 3300048091 Ga0495626_0004355 Ga0495626_0004355_505_1272 255
1414 3300048091 Ga0495626_0013753 Ga0495626_0013753_1967_2734 255
1415 3300048904 Ga0496101_0070971 Ga0496101_0070971_849_1619 255
1416 3300048907 Ga0496104_0101978 Ga0496104_0101978_1540_2310 255
1417 3300048907 Ga0496104_0184728 Ga0496104_0184728_234_1004 255
1418 3300048907 Ga0496104_0320738 Ga0496104_0320738_337_1107 255
1419 3300048908 Ga0496105_0014555 Ga0496105_0014555_3223_3993 255
1420 3300048908 Ga0496105_0125351 Ga0496105_0125351_654_1424 255
1421 3300048909 Ga0496106_0211364 Ga0496106_0211364_584_1354 255
1422 3300048910 Ga0496107_0016365 Ga0496107_0016365_1912_2682 255
1423 3300048911 Ga0496108_0027781 Ga0496108_0027781_3096_3866 255
1424 3300048912 Ga0496109_0184128 Ga0496109_0184128_53_823 255
1425 3300048913 Ga0496110_0137111 Ga0496110_0137111_348_1115 255
1426 3300048913 Ga0496110_0184653 Ga0496110_0184653_194_964 255
1427 3300048913 Ga0496110_0595775 Ga0496110_0595775_107_874 255
1428 3300048914 Ga0496111_0033977 Ga0496111_0033977_1402_2172 255
1429 3300048914 Ga0496111_0335261 Ga0496111_0335261_271_1038 255
1430 3300048916 Ga0496113_0129578 Ga0496113_0129578_135_905 255
1431 3300048917 Ga0496114_0060145 Ga0496114_0060145_1202_1972 255
1432 3300048917 Ga0496114_0468946 Ga0496114_0468946_86_856 255
1433 3300048918 Ga0496115_0000846 Ga0496115_0000846_10763_11533 255
1434 3300048918 Ga0496115_0004466 Ga0496115_0004466_5432_6202 255
1435 3300048918 Ga0496115_0006657 Ga0496115_0006657_2044_2814 255
1436 3300048918 Ga0496115_0014788 Ga0496115_0014788_4835_5605 255
1437 3300048918 Ga0496115_0035357 Ga0496115_0035357_1153_1923 255
1438 3300048919 Ga0496116_0002726 Ga0496116_0002726_8433_9200 255
1439 3300048919 Ga0496116_0010317 Ga0496116_0010317_333_1100 255
1440 3300048919 Ga0496116_0011956 Ga0496116_0011956_109_876 255
1441 3300048919 Ga0496116_0052398 Ga0496116_0052398_1295_2065 255
1442 3300048920 Ga0496117_0003521 Ga0496117_0003521_9801_10568 255
1443 3300048920 Ga0496117_0005256 Ga0496117_0005256_3857_4624 255
1444 3300048920 Ga0496117_0028601 Ga0496117_0028601_1359_2129 255
1445 3300048920 Ga0496117_0030689 Ga0496117_0030689_251_1018 255
1446 3300048920 Ga0496117_0050851 Ga0496117_0050851_1777_2547 255
1447 3300048920 Ga0496117_0058539 Ga0496117_0058539_1620_2387 255
1448 3300048920 Ga0496117_0063433 Ga0496117_0063433_1627_2394 255
1449 3300048921 Ga0496118_0001044 Ga0496118_0001044_5160_5930 255
1450 3300048921 Ga0496118_0002113 Ga0496118_0002113_6547_7314 255
1451 3300048921 Ga0496118_0009231 Ga0496118_0009231_1963_2733 255
1452 3300048921 Ga0496118_0033930 Ga0496118_0033930_173_940 255
1453 3300048921 Ga0496118_0055221 Ga0496118_0055221_1866_2633 255
1454 3300048921 Ga0496118_0095070 Ga0496118_0095070_408_1175 255
1455 3300048921 Ga0496118_0199138 Ga0496118_0199138_141_908 255
1456 3300048922 Ga0496119_0000011 Ga0496119_0000011_128735_129502 255
1457 3300048922 Ga0496119_0000029 Ga0496119_0000029_161736_162506 255
1458 3300048922 Ga0496119_0005007 Ga0496119_0005007_7201_7971 255
1459 3300048922 Ga0496119_0030938 Ga0496119_0030938_521_1288 255
1460 3300048923 Ga0496120_0000015 Ga0496120_0000015_220796_221566 255
1461 3300048923 Ga0496120_0000039 Ga0496120_0000039_39732_40502 255
1462 3300048923 Ga0496120_0000627 Ga0496120_0000627_26085_26852 255
1463 3300048923 Ga0496120_0021585 Ga0496120_0021585_409_1176 255
1464 3300048923 Ga0496120_0087082 Ga0496120_0087082_565_1332 255
1465 3300048924 Ga0496121_0000063 Ga0496121_0000063_251139_251909 255
1466 3300048924 Ga0496121_0007678 Ga0496121_0007678_12123_12890 255
1467 3300048924 Ga0496121_0010938 Ga0496121_0010938_7344_8111 255
1468 3300048924 Ga0496121_0017061 Ga0496121_0017061_6540_7307 255
1469 3300048924 Ga0496121_0019230 Ga0496121_0019230_3011_3781 255
1470 3300048924 Ga0496121_0036543 Ga0496121_0036543_3061_3831 255
1471 3300048924 Ga0496121_0088839 Ga0496121_0088839_258_1025 255
1472 3300048925 Ga0496122_0000834 Ga0496122_0000834_48025_48792 255
1473 3300048925 Ga0496122_0001785 Ga0496122_0001785_8676_9443 255
1474 3300048925 Ga0496122_0006982 Ga0496122_0006982_5684_6451 255
1475 3300048925 Ga0496122_0040138 Ga0496122_0040138_2622_3389 255
1476 3300048925 Ga0496122_0072407 Ga0496122_0072407_834_1601 255
1477 3300048925 Ga0496122_0074854 Ga0496122_0074854_1083_1850 255
1478 3300048926 Ga0496123_0000136 Ga0496123_0000136_21251_22018 255
1479 3300048926 Ga0496123_0001361 Ga0496123_0001361_28188_28955 255
1480 3300048926 Ga0496123_0013636 Ga0496123_0013636_3097_3864 255
1481 3300048926 Ga0496123_0020506 Ga0496123_0020506_890_1657 255
1482 3300048926 Ga0496123_0030565 Ga0496123_0030565_2054_2821 255
1483 3300048926 Ga0496123_0057074 Ga0496123_0057074_520_1287 255
1484 3300048926 Ga0496123_0081645 Ga0496123_0081645_139_906 255
1485 3300048927 Ga0496124_0000118 Ga0496124_0000118_4797_5564 255
1486 3300048927 Ga0496124_0001317 Ga0496124_0001317_9546_10313 255
1487 3300048927 Ga0496124_0002425 Ga0496124_0002425_1731_2498 255
1488 3300048927 Ga0496124_0003299 Ga0496124_0003299_9774_10541 255
1489 3300048927 Ga0496124_0012045 Ga0496124_0012045_7743_8510 255
1490 3300048927 Ga0496124_0039101 Ga0496124_0039101_2973_3740 255
1491 3300048927 Ga0496124_0067352 Ga0496124_0067352_2186_2953 255
1492 3300048927 Ga0496124_0130670 Ga0496124_0130670_491_1258 255
1493 3300048927 Ga0496124_0351225 Ga0496124_0351225_51_818 255
1494 3300048928 Ga0496125_0000536 Ga0496125_0000536_41738_42505 255
1495 3300048928 Ga0496125_0003132 Ga0496125_0003132_9340_10107 255
1496 3300048928 Ga0496125_0007271 Ga0496125_0007271_4303_5070 255
1497 3300048928 Ga0496125_0038556 Ga0496125_0038556_1238_2005 255
1498 3300048928 Ga0496125_0040786 Ga0496125_0040786_2882_3649 255
1499 3300048928 Ga0496125_0090612 Ga0496125_0090612_191_958 255
1500 3300048929 Ga0496126_0002573 Ga0496126_0002573_6793_7563 255
1501 3300048929 Ga0496126_0010547 Ga0496126_0010547_7982_8752 255
1502 3300048929 Ga0496126_0020370 Ga0496126_0020370_3633_4403 255
1503 3300048929 Ga0496126_0028240 Ga0496126_0028240_1648_2415 255
1504 3300048929 Ga0496126_0052567 Ga0496126_0052567_411_1178 255
1505 3300048929 Ga0496126_0082783 Ga0496126_0082783_1823_2593 255
1506 3300048929 Ga0496126_0198877 Ga0496126_0198877_867_1637 255
1507 3300049459 Ga0495678_000520 Ga0495678_000520_12842_13609 255
1508 3300049459 Ga0495678_001322 Ga0495678_001322_6243_7010 255
1509 3300049459 Ga0495678_003692 Ga0495678_003692_3045_3812 255
1510 3300049459 Ga0495678_004394 Ga0495678_004394_7358_8125 255
1511 3300049459 Ga0495678_004708 Ga0495678_004708_5701_6468 255
1512 3300049459 Ga0495678_007558 Ga0495678_007558_2985_3752 255
1513 3300049459 Ga0495678_009381 Ga0495678_009381_126_893 255
1514 3300049459 Ga0495678_009532 Ga0495678_009532_547_1314 255
1515 3300049459 Ga0495678_012820 Ga0495678_012820_1966_2733 255
1516 3300049459 Ga0495678_015698 Ga0495678_015698_159_926 255
1517 3300049459 Ga0495678_020258 Ga0495678_020258_60_830 255
1518 3300049459 Ga0495678_041879 Ga0495678_041879_982_1749 255
1519 3300049459 Ga0495678_087103 Ga0495678_087103_127_894 255
1520 3300049460 Ga0495682_0000023 Ga0495682_0000023_43370_44137 255
1521 3300049460 Ga0495682_0001956 Ga0495682_0001956_8339_9106 255
1522 3300049460 Ga0495682_0004975 Ga0495682_0004975_4429_5196 255
1523 3300049460 Ga0495682_0009232 Ga0495682_0009232_1255_2025 255
1524 3300049460 Ga0495682_0013997 Ga0495682_0013997_293_1060 255
1525 3300049460 Ga0495682_0069009 Ga0495682_0069009_13_780 255
1526 3300049571 Ga0501034_0006797 Ga0501034_0006797_8667_9434 255
1527 3300049758 Ga0501241_000310 Ga0501241_000310_4861_5628 255
1528 3300049822 Ga0501035_0207615 Ga0501035_0207615_786_1559 255
1529 3300049853 Ga0501226_000019 Ga0501226_000019_59006_59773 255
1530 3300050491 nmdc:mga00v17_64322_c1 nmdc:mga00v17_64322_c1_163_930 255
1531 3300050511 nmdc:mga08y16_1859_c1 nmdc:mga08y16_1859_c1_11165_11950 255
1532 3300050515 nmdc:mga0a205_411436_c1 nmdc:mga0a205_411436_c1_335_1111 255
1533 3300053077 Ga0495601_0155660 Ga0495601_0155660_461_1231 255
1534 3300053093 Ga0500651_0035034 Ga0500651_0035034_915_1685 255
1535 3300053111 Ga0500572_008691 Ga0500572_008691_1448_2215 255
1536 3300053119 Ga0500595_001997 Ga0500595_001997_2023_2793 255
1537 3300053125 Ga0500618_033011 Ga0500618_033011_373_1140 255
1538 3300053141 Ga0500574_000315 Ga0500574_000315_4673_5443 255
1539 3300053154 Ga0500619_000522 Ga0500619_000522_401_1171 255
1540 3300053161 Ga0500634_0006211 Ga0500634_0006211_4228_4995 255
1541 3300059641 Ga0587068_007681 Ga0587068_007681_694_1461 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

12

214

0.93

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

18

257

0.92

PF08659

KR

KR domain

13

204

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3awd-assembly1.cif.gz_D crystal structure of gox2181 0.983 7 254
6ixm-assembly1.cif.gz_B crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49 complexed with nad 0.98 9 253
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9799 9 252
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9792 8 252
3uf0-assembly1.cif.gz_A crystal structure of a putative nad(p) dependent gluconate 5-dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound nadp (low occupancy) 0.975 7 254
ID Description Score Start End Superfamily
3awdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9823 7 254 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.98 9 253 3.40.50.720
af_A0A0P0WC51_15_133_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9797 12 92 3.40.50.720
3svtA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9728 10 254 3.40.50.720
af_I1LJY0_35_302_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9726 5 254 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7C1CLP4-F1-model_v4 Glucose 1-dehydrogenase (EC 1.1.1.47) 0.9888 7 253 GO:0047936
AF-A0A3M1QB26-F1-model_v4 Glucose 1-dehydrogenase (EC 1.1.1.47) 0.983 9 253 GO:0047936
AF-A0A7V9PDN2-F1-model_v4 SDR family oxidoreductase 0.9814 139 253 GO:0016491
AF-A0A382EIM1-F1-model_v4 Uncharacterized protein 0.9809 6 254 GO:0006633
GO:0016616
GO:0048038
AF-A0A496AP36-F1-model_v4 2-deoxy-D-gluconate 3-dehydrogenase 0.9796 5 254 GO:0016616

Feature Viewer

pLDDT pTM Quality
94.85 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map