F494609

General Info

Members Datasets Scaffolds Average Seq Length
1532 936 1044 442

Family's Representative Sequence

Representative Sequence 3300025728|Ga0207655_1001748|Ga0207655_100174812
Length 428
Sequence MSTTARQMKLGAFLMATGHHVAAWRHPDVPAGAGLDFKHYRHVARVAEAAKFDALFVADSVAAATGDIASRMARSDHFEPLTLLSALSSVTEHIGLIATATTTYNEPYHVARKFASLDHLSGGRAGWNLVTSDAAAEAQNFGRREFHQVVTGLWDSWADNAFTRDKASGEYYNPARLHVLDHQGEHFSVKGPLNVARSPQGQPVVVQAGSSEVGRDLAAQTAEVVFTAQTSLAGAQAFYADIKGRLSAYGRDVDSLKIMPGVFIVVAETEALAKAKFESFQALVEPQVGVALLGRMLGNFDLSGYPLDGPLPELPLTDSGQRSRQKLLTELADQENLTLAQLGRRIAGGRGHYSLIGTPEQIADELQRWFEQGSADGFNVLVPHLPGGLEDVAQLLVPELQRRGLFRTEYEGTTLRENLGLQRPAYRF

Samples

Sample ID Description Type Environment
1 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
5 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
6 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
7 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
8 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
9 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
10 2511231006 Pseudomonas sp. GM17 Isolate Nodule
11 2511231010 Pseudomonas sp. GM25 Isolate Nodule
12 2511231011 Pseudomonas sp. GM30 Isolate Nodule
13 2511231021 Pseudomonas sp. GM78 Isolate Nodule
14 2511231023 Pseudomonas sp. GM80 Isolate Nodule
15 2511231031 Pseudomonas sp. GM16 Isolate Nodule
16 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
17 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
18 2512875024 Mesorhizobium loti R88b Isolate Nodule
19 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
20 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
21 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
22 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
23 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
24 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
25 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
26 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
27 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
28 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
29 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
30 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
31 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
32 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
33 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
34 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
35 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
36 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
37 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
38 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
39 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
40 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
41 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
42 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
43 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
44 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
45 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
46 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
47 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
48 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
49 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
50 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
51 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
52 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
53 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
54 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
55 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
56 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
57 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
58 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
59 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
60 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
61 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
62 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
63 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
64 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
65 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
66 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
67 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
68 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
69 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
70 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
71 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
72 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
73 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
74 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
75 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
76 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
77 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
78 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
79 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
80 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
81 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
82 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
83 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
84 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
85 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
86 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
87 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
88 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
89 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
90 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
91 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
92 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
93 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
94 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
95 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
96 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
97 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
98 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
99 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
100 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
101 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
102 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
103 2643221582 Rhizobium sp. Root651 Isolate Unclassified
104 2643221599 Rhizobium sp. Root708 Isolate Unclassified
105 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
106 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
107 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
108 2643221693 Rhizobium sp. Root491 Isolate Unclassified
109 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
110 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
111 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
112 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
113 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
114 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
115 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
116 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
117 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
118 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
119 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
120 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
121 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
122 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
123 2738541277 Variovorax sp. GV051 Isolate Unclassified
124 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
125 2738541307 Variovorax sp. GV008 Isolate Unclassified
126 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
127 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
128 2738543019 Variovorax sp. GV040 Isolate Unclassified
129 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
130 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
131 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
132 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
133 2773857673 Pseudomonas sp. 443 Isolate Unclassified
134 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
135 2784132063 Pseudomonas sp. 424 Isolate Unclassified
136 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
137 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
138 2791355199
139 2791355260 Rhizobium sp. L9 Isolate Nodule
140 2791355266 Rhizobium sp. L43 Isolate Nodule
141 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
142 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
143 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
144 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
145 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
146 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
147 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
148 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
149 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
150 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
151 2818991467 Bosea vestrisii 3192 Isolate Unclassified
152 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
153 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
154 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
155 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
156 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
157 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
158 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
159 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
160 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
161 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
162 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
163 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
164 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
165 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
166 2831426010 Nostoc sp. 106C Isolate Unclassified
167 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
168 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
169 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
170 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
171 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
172 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
173 2841760612 Bosea sp. Tri-49 Isolate Nodule
174 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
175 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
176 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
177 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
178 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
179 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
180 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
181 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
182 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
183 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
184 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
185 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
186 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
187 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
188 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
189 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
190 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
191 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
192 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
193 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
194 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
195 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
196 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
197 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
198 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
199 2844104063 Bosea sp. Tri-39 Isolate Nodule
200 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
201 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
202 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
203 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
204 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
205 2849660919 Nostoc sp. T09 Isolate Unclassified
206 2851182111 Bosea sp. Tri-44 Isolate Nodule
207 2851246043 Bosea sp. Tri-54 Isolate Nodule
208 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
209 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
210 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
211 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
212 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
213 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
214 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
215 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
216 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
217 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
218 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
219 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
220 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
221 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
222 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
223 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
224 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
225 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
226 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
227 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
228 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
229 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
230 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
231 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
232 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
233 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
234 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
235 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
236 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
237 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
238 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
239 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
240 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
241 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
242 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
243 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
244 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
245 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
246 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
247 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
248 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
249 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
250 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
251 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
252 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
253 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
254 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
255 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
256 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
257 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
258 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
259 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
260 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
261 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
262 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
263 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
264 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
265 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
266 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
267 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
268 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
269 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
270 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
271 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
272 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
273 2899924645 Variovorax sp. 369 Isolate Unclassified
274 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
275 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
276 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
277 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
278 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
279 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
280 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
281 2904699407
282 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
283 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
284 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
285 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
286 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
287 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
288 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
289 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
290 2906610324
291 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
292 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
293 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
294 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
295 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
296 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
297 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
298 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
299 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
300 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
301 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
302 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
303 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
304 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
305 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
306 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
307 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
308 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
309 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
310 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
311 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
312 2922425934
313 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
314 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
315 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
316 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
317 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
318 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
319 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
320 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
321 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
322 2928037797 Variovorax sp. 1126 Isolate Unclassified
323 2928044640 Variovorax sp. 1128 Isolate Unclassified
324 2928051484 Variovorax sp. 1133 Isolate Unclassified
325 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
326 2928070936 Variovorax gossypii 1167 Isolate Unclassified
327 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
328 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
329 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
330 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
331 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
332 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
333 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
334 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
335 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
336 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
337 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
338 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
339 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
340 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
341 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
342 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
343 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
344 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
345 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
346 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
347 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
348 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
349 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
350 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
351 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
352 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
353 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
354 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
355 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
356 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
357 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
358 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
359 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
360 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
361 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
362 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
363 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
364 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
365 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
366 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
367 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
368 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
369 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
370 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
371 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
372 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
373 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
374 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
375 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
376 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
377 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
378 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
379 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
380 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
381 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
382 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
383 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
384 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
385 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
386 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
387 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
388 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
389 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
390 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
391 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
392 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
393 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
394 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
395 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
396 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
397 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
398 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
399 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
400 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
401 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
402 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
403 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
404 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
405 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
406 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
407 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
408 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
409 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
410 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
411 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
412 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
413 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
414 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
415 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
416 2996887358 Rhizobium sp. R711 Isolate Nodule
417 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
418 3004167301 Mesorhizobium loti 582 Isolate Unclassified
419 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
420 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
421 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
422 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
423 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
424 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
425 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
426 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
427 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
428 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
429 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
430 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
431 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
432 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
433 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
434 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
435 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
436 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
437 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
438 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
439 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
440 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
441 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
442 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
443 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
444 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
445 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
446 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
447 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
448 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
449 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
450 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
451 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
452 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
453 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
454 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
455 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
456 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
457 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
458 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
459 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
460 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
461 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
462 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
463 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
464 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
465 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
466 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
467 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
468 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
469 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
470 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
471 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
472 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
473 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
474 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
475 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
476 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
477 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
478 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
479 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
480 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
481 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
482 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
483 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
484 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
485 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
486 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
487 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
488 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
489 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
490 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
491 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
492 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
493 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
494 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
495 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
496 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
497 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
498 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
499 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
500 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
501 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
502 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
503 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
504 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
505 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
506 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
507 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
508 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
509 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
510 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
511 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
512 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
513 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
514 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
515 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
516 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
517 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
518 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
519 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
520 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
521 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
522 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
523 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
524 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
525 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
526 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
527 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
528 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
529 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
530 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
531 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
532 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
533 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
534 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
535 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
536 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
537 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
538 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
539 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
540 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
541 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
542 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
543 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
544 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
545 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
546 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
547 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
548 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
549 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
550 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
551 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
552 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
553 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
554 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
555 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
556 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
557 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
558 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
559 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
560 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
561 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
562 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
563 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
564 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
565 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
566 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
567 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
568 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
569 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
570 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
571 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
572 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
573 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
574 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
575 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
576 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
577 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
578 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
579 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
580 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
581 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
582 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
583 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
584 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
585 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
586 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
587 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
588 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
589 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
590 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
591 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
592 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
593 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
594 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
595 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
596 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
597 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
598 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
599 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
600 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
601 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
602 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
603 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
604 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
605 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
606 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
607 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
608 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
609 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
610 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
611 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
612 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
613 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
614 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
615 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
616 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
617 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
618 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
619 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
620 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
621 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
622 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
623 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
624 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
625 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
626 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
627 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
628 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
629 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
630 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
631 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
632 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
633 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
634 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
635 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
636 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
637 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
638 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
639 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
640 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
641 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
642 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
643 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
644 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
645 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
646 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
647 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
648 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
649 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
650 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
651 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
652 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
653 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
654 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
655 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
656 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
657 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
658 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
659 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
660 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
661 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
662 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
663 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
664 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
665 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
666 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
667 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
668 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
669 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
670 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
671 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
672 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
673 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
674 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
675 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
676 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
677 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
678 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
679 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
680 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
681 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
682 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
683 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
684 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
685 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
686 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
687 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
688 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
689 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
690 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
691 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
692 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
693 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
694 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
695 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
696 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
697 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
698 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
699 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
700 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
701 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
702 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
703 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
704 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
705 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
706 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
707 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
708 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
709 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
710 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
711 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
712 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
713 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
714 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
715 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
716 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
717 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
718 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
719 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
720 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
721 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
722 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
723 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
724 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
725 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
726 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
727 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
728 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
729 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
730 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
731 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
732 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
733 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
734 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
735 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
736 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
737 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
738 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
739 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
740 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
741 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
742 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
743 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
744 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
745 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
746 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
747 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
748 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
749 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
750 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
751 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
752 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
753 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
754 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
755 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
756 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
757 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
758 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
759 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
760 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
761 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
762 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
763 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
764 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
765 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
766 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
767 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
768 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
769 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
770 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
771 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
772 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
773 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
774 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
775 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
776 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
777 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
778 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
779 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
780 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
781 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
782 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
783 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
784 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
785 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
786 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
787 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
788 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
789 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
790 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
791 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
792 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
793 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
794 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
795 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
796 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
797 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
798 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
799 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
800 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
801 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
802 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
803 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
804 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
805 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
806 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
807 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
808 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
809 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
810 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
811 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
812 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
813 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
814 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
815 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
816 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
817 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
818 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
819 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
820 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
821 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
822 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
823 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
824 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
825 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
826 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
827 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
828 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
829 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
830 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
831 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
832 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
833 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
834 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
835 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
836 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
837 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
838 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
839 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
840 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
841 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
842 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
843 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
844 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
845 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
846 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
847 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
848 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
849 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
850 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
851 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
852 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
853 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
854 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
855 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
856 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
857 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
858 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
859 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
860 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
861 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
862 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
863 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
864 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
865 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
866 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
867 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
868 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
869 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
870 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
871 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
872 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
873 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
874 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
875 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
876 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
877 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
878 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
879 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
880 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
881 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
882 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
883 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
884 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
885 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
886 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
887 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
888 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
889 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
890 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
891 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
892 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
893 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
894 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
895 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
896 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
897 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
898 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
899 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
900 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
901 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
902 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
903 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
904 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
905 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
906 8005258706 Rhizobium sp. R693 Isolate Nodule
907 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
908 8005321885 Rhizobium sp. R72 Isolate Nodule
909 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
910 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
911 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
912 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
913 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
914 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
915 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
916 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
917 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
918 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
919 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
920 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
921 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
922 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
923 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
924 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
925 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
926 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
927 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
928 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
929 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
930 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
931 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
932 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
933 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere
934 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
935 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
936 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.39
Metatranscriptomes 0
Isolates 31.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0
Endosphere 11.81
Nodule 16.91
Rhizoplane 4.83
Rhizosphere 49.54
Stem 0
Stem Tuber 0
Unclassified 16.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000007 3300002704 Bacteria 238857
2 JGI25156J39149_1000050 3300002705 Bacteria 89634
3 JGI25156J39149_1000295 3300002705 Bacteria 33633
4 JGI25162J39368_1000908 3300002737 Bacteria 19122
5 JGI25154J39366_1000035 3300002738 Bacteria 172224
6 JGI25157J39369_1000036 3300002741 Bacteria 133671
7 JGI25152J39213_1001356 3300002773 Bacteria 10707
8 JGI25150J39212_1002705 3300002774 Bacteria 4319
9 JGI25159J45721_1004063 3300002987 Bacteria 4966
10 JGI25151J46595_10000613 3300003187 Bacteria 31227
11 JGI25151J46595_10003952 3300003187 Bacteria 7995
12 JGI25151J46595_10039711 3300003187 Bacteria 1734
13 JGI25406J46586_10000006 3300003203 Bacteria 114937
14 JGI25406J46586_10002914 3300003203 Bacteria 8066
15 JGI25165J46597_1000375 3300003214 Bacteria 49445
16 JGI25165J46597_1002256 3300003214 Bacteria 6664
17 JGI25165J46597_1003958 3300003214 Bacteria 3396
18 JGI25153J46596_10005791 3300003215 Bacteria 6427
19 JGI25153J46596_10042717 3300003215 Bacteria 1381
20 JGI25160J50197_1002431 3300003354 Bacteria 8678
21 JGI25160J50197_1007040 3300003354 Bacteria 4454
22 JGI25160J50197_1015074 3300003354 Bacteria 2554
23 JGI25161J50226_1001494 3300003374 Bacteria 6959
24 Ga0055539_1000102 3300003752 Bacteria 98557
25 Ga0055533_1000110 3300003756 Bacteria 98557
26 Ga0055532_1000138 3300003758 Bacteria 71966
27 Ga0055532_1000254 3300003758 Bacteria 36666
28 Ga0055525_1000187 3300003759 Bacteria 75518
29 Ga0055535_1002320 3300003761 Bacteria 6920
30 Ga0055535_1002951 3300003761 Bacteria 5259
31 Ga0055542_1000021 3300003762 Bacteria 331499
32 Ga0055542_1000463 3300003762 Bacteria 38338
33 Ga0055526_1003161 3300003771 Bacteria 10671
34 Ga0055537_1000827 3300003773 Bacteria 15208
35 Ga0055524_1002061 3300003775 Bacteria 10671
36 Ga0055524_1009264 3300003775 Bacteria 4025
37 Ga0055536_1000093 3300003781 Bacteria 77156
38 Ga0055536_1000216 3300003781 Bacteria 47208
39 Ga0055534_1002463 3300003784 Bacteria 6391
40 Ga0055528_1001194 3300003790 Bacteria 16759
41 Ga0055528_1001347 3300003790 Bacteria 15208
42 Ga0055528_1007556 3300003790 Bacteria 4791
43 Ga0055530_10000034 3300003791 Bacteria 118012
44 Ga0055530_10002982 3300003791 Bacteria 10179
45 Ga0055540_1000064 3300003792 Bacteria 127318
46 Ga0055540_1000429 3300003792 Bacteria 33431
47 Ga0055531_10000039 3300003794 Bacteria 141103
48 Ga0055541_1000068 3300003841 Bacteria 98557
49 Ga0058692_1002826 3300003856 Bacteria 5691
50 Ga0055543_1000909 3300004625 Bacteria 13859
51 Ga0065165_1000393 3300005262 Bacteria 71081
52 Ga0065165_1005554 3300005262 Bacteria 7018
53 Ga0065714_10011017 3300005288 Bacteria 3091
54 Ga0065704_10081044 3300005289 Bacteria 3807
55 Ga0065712_10000260 3300005290 Bacteria 16444
56 Ga0070658_10197786 3300005327 Bacteria 1695
57 Ga0070658_10198021 3300005327 Bacteria 1694
58 Ga0070683_100056257 3300005329 Bacteria 3653
59 Ga0070683_100071169 3300005329 Bacteria 3245
60 Ga0070670_100000359 3300005331 Bacteria 38101
61 Ga0070680_100074218 3300005336 Bacteria 2799
62 Ga0070682_100077440 3300005337 Bacteria 2143
63 Ga0070668_100000734 3300005347 Bacteria 22404
64 Ga0070668_100006327 3300005347 Bacteria 8769
65 Ga0070668_100019325 3300005347 Bacteria 5127
66 Ga0070668_100048293 3300005347 Bacteria 3273
67 Ga0070668_100093749 3300005347 Bacteria 2370
68 Ga0070669_100003483 3300005353 Bacteria 11344
69 Ga0070669_100032753 3300005353 Bacteria 3755
70 Ga0070669_100120838 3300005353 Bacteria 1998
71 Ga0070674_100144345 3300005356 Bacteria 1790
72 Ga0070667_100001509 3300005367 Bacteria 20831
73 Ga0070667_100003665 3300005367 Bacteria 13078
74 Ga0070709_10004497 3300005434 Bacteria 7524
75 Ga0070709_10026694 3300005434 Bacteria 3426
76 Ga0070714_100004196 3300005435 Bacteria 10848
77 Ga0070714_100091486 3300005435 Bacteria 2666
78 Ga0070713_100009387 3300005436 Bacteria 6999
79 Ga0070713_100067291 3300005436 Bacteria 3016
80 Ga0070713_100086405 3300005436 Bacteria 2689
81 Ga0070713_100091636 3300005436 Bacteria 2615
82 Ga0070713_100117112 3300005436 Bacteria 2331
83 Ga0070710_10004116 3300005437 Bacteria 6901
84 Ga0070711_100004725 3300005439 Bacteria 8066
85 Ga0070711_100055615 3300005439 Bacteria 2734
86 Ga0070711_100064628 3300005439 Bacteria 2557
87 Ga0070678_100016493 3300005456 Bacteria 4729
88 Ga0070681_10044250 3300005458 Bacteria 4455
89 Ga0070706_100170110 3300005467 Bacteria 2034
90 Ga0070698_100000351 3300005471 Bacteria 47558
91 Ga0070679_100016753 3300005530 Bacteria 7082
92 Ga0070684_100158321 3300005535 Bacteria 2054
93 Ga0070697_100047675 3300005536 Bacteria 3473
94 Ga0070697_100052582 3300005536 Bacteria 3310
95 Ga0068853_100055368 3300005539 Bacteria 3418
96 Ga0068853_100061917 3300005539 Bacteria 3237
97 Ga0068853_100118484 3300005539 Bacteria 2359
98 Ga0070665_100001296 3300005548 Bacteria 29934
99 Ga0070665_100011759 3300005548 Bacteria 8837
100 Ga0070665_100023461 3300005548 Bacteria 6212
101 Ga0070665_100056340 3300005548 Bacteria 3941
102 Ga0068855_100048315 3300005563 Bacteria 5023
103 Ga0070664_100041024 3300005564 Bacteria 3904
104 Ga0068854_100044261 3300005578 Bacteria 3159
105 Ga0068856_100000427 3300005614 Bacteria 46259
106 Ga0068856_100124864 3300005614 Bacteria 2577
107 Ga0068856_100145970 3300005614 Bacteria 2374
108 Ga0068852_100215524 3300005616 Bacteria 1824
109 Ga0068859_100002889 3300005617 Bacteria 17455
110 Ga0068859_100197269 3300005617 Bacteria 2097
111 Ga0068851_10029404 3300005834 Bacteria 2720
112 Ga0068851_10035695 3300005834 Bacteria 2487
113 Ga0068863_100245583 3300005841 Bacteria 1728
114 Ga0068860_100000265 3300005843 Bacteria 76672
115 Ga0068860_100294113 3300005843 Bacteria 1590
116 Ga0068862_100070026 3300005844 Bacteria 3028
117 Ga0068862_100258304 3300005844 Bacteria 1589
118 Ga0081455_10000058 3300005937 Bacteria 119171
119 Ga0081455_10000366 3300005937 Bacteria 59625
120 Ga0081455_10000764 3300005937 Bacteria 41761
121 Ga0081455_10001795 3300005937 Bacteria 25921
122 Ga0081538_10005836 3300005981 Bacteria 10970
123 Ga0081538_10026519 3300005981 Bacteria 4049
124 Ga0081540_1000040 3300005983 Bacteria 136968
125 Ga0081540_1000916 3300005983 Bacteria 26580
126 Ga0081540_1001739 3300005983 Bacteria 18329
127 Ga0081540_1002782 3300005983 Bacteria 14184
128 Ga0081540_1013100 3300005983 Bacteria 5415
129 Ga0081540_1021438 3300005983 Bacteria 3846
130 Ga0081540_1049839 3300005983 Bacteria 2085
131 Ga0081539_10000176 3300005985 Bacteria 150292
132 Ga0081539_10000231 3300005985 Bacteria 131197
133 Ga0081539_10009227 3300005985 Bacteria 8305
134 Ga0081539_10062309 3300005985 Bacteria 2039
135 Ga0070717_10076107 3300006028 Bacteria 2808
136 Ga0075365_10002455 3300006038 Bacteria 9101
137 Ga0075365_10002499 3300006038 Bacteria 9051
138 Ga0075365_10025473 3300006038 Bacteria 3745
139 Ga0075368_10002158 3300006042 Bacteria 6361
140 Ga0075363_100002264 3300006048 Bacteria 7796
141 Ga0070716_100005587 3300006173 Bacteria 6104
142 Ga0070716_100078614 3300006173 Bacteria 1962
143 Ga0070712_100028636 3300006175 Bacteria 3728
144 Ga0070712_100066082 3300006175 Bacteria 2569
145 Ga0075367_10026312 3300006178 Bacteria 3299
146 Ga0075366_10008450 3300006195 Bacteria 5727
147 Ga0075370_10098471 3300006353 Bacteria 1691
148 Ga0068871_100219901 3300006358 Bacteria 1645
149 Ga0075430_100155975 3300006846 Bacteria 1901
150 Ga0075431_100001187 3300006847 Bacteria 23494
151 Ga0075433_10001198 3300006852 Bacteria 18880
152 Ga0075433_10212747 3300006852 Bacteria 1718
153 Ga0075434_100005705 3300006871 Bacteria 11367
154 Ga0097620_100002889 3300006931 Bacteria 17455
155 Ga0097620_100197255 3300006931 Bacteria 2097
156 Ga0099824_1006719 3300006942 Bacteria 15641
157 Ga0099822_1001392 3300006943 Bacteria 27954
158 Ga0099826_10007333 3300006948 Bacteria 8130
159 Ga0075435_100096255 3300007076 Bacteria 2449
160 Ga0099794_10048101 3300007265 Bacteria 2046
161 Ga0105251_10000274 3300009011 Bacteria 51694
162 Ga0105251_10001467 3300009011 Bacteria 20259
163 Ga0105244_10000607 3300009036 Bacteria 31826
164 Ga0105244_10013667 3300009036 Bacteria 4731
165 Ga0105244_10023885 3300009036 Bacteria 3344
166 Ga0105244_10034350 3300009036 Bacteria 2670
167 Ga0105244_10047892 3300009036 Bacteria 2190
168 Ga0105250_10000078 3300009092 Bacteria 84506
169 Ga0105250_10000191 3300009092 Bacteria 52429
170 Ga0105250_10001522 3300009092 Bacteria 12502
171 Ga0105250_10030412 3300009092 Bacteria 2171
172 Ga0105240_10000019 3300009093 Bacteria 406211
173 Ga0105240_10067903 3300009093 Bacteria 4418
174 Ga0105240_10086641 3300009093 Bacteria 3836
175 Ga0105240_10142232 3300009093 Bacteria 2867
176 Ga0111539_10004293 3300009094 Bacteria 18644
177 Ga0111539_10026576 3300009094 Bacteria 7077
178 Ga0105245_10069337 3300009098 Bacteria 3197
179 Ga0114129_10033150 3300009147 Bacteria 7299
180 Ga0105243_10003033 3300009148 Bacteria 13848
181 Ga0105243_10004474 3300009148 Bacteria 11050
182 Ga0105243_10017593 3300009148 Bacteria 5406
183 Ga0105243_10024978 3300009148 Bacteria 4562
184 Ga0105241_10074952 3300009174 Bacteria 2636
185 Ga0105241_10144679 3300009174 Bacteria 1939
186 Ga0105241_10230665 3300009174 Bacteria 1560
187 Ga0105237_10001204 3300009545 Bacteria 34612
188 Ga0105237_10002159 3300009545 Bacteria 24750
189 Ga0105237_10006864 3300009545 Bacteria 12549
190 Ga0105237_10026637 3300009545 Bacteria 5908
191 Ga0105237_10216874 3300009545 Bacteria 1913
192 Ga0105238_10007002 3300009551 Bacteria 11276
193 Ga0105238_10018527 3300009551 Bacteria 7085
194 Ga0105249_10295590 3300009553 Bacteria 1622
195 Ga0105249_10315408 3300009553 Bacteria 1573
196 Ga0123342_1026161 3300009766 Bacteria 3421
197 Ga0105239_10001427 3300010375 Bacteria 31882
198 Ga0105239_10002299 3300010375 Bacteria 24398
199 Ga0105239_10064579 3300010375 Bacteria 4018
200 Ga0105239_10091118 3300010375 Bacteria 3364
201 Ga0105239_10098729 3300010375 Bacteria 3228
202 Ga0105246_10001379 3300011119 Bacteria 14334
203 Ga0105246_10009601 3300011119 Bacteria 5963
204 Ga0157345_1000006 3300012498 Bacteria 72396
205 Ga0157373_10020395 3300013100 Bacteria 4818
206 Ga0157373_10109812 3300013100 Bacteria 1939
207 Ga0157371_10000042 3300013102 Bacteria 198938
208 Ga0157371_10004709 3300013102 Bacteria 11792
209 Ga0157371_10083815 3300013102 Bacteria 2257
210 Ga0157370_10000035 3300013104 Bacteria 137103
211 Ga0157370_10000131 3300013104 Bacteria 89805
212 Ga0157370_10069515 3300013104 Bacteria 3325
213 Ga0157370_10094735 3300013104 Bacteria 2801
214 Ga0157370_10126123 3300013104 Bacteria 2389
215 Ga0157370_10227157 3300013104 Bacteria 1728
216 Ga0157369_10005587 3300013105 Bacteria 14604
217 Ga0157369_10006177 3300013105 Bacteria 13901
218 Ga0157369_10009585 3300013105 Bacteria 11074
219 Ga0157369_10010643 3300013105 Bacteria 10470
220 Ga0157369_10067587 3300013105 Bacteria 3841
221 Ga0157369_10101511 3300013105 Bacteria 3066
222 Ga0157369_10115729 3300013105 Bacteria 2847
223 Ga0157369_10142127 3300013105 Bacteria 2539
224 Ga0157374_10033704 3300013296 Bacteria 4674
225 Ga0157374_10037116 3300013296 Bacteria 4470
226 Ga0157374_10072122 3300013296 Bacteria 3257
227 Ga0157378_10009614 3300013297 Bacteria 8418
228 Ga0163162_10000199 3300013306 Bacteria 55532
229 Ga0157372_10005780 3300013307 Bacteria 13176
230 Ga0157375_10000820 3300013308 Bacteria 27191
231 Ga0157375_10019193 3300013308 Bacteria 6212
232 Ga0157375_10296274 3300013308 Bacteria 1781
233 Ga0163163_10092729 3300014325 Bacteria 3036
234 Ga0182008_10002472 3300014497 Bacteria 11564
235 Ga0182008_10037101 3300014497 Bacteria 2439
236 Ga0157376_10137365 3300014969 Bacteria 2189
237 Ga0182006_1001883 3300015261 Bacteria 11976
238 Ga0182006_1003283 3300015261 Bacteria 8358
239 Ga0183362_10008 3300015683 Bacteria 223037
240 Ga0163161_10000139 3300017792 Bacteria 67878
241 Ga0163161_10006288 3300017792 Bacteria 8220
242 Ga0163161_10038439 3300017792 Bacteria 3433
243 Ga0213872_10007327 3300021361 Bacteria 5444
244 Ga0213872_10023178 3300021361 Bacteria 2857
245 Ga0213876_10038944 3300021384 Bacteria 2510
246 Ga0213871_10000078 3300021441 Bacteria 8306
247 Ga0209435_100005 3300025206 Bacteria 573745
248 Ga0209435_100373 3300025206 Bacteria 10012
249 Ga0209436_108537 3300025208 Bacteria 2031
250 Ga0209784_100057 3300025224 Bacteria 167476
251 Ga0209566_100073 3300025225 Bacteria 167476
252 Ga0209674_100095 3300025226 Bacteria 167476
253 Ga0209672_100295 3300025228 Bacteria 34529
254 Ga0209147_100021 3300025229 Bacteria 464719
255 Ga0209147_100092 3300025229 Bacteria 167476
256 Ga0209563_100093 3300025230 Bacteria 167476
257 Ga0209563_101932 3300025230 Bacteria 5007
258 Ga0209437_100058 3300025233 Bacteria 357279
259 Ga0209437_100060 3300025233 Bacteria 355034
260 Ga0209258_100058 3300025242 Bacteria 331567
261 Ga0209258_100300 3300025242 Bacteria 80484
262 Ga0207425_1000157 3300025245 Bacteria 57625
263 Ga0209646_1000011 3300025246 Bacteria 573745
264 Ga0209646_1000617 3300025246 Bacteria 13677
265 Ga0209646_1007185 3300025246 Bacteria 1830
266 Ga0209026_1000005 3300025250 Bacteria 731387
267 Ga0209026_1000008 3300025250 Bacteria 573745
268 Ga0209026_1002172 3300025250 Bacteria 7614
269 Ga0209677_100054 3300025253 Bacteria 167476
270 Ga0209677_101475 3300025253 Bacteria 10119
271 Ga0209148_1000057 3300025254 Bacteria 360463
272 Ga0209148_1000071 3300025254 Bacteria 331551
273 Ga0209759_1000004 3300025256 Bacteria 573745
274 Ga0209759_1000082 3300025256 Bacteria 169562
275 Ga0209759_1000265 3300025256 Bacteria 75472
276 Ga0209759_1010198 3300025256 Bacteria 2772
277 Ga0209129_1000483 3300025258 Bacteria 29091
278 Ga0209129_1002306 3300025258 Bacteria 9481
279 Ga0209233_1000240 3300025261 Bacteria 90758
280 Ga0209233_1000275 3300025261 Bacteria 72941
281 Ga0209233_1000814 3300025261 Bacteria 13897
282 Ga0209233_1004380 3300025261 Bacteria 4812
283 Ga0209565_1000038 3300025263 Bacteria 286433
284 Ga0209455_1000205 3300025272 Bacteria 84765
285 Ga0209455_1003651 3300025272 Bacteria 5340
286 Ga0209673_1000362 3300025273 Bacteria 81651
287 Ga0209673_1001694 3300025273 Bacteria 18740
288 Ga0209673_1012725 3300025273 Bacteria 3370
289 Ga0209130_1000061 3300025284 Bacteria 200990
290 Ga0209130_1000664 3300025284 Bacteria 31314
291 Ga0209130_1001275 3300025284 Bacteria 17462
292 Ga0209675_1000102 3300025291 Bacteria 123742
293 Ga0209675_1002094 3300025291 Bacteria 10587
294 Ga0209676_1000025 3300025292 Bacteria 577569
295 Ga0209676_1000032 3300025292 Bacteria 469558
296 Ga0209676_1000404 3300025292 Bacteria 77964
297 Ga0209676_1003421 3300025292 Bacteria 9780
298 Ga0209025_1000056 3300025294 Bacteria 316188
299 Ga0209025_1000486 3300025294 Bacteria 76804
300 Ga0209025_1002869 3300025294 Bacteria 17281
301 Ga0209025_1011019 3300025294 Bacteria 6029
302 Ga0209025_1041756 3300025294 Bacteria 1959
303 Ga0209564_1000542 3300025295 Bacteria 60997
304 Ga0209564_1004853 3300025295 Bacteria 7994
305 Ga0209758_1000044 3300025297 Bacteria 398448
306 Ga0209758_1001732 3300025297 Bacteria 24300
307 Ga0209758_1001986 3300025297 Bacteria 22053
308 Ga0209758_1002282 3300025297 Bacteria 19849
309 Ga0209758_1003333 3300025297 Bacteria 14770
310 Ga0209758_1003786 3300025297 Bacteria 13331
311 Ga0209758_1023382 3300025297 Bacteria 2796
312 Ga0209050_1000025 3300025298 Bacteria 528225
313 Ga0209050_1000099 3300025298 Bacteria 232176
314 Ga0209256_1000020 3300025299 Bacteria 542402
315 Ga0209256_1001947 3300025299 Bacteria 18747
316 Ga0207426_1000001 3300025302 Bacteria 1341301
317 Ga0207426_1000451 3300025302 Bacteria 65459
318 Ga0207426_1002786 3300025302 Bacteria 10498
319 Ga0209051_1000026 3300025303 Bacteria 413311
320 Ga0209051_1000039 3300025303 Bacteria 319632
321 Ga0209051_1000047 3300025303 Bacteria 293227
322 Ga0209051_1003798 3300025303 Bacteria 9663
323 Ga0209051_1011280 3300025303 Bacteria 4427
324 Ga0209257_1000034 3300025304 Bacteria 662719
325 Ga0209257_1001689 3300025304 Bacteria 24828
326 Ga0207656_10005610 3300025321 Bacteria 4451
327 Ga0207696_1000071 3300025711 Bacteria 225219
328 Ga0207696_1000078 3300025711 Bacteria 207623
329 Ga0207696_1000212 3300025711 Bacteria 87811
330 Ga0207696_1000961 3300025711 Bacteria 17531
331 Ga0207696_1021437 3300025711 Bacteria 2069
332 Ga0207655_1000014 3300025728 Bacteria 607124
333 Ga0207655_1000441 3300025728 Bacteria 55196
334 Ga0207655_1001362 3300025728 Bacteria 22923
335 Ga0207655_1001748 3300025728 Bacteria 19046
336 Ga0207655_1006386 3300025728 Bacteria 7825
337 Ga0207655_1014596 3300025728 Bacteria 4428
338 Ga0207713_1000010 3300025735 Bacteria 528374
339 Ga0207713_1001597 3300025735 Bacteria 17721
340 Ga0207713_1003526 3300025735 Bacteria 10607
341 Ga0207713_1006493 3300025735 Bacteria 7112
342 Ga0207713_1011892 3300025735 Bacteria 4696
343 Ga0207713_1014554 3300025735 Bacteria 4082
344 Ga0207692_10001246 3300025898 Bacteria 9460
345 Ga0207699_10000763 3300025906 Bacteria 15426
346 Ga0207699_10062447 3300025906 Bacteria 2246
347 Ga0207645_10043988 3300025907 Bacteria 2858
348 Ga0207705_10163338 3300025909 Bacteria 1674
349 Ga0207684_10114167 3300025910 Bacteria 2313
350 Ga0207654_10086047 3300025911 Bacteria 1904
351 Ga0207707_10029007 3300025912 Bacteria 4836
352 Ga0207707_10056027 3300025912 Bacteria 3429
353 Ga0207707_10080667 3300025912 Bacteria 2841
354 Ga0207695_10000049 3300025913 Bacteria 406233
355 Ga0207695_10003498 3300025913 Bacteria 22039
356 Ga0207695_10043878 3300025913 Bacteria 4760
357 Ga0207695_10096753 3300025913 Bacteria 2954
358 Ga0207695_10198549 3300025913 Bacteria 1921
359 Ga0207671_10001771 3300025914 Bacteria 24269
360 Ga0207671_10009517 3300025914 Bacteria 8114
361 Ga0207671_10020040 3300025914 Bacteria 5101
362 Ga0207671_10040867 3300025914 Bacteria 3432
363 Ga0207671_10050623 3300025914 Bacteria 3076
364 Ga0207671_10082481 3300025914 Bacteria 2413
365 Ga0207693_10081334 3300025915 Bacteria 2536
366 Ga0207663_10042162 3300025916 Bacteria 2787
367 Ga0207663_10111722 3300025916 Bacteria 1855
368 Ga0207663_10135336 3300025916 Bacteria 1709
369 Ga0207660_10003538 3300025917 Bacteria 10179
370 Ga0207660_10154060 3300025917 Bacteria 1768
371 Ga0207657_10085467 3300025919 Bacteria 2643
372 Ga0207652_10010392 3300025921 Bacteria 7494
373 Ga0207652_10057070 3300025921 Bacteria 3362
374 Ga0207681_10001048 3300025923 Bacteria 17940
375 Ga0207681_10001413 3300025923 Bacteria 15506
376 Ga0207681_10060130 3300025923 Bacteria 2607
377 Ga0207694_10004900 3300025924 Bacteria 10394
378 Ga0207694_10069419 3300025924 Bacteria 2753
379 Ga0207650_10000295 3300025925 Bacteria 50101
380 Ga0207650_10002333 3300025925 Bacteria 13220
381 Ga0207700_10032960 3300025928 Bacteria 3702
382 Ga0207700_10053019 3300025928 Bacteria 3036
383 Ga0207700_10064987 3300025928 Bacteria 2782
384 Ga0207664_10019001 3300025929 Bacteria 5071
385 Ga0207664_10097018 3300025929 Bacteria 2428
386 Ga0207644_10218694 3300025931 Bacteria 1509
387 Ga0207706_10153171 3300025933 Bacteria 2028
388 Ga0207709_10000040 3300025935 Bacteria 259497
389 Ga0207709_10019621 3300025935 Bacteria 3804
390 Ga0207665_10002269 3300025939 Bacteria 12975
391 Ga0207665_10119013 3300025939 Bacteria 1864
392 Ga0207711_10084540 3300025941 Bacteria 2778
393 Ga0207711_10149314 3300025941 Bacteria 2108
394 Ga0207689_10046690 3300025942 Bacteria 3579
395 Ga0207661_10034196 3300025944 Bacteria 3951
396 Ga0207667_10046644 3300025949 Bacteria 4588
397 Ga0207667_10161664 3300025949 Bacteria 2303
398 Ga0207712_10184219 3300025961 Bacteria 1643
399 Ga0207668_10000033 3300025972 Bacteria 121080
400 Ga0207668_10012379 3300025972 Bacteria 5221
401 Ga0207668_10042899 3300025972 Bacteria 3066
402 Ga0207640_10030435 3300025981 Bacteria 3324
403 Ga0207640_10107267 3300025981 Bacteria 1972
404 Ga0207640_10138929 3300025981 Bacteria 1768
405 Ga0207658_10001268 3300025986 Bacteria 19958
406 Ga0207658_10004077 3300025986 Bacteria 10198
407 Ga0207703_10260727 3300026035 Bacteria 1567
408 Ga0207639_10007940 3300026041 Bacteria 7250
409 Ga0207639_10075984 3300026041 Bacteria 2643
410 Ga0207639_10088242 3300026041 Bacteria 2474
411 Ga0207702_10002818 3300026078 Bacteria 16258
412 Ga0207702_10006542 3300026078 Bacteria 10021
413 Ga0207702_10043495 3300026078 Bacteria 3771
414 Ga0207702_10083796 3300026078 Bacteria 2774
415 Ga0207702_10170448 3300026078 Bacteria 1995
416 Ga0207641_10115717 3300026088 Bacteria 2385
417 Ga0207674_10092290 3300026116 Bacteria 3018
418 Ga0207683_10044288 3300026121 Bacteria 3890
419 Ga0207683_10158234 3300026121 Bacteria 2047
420 Ga0209389_1000068 3300027296 Bacteria 98954
421 Ga0209371_1000003 3300027312 Bacteria 1122971
422 Ga0209371_1003295 3300027312 Bacteria 7996
423 Ga0209371_1004989 3300027312 Bacteria 5487
424 Ga0209589_1000023 3300027357 Bacteria 177856
425 Ga0209489_100032 3300027361 Bacteria 177856
426 Ga0209489_113471 3300027361 Bacteria 6562
427 Ga0209700_100040 3300027363 Bacteria 177856
428 Ga0209700_100117 3300027363 Bacteria 115595
429 Ga0209282_1013642 3300027666 Bacteria 5171
430 Ga0207428_10039670 3300027907 Bacteria 3824
431 Ga0268266_10004462 3300028379 Bacteria 13381
432 Ga0268266_10007442 3300028379 Bacteria 9880
433 Ga0268266_10014083 3300028379 Bacteria 6884
434 Ga0268266_10034015 3300028379 Bacteria 4332
435 Ga0268266_10056761 3300028379 Bacteria 3368
436 Ga0268266_10104048 3300028379 Bacteria 2506
437 Ga0268266_10166119 3300028379 Bacteria 1999
438 Ga0268266_10192613 3300028379 Bacteria 1862
439 Ga0268264_10000318 3300028381 Bacteria 76687
440 Ga0265334_10012389 3300028573 Bacteria 3584
441 Ga0265334_10017805 3300028573 Bacteria 2931
442 Ga0265318_10006964 3300028577 Bacteria 5152
443 Ga0307515_10082124 3300028794 Bacteria 4174
444 Ga0268256_1000004 3300030500 Bacteria 1122967
445 Ga0268256_1002990 3300030500 Bacteria 7996
446 Ga0307511_10086694 3300030521 Bacteria 2155
447 Ga0316181_1206187 3300030744 Bacteria 10221
448 Ga0316182_1118994 3300030745 Bacteria 1556
449 Ga0265340_10004049 3300031247 Bacteria 8231
450 Ga0265340_10059627 3300031247 Bacteria 1830
451 Ga0265327_10002922 3300031251 Bacteria 17100
452 Ga0307509_10147409 3300031507 Bacteria 2276
453 Ga0307508_10000010 3300031616 Bacteria 255747
454 Ga0265314_10047018 3300031711 Bacteria 3040
455 Ga0307416_100284656 3300032002 Bacteria 1632
456 Ga0307411_10006188 3300032005 Bacteria 5960
457 Ga0307507_10063344 3300033179 Bacteria 3424
458 Ga0307510_10000085 3300033180 Bacteria 70352
459 Ga0307510_10007185 3300033180 Bacteria 13262
460 Ga0315911_1000029 3300033442 Bacteria 82350
461 Ga0373934_0006326 3300035086 Bacteria 4390
462 Ga0373934_0028433 3300035086 Bacteria 2179
463 Ga0373940_0014749 3300035088 Bacteria 1911
464 Ga0373949_0014712 3300035090 Bacteria 1744
465 Ga0373936_0000012 3300035113 Bacteria 228915
466 Ga0373936_0000048 3300035113 Bacteria 69508
467 Ga0373936_0052766 3300035113 Bacteria 1648
468 Ga0373953_0000640 3300035117 Bacteria 9722
469 Ga0373953_0011634 3300035117 Bacteria 3095
470 Ga0373954_0000067 3300035118 Bacteria 37060
471 Ga0373956_0002213 3300035119 Bacteria 8017
472 Ga0373956_0012978 3300035119 Bacteria 3462
473 Ga0373957_0001550 3300035120 Bacteria 6266
474 Ga0373955_0003543 3300035172 Bacteria 6870
475 Ga0373955_0009025 3300035172 Bacteria 4656
476 Ga0373962_0001722 3300035242 Bacteria 5202
477 Ga0373924_0000928 3300035410 Bacteria 9241
478 Ga0373924_0006108 3300035410 Bacteria 4301
479 Ga0373931_0003739 3300035691 Bacteria 6883
480 Ga0373931_0023668 3300035691 Bacteria 3103
481 Ga0373931_0064578 3300035691 Bacteria 1982
482 Ga0373935_0093265 3300035692 Bacteria 1974
483 Ga0373935_0107883 3300035692 Bacteria 1844
484 Ga0373935_0141194 3300035692 Bacteria 1627
485 Ga0373927_0017434 3300035695 Bacteria 4725
486 Ga0373927_0162396 3300035695 Bacteria 1464
487 Ga0373933_0000324 3300035724 Bacteria 30843
488 Ga0373933_0000746 3300035724 Bacteria 19870
489 Ga0373933_0006219 3300035724 Bacteria 6496
490 Ga0373933_0022874 3300035724 Bacteria 3564
491 Ga0373947_0011851 3300035725 Bacteria 4997
492 Ga0373947_0015707 3300035725 Bacteria 4349
493 Ga0373937_0000413 3300036401 Bacteria 39908
494 Ga0373937_0001425 3300036401 Bacteria 19991
495 Ga0373937_0001548 3300036401 Bacteria 19310
496 Ga0373937_0023468 3300036401 Bacteria 5554
497 Ga0373937_0025703 3300036401 Bacteria 5318
498 Ga0373925_0013237 3300037068 Bacteria 5970
499 Ga0373925_0063685 3300037068 Bacteria 2775
500 Ga0373925_0086422 3300037068 Bacteria 2392
501 Ga0395899_0003559 3300037312 Bacteria 12330
502 Ga0395899_0030722 3300037312 Bacteria 4039
503 Ga0395900_0001064 3300037418 Bacteria 35026
504 Ga0395900_0025676 3300037418 Bacteria 6031
505 Ga0395900_0028557 3300037418 Bacteria 5716
506 Ga0395900_0087840 3300037418 Bacteria 3195
507 Ga0395900_0126534 3300037418 Bacteria 2621
508 Ga0395900_0130163 3300037418 Bacteria 2579
509 Ga0395900_0291392 3300037418 Bacteria 1621
510 Ga0395898_0128102 3300037466 Bacteria 2432
511 Ga0395898_0151633 3300037466 Bacteria 2217
512 Ga0395905_0035462 3300037471 Bacteria 4684
513 Ga0395905_0171592 3300037471 Bacteria 2037
514 Ga0436364_0867524 3300037853 Bacteria 16925
515 Ga0395901_0029508 3300038443 Bacteria 5648
516 Ga0395901_0035567 3300038443 Bacteria 5147
517 Ga0395901_0060827 3300038443 Bacteria 3930
518 Ga0395901_0256413 3300038443 Bacteria 1821
519 Ga0237819_02648 3300038705 Bacteria 3502
520 Ga0436365_0871323 3300039437 Bacteria 58014
521 Ga0436365_1607850 3300039437 Bacteria 28034
522 Ga0436360_1295423 3300039438 Bacteria 34613
523 Ga0436361_0144287 3300039447 Bacteria 22519
524 Ga0436361_0183072 3300039447 Bacteria 4156
525 Ga0436361_0256362 3300039447 Bacteria 3344
526 Ga0436361_0294136 3300039447 Bacteria 3610
527 Ga0436361_0488499 3300039447 Bacteria 8012
528 Ga0436361_0983753 3300039447 Bacteria 1638
529 Ga0436361_1199195 3300039447 Bacteria 1589
530 Ga0436363_1134489 3300039450 Bacteria 2109
531 Ga0436363_1329538 3300039450 Bacteria 2770
532 Ga0439465_0020010 3300041413 Bacteria 2094
533 Ga0451793_1407387 3300041452 Bacteria 3413
534 Ga0451797_0747061 3300041453 Bacteria 3557
535 Ga0451807_0031918 3300041486 Bacteria 10646
536 Ga0439451_007601 3300042009 Bacteria 2205
537 Ga0439463_000088 3300042016 Bacteria 21428
538 Ga0450911_000132 3300042115 Bacteria 29769
539 Ga0450904_001603 3300042139 Bacteria 3069
540 Ga0466972_0000076 3300044658 Bacteria 92672
541 Ga0466966_0014368 3300044684 Bacteria 5241
542 Ga0466961_0000600 3300044693 Bacteria 22699
543 Ga0466963_0066091 3300044694 Bacteria 2425
544 Ga0466970_0010203 3300044765 Bacteria 4760
545 Ga0466960_0006169 3300044901 Bacteria 4798
546 Ga0466959_0000651 3300045049 Bacteria 20259
547 Ga0466959_0003113 3300045049 Bacteria 10757
548 Ga0466958_0050355 3300045836 Bacteria 2522
549 Ga0495627_000962 3300046453 Bacteria 19713
550 Ga0495627_001135 3300046453 Bacteria 17214
551 Ga0495627_003213 3300046453 Bacteria 7353
552 Ga0495592_0000629 3300046454 Bacteria 24609
553 Ga0495592_0001030 3300046454 Bacteria 19355
554 Ga0495603_0059365 3300046455 Bacteria 2261
555 Ga0495591_001034 3300046458 Bacteria 18824
556 Ga0495591_001961 3300046458 Bacteria 12020
557 Ga0495591_003002 3300046458 Bacteria 8990
558 Ga0495591_006316 3300046458 Bacteria 5265
559 Ga0495591_025435 3300046458 Bacteria 1857
560 Ga0495629_0000398 3300046459 Bacteria 36605
561 Ga0495629_0000948 3300046459 Bacteria 23342
562 Ga0495638_0000120 3300046460 Bacteria 127382
563 Ga0495638_0000830 3300046460 Bacteria 32408
564 Ga0495638_0007158 3300046460 Bacteria 8039
565 Ga0495638_0010795 3300046460 Bacteria 6317
566 Ga0495651_0000319 3300046462 Bacteria 37294
567 Ga0495651_0004166 3300046462 Bacteria 11071
568 Ga0495653_0000391 3300046463 Bacteria 35079
569 Ga0495653_0000598 3300046463 Bacteria 27691
570 Ga0495653_0002549 3300046463 Bacteria 14521
571 Ga0495650_0020937 3300046471 Bacteria 3175
572 Ga0495650_0059865 3300046471 Bacteria 1531
573 Ga0495580_0007113 3300046472 Bacteria 9013
574 Ga0495582_0094401 3300046473 Bacteria 1670
575 Ga0495582_0116066 3300046473 Bacteria 1506
576 Ga0495605_0000158 3300046474 Bacteria 86829
577 Ga0495605_0000164 3300046474 Bacteria 84623
578 Ga0495605_0000220 3300046474 Bacteria 70521
579 Ga0495605_0009203 3300046474 Bacteria 5553
580 Ga0495605_0043870 3300046474 Bacteria 2214
581 Ga0495605_0061269 3300046474 Bacteria 1801
582 Ga0495664_0000849 3300046477 Bacteria 15703
583 Ga0495584_0057027 3300046491 Bacteria 1965
584 Ga0495585_0033962 3300046492 Bacteria 2884
585 Ga0495585_0054980 3300046492 Bacteria 2200
586 Ga0495585_0104414 3300046492 Bacteria 1512
587 Ga0495596_0011116 3300046500 Bacteria 3893
588 Ga0495607_0000013 3300046501 Bacteria 189755
589 Ga0495607_0000032 3300046501 Bacteria 153288
590 Ga0495607_0000082 3300046501 Bacteria 96822
591 Ga0495607_0002081 3300046501 Bacteria 16718
592 Ga0495607_0003493 3300046501 Bacteria 12023
593 Ga0495607_0007523 3300046501 Bacteria 7524
594 Ga0495607_0053320 3300046501 Bacteria 2338
595 Ga0495607_0077763 3300046501 Bacteria 1832
596 Ga0495607_0084209 3300046501 Bacteria 1740
597 Ga0495583_0000086 3300046506 Bacteria 165176
598 Ga0495583_0000226 3300046506 Bacteria 95293
599 Ga0495583_0009346 3300046506 Bacteria 5869
600 Ga0495606_0000061 3300046507 Bacteria 185384
601 Ga0495606_0003058 3300046507 Bacteria 18238
602 Ga0495606_0004653 3300046507 Bacteria 13571
603 Ga0495606_0005451 3300046507 Bacteria 12180
604 Ga0495606_0088820 3300046507 Bacteria 1905
605 Ga0495606_0117021 3300046507 Bacteria 1600
606 Ga0495606_0133929 3300046507 Eukaryota 1470
607 Ga0495608_0000916 3300046511 Bacteria 20676
608 Ga0495608_0002252 3300046511 Bacteria 13923
609 Ga0495608_0003379 3300046511 Bacteria 11423
610 Ga0495608_0071490 3300046511 Bacteria 2263
611 Ga0495610_0000138 3300046512 Bacteria 81842
612 Ga0495610_0005026 3300046512 Bacteria 9562
613 Ga0495610_0008977 3300046512 Bacteria 6391
614 Ga0495610_0016998 3300046512 Bacteria 4163
615 Ga0495616_0003497 3300046513 Bacteria 10047
616 Ga0495616_0003740 3300046513 Bacteria 9705
617 Ga0495616_0003971 3300046513 Bacteria 9413
618 Ga0495616_0038331 3300046513 Bacteria 2461
619 Ga0495616_0081280 3300046513 Bacteria 1550
620 Ga0495616_0084874 3300046513 Bacteria 1509
621 Ga0495620_0000047 3300046515 Bacteria 107032
622 Ga0495620_0001699 3300046515 Bacteria 12996
623 Ga0495620_0014504 3300046515 Bacteria 4004
624 Ga0495628_0017882 3300046516 Bacteria 5884
625 Ga0495628_0030305 3300046516 Bacteria 4381
626 Ga0495630_0025184 3300046517 Bacteria 4398
627 Ga0495631_0019496 3300046518 Bacteria 3179
628 Ga0495632_0000719 3300046519 Bacteria 30093
629 Ga0495632_0011234 3300046519 Bacteria 5238
630 Ga0495632_0034577 3300046519 Bacteria 2585
631 Ga0495632_0060532 3300046519 Bacteria 1839
632 Ga0495637_0002352 3300046520 Bacteria 10476
633 Ga0495637_0010199 3300046520 Bacteria 4553
634 Ga0495637_0011909 3300046520 Bacteria 4168
635 Ga0495637_0042753 3300046520 Bacteria 1937
636 Ga0495643_0008772 3300046522 Bacteria 6370
637 Ga0495643_0044851 3300046522 Bacteria 2401
638 Ga0495643_0065956 3300046522 Bacteria 1910
639 Ga0495648_0000552 3300046524 Bacteria 40192
640 Ga0495648_0001770 3300046524 Bacteria 20832
641 Ga0495648_0003462 3300046524 Bacteria 13885
642 Ga0495648_0005888 3300046524 Bacteria 10079
643 Ga0495648_0036428 3300046524 Bacteria 3175
644 Ga0495648_0049091 3300046524 Bacteria 2591
645 Ga0495666_0064554 3300046526 Bacteria 1747
646 Ga0495652_0001170 3300046529 Bacteria 29592
647 Ga0495652_0009435 3300046529 Bacteria 8863
648 Ga0495654_0000117 3300046530 Bacteria 89307
649 Ga0495654_0000224 3300046530 Bacteria 52709
650 Ga0495654_0000732 3300046530 Bacteria 25488
651 Ga0495654_0001955 3300046530 Bacteria 13613
652 Ga0495654_0003210 3300046530 Bacteria 10121
653 Ga0495654_0019243 3300046530 Bacteria 3572
654 Ga0495665_0088474 3300046531 Bacteria 1628
655 Ga0495640_0035357 3300046533 Bacteria 3536
656 Ga0495640_0103047 3300046533 Bacteria 1872
657 Ga0495587_0001521 3300046536 Bacteria 15413
658 Ga0495587_0008765 3300046536 Bacteria 6488
659 Ga0495587_0018340 3300046536 Bacteria 4340
660 Ga0495609_0000156 3300046538 Bacteria 70241
661 Ga0495609_0006521 3300046538 Bacteria 5945
662 Ga0495609_0037939 3300046538 Bacteria 2173
663 Ga0495597_0000013 3300046542 Bacteria 203829
664 Ga0495597_0002855 3300046542 Bacteria 10559
665 Ga0495597_0033929 3300046542 Bacteria 2308
666 Ga0495645_0013413 3300046543 Bacteria 5792
667 Ga0495645_0090314 3300046543 Bacteria 2189
668 Ga0495645_0112991 3300046543 Bacteria 1920
669 Ga0495622_0001594 3300046557 Bacteria 11206
670 Ga0495633_0000453 3300046558 Bacteria 42087
671 Ga0495633_0023805 3300046558 Bacteria 3031
672 Ga0495633_0030237 3300046558 Bacteria 2632
673 Ga0495633_0052648 3300046558 Bacteria 1917
674 Ga0495667_0000305 3300046559 Bacteria 31224
675 Ga0495667_0002351 3300046559 Bacteria 12645
676 Ga0495667_0013747 3300046559 Bacteria 5467
677 Ga0495667_0043230 3300046559 Bacteria 2986
678 Ga0495656_0005918 3300046615 Bacteria 4255
679 Ga0495668_0001200 3300046616 Bacteria 26319
680 Ga0495668_0031490 3300046616 Bacteria 2989
681 Ga0495668_0057348 3300046616 Bacteria 2149
682 Ga0495634_0001959 3300046642 Bacteria 17575
683 Ga0495634_0003266 3300046642 Bacteria 13085
684 Ga0495634_0084101 3300046642 Bacteria 2075
685 Ga0495611_0000339 3300046648 Bacteria 30358
686 Ga0495625_0004731 3300046660 Bacteria 12748
687 Ga0495625_0005554 3300046660 Bacteria 11447
688 Ga0495625_0006484 3300046660 Bacteria 10402
689 Ga0495625_0032089 3300046660 Bacteria 3900
690 Ga0495625_0066117 3300046660 Bacteria 2547
691 Ga0495635_0000102 3300046663 Bacteria 50623
692 Ga0495635_0003651 3300046663 Bacteria 10674
693 Ga0495635_0069033 3300046663 Bacteria 2423
694 Ga0495661_0000007 3300046665 Bacteria 411832
695 Ga0495661_0000154 3300046665 Bacteria 80795
696 Ga0495661_0000172 3300046665 Bacteria 74827
697 Ga0495661_0011508 3300046665 Bacteria 6002
698 Ga0495661_0012271 3300046665 Bacteria 5787
699 Ga0495661_0036529 3300046665 Bacteria 3076
700 Ga0495588_0012716 3300046674 Bacteria 3987
701 Ga0495657_0000677 3300046675 Bacteria 30671
702 Ga0495657_0011228 3300046675 Bacteria 6710
703 Ga0495599_0001494 3300046678 Bacteria 13444
704 Ga0495599_0001882 3300046678 Bacteria 12160
705 Ga0495599_0021326 3300046678 Bacteria 4041
706 Ga0495623_0005677 3300046679 Bacteria 8147
707 Ga0495646_0005928 3300046680 Bacteria 7744
708 Ga0495646_0007052 3300046680 Bacteria 7139
709 Ga0495646_0067017 3300046680 Bacteria 2123
710 Ga0495647_0026488 3300046681 Bacteria 2125
711 Ga0495613_0046524 3300046689 Bacteria 3208
712 Ga0495613_0183622 3300046689 Bacteria 1480
713 Ga0495624_0002316 3300046690 Bacteria 14498
714 Ga0495624_0053891 3300046690 Bacteria 2538
715 Ga0495670_0002847 3300046691 Bacteria 8553
716 Ga0495670_0009646 3300046691 Bacteria 4744
717 Ga0495671_0029777 3300046692 Bacteria 2800
718 Ga0495671_0086739 3300046692 Bacteria 1533
719 Ga0495649_0000685 3300046694 Bacteria 27597
720 Ga0495649_0008434 3300046694 Bacteria 6202
721 Ga0495649_0021189 3300046694 Bacteria 3642
722 Ga0495649_0048237 3300046694 Bacteria 2314
723 Ga0495649_0066095 3300046694 Bacteria 1940
724 Ga0495649_0069243 3300046694 Bacteria 1893
725 Ga0495589_0010970 3300046794 Bacteria 4704
726 Ga0495589_0015004 3300046794 Bacteria 3986
727 Ga0495589_0053544 3300046794 Bacteria 1991
728 Ga0495589_0054925 3300046794 Bacteria 1963
729 Ga0495660_0000333 3300046810 Bacteria 41657
730 Ga0495660_0003395 3300046810 Bacteria 9852
731 Ga0495660_0015649 3300046810 Bacteria 4380
732 Ga0495660_0036141 3300046810 Bacteria 2756
733 Ga0495660_0056579 3300046810 Bacteria 2118
734 Ga0495660_0065580 3300046810 Bacteria 1938
735 Ga0495581_0026545 3300047315 Bacteria 3357
736 Ga0495604_0000580 3300047317 Bacteria 32005
737 Ga0495604_0001099 3300047317 Bacteria 22454
738 Ga0495604_0063570 3300047317 Bacteria 2815
739 Ga0495674_0001292 3300047319 Bacteria 24333
740 Ga0495674_0013937 3300047319 Bacteria 7542
741 Ga0495674_0071933 3300047319 Bacteria 2984
742 Ga0495674_0257629 3300047319 Bacteria 1434
743 Ga0495672_0004828 3300047320 Bacteria 10864
744 Ga0495672_0029603 3300047320 Bacteria 3446
745 Ga0495672_0036625 3300047320 Bacteria 3011
746 Ga0495672_0041227 3300047320 Bacteria 2793
747 Ga0495672_0077600 3300047320 Bacteria 1861
748 Ga0495680_0000636 3300047322 Bacteria 39417
749 Ga0495680_0018405 3300047322 Bacteria 5932
750 Ga0495680_0156163 3300047322 Bacteria 1659
751 Ga0495683_0000099 3300047323 Bacteria 88483
752 Ga0495683_0000113 3300047323 Bacteria 82670
753 Ga0495687_000572 3300047443 Bacteria 43367
754 Ga0495687_035975 3300047443 Bacteria 2220
755 Ga0495687_052619 3300047443 Bacteria 1720
756 Ga0495675_0007147 3300047444 Bacteria 6873
757 Ga0495675_0024914 3300047444 Bacteria 3816
758 Ga0495679_000549 3300047446 Bacteria 26435
759 Ga0495679_007354 3300047446 Bacteria 4600
760 Ga0495679_023488 3300047446 Bacteria 2090
761 Ga0495679_028495 3300047446 Bacteria 1832
762 Ga0495673_0003314 3300047469 Bacteria 10675
763 Ga0495673_0003583 3300047469 Bacteria 10190
764 Ga0495673_0020162 3300047469 Bacteria 3324
765 Ga0495673_0052489 3300047469 Bacteria 1781
766 Ga0495673_0074076 3300047469 Bacteria 1425
767 Ga0495681_0002645 3300047470 Bacteria 12709
768 Ga0495681_0002739 3300047470 Bacteria 12474
769 Ga0495681_0003661 3300047470 Bacteria 10675
770 Ga0495681_0004812 3300047470 Bacteria 9146
771 Ga0495681_0037021 3300047470 Bacteria 2408
772 Ga0495681_0056181 3300047470 Bacteria 1832
773 Ga0495684_0000088 3300047471 Bacteria 64704
774 Ga0495684_0112571 3300047471 Bacteria 2052
775 Ga0495684_0220346 3300047471 Bacteria 1391
776 Ga0495686_0001608 3300047472 Bacteria 23795
777 Ga0495686_0004287 3300047472 Bacteria 11814
778 Ga0495686_0014472 3300047472 Bacteria 5426
779 Ga0495686_0015085 3300047472 Bacteria 5292
780 Ga0495686_0039136 3300047472 Bacteria 3030
781 Ga0495593_0009454 3300047673 Bacteria 5657
782 Ga0495602_0000162 3300048088 Bacteria 62143
783 Ga0495602_0004623 3300048088 Bacteria 14359
784 Ga0495602_0006564 3300048088 Bacteria 12199
785 Ga0495602_0028311 3300048088 Bacteria 5364
786 Ga0495626_0000162 3300048091 Bacteria 81809
787 Ga0495626_0004818 3300048091 Bacteria 8135
788 Ga0496100_0010556 3300048903 Bacteria 5230
789 Ga0496100_0018696 3300048903 Bacteria 4117
790 Ga0496101_0008338 3300048904 Bacteria 6770
791 Ga0496101_0011098 3300048904 Bacteria 5970
792 Ga0496101_0117825 3300048904 Bacteria 2005
793 Ga0496102_0000613 3300048905 Bacteria 36995
794 Ga0496102_0002326 3300048905 Bacteria 16233
795 Ga0496103_0002825 3300048906 Bacteria 10796
796 Ga0496103_0008910 3300048906 Bacteria 5948
797 Ga0496103_0090578 3300048906 Bacteria 1930
798 Ga0496104_0002277 3300048907 Bacteria 16556
799 Ga0496104_0005539 3300048907 Bacteria 11061
800 Ga0496104_0036850 3300048907 Bacteria 4573
801 Ga0496104_0038908 3300048907 Bacteria 4451
802 Ga0496104_0096350 3300048907 Bacteria 2830
803 Ga0496105_0001309 3300048908 Bacteria 17421
804 Ga0496105_0055730 3300048908 Bacteria 3263
805 Ga0496106_0001425 3300048909 Bacteria 17950
806 Ga0496107_0003742 3300048910 Eukaryota 10217
807 Ga0496107_0014938 3300048910 Bacteria 5438
808 Ga0496108_0029179 3300048911 Bacteria 4568
809 Ga0496108_0139543 3300048911 Bacteria 2088
810 Ga0496110_0041157 3300048913 Bacteria 4031
811 Ga0496110_0142856 3300048913 Bacteria 2164
812 Ga0496110_0294871 3300048913 Bacteria 1477
813 Ga0496111_0098314 3300048914 Bacteria 2149
814 Ga0496112_0016228 3300048915 Bacteria 6969
815 Ga0496112_0105054 3300048915 Bacteria 2794
816 Ga0496112_0215061 3300048915 Bacteria 1879
817 Ga0496113_0000100 3300048916 Bacteria 36225
818 Ga0496113_0179574 3300048916 Bacteria 1678
819 Ga0496114_0081585 3300048917 Bacteria 2732
820 Ga0496114_0120405 3300048917 Bacteria 2257
821 Ga0496115_0003736 3300048918 Bacteria 10949
822 Ga0496115_0068101 3300048918 Bacteria 2881
823 Ga0496115_0070947 3300048918 Bacteria 2825
824 Ga0496116_0000042 3300048919 Bacteria 330516
825 Ga0496116_0002293 3300048919 Bacteria 20293
826 Ga0496117_0000036 3300048920 Bacteria 325635
827 Ga0496117_0000218 3300048920 Bacteria 109766
828 Ga0496117_0001162 3300048920 Bacteria 39563
829 Ga0496117_0017563 3300048920 Bacteria 5969
830 Ga0496117_0022908 3300048920 Bacteria 4998
831 Ga0496117_0032539 3300048920 Bacteria 3960
832 Ga0496117_0043984 3300048920 Bacteria 3239
833 Ga0496117_0070470 3300048920 Bacteria 2348
834 Ga0496117_0086916 3300048920 Bacteria 2029
835 Ga0496117_0098792 3300048920 Bacteria 1854
836 Ga0496118_0000729 3300048921 Bacteria 53121
837 Ga0496118_0002112 3300048921 Bacteria 27854
838 Ga0496118_0017938 3300048921 Bacteria 6417
839 Ga0496118_0037856 3300048921 Bacteria 3874
840 Ga0496118_0038443 3300048921 Bacteria 3835
841 Ga0496118_0044009 3300048921 Bacteria 3500
842 Ga0496118_0093332 3300048921 Bacteria 2062
843 Ga0496119_0002625 3300048922 Bacteria 19507
844 Ga0496119_0003738 3300048922 Bacteria 15572
845 Ga0496119_0005237 3300048922 Bacteria 12498
846 Ga0496119_0012527 3300048922 Bacteria 6877
847 Ga0496119_0032141 3300048922 Bacteria 3502
848 Ga0496119_0047055 3300048922 Bacteria 2687
849 Ga0496120_0000036 3300048923 Bacteria 206505
850 Ga0496120_0003787 3300048923 Bacteria 13333
851 Ga0496120_0003789 3300048923 Bacteria 13331
852 Ga0496120_0004614 3300048923 Bacteria 11431
853 Ga0496120_0004974 3300048923 Bacteria 10797
854 Ga0496120_0072515 3300048923 Bacteria 1887
855 Ga0496121_0000033 3300048924 Bacteria 377542
856 Ga0496121_0000077 3300048924 Bacteria 235293
857 Ga0496121_0000570 3300048924 Bacteria 69574
858 Ga0496121_0000664 3300048924 Bacteria 64277
859 Ga0496121_0006454 3300048924 Bacteria 14545
860 Ga0496121_0009406 3300048924 Bacteria 11240
861 Ga0496121_0016116 3300048924 Bacteria 7743
862 Ga0496121_0019411 3300048924 Bacteria 6796
863 Ga0496121_0023336 3300048924 Bacteria 5962
864 Ga0496121_0052814 3300048924 Bacteria 3409
865 Ga0496121_0057807 3300048924 Bacteria 3211
866 Ga0496121_0087611 3300048924 Bacteria 2443
867 Ga0496122_0000002 3300048925 Bacteria 905834
868 Ga0496122_0000428 3300048925 Bacteria 88816
869 Ga0496122_0000996 3300048925 Bacteria 50450
870 Ga0496122_0006539 3300048925 Bacteria 13331
871 Ga0496122_0021606 3300048925 Bacteria 5753
872 Ga0496122_0028116 3300048925 Bacteria 4784
873 Ga0496122_0066047 3300048925 Bacteria 2617
874 Ga0496122_0084221 3300048925 Bacteria 2200
875 Ga0496122_0138454 3300048925 Bacteria 1528
876 Ga0496123_0000002 3300048926 Bacteria 1811682
877 Ga0496123_0000337 3300048926 Bacteria 88727
878 Ga0496123_0001068 3300048926 Bacteria 41396
879 Ga0496123_0004528 3300048926 Bacteria 14519
880 Ga0496123_0005027 3300048926 Bacteria 13532
881 Ga0496123_0011126 3300048926 Bacteria 7845
882 Ga0496123_0041597 3300048926 Bacteria 3183
883 Ga0496123_0046469 3300048926 Bacteria 2944
884 Ga0496123_0050340 3300048926 Bacteria 2784
885 Ga0496124_0000259 3300048927 Bacteria 101764
886 Ga0496124_0000812 3300048927 Bacteria 50806
887 Ga0496124_0001166 3300048927 Bacteria 41149
888 Ga0496124_0001679 3300048927 Bacteria 31447
889 Ga0496124_0002048 3300048927 Bacteria 27374
890 Ga0496124_0005729 3300048927 Bacteria 13838
891 Ga0496124_0016064 3300048927 Bacteria 7142
892 Ga0496124_0021308 3300048927 Bacteria 5973
893 Ga0496124_0029306 3300048927 Bacteria 4907
894 Ga0496124_0051980 3300048927 Bacteria 3483
895 Ga0496124_0081579 3300048927 Bacteria 2657
896 Ga0496125_0000235 3300048928 Bacteria 113379
897 Ga0496125_0000681 3300048928 Bacteria 56691
898 Ga0496125_0000760 3300048928 Bacteria 52776
899 Ga0496125_0006813 3300048928 Bacteria 12261
900 Ga0496125_0039434 3300048928 Bacteria 4067
901 Ga0496125_0050297 3300048928 Bacteria 3452
902 Ga0496125_0066080 3300048928 Bacteria 2860
903 Ga0496125_0127718 3300048928 Bacteria 1798
904 Ga0496126_0001647 3300048929 Bacteria 33697
905 Ga0496126_0002030 3300048929 Bacteria 28578
906 Ga0496126_0004349 3300048929 Bacteria 16993
907 Ga0496126_0010785 3300048929 Bacteria 9540
908 Ga0496126_0012038 3300048929 Bacteria 8889
909 Ga0496126_0016102 3300048929 Bacteria 7492
910 Ga0496126_0039056 3300048929 Bacteria 4408
911 Ga0496126_0040697 3300048929 Bacteria 4307
912 Ga0496126_0057675 3300048929 Bacteria 3504
913 Ga0496126_0103810 3300048929 Bacteria 2483
914 Ga0496126_0127421 3300048929 Bacteria 2202
915 Ga0496126_0213249 3300048929 Bacteria 1624
916 Ga0495678_000124 3300049459 Bacteria 90202
917 Ga0495678_026948 3300049459 Bacteria 2444
918 Ga0495678_043782 3300049459 Bacteria 1775
919 Ga0501031_0000620 3300049568 Bacteria 20973
920 Ga0501032_0003195 3300049569 Bacteria 12615
921 Ga0501033_0000241 3300049570 Bacteria 52500
922 Ga0501033_0026589 3300049570 Bacteria 4354
923 Ga0501033_0049249 3300049570 Bacteria 3127
924 Ga0501034_0000021 3300049571 Bacteria 266023
925 Ga0501034_0000109 3300049571 Bacteria 151550
926 Ga0501034_0001751 3300049571 Bacteria 27824
927 Ga0501034_0091961 3300049571 Bacteria 3031
928 Ga0501036_0000055 3300049572 Bacteria 73738
929 Ga0501037_0000398 3300049573 Bacteria 36170
930 Ga0501038_0001235 3300049574 Bacteria 23202
931 Ga0501039_0000293 3300049575 Bacteria 35520
932 Ga0501043_0000033 3300049579 Bacteria 139500
933 Ga0501046_0000452 3300049580 Bacteria 41240
934 Ga0501046_0158687 3300049580 Bacteria 1702
935 Ga0501047_0000574 3300049581 Bacteria 39096
936 Ga0501048_0000261 3300049582 Bacteria 35293
937 Ga0501067_0000045 3300049583 Bacteria 73394
938 Ga0501067_0120805 3300049583 Bacteria 1458
939 Ga0501068_0003740 3300049584 Bacteria 8231
940 Ga0501068_0019486 3300049584 Bacteria 3941
941 Ga0501069_0003820 3300049585 Bacteria 7754
942 Ga0501070_0002498 3300049586 Bacteria 16116
943 Ga0501070_0006242 3300049586 Bacteria 10144
944 Ga0501070_0053039 3300049586 Bacteria 3365
945 Ga0501071_0017446 3300049587 Bacteria 4951
946 Ga0501072_0010633 3300049588 Bacteria 7009
947 Ga0501073_0010956 3300049589 Bacteria 6634
948 Ga0501073_0023935 3300049589 Bacteria 4385
949 Ga0501073_0034888 3300049589 Bacteria 3578
950 Ga0501074_0003795 3300049590 Bacteria 10738
951 Ga0501074_0015583 3300049590 Bacteria 5525
952 Ga0501077_0023333 3300049593 Bacteria 3923
953 Ga0501077_0030316 3300049593 Bacteria 3442
954 Ga0501080_0004826 3300049742 Bacteria 12024
955 Ga0501081_0034632 3300049743 Bacteria 3436
956 Ga0501083_0000182 3300049744 Bacteria 40680
957 Ga0501035_0000241 3300049822 Bacteria 65546
958 Ga0501035_0111993 3300049822 Bacteria 2391
959 Ga0501044_0000640 3300049823 Bacteria 42246
960 Ga0501044_0034874 3300049823 Bacteria 5273
961 Ga0501045_0088025 3300049824 Bacteria 2294
962 nmdc:mga03683_718_c1 3300050489 Bacteria 9504
963 nmdc:mga03n38_2026_c1 3300050490 Bacteria 6103
964 nmdc:mga00v17_19_c1 3300050491 Bacteria 115002
965 nmdc:mga00v17_2987_c1 3300050491 Bacteria 8682
966 nmdc:mga0yw44_386_c1 3300050492 Bacteria 15352
967 nmdc:mga0yw44_575_c1 3300050492 Bacteria 13288
968 nmdc:mga09592_38638_c1 3300050508 Bacteria 4007
969 nmdc:mga0qj67_106915_c1 3300050509 Bacteria 2257
970 nmdc:mga08y16_13395_c1 3300050511 Bacteria 8625
971 nmdc:mga08y16_46635_c1 3300050511 Bacteria 4537
972 nmdc:mga08y16_83612_c1 3300050511 Bacteria 3327
973 nmdc:mga0n895_1221_c1 3300050512 Bacteria 18979
974 nmdc:mga0sz30_8616_c1 3300050516 Bacteria 3855
975 Ga0495601_0002864 3300053077 Bacteria 9804
976 Ga0495601_0012935 3300053077 Bacteria 5011
977 Ga0495601_0020150 3300053077 Bacteria 4071
978 Ga0495601_0098530 3300053077 Bacteria 1887
979 Ga0495612_0004607 3300053078 Bacteria 5715
980 Ga0495612_0016518 3300053078 Bacteria 2957
981 Ga0500610_0004055 3300053079 Bacteria 5742
982 Ga0495595_0000112 3300053084 Bacteria 37201
983 Ga0495595_0003426 3300053084 Bacteria 6293
984 Ga0495619_0000166 3300053085 Bacteria 48296
985 Ga0495619_0001541 3300053085 Bacteria 15178
986 Ga0495619_0027730 3300053085 Bacteria 3651
987 Ga0495619_0027922 3300053085 Bacteria 3640
988 Ga0500578_0100810 3300053086 Bacteria 1827
989 Ga0500643_000362 3300053087 Bacteria 35932
990 Ga0500643_043512 3300053087 Bacteria 1309
991 Ga0500566_0002077 3300053094 Bacteria 11838
992 Ga0500641_0054968 3300053096 Bacteria 1647
993 Ga0500555_003622 3300053103 Bacteria 4398
994 Ga0500556_0000030 3300053104 Bacteria 165098
995 Ga0500556_0001124 3300053104 Bacteria 13249
996 Ga0500557_000223 3300053105 Bacteria 8865
997 Ga0500560_000050 3300053107 Bacteria 11659
998 Ga0500560_001099 3300053107 Bacteria 4423
999 Ga0500572_000055 3300053111 Bacteria 34260
1000 Ga0500572_001371 3300053111 Bacteria 6719
1001 Ga0500572_001447 3300053111 Bacteria 6498
1002 Ga0500572_020641 3300053111 Bacteria 1735
1003 Ga0500591_051586 3300053115 Bacteria 1928
1004 Ga0500595_008373 3300053119 Bacteria 4226
1005 Ga0500595_011111 3300053119 Bacteria 3541
1006 Ga0500595_015948 3300053119 Bacteria 2807
1007 Ga0500595_024033 3300053119 Bacteria 2132
1008 Ga0500595_035614 3300053119 Bacteria 1637
1009 Ga0500608_015526 3300053122 Bacteria 3423
1010 Ga0500618_006987 3300053125 Bacteria 3261
1011 Ga0500658_0072713 3300053134 Bacteria 1454
1012 Ga0500559_0000678 3300053136 Bacteria 22700
1013 Ga0500559_0000870 3300053136 Bacteria 19374
1014 Ga0500559_0001368 3300053136 Bacteria 13979
1015 Ga0500559_0003497 3300053136 Bacteria 7705
1016 Ga0500559_0029135 3300053136 Bacteria 2362
1017 Ga0500568_0000323 3300053139 Bacteria 37840
1018 Ga0500568_0000361 3300053139 Bacteria 35246
1019 Ga0500573_0014832 3300053140 Bacteria 4413
1020 Ga0500573_0021953 3300053140 Bacteria 3663
1021 Ga0500573_0074730 3300053140 Bacteria 1930
1022 Ga0500603_001487 3300053150 Bacteria 5345
1023 Ga0500604_0028580 3300053151 Bacteria 1620
1024 Ga0500616_0009600 3300053153 Bacteria 5871
1025 Ga0500622_0015058 3300053156 Bacteria 4147
1026 Ga0500624_000424 3300053157 Bacteria 12877
1027 Ga0500624_002884 3300053157 Bacteria 2279
1028 Ga0500627_0000105 3300053158 Bacteria 28056
1029 Ga0500627_0008706 3300053158 Bacteria 3621
1030 Ga0500630_032865 3300053159 Bacteria 2545
1031 Ga0500634_0006837 3300053161 Bacteria 5557
1032 Ga0500634_0022929 3300053161 Bacteria 3391
1033 Ga0500639_000004 3300053163 Bacteria 216921
1034 Ga0500636_0000367 3300053177 Bacteria 24765
1035 Ga0500636_0003604 3300053177 Bacteria 8733
1036 Ga0500637_0000106 3300053178 Bacteria 29937
1037 Ga0500645_001373 3300053730 Bacteria 12495
1038 Ga0500645_001822 3300053730 Bacteria 10210
1039 Ga0500596_000144 3300053735 Bacteria 10776
1040 Ga0500596_007152 3300053735 Bacteria 1842
1041 Ga0501084_0016986 3300054114 Bacteria 6047
1042 Ga0501084_0118168 3300054114 Bacteria 2229
1043 Ga0501082_0055942 3300060353 Bacteria 3398
1044 Ga0530510_0202558 3300061734 Bacteria 1474

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8016583857 8016593001 395
2 3300046513 Ga0495616_0003497 Ga0495616_0003497_4716_5918 397
3 3300048920 Ga0496117_0086916 Ga0496117_0086916_765_1976 403
4 3300048925 Ga0496122_0138454 Ga0496122_0138454_268_1479 403
5 3300005548 Ga0070665_100001296 Ga0070665_1000012966 406
6 3300028379 Ga0268266_10007442 Ga0268266_1000744213 406
7 3300053087 Ga0500643_043512 Ga0500643_043512_47_1267 406
8 3300046473 Ga0495582_0094401 Ga0495582_0094401_410_1657 409
9 3300046642 Ga0495634_0001959 Ga0495634_0001959_14_1249 409
10 3300046471 Ga0495650_0059865 Ga0495650_0059865_272_1516 411
11 3300047470 Ga0495681_0002739 Ga0495681_0002739_7413_8738 411
12 3300053107 Ga0500560_001099 Ga0500560_001099_2592_3917 411
13 iso_pu_bacteria 2965089291 2965089892 413
14 3300006948 Ga0099826_10007333 Ga0099826_100073335 415
15 3300027666 Ga0209282_1013642 Ga0209282_10136423 415
16 3300030744 Ga0316181_1206187 Ga0316181_12061874 415
17 3300027312 Ga0209371_1000003 Ga0209371_1000003129 416
18 3300030500 Ga0268256_1000004 Ga0268256_1000004922 416
19 3300030745 Ga0316182_1118994 Ga0316182_11189941 416
20 3300047472 Ga0495686_0001608 Ga0495686_0001608_3544_4896 416
21 3300009036 Ga0105244_10000607 Ga0105244_100006074 418
22 3300009148 Ga0105243_10004474 Ga0105243_100044745 418
23 3300037418 Ga0395900_0025676 Ga0395900_0025676_2060_3325 418
24 3300037471 Ga0395905_0171592 Ga0395905_0171592_94_1359 418
25 3300038443 Ga0395901_0256413 Ga0395901_0256413_287_1552 418
26 3300046558 Ga0495633_0023805 Ga0495633_0023805_1753_3021 419
27 3300046660 Ga0495625_0066117 Ga0495625_0066117_943_2295 420
28 iso_pu_bacteria 8016566248 8016574197 420
29 3300003856 Ga0058692_1002826 Ga0058692_10028262 422
30 3300027312 Ga0209371_1004989 Ga0209371_10049895 422
31 3300025294 Ga0209025_1011019 Ga0209025_10110197 423
32 3300025728 Ga0207655_1001748 Ga0207655_100174812 424
33 3300013100 Ga0157373_10020395 Ga0157373_100203952 425
34 3300046458 Ga0495591_006316 Ga0495591_006316_16_1302 425
35 3300046794 Ga0495589_0015004 Ga0495589_0015004_2690_3976 425
36 3300047320 Ga0495672_0041227 Ga0495672_0041227_1497_2783 425
37 iso_pu_bacteria 2857509624 2857510430 426
38 iso_pu_bacteria 2968138860 2968139851 426
39 3300053161 Ga0500634_0022929 Ga0500634_0022929_703_2031 428
40 3300048919 Ga0496116_0000042 Ga0496116_0000042_78915_80234 429
41 3300005985 Ga0081539_10062309 Ga0081539_100623092 430
42 3300026078 Ga0207702_10083796 Ga0207702_100837962 430
43 3300035695 Ga0373927_0162396 Ga0373927_0162396_40_1332 430
44 3300037418 Ga0395900_0291392 Ga0395900_0291392_38_1330 430
45 3300037466 Ga0395898_0128102 Ga0395898_0128102_1046_2338 430
46 3300044684 Ga0466966_0014368 Ga0466966_0014368_14_1306 430
47 3300046531 Ga0495665_0088474 Ga0495665_0088474_51_1343 430
48 3300046559 Ga0495667_0043230 Ga0495667_0043230_1678_2970 430
49 3300047471 Ga0495684_0220346 Ga0495684_0220346_84_1376 430
50 3300048913 Ga0496110_0294871 Ga0496110_0294871_15_1307 430
51 3300048924 Ga0496121_0000664 Ga0496121_0000664_6363_7655 430
52 3300048924 Ga0496121_0052814 Ga0496121_0052814_962_2254 430
53 3300049568 Ga0501031_0000620 Ga0501031_0000620_16930_18222 430
54 3300049569 Ga0501032_0003195 Ga0501032_0003195_7480_8772 430
55 3300049570 Ga0501033_0000241 Ga0501033_0000241_18849_20141 430
56 3300049571 Ga0501034_0000021 Ga0501034_0000021_117019_118311 430
57 3300049572 Ga0501036_0000055 Ga0501036_0000055_7760_9052 430
58 3300049573 Ga0501037_0000398 Ga0501037_0000398_10971_12263 430
59 3300049574 Ga0501038_0001235 Ga0501038_0001235_14151_15443 430
60 3300049575 Ga0501039_0000293 Ga0501039_0000293_33249_34541 430
61 3300049579 Ga0501043_0000033 Ga0501043_0000033_36142_37434 430
62 3300049580 Ga0501046_0000452 Ga0501046_0000452_19396_20688 430
63 3300049581 Ga0501047_0000574 Ga0501047_0000574_22671_23963 430
64 3300049582 Ga0501048_0000261 Ga0501048_0000261_10214_11506 430
65 3300049584 Ga0501068_0003740 Ga0501068_0003740_4827_6119 430
66 3300049585 Ga0501069_0003820 Ga0501069_0003820_2614_3906 430
67 3300049586 Ga0501070_0002498 Ga0501070_0002498_3763_5055 430
68 3300049587 Ga0501071_0017446 Ga0501071_0017446_2685_3977 430
69 3300049588 Ga0501072_0010633 Ga0501072_0010633_2240_3532 430
70 3300049590 Ga0501074_0003795 Ga0501074_0003795_7496_8788 430
71 3300049744 Ga0501083_0000182 Ga0501083_0000182_36690_37982 430
72 3300049822 Ga0501035_0000241 Ga0501035_0000241_22670_23962 430
73 3300049823 Ga0501044_0000640 Ga0501044_0000640_20066_21358 430
74 3300053087 Ga0500643_000362 Ga0500643_000362_19291_20643 430
75 3300053122 Ga0500608_015526 Ga0500608_015526_1978_3270 430
76 3300053134 Ga0500658_0072713 Ga0500658_0072713_137_1429 430
77 3300053151 Ga0500604_0028580 Ga0500604_0028580_20_1312 430
78 3300054114 Ga0501084_0016986 Ga0501084_0016986_145_1437 430
79 3300003773 Ga0055537_1000827 Ga0055537_10008279 431
80 3300003790 Ga0055528_1001347 Ga0055528_10013479 431
81 3300004625 Ga0055543_1000909 Ga0055543_10009094 431
82 3300028573 Ga0265334_10017805 Ga0265334_100178052 431
83 3300049570 Ga0501033_0049249 Ga0501033_0049249_178_1473 431
84 3300006852 Ga0075433_10212747 Ga0075433_102127471 432
85 3300013102 Ga0157371_10004709 Ga0157371_100047097 432
86 3300013104 Ga0157370_10126123 Ga0157370_101261232 432
87 3300013105 Ga0157369_10115729 Ga0157369_101157292 432
88 3300031247 Ga0265340_10004049 Ga0265340_100040496 432
89 3300046615 Ga0495656_0005918 Ga0495656_0005918_1432_2730 432
90 3300046810 Ga0495660_0036141 Ga0495660_0036141_1439_2740 432
91 3300053086 Ga0500578_0100810 Ga0500578_0100810_515_1813 432
92 iso_pu_bacteria 2511231010 2511288980 432
93 iso_pu_bacteria 2511231011 2511295893 432
94 iso_pu_bacteria 2511231023 2511371945 432
95 iso_pu_bacteria 2511231031 2511415384 432
96 iso_pu_bacteria 2582581865 2585390209 432
97 iso_pu_bacteria 2600255318 2601797647 432
98 iso_pu_bacteria 2603880185 2606076871 432
99 iso_pu_bacteria 2603880199 2606128716 432
100 iso_pu_bacteria 2623620443 2624478023 432
101 iso_pu_bacteria 2713897149 2715754289 432
102 iso_pu_bacteria 2738543025 2739311084 432
103 iso_pu_bacteria 2773857673 2774134534 432
104 iso_pu_bacteria 2784132063 2784261257 432
105 iso_pu_bacteria 2808606445 2809217784 432
106 iso_pu_bacteria 2818991456 2819657048 432
107 iso_pu_bacteria 2842843487 2842846543 432
108 iso_pu_bacteria 2849660919 2849660932 432
109 iso_pu_bacteria 2852657418 2852661523 432
110 iso_pu_bacteria 2878029506 2878029968 432
111 iso_pu_bacteria 2880230671 2880230926 432
112 iso_pu_bacteria 2904518522 2904519386 432
113 iso_pu_bacteria 2919063839 2919066344 432
114 iso_pu_bacteria 2929189879 2929193336 432
115 iso_pu_bacteria 2974289157 2974293533 432
116 iso_pu_bacteria 3004334049 3004338906 432
117 iso_pu_bacteria 3007614139 3007615629 432
118 iso_pu_bacteria 3007718800 3007723414 432
119 iso_pu_bacteria 3007861166 3007864600 432
120 iso_pu_bacteria 8056569372 8056572132 432
121 3300002705 JGI25156J39149_1000295 JGI25156J39149_100029526 433
122 3300003758 Ga0055532_1000254 Ga0055532_10002547 433
123 3300025229 Ga0209147_100021 Ga0209147_100021284 433
124 3300025256 Ga0209759_1000082 Ga0209759_1000082135 433
125 3300046530 Ga0495654_0000224 Ga0495654_0000224_22617_23918 433
126 3300046616 Ga0495668_0001200 Ga0495668_0001200_21163_22464 433
127 3300053158 Ga0500627_0000105 Ga0500627_0000105_23046_24347 433
128 3300046501 Ga0495607_0000082 Ga0495607_0000082_24526_25830 434
129 3300048910 Ga0496107_0003742 Ga0496107_0003742_4949_6262 434
130 3300053730 Ga0500645_001373 Ga0500645_001373_10512_11825 434
131 iso_pu_bacteria 2597489887 2597855466 434
132 iso_pu_bacteria 2599185155 2599331195 434
133 iso_pu_bacteria 2599185185 2599485351 434
134 iso_pu_bacteria 2599185257 2599806496 434
135 iso_pu_bacteria 2671180172 2671772147 434
136 iso_pu_bacteria 2826581358 2826582538 434
137 iso_pu_bacteria 2842815866 2842817612 434
138 iso_pu_bacteria 2842849001 2842851573 434
139 iso_pu_bacteria 3007619802 3007624718 434
140 iso_pu_bacteria 8057101203 8057105826 434
141 3300003781 Ga0055536_1000216 Ga0055536_10002167 435
142 3300003791 Ga0055530_10002982 Ga0055530_100029822 435
143 3300003792 Ga0055540_1000064 Ga0055540_100006455 435
144 3300003794 Ga0055531_10000039 Ga0055531_1000003969 435
145 3300005353 Ga0070669_100003483 Ga0070669_1000034836 435
146 3300009036 Ga0105244_10047892 Ga0105244_100478922 435
147 3300009092 Ga0105250_10001522 Ga0105250_100015226 435
148 3300009148 Ga0105243_10003033 Ga0105243_100030335 435
149 3300012498 Ga0157345_1000006 Ga0157345_100000611 435
150 3300013100 Ga0157373_10109812 Ga0157373_101098122 435
151 3300013105 Ga0157369_10005587 Ga0157369_100055878 435
152 3300013306 Ga0163162_10000199 Ga0163162_1000019912 435
153 3300013307 Ga0157372_10005780 Ga0157372_100057807 435
154 3300013308 Ga0157375_10296274 Ga0157375_102962742 435
155 3300014497 Ga0182008_10002472 Ga0182008_100024727 435
156 3300015261 Ga0182006_1001883 Ga0182006_10018837 435
157 3300015261 Ga0182006_1003283 Ga0182006_10032837 435
158 3300017792 Ga0163161_10006288 Ga0163161_100062882 435
159 3300025230 Ga0209563_101932 Ga0209563_1019323 435
160 3300025291 Ga0209675_1002094 Ga0209675_10020945 435
161 3300025292 Ga0209676_1000025 Ga0209676_1000025450 435
162 3300025292 Ga0209676_1000404 Ga0209676_100040417 435
163 3300025298 Ga0209050_1000099 Ga0209050_100009996 435
164 3300025303 Ga0209051_1000026 Ga0209051_1000026245 435
165 3300025304 Ga0209257_1000034 Ga0209257_1000034450 435
166 3300025711 Ga0207696_1000071 Ga0207696_100007169 435
167 3300025711 Ga0207696_1000961 Ga0207696_10009619 435
168 3300025728 Ga0207655_1000441 Ga0207655_10004419 435
169 3300025728 Ga0207655_1006386 Ga0207655_10063865 435
170 3300025735 Ga0207713_1001597 Ga0207713_10015979 435
171 3300025735 Ga0207713_1003526 Ga0207713_10035266 435
172 3300025735 Ga0207713_1014554 Ga0207713_10145542 435
173 3300025923 Ga0207681_10001048 Ga0207681_1000104812 435
174 3300025933 Ga0207706_10153171 Ga0207706_101531712 435
175 3300025935 Ga0207709_10000040 Ga0207709_10000040128 435
176 3300028379 Ga0268266_10034015 Ga0268266_100340152 435
177 3300030521 Ga0307511_10086694 Ga0307511_100866942 435
178 3300032005 Ga0307411_10006188 Ga0307411_100061882 435
179 3300033180 Ga0307510_10000085 Ga0307510_1000008556 435
180 3300038705 Ga0237819_02648 Ga0237819_02648_1021_2340 435
181 3300039447 Ga0436361_0183072 Ga0436361_0183072_2624_3952 435
182 3300042139 Ga0450904_001603 Ga0450904_001603_1706_3025 435
183 3300046453 Ga0495627_001135 Ga0495627_001135_13532_14851 435
184 3300046458 Ga0495591_001961 Ga0495591_001961_4460_5779 435
185 3300046458 Ga0495591_003002 Ga0495591_003002_3299_4618 435
186 3300046458 Ga0495591_025435 Ga0495591_025435_75_1394 435
187 3300046460 Ga0495638_0010795 Ga0495638_0010795_4386_5705 435
188 3300046474 Ga0495605_0043870 Ga0495605_0043870_122_1441 435
189 3300046491 Ga0495584_0057027 Ga0495584_0057027_405_1724 435
190 3300046492 Ga0495585_0054980 Ga0495585_0054980_552_1871 435
191 3300046492 Ga0495585_0104414 Ga0495585_0104414_16_1335 435
192 3300046500 Ga0495596_0011116 Ga0495596_0011116_982_2301 435
193 3300046501 Ga0495607_0002081 Ga0495607_0002081_9750_11069 435
194 3300046501 Ga0495607_0007523 Ga0495607_0007523_3832_5151 435
195 3300046501 Ga0495607_0077763 Ga0495607_0077763_229_1548 435
196 3300046501 Ga0495607_0084209 Ga0495607_0084209_221_1540 435
197 3300046507 Ga0495606_0005451 Ga0495606_0005451_4280_5599 435
198 3300046512 Ga0495610_0005026 Ga0495610_0005026_3932_5251 435
199 3300046513 Ga0495616_0003740 Ga0495616_0003740_3447_4766 435
200 3300046513 Ga0495616_0038331 Ga0495616_0038331_963_2282 435
201 3300046513 Ga0495616_0081280 Ga0495616_0081280_55_1374 435
202 3300046515 Ga0495620_0001699 Ga0495620_0001699_4196_5515 435
203 3300046519 Ga0495632_0000719 Ga0495632_0000719_4132_5451 435
204 3300046519 Ga0495632_0011234 Ga0495632_0011234_821_2140 435
205 3300046520 Ga0495637_0002352 Ga0495637_0002352_4977_6296 435
206 3300046522 Ga0495643_0008772 Ga0495643_0008772_4248_5567 435
207 3300046524 Ga0495648_0005888 Ga0495648_0005888_4689_6008 435
208 3300046526 Ga0495666_0064554 Ga0495666_0064554_239_1558 435
209 3300046530 Ga0495654_0003210 Ga0495654_0003210_4618_5937 435
210 3300046538 Ga0495609_0006521 Ga0495609_0006521_2916_4235 435
211 3300046538 Ga0495609_0037939 Ga0495609_0037939_653_1972 435
212 3300046557 Ga0495622_0001594 Ga0495622_0001594_5790_7109 435
213 3300046616 Ga0495668_0057348 Ga0495668_0057348_528_1847 435
214 3300046642 Ga0495634_0084101 Ga0495634_0084101_186_1505 435
215 3300046648 Ga0495611_0000339 Ga0495611_0000339_4262_5581 435
216 3300046660 Ga0495625_0005554 Ga0495625_0005554_7351_8670 435
217 3300046665 Ga0495661_0036529 Ga0495661_0036529_72_1391 435
218 3300046680 Ga0495646_0067017 Ga0495646_0067017_540_1859 435
219 3300046689 Ga0495613_0046524 Ga0495613_0046524_910_2229 435
220 3300046690 Ga0495624_0002316 Ga0495624_0002316_8173_9492 435
221 3300046691 Ga0495670_0002847 Ga0495670_0002847_2884_4203 435
222 3300046692 Ga0495671_0029777 Ga0495671_0029777_1147_2466 435
223 3300046694 Ga0495649_0021189 Ga0495649_0021189_2261_3580 435
224 3300046694 Ga0495649_0048237 Ga0495649_0048237_210_1529 435
225 3300046694 Ga0495649_0066095 Ga0495649_0066095_559_1878 435
226 3300046694 Ga0495649_0069243 Ga0495649_0069243_292_1611 435
227 3300046794 Ga0495589_0053544 Ga0495589_0053544_475_1794 435
228 3300046810 Ga0495660_0015649 Ga0495660_0015649_756_2075 435
229 3300046810 Ga0495660_0056579 Ga0495660_0056579_484_1803 435
230 3300047320 Ga0495672_0004828 Ga0495672_0004828_5366_6685 435
231 3300047446 Ga0495679_023488 Ga0495679_023488_496_1815 435
232 3300047446 Ga0495679_028495 Ga0495679_028495_431_1750 435
233 3300047469 Ga0495673_0003583 Ga0495673_0003583_4625_5944 435
234 3300047469 Ga0495673_0052489 Ga0495673_0052489_168_1487 435
235 3300047469 Ga0495673_0074076 Ga0495673_0074076_38_1357 435
236 3300047470 Ga0495681_0002645 Ga0495681_0002645_6001_7320 435
237 3300047470 Ga0495681_0004812 Ga0495681_0004812_4308_5627 435
238 3300047470 Ga0495681_0056181 Ga0495681_0056181_32_1351 435
239 3300047471 Ga0495684_0112571 Ga0495684_0112571_198_1517 435
240 3300048088 Ga0495602_0006564 Ga0495602_0006564_5966_7285 435
241 3300048091 Ga0495626_0004818 Ga0495626_0004818_4517_5836 435
242 3300048913 Ga0496110_0041157 Ga0496110_0041157_2370_3692 435
243 3300048920 Ga0496117_0022908 Ga0496117_0022908_445_1764 435
244 3300048920 Ga0496117_0032539 Ga0496117_0032539_2413_3732 435
245 3300048921 Ga0496118_0044009 Ga0496118_0044009_232_1551 435
246 3300048922 Ga0496119_0012527 Ga0496119_0012527_5354_6673 435
247 3300048924 Ga0496121_0019411 Ga0496121_0019411_5422_6741 435
248 3300048925 Ga0496122_0028116 Ga0496122_0028116_2905_4224 435
249 3300048927 Ga0496124_0081579 Ga0496124_0081579_910_2229 435
250 3300049459 Ga0495678_026948 Ga0495678_026948_620_1939 435
251 3300049459 Ga0495678_043782 Ga0495678_043782_317_1636 435
252 3300053111 Ga0500572_020641 Ga0500572_020641_222_1541 435
253 iso_pu_bacteria 2510917026 2511173644 435
254 iso_pu_bacteria 2554235341 2555667199 435
255 iso_pu_bacteria 2585427634 2586003169 435
256 iso_pu_bacteria 2599185160 2599356424 435
257 iso_pu_bacteria 2599185161 2599363549 435
258 iso_pu_bacteria 2599185162 2599369499 435
259 iso_pu_bacteria 2599185163 2599376658 435
260 iso_pu_bacteria 2599185164 2599381529 435
261 iso_pu_bacteria 2599185165 2599388327 435
262 iso_pu_bacteria 2599185166 2599395146 435
263 iso_pu_bacteria 2599185168 2599406911 435
264 iso_pu_bacteria 2599185181 2599463257 435
265 iso_pu_bacteria 2599185182 2599469396 435
266 iso_pu_bacteria 2599185186 2599492274 435
267 iso_pu_bacteria 2599185356 2600215886 435
268 iso_pu_bacteria 2600255313 2601776053 435
269 iso_pu_bacteria 2667528171 2671100189 435
270 iso_pu_bacteria 2728368998 2728754482 435
271 iso_pu_bacteria 2818991461 2819682539 435
272 iso_pu_bacteria 2818991464 2819704995 435
273 iso_pu_bacteria 2844665904 2844667693 435
274 iso_pu_bacteria 2857531043 2857536804 435
275 iso_pu_bacteria 2869242130 2869245227 435
276 iso_pu_bacteria 2871481445 2871484786 435
277 iso_pu_bacteria 2874116593 2874120645 435
278 iso_pu_bacteria 2876386047 2876388684 435
279 iso_pu_bacteria 2876420981 2876426457 435
280 iso_pu_bacteria 2879083081 2879090806 435
281 iso_pu_bacteria 2906401398 2906403596 435
282 iso_pu_bacteria 2917070673 2917070948 435
283 iso_pu_bacteria 2924741084 2924744071 435
284 iso_pu_bacteria 2929138655 2929144123 435
285 iso_pu_bacteria 2935353572 2935358776 435
286 iso_pu_bacteria 2937861824 2937865105 435
287 iso_pu_bacteria 2937980651 2937984610 435
288 iso_pu_bacteria 2958108152 2958108768 435
289 iso_pu_bacteria 2961183825 2961188764 435
290 iso_pu_bacteria 2970532167 2970538152 435
291 iso_pu_bacteria 2970627176 2970631920 435
292 iso_pu_bacteria 2977851361 2977854737 435
293 iso_pu_bacteria 2977907340 2977909340 435
294 iso_pu_bacteria 2979764755 2979765997 435
295 iso_pu_bacteria 2979772303 2979773074 435
296 iso_pu_bacteria 3004248173 3004254369 435
297 iso_pu_bacteria 3007395558 3007397853 435
298 iso_pu_bacteria 637000220 637317599 435
299 iso_pu_bacteria 8018150411 8018153860 435
300 3300026121 Ga0207683_10044288 Ga0207683_100442883 436
301 3300046471 Ga0495650_0020937 Ga0495650_0020937_1544_2863 436
302 3300046474 Ga0495605_0000164 Ga0495605_0000164_16578_17897 436
303 3300046501 Ga0495607_0053320 Ga0495607_0053320_314_1633 436
304 3300046506 Ga0495583_0000226 Ga0495583_0000226_26839_28158 436
305 3300046512 Ga0495610_0008977 Ga0495610_0008977_1514_2833 436
306 3300046515 Ga0495620_0000047 Ga0495620_0000047_89264_90583 436
307 3300046518 Ga0495631_0019496 Ga0495631_0019496_579_1898 436
308 3300046520 Ga0495637_0042753 Ga0495637_0042753_333_1652 436
309 3300046524 Ga0495648_0003462 Ga0495648_0003462_7187_8506 436
310 3300046530 Ga0495654_0001955 Ga0495654_0001955_7664_8983 436
311 3300046538 Ga0495609_0000156 Ga0495609_0000156_16424_17743 436
312 3300046542 Ga0495597_0002855 Ga0495597_0002855_7637_8956 436
313 3300046558 Ga0495633_0000453 Ga0495633_0000453_24310_25629 436
314 3300046665 Ga0495661_0000172 Ga0495661_0000172_57117_58436 436
315 3300046794 Ga0495589_0010970 Ga0495589_0010970_3116_4435 436
316 3300047323 Ga0495683_0000113 Ga0495683_0000113_56874_58193 436
317 3300047446 Ga0495679_000549 Ga0495679_000549_883_2202 436
318 3300047469 Ga0495673_0003314 Ga0495673_0003314_9221_10540 436
319 3300047470 Ga0495681_0003661 Ga0495681_0003661_7923_9242 436
320 3300048925 Ga0496122_0000996 Ga0496122_0000996_3498_4811 436
321 3300048926 Ga0496123_0000337 Ga0496123_0000337_56641_57954 436
322 3300048926 Ga0496123_0011126 Ga0496123_0011126_1791_3110 436
323 3300048929 Ga0496126_0001647 Ga0496126_0001647_18415_19725 436
324 3300049459 Ga0495678_000124 Ga0495678_000124_72431_73750 436
325 3300050511 nmdc:mga08y16_46635_c1 nmdc:mga08y16_46635_c1_27_1346 436
326 3300053140 Ga0500573_0074730 Ga0500573_0074730_590_1900 436
327 iso_pu_bacteria 2510065059 2510316217 436
328 iso_pu_bacteria 2513237305 2514418842 436
329 iso_pu_bacteria 2537561587 2537873452 436
330 iso_pu_bacteria 2597489888 2597864819 436
331 iso_pu_bacteria 2597489889 2597870674 436
332 iso_pu_bacteria 2599185189 2599507002 436
333 iso_pu_bacteria 2599185210 2599605587 436
334 iso_pu_bacteria 2599185288 2599878156 436
335 iso_pu_bacteria 2600255296 2601689911 436
336 iso_pu_bacteria 2643221713 2644622365 436
337 iso_pu_bacteria 2687453392 2688597819 436
338 iso_pu_bacteria 2721755607 2723249577 436
339 iso_pu_bacteria 2738541294 2738809859 436
340 iso_pu_bacteria 2738541309 2738897219 436
341 iso_pu_bacteria 2756170246 2756676296 436
342 iso_pu_bacteria 2791355123 2792750065 436
343 iso_pu_bacteria 2818991439 2819557843 436
344 iso_pu_bacteria 2821443989 2821444435 436
345 iso_pu_bacteria 2841760612 2841762370 436
346 iso_pu_bacteria 2841859092 2841864071 436
347 iso_pu_bacteria 2842515876 2842520853 436
348 iso_pu_bacteria 2842826826 2842831187 436
349 iso_pu_bacteria 2842837860 2842842450 436
350 iso_pu_bacteria 2844002411 2844004785 436
351 iso_pu_bacteria 2844009547 2844009684 436
352 iso_pu_bacteria 2844104063 2844109908 436
353 iso_pu_bacteria 2851182111 2851186937 436
354 iso_pu_bacteria 2851246043 2851248383 436
355 iso_pu_bacteria 2856328259 2856329918 436
356 iso_pu_bacteria 2856334872 2856337072 436
357 iso_pu_bacteria 2857367948 2857371508 436
358 iso_pu_bacteria 2869234852 2869237173 436
359 iso_pu_bacteria 2869249662 2869252100 436
360 iso_pu_bacteria 2869256925 2869260440 436
361 iso_pu_bacteria 2869264136 2869270615 436
362 iso_pu_bacteria 2869271264 2869272248 436
363 iso_pu_bacteria 2871435913 2871443518 436
364 iso_pu_bacteria 2871459585 2871460389 436
365 iso_pu_bacteria 2874109183 2874115098 436
366 iso_pu_bacteria 2874131515 2874132505 436
367 iso_pu_bacteria 2874162495 2874163901 436
368 iso_pu_bacteria 2874168670 2874171232 436
369 iso_pu_bacteria 2876399893 2876401559 436
370 iso_pu_bacteria 2876406927 2876411095 436
371 iso_pu_bacteria 2878774303 2878774756 436
372 iso_pu_bacteria 2878781027 2878781769 436
373 iso_pu_bacteria 2899792073 2899793616 436
374 iso_pu_bacteria 2906363423 2906369306 436
375 iso_pu_bacteria 2906370794 2906371725 436
376 iso_pu_bacteria 2906386501 2906392923 436
377 iso_pu_bacteria 2906393657 2906399065 436
378 iso_pu_bacteria 2906408224 2906409588 436
379 iso_pu_bacteria 2908446538 2908450639 436
380 iso_pu_bacteria 2922151315 2922151578 436
381 iso_pu_bacteria 2922172374 2922178074 436
382 iso_pu_bacteria 2924710171 2924713991 436
383 iso_pu_bacteria 2924733363 2924740709 436
384 iso_pu_bacteria 2924748358 2924754662 436
385 iso_pu_bacteria 2933011516 2933016534 436
386 iso_pu_bacteria 2937071275 2937076418 436
387 iso_pu_bacteria 2937868953 2937874487 436
388 iso_pu_bacteria 2958122699 2958128337 436
389 iso_pu_bacteria 2958137437 2958144235 436
390 iso_pu_bacteria 2958158011 2958161550 436
391 iso_pu_bacteria 2961136820 2961138369 436
392 iso_pu_bacteria 2965025482 2965031107 436
393 iso_pu_bacteria 2965040258 2965045384 436
394 iso_pu_bacteria 2965047637 2965053659 436
395 iso_pu_bacteria 2965110997 2965115799 436
396 iso_pu_bacteria 2970489779 2970491448 436
397 iso_pu_bacteria 2970510686 2970517746 436
398 iso_pu_bacteria 2970547951 2970554598 436
399 iso_pu_bacteria 2970619444 2970624091 436
400 iso_pu_bacteria 2977872689 2977879290 436
401 iso_pu_bacteria 2977898635 2977906308 436
402 iso_pu_bacteria 2977915119 2977918174 436
403 iso_pu_bacteria 2977935797 2977937126 436
404 iso_pu_bacteria 2977950692 2977954058 436
405 iso_pu_bacteria 2977957713 2977958299 436
406 iso_pu_bacteria 2979100975 2979102884 436
407 iso_pu_bacteria 2979793036 2979798603 436
408 iso_pu_bacteria 2984509177 2984509227 436
409 iso_pu_bacteria 2984518228 2984520075 436
410 iso_pu_bacteria 2984537506 2984537556 436
411 iso_pu_bacteria 2984601300 2984604304 436
412 iso_pu_bacteria 2987645492 2987652122 436
413 iso_pu_bacteria 2987673487 2987674735 436
414 iso_pu_bacteria 2996386984 2996388436 436
415 iso_pu_bacteria 3002141150 3002144307 436
416 iso_pu_bacteria 3004167301 3004172004 436
417 iso_pu_bacteria 3004195979 3004198143 436
418 iso_pu_bacteria 3004232784 3004239716 436
419 iso_pu_bacteria 3004239961 3004242346 436
420 iso_pu_bacteria 3004268573 3004271531 436
421 iso_pu_bacteria 649633066 649872361 436
422 iso_pu_bacteria 8004300914 8004301392 436
423 iso_pu_bacteria 8004361976 8004369160 436
424 iso_pu_bacteria 8004695233 8004697003 436
425 iso_pu_bacteria 8054285046 8054289839 436
426 iso_pu_bacteria 8054347763 8054348639 436
427 iso_pu_bacteria 8054503363 8054507171 436
428 iso_pu_bacteria 8055817908 8055822099 436
429 iso_pu_bacteria 8057529695 8057535477 436
430 3300003781 Ga0055536_1000093 Ga0055536_10000939 437
431 3300003791 Ga0055530_10000034 Ga0055530_1000003483 437
432 3300003792 Ga0055540_1000429 Ga0055540_100042912 437
433 3300005289 Ga0065704_10081044 Ga0065704_100810442 437
434 3300005290 Ga0065712_10000260 Ga0065712_1000026011 437
435 3300025292 Ga0209676_1000032 Ga0209676_1000032156 437
436 3300025298 Ga0209050_1000025 Ga0209050_1000025157 437
437 3300025303 Ga0209051_1000039 Ga0209051_1000039120 437
438 3300025303 Ga0209051_1000047 Ga0209051_1000047120 437
439 3300042009 Ga0439451_007601 Ga0439451_007601_185_1552 437
440 3300042016 Ga0439463_000088 Ga0439463_000088_13613_14980 437
441 3300046460 Ga0495638_0000830 Ga0495638_0000830_30933_32258 437
442 3300046522 Ga0495643_0044851 Ga0495643_0044851_340_1665 437
443 3300046558 Ga0495633_0052648 Ga0495633_0052648_258_1583 437
444 3300046660 Ga0495625_0006484 Ga0495625_0006484_105_1430 437
445 3300047320 Ga0495672_0077600 Ga0495672_0077600_116_1441 437
446 iso_pu_bacteria 2508501128 2509153250 437
447 iso_pu_bacteria 2510917030 2511200207 437
448 iso_pu_bacteria 2511231006 2511264300 437
449 iso_pu_bacteria 2512047018 2512328877 437
450 iso_pu_bacteria 2513237096 2513659593 437
451 iso_pu_bacteria 2513237101 2513691643 437
452 iso_pu_bacteria 2513237102 2513705181 437
453 iso_pu_bacteria 2513237104 2513717626 437
454 iso_pu_bacteria 2513237137 2513859646 437
455 iso_pu_bacteria 2513237141 2513889395 437
456 iso_pu_bacteria 2513237145 2513921687 437
457 iso_pu_bacteria 2517572143 2517893274 437
458 iso_pu_bacteria 2524023205 2524439701 437
459 iso_pu_bacteria 2554235003 2554245873 437
460 iso_pu_bacteria 2558860242 2559296361 437
461 iso_pu_bacteria 2582580891 2583792927 437
462 iso_pu_bacteria 2582581298 2585222362 437
463 iso_pu_bacteria 2585427529 2585544686 437
464 iso_pu_bacteria 2599185212 2599616521 437
465 iso_pu_bacteria 2599185318 2600038721 437
466 iso_pu_bacteria 2599185322 2600062604 437
467 iso_pu_bacteria 2617270735 2617354038 437
468 iso_pu_bacteria 2617270741 2617376651 437
469 iso_pu_bacteria 2643221582 2643921976 437
470 iso_pu_bacteria 2643221643 2644240985 437
471 iso_pu_bacteria 2643221693 2644522837 437
472 iso_pu_bacteria 2667528175 2671117919 437
473 iso_pu_bacteria 2721755755 2723845937 437
474 iso_pu_bacteria 2740892503 2743738090 437
475 iso_pu_bacteria 2744054633 2745082156 437
476 iso_pu_bacteria 2791355197 2793069856 437
477 iso_pu_bacteria 2791355199 2793079741 437
478 iso_pu_bacteria 2808606387 2808988579 437
479 iso_pu_bacteria 2818991467 2819717596 437
480 iso_pu_bacteria 2824600985 2824606589 437
481 iso_pu_bacteria 2824609381 2824613091 437
482 iso_pu_bacteria 2824617872 2824624552 437
483 iso_pu_bacteria 2824626560 2824630701 437
484 iso_pu_bacteria 2824635225 2824640363 437
485 iso_pu_bacteria 2824644064 2824647842 437
486 iso_pu_bacteria 2824653114 2824655812 437
487 iso_pu_bacteria 2824696289 2824700649 437
488 iso_pu_bacteria 2824714736 2824718892 437
489 iso_pu_bacteria 2824723954 2824730568 437
490 iso_pu_bacteria 2824732956 2824735740 437
491 iso_pu_bacteria 2824746037 2824751684 437
492 iso_pu_bacteria 2838675328 2838679757 437
493 iso_pu_bacteria 2838714209 2838717473 437
494 iso_pu_bacteria 2838719591 2838724326 437
495 iso_pu_bacteria 2838724970 2838729357 437
496 iso_pu_bacteria 2841846520 2841850784 437
497 iso_pu_bacteria 2842124991 2842129589 437
498 iso_pu_bacteria 2842130223 2842134734 437
499 iso_pu_bacteria 2842152218 2842156748 437
500 iso_pu_bacteria 2842170452 2842173006 437
501 iso_pu_bacteria 2842175837 2842180366 437
502 iso_pu_bacteria 2842187318 2842191975 437
503 iso_pu_bacteria 2842211629 2842216291 437
504 iso_pu_bacteria 2842224351 2842229011 437
505 iso_pu_bacteria 2847930680 2847935077 437
506 iso_pu_bacteria 2847939898 2847945636 437
507 iso_pu_bacteria 2856320880 2856326250 437
508 iso_pu_bacteria 2857524615 2857530616 437
509 iso_pu_bacteria 2869278585 2869284127 437
510 iso_pu_bacteria 2874139085 2874144751 437
511 iso_pu_bacteria 2874604998 2874609407 437
512 iso_pu_bacteria 2874645413 2874651197 437
513 iso_pu_bacteria 2876808645 2876813208 437
514 iso_pu_bacteria 2878738818 2878743879 437
515 iso_pu_bacteria 2879110137 2879110370 437
516 iso_pu_bacteria 2881665667 2881673075 437
517 iso_pu_bacteria 2885326080 2885328942 437
518 iso_pu_bacteria 2885374607 2885374868 437
519 iso_pu_bacteria 2888378607 2888383063 437
520 iso_pu_bacteria 2888388044 2888394765 437
521 iso_pu_bacteria 2888419890 2888423521 437
522 iso_pu_bacteria 2889306138 2889307561 437
523 iso_pu_bacteria 2893066018 2893070261 437
524 iso_pu_bacteria 2899845264 2899848706 437
525 iso_pu_bacteria 2903748898 2903755738 437
526 iso_pu_bacteria 2904690495 2904696681 437
527 iso_pu_bacteria 2904699407 2904704330 437
528 iso_pu_bacteria 2906610324 2906617520 437
529 iso_pu_bacteria 2906635258 2906636177 437
530 iso_pu_bacteria 2906643746 2906647718 437
531 iso_pu_bacteria 2906660503 2906667980 437
532 iso_pu_bacteria 2908739725 2908743670 437
533 iso_pu_bacteria 2908756301 2908761302 437
534 iso_pu_bacteria 2919100787 2919102922 437
535 iso_pu_bacteria 2919114240 2919119225 437
536 iso_pu_bacteria 2922361189 2922367889 437
537 iso_pu_bacteria 2922393267 2922395454 437
538 iso_pu_bacteria 2922425934 2922429197 437
539 iso_pu_bacteria 2923153595 2923157138 437
540 iso_pu_bacteria 2924776078 2924781796 437
541 iso_pu_bacteria 2926754445 2926759256 437
542 iso_pu_bacteria 2926760298 2926763307 437
543 iso_pu_bacteria 2928959182 2928961953 437
544 iso_pu_bacteria 2932794094 2932796320 437
545 iso_pu_bacteria 2932801729 2932804374 437
546 iso_pu_bacteria 2933006813 2933011353 437
547 iso_pu_bacteria 2935630451 2935634212 437
548 iso_pu_bacteria 2935883170 2935888785 437
549 iso_pu_bacteria 2937836603 2937838504 437
550 iso_pu_bacteria 2937877337 2937884876 437
551 iso_pu_bacteria 2937972304 2937978148 437
552 iso_pu_bacteria 2941507105 2941511102 437
553 iso_pu_bacteria 2941515067 2941518486 437
554 iso_pu_bacteria 2941523033 2941527251 437
555 iso_pu_bacteria 2958034702 2958040516 437
556 iso_pu_bacteria 2958041894 2958055364 437
557 iso_pu_bacteria 2958084443 2958092185 437
558 iso_pu_bacteria 2968016561 2968021858 437
559 iso_pu_bacteria 2970469710 2970474448 437
560 iso_pu_bacteria 2970593180 2970598739 437
561 iso_pu_bacteria 2979089926 2979091660 437
562 iso_pu_bacteria 2979095461 2979097181 437
563 iso_pu_bacteria 2996348954 2996353857 437
564 iso_pu_bacteria 3004275668 3004280525 437
565 iso_pu_bacteria 3005445848 3005450857 437
566 iso_pu_bacteria 3005474847 3005479367 437
567 iso_pu_bacteria 3005483717 3005490047 437
568 iso_pu_bacteria 3005710791 3005713990 437
569 iso_pu_bacteria 3007395558 3007396052 437
570 iso_pu_bacteria 650716007 650842754 437
571 iso_pu_bacteria 8003570095 8003574644 437
572 iso_pu_bacteria 8006964411 8006968722 437
573 iso_pu_bacteria 8006984368 8006990537 437
574 iso_pu_bacteria 8015687852 8015691320 437
575 iso_pu_bacteria 8019555841 8019557689 437
576 iso_pu_bacteria 8019565922 8019567609 437
577 iso_pu_bacteria 8055770955 8055774496 437
578 iso_pu_bacteria 8056681323 8056684073 437
579 iso_pu_bacteria 8056689827 8056695773 437
580 3300009011 Ga0105251_10000274 Ga0105251_1000027426 438
581 3300009092 Ga0105250_10000191 Ga0105250_1000019128 438
582 3300009092 Ga0105250_10030412 Ga0105250_100304122 438
583 3300025711 Ga0207696_1000078 Ga0207696_1000078175 438
584 3300025711 Ga0207696_1021437 Ga0207696_10214372 438
585 3300025735 Ga0207713_1000010 Ga0207713_1000010329 438
586 3300046474 Ga0495605_0009203 Ga0495605_0009203_47_1363 438
587 3300046513 Ga0495616_0003971 Ga0495616_0003971_3587_4924 438
588 3300046519 Ga0495632_0034577 Ga0495632_0034577_842_2158 438
589 3300046660 Ga0495625_0004731 Ga0495625_0004731_11384_12700 438
590 3300046691 Ga0495670_0009646 Ga0495670_0009646_1030_2346 438
591 3300046810 Ga0495660_0065580 Ga0495660_0065580_443_1759 438
592 3300048091 Ga0495626_0000162 Ga0495626_0000162_18477_19814 438
593 3300049571 Ga0501034_0000109 Ga0501034_0000109_116542_117885 438
594 3300049584 Ga0501068_0019486 Ga0501068_0019486_873_2216 438
595 3300049823 Ga0501044_0034874 Ga0501044_0034874_740_2083 438
596 3300053079 Ga0500610_0004055 Ga0500610_0004055_3442_4758 438
597 3300053105 Ga0500557_000223 Ga0500557_000223_3969_5285 438
598 iso_pu_bacteria 2643221599 2644003071 438
599 iso_pu_bacteria 2643221634 2644191935 438
600 iso_pu_bacteria 2849076700 2849080186 438
601 iso_pu_bacteria 2857542790 2857546898 438
602 iso_pu_bacteria 3005452660 3005455211 438
603 iso_pu_bacteria 3007419365 3007419786 438
604 3300003752 Ga0055539_1000102 Ga0055539_100010266 439
605 3300003756 Ga0055533_1000110 Ga0055533_100011066 439
606 3300003758 Ga0055532_1000138 Ga0055532_100013842 439
607 3300003759 Ga0055525_1000187 Ga0055525_100018711 439
608 3300003761 Ga0055535_1002951 Ga0055535_10029512 439
609 3300003790 Ga0055528_1001194 Ga0055528_100119415 439
610 3300003841 Ga0055541_1000068 Ga0055541_100006841 439
611 3300009036 Ga0105244_10013667 Ga0105244_100136672 439
612 3300009036 Ga0105244_10023885 Ga0105244_100238852 439
613 3300009092 Ga0105250_10000078 Ga0105250_1000007848 439
614 3300011119 Ga0105246_10009601 Ga0105246_100096013 439
615 3300013105 Ga0157369_10009585 Ga0157369_100095857 439
616 3300013105 Ga0157369_10142127 Ga0157369_101421273 439
617 3300013296 Ga0157374_10033704 Ga0157374_100337046 439
618 3300013308 Ga0157375_10000820 Ga0157375_1000082014 439
619 3300013308 Ga0157375_10019193 Ga0157375_100191935 439
620 3300025206 Ga0209435_100373 Ga0209435_1003732 439
621 3300025224 Ga0209784_100057 Ga0209784_100057129 439
622 3300025225 Ga0209566_100073 Ga0209566_100073129 439
623 3300025226 Ga0209674_100095 Ga0209674_100095129 439
624 3300025229 Ga0209147_100092 Ga0209147_100092129 439
625 3300025230 Ga0209563_100093 Ga0209563_10009341 439
626 3300025242 Ga0209258_100300 Ga0209258_10030023 439
627 3300025246 Ga0209646_1000617 Ga0209646_100061711 439
628 3300025253 Ga0209677_100054 Ga0209677_100054129 439
629 3300025256 Ga0209759_1010198 Ga0209759_10101982 439
630 3300025273 Ga0209673_1001694 Ga0209673_10016943 439
631 3300025295 Ga0209564_1004853 Ga0209564_10048532 439
632 3300025299 Ga0209256_1001947 Ga0209256_10019473 439
633 3300025711 Ga0207696_1000212 Ga0207696_100021226 439
634 3300025728 Ga0207655_1001362 Ga0207655_10013624 439
635 3300025728 Ga0207655_1014596 Ga0207655_10145962 439
636 3300025735 Ga0207713_1011892 Ga0207713_10118922 439
637 3300025925 Ga0207650_10002333 Ga0207650_100023333 439
638 3300041452 Ga0451793_1407387 Ga0451793_1407387_298_1617 439
639 3300041453 Ga0451797_0747061 Ga0451797_0747061_1906_3225 439
640 3300041486 Ga0451807_0031918 Ga0451807_0031918_1919_3238 439
641 3300044901 Ga0466960_0006169 Ga0466960_0006169_2995_4314 439
642 3300046453 Ga0495627_000962 Ga0495627_000962_13366_14697 439
643 3300046458 Ga0495591_001034 Ga0495591_001034_5026_6357 439
644 3300046463 Ga0495653_0002549 Ga0495653_0002549_483_1838 439
645 3300046492 Ga0495585_0033962 Ga0495585_0033962_252_1607 439
646 3300046501 Ga0495607_0003493 Ga0495607_0003493_443_1774 439
647 3300046507 Ga0495606_0000061 Ga0495606_0000061_34589_35944 439
648 3300046507 Ga0495606_0117021 Ga0495606_0117021_74_1405 439
649 3300046512 Ga0495610_0016998 Ga0495610_0016998_502_1833 439
650 3300046513 Ga0495616_0084874 Ga0495616_0084874_110_1441 439
651 3300046519 Ga0495632_0060532 Ga0495632_0060532_348_1679 439
652 3300046520 Ga0495637_0011909 Ga0495637_0011909_2426_3757 439
653 3300046524 Ga0495648_0001770 Ga0495648_0001770_14329_15660 439
654 3300046530 Ga0495654_0000732 Ga0495654_0000732_17412_18743 439
655 3300046530 Ga0495654_0019243 Ga0495654_0019243_230_1561 439
656 3300046665 Ga0495661_0000007 Ga0495661_0000007_140215_141570 439
657 3300046665 Ga0495661_0000154 Ga0495661_0000154_52759_54090 439
658 3300046665 Ga0495661_0012271 Ga0495661_0012271_1290_2621 439
659 3300046694 Ga0495649_0000685 Ga0495649_0000685_13533_14864 439
660 3300046694 Ga0495649_0008434 Ga0495649_0008434_4486_5817 439
661 3300046794 Ga0495589_0054925 Ga0495589_0054925_234_1565 439
662 3300047323 Ga0495683_0000099 Ga0495683_0000099_59434_60765 439
663 3300047446 Ga0495679_007354 Ga0495679_007354_519_1850 439
664 3300048920 Ga0496117_0000218 Ga0496117_0000218_55365_56696 439
665 3300048920 Ga0496117_0098792 Ga0496117_0098792_54_1385 439
666 3300048921 Ga0496118_0017938 Ga0496118_0017938_1286_2605 439
667 3300048921 Ga0496118_0037856 Ga0496118_0037856_2370_3701 439
668 3300048922 Ga0496119_0047055 Ga0496119_0047055_259_1590 439
669 3300048923 Ga0496120_0003789 Ga0496120_0003789_4856_6187 439
670 3300048923 Ga0496120_0072515 Ga0496120_0072515_110_1429 439
671 3300048924 Ga0496121_0000033 Ga0496121_0000033_167771_169090 439
672 3300048924 Ga0496121_0057807 Ga0496121_0057807_1273_2604 439
673 3300048925 Ga0496122_0066047 Ga0496122_0066047_993_2324 439
674 3300048926 Ga0496123_0041597 Ga0496123_0041597_409_1728 439
675 3300048926 Ga0496123_0046469 Ga0496123_0046469_244_1563 439
676 3300048926 Ga0496123_0050340 Ga0496123_0050340_1011_2342 439
677 3300048927 Ga0496124_0002048 Ga0496124_0002048_21175_22506 439
678 3300048927 Ga0496124_0051980 Ga0496124_0051980_874_2193 439
679 3300048928 Ga0496125_0000235 Ga0496125_0000235_596_1927 439
680 3300048928 Ga0496125_0000760 Ga0496125_0000760_1067_2386 439
681 3300048928 Ga0496125_0066080 Ga0496125_0066080_585_1916 439
682 3300048929 Ga0496126_0010785 Ga0496126_0010785_7421_8752 439
683 3300053111 Ga0500572_001371 Ga0500572_001371_2663_3982 439
684 3300053161 Ga0500634_0006837 Ga0500634_0006837_1316_2647 439
685 3300053177 Ga0500636_0000367 Ga0500636_0000367_2291_3610 439
686 iso_pu_bacteria 2510065019 2510137779 439
687 iso_pu_bacteria 2510917028 2511183689 439
688 iso_pu_bacteria 2513237103 2513712757 439
689 iso_pu_bacteria 2513237138 2513871510 439
690 iso_pu_bacteria 2513237162 2514018973 439
691 iso_pu_bacteria 2515075009 2515109362 439
692 iso_pu_bacteria 2516653077 2517042235 439
693 iso_pu_bacteria 2517093000 2517099573 439
694 iso_pu_bacteria 2517287029 2517411774 439
695 iso_pu_bacteria 2582581867 2585400762 439
696 iso_pu_bacteria 2585427528 2585539365 439
697 iso_pu_bacteria 2585427590 2585819677 439
698 iso_pu_bacteria 2585427593 2585837319 439
699 iso_pu_bacteria 2599185214 2599626551 439
700 iso_pu_bacteria 2599185226 2599675615 439
701 iso_pu_bacteria 2599185227 2599684088 439
702 iso_pu_bacteria 2599185229 2599696102 439
703 iso_pu_bacteria 2602042107 2603859778 439
704 iso_pu_bacteria 2724679232 2725948178 439
705 iso_pu_bacteria 2791355260 2793322525 439
706 iso_pu_bacteria 2791355266 2793359904 439
707 iso_pu_bacteria 2842217011 2842222843 439
708 iso_pu_bacteria 2842775625 2842778766 439
709 iso_pu_bacteria 2857516855 2857522534 439
710 iso_pu_bacteria 2899924645 2899925008 439
711 iso_pu_bacteria 2919073203 2919076212 439
712 iso_pu_bacteria 2923556063 2923558115 439
713 iso_pu_bacteria 2928037797 2928038867 439
714 iso_pu_bacteria 2928044640 2928045528 439
715 iso_pu_bacteria 2928051484 2928053144 439
716 iso_pu_bacteria 2928064002 2928066750 439
717 iso_pu_bacteria 2928070936 2928071363 439
718 iso_pu_bacteria 2996887358 2996892465 439
719 iso_pu_bacteria 639633055 639645782 439
720 iso_pu_bacteria 8005258706 8005259765 439
721 iso_pu_bacteria 8005321885 8005326992 439
722 iso_pu_bacteria 8005460587 8005466490 439
723 iso_pu_bacteria 8005556819 8005558710 439
724 iso_pu_bacteria 8005563573 8005563681 439
725 iso_pu_bacteria 8018163183 8018164064 439
726 iso_pu_bacteria 8057874678 8057876884 439
727 3300003187 JGI25151J46595_10000613 JGI25151J46595_1000061325 440
728 3300003187 JGI25151J46595_10039711 JGI25151J46595_100397111 440
729 3300003354 JGI25160J50197_1007040 JGI25160J50197_10070403 440
730 3300005262 Ga0065165_1000393 Ga0065165_100039323 440
731 3300005337 Ga0070682_100077440 Ga0070682_1000774402 440
732 3300005436 Ga0070713_100067291 Ga0070713_1000672912 440
733 3300006847 Ga0075431_100001187 Ga0075431_1000011873 440
734 3300007076 Ga0075435_100096255 Ga0075435_1000962552 440
735 3300009094 Ga0111539_10026576 Ga0111539_100265763 440
736 3300009147 Ga0114129_10033150 Ga0114129_100331504 440
737 3300013102 Ga0157371_10000042 Ga0157371_10000042104 440
738 3300013104 Ga0157370_10000035 Ga0157370_1000003554 440
739 3300021361 Ga0213872_10023178 Ga0213872_100231782 440
740 3300021384 Ga0213876_10038944 Ga0213876_100389442 440
741 3300025284 Ga0209130_1000061 Ga0209130_100006125 440
742 3300025284 Ga0209130_1001275 Ga0209130_100127513 440
743 3300025294 Ga0209025_1000486 Ga0209025_100048625 440
744 3300025294 Ga0209025_1002869 Ga0209025_10028698 440
745 3300025294 Ga0209025_1041756 Ga0209025_10417561 440
746 3300025297 Ga0209758_1002282 Ga0209758_100228211 440
747 3300025302 Ga0207426_1000451 Ga0207426_100045134 440
748 3300039437 Ga0436365_1607850 Ga0436365_1607850_13092_14420 440
749 3300039447 Ga0436361_0294136 Ga0436361_0294136_1085_2407 440
750 3300046543 Ga0495645_0112991 Ga0495645_0112991_402_1739 440
751 3300046558 Ga0495633_0030237 Ga0495633_0030237_11_1339 440
752 3300048916 Ga0496113_0179574 Ga0496113_0179574_191_1519 440
753 3300048920 Ga0496117_0000036 Ga0496117_0000036_218386_219714 440
754 3300048922 Ga0496119_0032141 Ga0496119_0032141_2109_3437 440
755 3300048923 Ga0496120_0000036 Ga0496120_0000036_124124_125452 440
756 3300048925 Ga0496122_0000002 Ga0496122_0000002_661653_662981 440
757 3300048926 Ga0496123_0000002 Ga0496123_0000002_1148702_1150030 440
758 3300048926 Ga0496123_0000002 Ga0496123_0000002_661653_662981 440
759 3300048927 Ga0496124_0000259 Ga0496124_0000259_54560_55918 440
760 3300049593 Ga0501077_0023333 Ga0501077_0023333_2044_3369 440
761 3300049743 Ga0501081_0034632 Ga0501081_0034632_213_1538 440
762 3300049824 Ga0501045_0088025 Ga0501045_0088025_235_1560 440
763 3300050491 nmdc:mga00v17_19_c1 nmdc:mga00v17_19_c1_63963_65291 440
764 3300050492 nmdc:mga0yw44_386_c1 nmdc:mga0yw44_386_c1_11942_13270 440
765 3300050508 nmdc:mga09592_38638_c1 nmdc:mga09592_38638_c1_1039_2364 440
766 3300050509 nmdc:mga0qj67_106915_c1 nmdc:mga0qj67_106915_c1_465_1790 440
767 3300050511 nmdc:mga08y16_13395_c1 nmdc:mga08y16_13395_c1_1967_3304 440
768 3300053107 Ga0500560_000050 Ga0500560_000050_3461_4789 440
769 3300053157 Ga0500624_000424 Ga0500624_000424_8074_9402 440
770 3300054114 Ga0501084_0118168 Ga0501084_0118168_737_2062 440
771 3300060353 Ga0501082_0055942 Ga0501082_0055942_1986_3311 440
772 3300061734 Ga0530510_0202558 Ga0530510_0202558_39_1364 440
773 iso_pu_bacteria 2511231021 2511355673 440
774 iso_pu_bacteria 2738541277 2738717968 440
775 iso_pu_bacteria 2738543019 2739278654 440
776 iso_pu_bacteria 2831426010 2831428903 440
777 iso_pu_bacteria 2848694841 2848697371 440
778 iso_pu_bacteria 2946027586 2946031630 440
779 3300003203 JGI25406J46586_10000006 JGI25406J46586_100000063 441
780 3300003203 JGI25406J46586_10002914 JGI25406J46586_100029147 441
781 3300003215 JGI25153J46596_10042717 JGI25153J46596_100427171 441
782 3300005288 Ga0065714_10011017 Ga0065714_100110173 441
783 3300005329 Ga0070683_100056257 Ga0070683_1000562571 441
784 3300005329 Ga0070683_100071169 Ga0070683_1000711692 441
785 3300005336 Ga0070680_100074218 Ga0070680_1000742182 441
786 3300005347 Ga0070668_100006327 Ga0070668_1000063274 441
787 3300005347 Ga0070668_100019325 Ga0070668_1000193253 441
788 3300005347 Ga0070668_100048293 Ga0070668_1000482931 441
789 3300005353 Ga0070669_100032753 Ga0070669_1000327532 441
790 3300005367 Ga0070667_100003665 Ga0070667_1000036654 441
791 3300005434 Ga0070709_10004497 Ga0070709_100044978 441
792 3300005434 Ga0070709_10026694 Ga0070709_100266942 441
793 3300005435 Ga0070714_100091486 Ga0070714_1000914862 441
794 3300005436 Ga0070713_100091636 Ga0070713_1000916362 441
795 3300005436 Ga0070713_100117112 Ga0070713_1001171123 441
796 3300005439 Ga0070711_100055615 Ga0070711_1000556153 441
797 3300005458 Ga0070681_10044250 Ga0070681_100442503 441
798 3300005535 Ga0070684_100158321 Ga0070684_1001583211 441
799 3300005536 Ga0070697_100047675 Ga0070697_1000476754 441
800 3300005536 Ga0070697_100052582 Ga0070697_1000525822 441
801 3300005539 Ga0068853_100055368 Ga0068853_1000553682 441
802 3300005539 Ga0068853_100061917 Ga0068853_1000619173 441
803 3300005548 Ga0070665_100011759 Ga0070665_1000117591 441
804 3300005548 Ga0070665_100023461 Ga0070665_1000234615 441
805 3300005563 Ga0068855_100048315 Ga0068855_1000483154 441
806 3300005578 Ga0068854_100044261 Ga0068854_1000442612 441
807 3300005614 Ga0068856_100000427 Ga0068856_10000042722 441
808 3300005617 Ga0068859_100002889 Ga0068859_10000288912 441
809 3300005617 Ga0068859_100197269 Ga0068859_1001972691 441
810 3300005834 Ga0068851_10035695 Ga0068851_100356952 441
811 3300005841 Ga0068863_100245583 Ga0068863_1002455832 441
812 3300005843 Ga0068860_100294113 Ga0068860_1002941131 441
813 3300005844 Ga0068862_100258304 Ga0068862_1002583042 441
814 3300005937 Ga0081455_10000764 Ga0081455_1000076412 441
815 3300005981 Ga0081538_10005836 Ga0081538_100058369 441
816 3300005983 Ga0081540_1000916 Ga0081540_10009162 441
817 3300005983 Ga0081540_1001739 Ga0081540_10017392 441
818 3300005983 Ga0081540_1002782 Ga0081540_10027826 441
819 3300005983 Ga0081540_1013100 Ga0081540_10131005 441
820 3300005983 Ga0081540_1021438 Ga0081540_10214384 441
821 3300005983 Ga0081540_1049839 Ga0081540_10498392 441
822 3300005985 Ga0081539_10000176 Ga0081539_10000176120 441
823 3300005985 Ga0081539_10000231 Ga0081539_10000231124 441
824 3300006028 Ga0070717_10076107 Ga0070717_100761073 441
825 3300006042 Ga0075368_10002158 Ga0075368_100021583 441
826 3300006048 Ga0075363_100002264 Ga0075363_1000022645 441
827 3300006175 Ga0070712_100028636 Ga0070712_1000286365 441
828 3300006846 Ga0075430_100155975 Ga0075430_1001559752 441
829 3300006931 Ga0097620_100002889 Ga0097620_10000288912 441
830 3300006931 Ga0097620_100197255 Ga0097620_1001972551 441
831 3300006942 Ga0099824_1006719 Ga0099824_10067195 441
832 3300006943 Ga0099822_1001392 Ga0099822_10013925 441
833 3300007265 Ga0099794_10048101 Ga0099794_100481011 441
834 3300009093 Ga0105240_10086641 Ga0105240_100866412 441
835 3300009174 Ga0105241_10230665 Ga0105241_102306651 441
836 3300009545 Ga0105237_10026637 Ga0105237_100266375 441
837 3300009545 Ga0105237_10216874 Ga0105237_102168742 441
838 3300009551 Ga0105238_10007002 Ga0105238_100070022 441
839 3300009553 Ga0105249_10315408 Ga0105249_103154081 441
840 3300010375 Ga0105239_10064579 Ga0105239_100645792 441
841 3300010375 Ga0105239_10091118 Ga0105239_100911181 441
842 3300013102 Ga0157371_10083815 Ga0157371_100838152 441
843 3300013104 Ga0157370_10227157 Ga0157370_102271571 441
844 3300013105 Ga0157369_10006177 Ga0157369_1000617711 441
845 3300013296 Ga0157374_10037116 Ga0157374_100371164 441
846 3300013296 Ga0157374_10072122 Ga0157374_100721221 441
847 3300013297 Ga0157378_10009614 Ga0157378_100096145 441
848 3300025297 Ga0209758_1001732 Ga0209758_100173213 441
849 3300025297 Ga0209758_1001986 Ga0209758_10019866 441
850 3300025297 Ga0209758_1003786 Ga0209758_100378610 441
851 3300025297 Ga0209758_1023382 Ga0209758_10233822 441
852 3300025906 Ga0207699_10062447 Ga0207699_100624471 441
853 3300025907 Ga0207645_10043988 Ga0207645_100439883 441
854 3300025909 Ga0207705_10163338 Ga0207705_101633381 441
855 3300025910 Ga0207684_10114167 Ga0207684_101141671 441
856 3300025912 Ga0207707_10029007 Ga0207707_100290076 441
857 3300025912 Ga0207707_10056027 Ga0207707_100560272 441
858 3300025912 Ga0207707_10080667 Ga0207707_100806672 441
859 3300025913 Ga0207695_10043878 Ga0207695_100438782 441
860 3300025914 Ga0207671_10009517 Ga0207671_100095178 441
861 3300025914 Ga0207671_10050623 Ga0207671_100506232 441
862 3300025914 Ga0207671_10082481 Ga0207671_100824812 441
863 3300025916 Ga0207663_10111722 Ga0207663_101117222 441
864 3300025917 Ga0207660_10003538 Ga0207660_100035385 441
865 3300025919 Ga0207657_10085467 Ga0207657_100854672 441
866 3300025921 Ga0207652_10010392 Ga0207652_100103925 441
867 3300025921 Ga0207652_10057070 Ga0207652_100570704 441
868 3300025923 Ga0207681_10001413 Ga0207681_100014133 441
869 3300025928 Ga0207700_10032960 Ga0207700_100329602 441
870 3300025928 Ga0207700_10053019 Ga0207700_100530193 441
871 3300025929 Ga0207664_10097018 Ga0207664_100970181 441
872 3300025931 Ga0207644_10218694 Ga0207644_102186941 441
873 3300025941 Ga0207711_10084540 Ga0207711_100845401 441
874 3300025942 Ga0207689_10046690 Ga0207689_100466902 441
875 3300025944 Ga0207661_10034196 Ga0207661_100341962 441
876 3300025949 Ga0207667_10046644 Ga0207667_100466441 441
877 3300025949 Ga0207667_10161664 Ga0207667_101616643 441
878 3300025961 Ga0207712_10184219 Ga0207712_101842191 441
879 3300025972 Ga0207668_10042899 Ga0207668_100428994 441
880 3300025981 Ga0207640_10030435 Ga0207640_100304354 441
881 3300025981 Ga0207640_10138929 Ga0207640_101389291 441
882 3300025986 Ga0207658_10004077 Ga0207658_100040773 441
883 3300026035 Ga0207703_10260727 Ga0207703_102607271 441
884 3300026041 Ga0207639_10075984 Ga0207639_100759842 441
885 3300026041 Ga0207639_10088242 Ga0207639_100882422 441
886 3300026078 Ga0207702_10002818 Ga0207702_100028186 441
887 3300026078 Ga0207702_10043495 Ga0207702_100434953 441
888 3300026116 Ga0207674_10092290 Ga0207674_100922901 441
889 3300026121 Ga0207683_10158234 Ga0207683_101582341 441
890 3300027357 Ga0209589_1000023 Ga0209589_1000023176 441
891 3300027361 Ga0209489_100032 Ga0209489_100032176 441
892 3300027363 Ga0209700_100040 Ga0209700_100040176 441
893 3300028379 Ga0268266_10004462 Ga0268266_100044622 441
894 3300028379 Ga0268266_10014083 Ga0268266_100140832 441
895 3300028379 Ga0268266_10056761 Ga0268266_100567612 441
896 3300028379 Ga0268266_10166119 Ga0268266_101661192 441
897 3300028379 Ga0268266_10192613 Ga0268266_101926131 441
898 3300028794 Ga0307515_10082124 Ga0307515_100821243 441
899 3300031507 Ga0307509_10147409 Ga0307509_101474092 441
900 3300031616 Ga0307508_10000010 Ga0307508_10000010245 441
901 3300031711 Ga0265314_10047018 Ga0265314_100470183 441
902 3300032002 Ga0307416_100284656 Ga0307416_1002846561 441
903 3300033179 Ga0307507_10063344 Ga0307507_100633442 441
904 3300033180 Ga0307510_10007185 Ga0307510_1000718512 441
905 3300033442 Ga0315911_1000029 Ga0315911_100002914 441
906 3300035086 Ga0373934_0006326 Ga0373934_0006326_114_1439 441
907 3300035090 Ga0373949_0014712 Ga0373949_0014712_361_1689 441
908 3300035113 Ga0373936_0052766 Ga0373936_0052766_212_1537 441
909 3300035117 Ga0373953_0000640 Ga0373953_0000640_7338_8663 441
910 3300035118 Ga0373954_0000067 Ga0373954_0000067_11604_12929 441
911 3300035120 Ga0373957_0001550 Ga0373957_0001550_787_2112 441
912 3300035172 Ga0373955_0003543 Ga0373955_0003543_2900_4225 441
913 3300035410 Ga0373924_0006108 Ga0373924_0006108_2905_4230 441
914 3300035692 Ga0373935_0093265 Ga0373935_0093265_332_1657 441
915 3300035692 Ga0373935_0141194 Ga0373935_0141194_226_1551 441
916 3300035695 Ga0373927_0017434 Ga0373927_0017434_1635_2960 441
917 3300035724 Ga0373933_0000324 Ga0373933_0000324_6768_8093 441
918 3300035725 Ga0373947_0011851 Ga0373947_0011851_3086_4411 441
919 3300035725 Ga0373947_0015707 Ga0373947_0015707_248_1573 441
920 3300036401 Ga0373937_0001425 Ga0373937_0001425_17574_18899 441
921 3300036401 Ga0373937_0025703 Ga0373937_0025703_1532_2857 441
922 3300037068 Ga0373925_0063685 Ga0373925_0063685_1121_2446 441
923 3300037068 Ga0373925_0086422 Ga0373925_0086422_753_2105 441
924 3300037418 Ga0395900_0001064 Ga0395900_0001064_12079_13404 441
925 3300037466 Ga0395898_0151633 Ga0395898_0151633_58_1383 441
926 3300037471 Ga0395905_0035462 Ga0395905_0035462_2056_3393 441
927 3300038443 Ga0395901_0035567 Ga0395901_0035567_2871_4196 441
928 3300039437 Ga0436365_0871323 Ga0436365_0871323_132_1457 441
929 3300039447 Ga0436361_0488499 Ga0436361_0488499_1819_3144 441
930 3300039447 Ga0436361_0983753 Ga0436361_0983753_288_1613 441
931 3300039450 Ga0436363_1134489 Ga0436363_1134489_36_1361 441
932 3300041413 Ga0439465_0020010 Ga0439465_0020010_97_1422 441
933 3300044658 Ga0466972_0000076 Ga0466972_0000076_69119_70444 441
934 3300044693 Ga0466961_0000600 Ga0466961_0000600_13667_14992 441
935 3300044694 Ga0466963_0066091 Ga0466963_0066091_985_2310 441
936 3300045049 Ga0466959_0000651 Ga0466959_0000651_17785_19110 441
937 3300045049 Ga0466959_0003113 Ga0466959_0003113_5496_6821 441
938 3300045836 Ga0466958_0050355 Ga0466958_0050355_84_1409 441
939 3300046454 Ga0495592_0001030 Ga0495592_0001030_10059_11384 441
940 3300046455 Ga0495603_0059365 Ga0495603_0059365_449_1774 441
941 3300046459 Ga0495629_0000398 Ga0495629_0000398_6461_7786 441
942 3300046462 Ga0495651_0004166 Ga0495651_0004166_1481_2806 441
943 3300046463 Ga0495653_0000598 Ga0495653_0000598_25741_27066 441
944 3300046473 Ga0495582_0116066 Ga0495582_0116066_108_1433 441
945 3300046474 Ga0495605_0000158 Ga0495605_0000158_17456_18814 441
946 3300046474 Ga0495605_0000220 Ga0495605_0000220_60977_62314 441
947 3300046501 Ga0495607_0000013 Ga0495607_0000013_104177_105514 441
948 3300046501 Ga0495607_0000032 Ga0495607_0000032_104204_105604 441
949 3300046506 Ga0495583_0000086 Ga0495583_0000086_58319_59644 441
950 3300046507 Ga0495606_0004653 Ga0495606_0004653_2509_3834 441
951 3300046507 Ga0495606_0088820 Ga0495606_0088820_567_1892 441
952 3300046511 Ga0495608_0071490 Ga0495608_0071490_902_2227 441
953 3300046516 Ga0495628_0017882 Ga0495628_0017882_2137_3534 441
954 3300046516 Ga0495628_0030305 Ga0495628_0030305_1787_3112 441
955 3300046522 Ga0495643_0065956 Ga0495643_0065956_569_1894 441
956 3300046524 Ga0495648_0000552 Ga0495648_0000552_35113_36438 441
957 3300046529 Ga0495652_0009435 Ga0495652_0009435_2423_3748 441
958 3300046530 Ga0495654_0000117 Ga0495654_0000117_5189_6514 441
959 3300046536 Ga0495587_0018340 Ga0495587_0018340_2423_3748 441
960 3300046542 Ga0495597_0000013 Ga0495597_0000013_113953_115290 441
961 3300046542 Ga0495597_0033929 Ga0495597_0033929_415_1773 441
962 3300046543 Ga0495645_0090314 Ga0495645_0090314_732_2057 441
963 3300046559 Ga0495667_0000305 Ga0495667_0000305_21928_23253 441
964 3300046660 Ga0495625_0032089 Ga0495625_0032089_576_1913 441
965 3300046663 Ga0495635_0000102 Ga0495635_0000102_27371_28696 441
966 3300046663 Ga0495635_0069033 Ga0495635_0069033_816_2141 441
967 3300046674 Ga0495588_0012716 Ga0495588_0012716_594_1919 441
968 3300046675 Ga0495657_0000677 Ga0495657_0000677_28721_30046 441
969 3300046678 Ga0495599_0001882 Ga0495599_0001882_7570_8895 441
970 3300046679 Ga0495623_0005677 Ga0495623_0005677_489_1814 441
971 3300046680 Ga0495646_0005928 Ga0495646_0005928_3034_4359 441
972 3300046689 Ga0495613_0183622 Ga0495613_0183622_33_1430 441
973 3300046690 Ga0495624_0053891 Ga0495624_0053891_507_1832 441
974 3300046810 Ga0495660_0000333 Ga0495660_0000333_37866_39203 441
975 3300046810 Ga0495660_0003395 Ga0495660_0003395_1639_2976 441
976 3300047317 Ga0495604_0001099 Ga0495604_0001099_3761_5086 441
977 3300047319 Ga0495674_0013937 Ga0495674_0013937_2823_4148 441
978 3300047320 Ga0495672_0029603 Ga0495672_0029603_491_1816 441
979 3300047320 Ga0495672_0036625 Ga0495672_0036625_74_1474 441
980 3300047322 Ga0495680_0018405 Ga0495680_0018405_3141_4466 441
981 3300047443 Ga0495687_000572 Ga0495687_000572_15155_16480 441
982 3300047443 Ga0495687_035975 Ga0495687_035975_624_1949 441
983 3300047443 Ga0495687_052619 Ga0495687_052619_319_1644 441
984 3300047444 Ga0495675_0024914 Ga0495675_0024914_626_1951 441
985 3300047470 Ga0495681_0037021 Ga0495681_0037021_765_2090 441
986 3300047471 Ga0495684_0000088 Ga0495684_0000088_25883_27208 441
987 3300047673 Ga0495593_0009454 Ga0495593_0009454_3265_4590 441
988 3300048088 Ga0495602_0028311 Ga0495602_0028311_3138_4463 441
989 3300048903 Ga0496100_0010556 Ga0496100_0010556_1233_2675 441
990 3300048903 Ga0496100_0018696 Ga0496100_0018696_2093_3418 441
991 3300048904 Ga0496101_0008338 Ga0496101_0008338_1204_2646 441
992 3300048904 Ga0496101_0117825 Ga0496101_0117825_25_1350 441
993 3300048905 Ga0496102_0000613 Ga0496102_0000613_1233_2675 441
994 3300048905 Ga0496102_0002326 Ga0496102_0002326_6422_7747 441
995 3300048906 Ga0496103_0002825 Ga0496103_0002825_8122_9564 441
996 3300048906 Ga0496103_0008910 Ga0496103_0008910_109_1434 441
997 3300048906 Ga0496103_0090578 Ga0496103_0090578_336_1661 441
998 3300048907 Ga0496104_0002277 Ga0496104_0002277_13882_15324 441
999 3300048907 Ga0496104_0036850 Ga0496104_0036850_3133_4458 441
1000 3300048907 Ga0496104_0038908 Ga0496104_0038908_1262_2587 441
1001 3300048907 Ga0496104_0096350 Ga0496104_0096350_609_1934 441
1002 3300048908 Ga0496105_0001309 Ga0496105_0001309_1233_2675 441
1003 3300048908 Ga0496105_0055730 Ga0496105_0055730_994_2319 441
1004 3300048909 Ga0496106_0001425 Ga0496106_0001425_16243_17568 441
1005 3300048910 Ga0496107_0014938 Ga0496107_0014938_3945_5270 441
1006 3300048911 Ga0496108_0029179 Ga0496108_0029179_210_1535 441
1007 3300048911 Ga0496108_0139543 Ga0496108_0139543_168_1493 441
1008 3300048913 Ga0496110_0142856 Ga0496110_0142856_44_1369 441
1009 3300048914 Ga0496111_0098314 Ga0496111_0098314_174_1499 441
1010 3300048915 Ga0496112_0016228 Ga0496112_0016228_1720_3162 441
1011 3300048915 Ga0496112_0215061 Ga0496112_0215061_98_1423 441
1012 3300048916 Ga0496113_0000100 Ga0496113_0000100_8137_9579 441
1013 3300048917 Ga0496114_0081585 Ga0496114_0081585_1066_2391 441
1014 3300048917 Ga0496114_0120405 Ga0496114_0120405_95_1420 441
1015 3300048918 Ga0496115_0003736 Ga0496115_0003736_261_1586 441
1016 3300048920 Ga0496117_0017563 Ga0496117_0017563_1213_2655 441
1017 3300048920 Ga0496117_0043984 Ga0496117_0043984_1505_2830 441
1018 3300048921 Ga0496118_0002112 Ga0496118_0002112_22560_23885 441
1019 3300048922 Ga0496119_0003738 Ga0496119_0003738_12898_14340 441
1020 3300048922 Ga0496119_0005237 Ga0496119_0005237_1127_2452 441
1021 3300048923 Ga0496120_0004974 Ga0496120_0004974_1225_2667 441
1022 3300048924 Ga0496121_0000077 Ga0496121_0000077_225283_226608 441
1023 3300048924 Ga0496121_0009406 Ga0496121_0009406_1077_2519 441
1024 3300048924 Ga0496121_0023336 Ga0496121_0023336_806_2131 441
1025 3300048925 Ga0496122_0021606 Ga0496122_0021606_3079_4521 441
1026 3300048926 Ga0496123_0004528 Ga0496123_0004528_11845_13287 441
1027 3300048927 Ga0496124_0000812 Ga0496124_0000812_4958_6349 441
1028 3300048927 Ga0496124_0001166 Ga0496124_0001166_32218_33543 441
1029 3300048927 Ga0496124_0001679 Ga0496124_0001679_12721_14163 441
1030 3300048928 Ga0496125_0000681 Ga0496125_0000681_1471_2799 441
1031 3300048928 Ga0496125_0006813 Ga0496125_0006813_9587_11029 441
1032 3300048928 Ga0496125_0127718 Ga0496125_0127718_437_1762 441
1033 3300048929 Ga0496126_0002030 Ga0496126_0002030_9615_10940 441
1034 3300048929 Ga0496126_0004349 Ga0496126_0004349_14319_15761 441
1035 3300048929 Ga0496126_0040697 Ga0496126_0040697_220_1545 441
1036 3300048929 Ga0496126_0103810 Ga0496126_0103810_1070_2395 441
1037 3300048929 Ga0496126_0127421 Ga0496126_0127421_504_1829 441
1038 3300049580 Ga0501046_0158687 Ga0501046_0158687_99_1424 441
1039 3300049586 Ga0501070_0006242 Ga0501070_0006242_7616_8941 441
1040 3300049589 Ga0501073_0023935 Ga0501073_0023935_109_1434 441
1041 3300049590 Ga0501074_0015583 Ga0501074_0015583_2022_3347 441
1042 3300049593 Ga0501077_0030316 Ga0501077_0030316_1784_3109 441
1043 3300049742 Ga0501080_0004826 Ga0501080_0004826_2179_3504 441
1044 3300050490 nmdc:mga03n38_2026_c1 nmdc:mga03n38_2026_c1_3491_4816 441
1045 3300053077 Ga0495601_0012935 Ga0495601_0012935_406_1731 441
1046 3300053077 Ga0495601_0098530 Ga0495601_0098530_80_1405 441
1047 3300053084 Ga0495595_0003426 Ga0495595_0003426_4461_5786 441
1048 3300053085 Ga0495619_0000166 Ga0495619_0000166_10152_11477 441
1049 3300053085 Ga0495619_0027922 Ga0495619_0027922_2245_3570 441
1050 3300053096 Ga0500641_0054968 Ga0500641_0054968_307_1632 441
1051 3300053104 Ga0500556_0000030 Ga0500556_0000030_148359_149684 441
1052 3300053111 Ga0500572_001447 Ga0500572_001447_3292_4617 441
1053 3300053119 Ga0500595_008373 Ga0500595_008373_1038_2363 441
1054 3300053119 Ga0500595_015948 Ga0500595_015948_835_2160 441
1055 3300053119 Ga0500595_024033 Ga0500595_024033_504_1829 441
1056 3300053119 Ga0500595_035614 Ga0500595_035614_175_1500 441
1057 3300053136 Ga0500559_0000870 Ga0500559_0000870_6184_7509 441
1058 3300053136 Ga0500559_0029135 Ga0500559_0029135_327_1652 441
1059 3300053140 Ga0500573_0014832 Ga0500573_0014832_2377_3702 441
1060 3300053158 Ga0500627_0008706 Ga0500627_0008706_2058_3383 441
1061 3300053735 Ga0500596_007152 Ga0500596_007152_363_1688 441
1062 iso_pu_bacteria 2883577096 2883578052 441
1063 iso_pu_bacteria 2886627955 2886628645 441
1064 iso_pu_bacteria 2913844669 2913848143 441
1065 iso_pu_bacteria 2913939268 2913943507 441
1066 3300005327 Ga0070658_10197786 Ga0070658_101977861 442
1067 3300005327 Ga0070658_10198021 Ga0070658_101980211 442
1068 3300005436 Ga0070713_100086405 Ga0070713_1000864053 442
1069 3300005439 Ga0070711_100064628 Ga0070711_1000646281 442
1070 3300005844 Ga0068862_100070026 Ga0068862_1000700262 442
1071 3300006173 Ga0070716_100078614 Ga0070716_1000786142 442
1072 3300006175 Ga0070712_100066082 Ga0070712_1000660823 442
1073 3300009174 Ga0105241_10074952 Ga0105241_100749522 442
1074 3300009545 Ga0105237_10001204 Ga0105237_100012042 442
1075 3300010375 Ga0105239_10001427 Ga0105239_1000142712 442
1076 3300011119 Ga0105246_10001379 Ga0105246_100013792 442
1077 3300013104 Ga0157370_10069515 Ga0157370_100695152 442
1078 3300013105 Ga0157369_10067587 Ga0157369_100675872 442
1079 3300017792 Ga0163161_10038439 Ga0163161_100384392 442
1080 3300025253 Ga0209677_101475 Ga0209677_1014758 442
1081 3300025261 Ga0209233_1004380 Ga0209233_10043805 442
1082 3300025272 Ga0209455_1003651 Ga0209455_10036514 442
1083 3300025297 Ga0209758_1003333 Ga0209758_100333312 442
1084 3300025911 Ga0207654_10086047 Ga0207654_100860471 442
1085 3300025913 Ga0207695_10003498 Ga0207695_1000349816 442
1086 3300025914 Ga0207671_10040867 Ga0207671_100408673 442
1087 3300025915 Ga0207693_10081334 Ga0207693_100813342 442
1088 3300025916 Ga0207663_10135336 Ga0207663_101353361 442
1089 3300025917 Ga0207660_10154060 Ga0207660_101540602 442
1090 3300025939 Ga0207665_10119013 Ga0207665_101190132 442
1091 3300027296 Ga0209389_1000068 Ga0209389_100006832 442
1092 3300027361 Ga0209489_113471 Ga0209489_1134712 442
1093 3300027363 Ga0209700_100117 Ga0209700_10011771 442
1094 3300028577 Ga0265318_10006964 Ga0265318_100069644 442
1095 3300035113 Ga0373936_0000048 Ga0373936_0000048_47995_49338 442
1096 3300035119 Ga0373956_0012978 Ga0373956_0012978_933_2261 442
1097 3300035172 Ga0373955_0009025 Ga0373955_0009025_713_2041 442
1098 3300035410 Ga0373924_0000928 Ga0373924_0000928_775_2103 442
1099 3300035692 Ga0373935_0107883 Ga0373935_0107883_26_1354 442
1100 3300035724 Ga0373933_0006219 Ga0373933_0006219_2324_3652 442
1101 3300035724 Ga0373933_0022874 Ga0373933_0022874_1866_3194 442
1102 3300036401 Ga0373937_0001548 Ga0373937_0001548_6919_8247 442
1103 3300036401 Ga0373937_0023468 Ga0373937_0023468_2100_3428 442
1104 3300042115 Ga0450911_000132 Ga0450911_000132_5938_7266 442
1105 3300046460 Ga0495638_0007158 Ga0495638_0007158_6117_7445 442
1106 3300046477 Ga0495664_0000849 Ga0495664_0000849_9379_10707 442
1107 3300046507 Ga0495606_0133929 Ga0495606_0133929_79_1422 442
1108 3300046511 Ga0495608_0002252 Ga0495608_0002252_10390_11718 442
1109 3300046511 Ga0495608_0003379 Ga0495608_0003379_7075_8403 442
1110 3300046524 Ga0495648_0036428 Ga0495648_0036428_913_2241 442
1111 3300046533 Ga0495640_0035357 Ga0495640_0035357_2101_3429 442
1112 3300046533 Ga0495640_0103047 Ga0495640_0103047_393_1721 442
1113 3300046536 Ga0495587_0008765 Ga0495587_0008765_3796_5124 442
1114 3300046543 Ga0495645_0013413 Ga0495645_0013413_925_2253 442
1115 3300046559 Ga0495667_0013747 Ga0495667_0013747_554_1882 442
1116 3300046678 Ga0495599_0021326 Ga0495599_0021326_2179_3507 442
1117 3300046680 Ga0495646_0007052 Ga0495646_0007052_336_1664 442
1118 3300047317 Ga0495604_0063570 Ga0495604_0063570_966_2294 442
1119 3300047319 Ga0495674_0071933 Ga0495674_0071933_1464_2792 442
1120 3300047322 Ga0495680_0156163 Ga0495680_0156163_84_1412 442
1121 3300047472 Ga0495686_0015085 Ga0495686_0015085_3670_4998 442
1122 3300047472 Ga0495686_0039136 Ga0495686_0039136_1443_2774 442
1123 3300048088 Ga0495602_0000162 Ga0495602_0000162_12084_13412 442
1124 3300048920 Ga0496117_0070470 Ga0496117_0070470_615_1955 442
1125 3300048924 Ga0496121_0016116 Ga0496121_0016116_1020_2348 442
1126 3300048924 Ga0496121_0087611 Ga0496121_0087611_743_2083 442
1127 3300048928 Ga0496125_0039434 Ga0496125_0039434_446_1777 442
1128 3300048928 Ga0496125_0050297 Ga0496125_0050297_880_2208 442
1129 3300048929 Ga0496126_0016102 Ga0496126_0016102_4717_6057 442
1130 3300048929 Ga0496126_0057675 Ga0496126_0057675_187_1518 442
1131 3300048929 Ga0496126_0213249 Ga0496126_0213249_191_1576 442
1132 3300049570 Ga0501033_0026589 Ga0501033_0026589_2185_3513 442
1133 3300049583 Ga0501067_0000045 Ga0501067_0000045_25339_26667 442
1134 3300049589 Ga0501073_0034888 Ga0501073_0034888_2229_3557 442
1135 3300049822 Ga0501035_0111993 Ga0501035_0111993_336_1664 442
1136 3300053077 Ga0495601_0002864 Ga0495601_0002864_6491_7819 442
1137 3300053078 Ga0495612_0016518 Ga0495612_0016518_621_1949 442
1138 3300053085 Ga0495619_0027730 Ga0495619_0027730_1361_2689 442
1139 3300053094 Ga0500566_0002077 Ga0500566_0002077_9997_11391 442
1140 3300053104 Ga0500556_0001124 Ga0500556_0001124_10016_11344 442
1141 3300053111 Ga0500572_000055 Ga0500572_000055_19025_20500 442
1142 3300053115 Ga0500591_051586 Ga0500591_051586_329_1804 442
1143 3300053125 Ga0500618_006987 Ga0500618_006987_1662_3056 442
1144 3300053136 Ga0500559_0000678 Ga0500559_0000678_6763_8157 442
1145 3300053136 Ga0500559_0001368 Ga0500559_0001368_5431_6771 442
1146 3300053136 Ga0500559_0003497 Ga0500559_0003497_5078_6553 442
1147 3300053139 Ga0500568_0000361 Ga0500568_0000361_31861_33207 442
1148 3300053150 Ga0500603_001487 Ga0500603_001487_2884_4359 442
1149 3300053156 Ga0500622_0015058 Ga0500622_0015058_778_2106 442
1150 3300053157 Ga0500624_002884 Ga0500624_002884_588_1922 442
1151 3300053159 Ga0500630_032865 Ga0500630_032865_21_1451 442
1152 3300053163 Ga0500639_000004 Ga0500639_000004_131338_132813 442
1153 3300053177 Ga0500636_0003604 Ga0500636_0003604_3785_5179 442
1154 3300053178 Ga0500637_0000106 Ga0500637_0000106_21747_23081 442
1155 3300053730 Ga0500645_001822 Ga0500645_001822_8342_9670 442
1156 3300053735 Ga0500596_000144 Ga0500596_000144_2822_4297 442
1157 iso_pu_bacteria 2513237090 2513607968 442
1158 iso_pu_bacteria 2513237139 2513879375 442
1159 iso_pu_bacteria 2582581299 2585230307 442
1160 iso_pu_bacteria 2693429783 2694632755 442
1161 iso_pu_bacteria 2693429784 2694639516 442
1162 iso_pu_bacteria 2721755686 2723577870 442
1163 iso_pu_bacteria 2802429603 2805920273 442
1164 iso_pu_bacteria 2816332527 2818240357 442
1165 iso_pu_bacteria 2835312727 2835313151 442
1166 iso_pu_bacteria 2856364286 2856365217 442
1167 iso_pu_bacteria 2857349434 2857354643 442
1168 iso_pu_bacteria 2869285874 2869288685 442
1169 iso_pu_bacteria 2871429161 2871432043 442
1170 iso_pu_bacteria 2874146452 2874150684 442
1171 iso_pu_bacteria 2874155637 2874156139 442
1172 iso_pu_bacteria 2876413966 2876416724 442
1173 iso_pu_bacteria 2878745973 2878748707 442
1174 iso_pu_bacteria 2889010040 2889013580 442
1175 iso_pu_bacteria 2889016732 2889021702 442
1176 iso_pu_bacteria 2903492973 2903503011 442
1177 iso_pu_bacteria 2906308376 2906311118 442
1178 iso_pu_bacteria 2906321335 2906323158 442
1179 iso_pu_bacteria 2922130491 2922134655 442
1180 iso_pu_bacteria 2922185730 2922193513 442
1181 iso_pu_bacteria 2937813078 2937818761 442
1182 iso_pu_bacteria 2937848649 2937850418 442
1183 iso_pu_bacteria 2938014810 2938017913 442
1184 iso_pu_bacteria 2958100919 2958107159 442
1185 iso_pu_bacteria 2958130278 2958133082 442
1186 iso_pu_bacteria 2958172287 2958173269 442
1187 iso_pu_bacteria 2958179912 2958182776 442
1188 iso_pu_bacteria 2961077736 2961080633 442
1189 iso_pu_bacteria 2965119406 2965123352 442
1190 iso_pu_bacteria 2968117919 2968118767 442
1191 iso_pu_bacteria 2977843712 2977844442 442
1192 iso_pu_bacteria 2977922695 2977927894 442
1193 iso_pu_bacteria 2977942078 2977946422 442
1194 iso_pu_bacteria 2979710463 2979717145 442
1195 iso_pu_bacteria 2987636660 2987643245 442
1196 iso_pu_bacteria 2987652177 2987652394 442
1197 iso_pu_bacteria 3004203850 3004206792 442
1198 iso_pu_bacteria 3004211236 3004213722 442
1199 iso_pu_bacteria 3004218560 3004223313 442
1200 iso_pu_bacteria 3005718088 3005721439 442
1201 iso_pu_bacteria 8001845381 8001849370 442
1202 iso_pu_bacteria 8004387939 8004390764 442
1203 iso_pu_bacteria 8004640170 8004645896 442
1204 iso_pu_bacteria 8004714634 8004717342 442
1205 3300002773 JGI25152J39213_1001356 JGI25152J39213_10013566 443
1206 3300002774 JGI25150J39212_1002705 JGI25150J39212_10027053 443
1207 3300002987 JGI25159J45721_1004063 JGI25159J45721_10040634 443
1208 3300003187 JGI25151J46595_10003952 JGI25151J46595_100039523 443
1209 3300003215 JGI25153J46596_10005791 JGI25153J46596_100057912 443
1210 3300003354 JGI25160J50197_1002431 JGI25160J50197_10024315 443
1211 3300003354 JGI25160J50197_1015074 JGI25160J50197_10150742 443
1212 3300003374 JGI25161J50226_1001494 JGI25161J50226_10014946 443
1213 3300003761 Ga0055535_1002320 Ga0055535_10023205 443
1214 3300003762 Ga0055542_1000021 Ga0055542_1000021157 443
1215 3300003771 Ga0055526_1003161 Ga0055526_10031615 443
1216 3300003775 Ga0055524_1002061 Ga0055524_10020615 443
1217 3300003775 Ga0055524_1009264 Ga0055524_10092642 443
1218 3300003784 Ga0055534_1002463 Ga0055534_10024632 443
1219 3300003790 Ga0055528_1007556 Ga0055528_10075562 443
1220 3300005262 Ga0065165_1005554 Ga0065165_10055545 443
1221 3300005347 Ga0070668_100093749 Ga0070668_1000937493 443
1222 3300005530 Ga0070679_100016753 Ga0070679_1000167536 443
1223 3300005834 Ga0068851_10029404 Ga0068851_100294043 443
1224 3300006038 Ga0075365_10002499 Ga0075365_100024995 443
1225 3300006353 Ga0075370_10098471 Ga0075370_100984711 443
1226 3300009093 Ga0105240_10067903 Ga0105240_100679032 443
1227 3300009553 Ga0105249_10295590 Ga0105249_102955901 443
1228 3300009766 Ga0123342_1026161 Ga0123342_10261612 443
1229 3300010375 Ga0105239_10098729 Ga0105239_100987293 443
1230 3300013105 Ga0157369_10010643 Ga0157369_100106436 443
1231 3300015683 Ga0183362_10008 Ga0183362_10008179 443
1232 3300017792 Ga0163161_10000139 Ga0163161_1000013926 443
1233 3300025208 Ga0209436_108537 Ga0209436_1085372 443
1234 3300025228 Ga0209672_100295 Ga0209672_10029524 443
1235 3300025242 Ga0209258_100058 Ga0209258_100058157 443
1236 3300025245 Ga0207425_1000157 Ga0207425_10001579 443
1237 3300025254 Ga0209148_1000071 Ga0209148_1000071157 443
1238 3300025258 Ga0209129_1000483 Ga0209129_100048316 443
1239 3300025258 Ga0209129_1002306 Ga0209129_10023063 443
1240 3300025263 Ga0209565_1000038 Ga0209565_100003845 443
1241 3300025273 Ga0209673_1000362 Ga0209673_100036264 443
1242 3300025273 Ga0209673_1012725 Ga0209673_10127252 443
1243 3300025284 Ga0209130_1000664 Ga0209130_10006649 443
1244 3300025291 Ga0209675_1000102 Ga0209675_1000102100 443
1245 3300025292 Ga0209676_1003421 Ga0209676_10034212 443
1246 3300025294 Ga0209025_1000056 Ga0209025_1000056239 443
1247 3300025295 Ga0209564_1000542 Ga0209564_100054248 443
1248 3300025297 Ga0209758_1000044 Ga0209758_1000044226 443
1249 3300025299 Ga0209256_1000020 Ga0209256_1000020229 443
1250 3300025302 Ga0207426_1000001 Ga0207426_1000001864 443
1251 3300025302 Ga0207426_1002786 Ga0207426_100278617 443
1252 3300025303 Ga0209051_1003798 Ga0209051_10037988 443
1253 3300025303 Ga0209051_1011280 Ga0209051_10112804 443
1254 3300025304 Ga0209257_1001689 Ga0209257_10016897 443
1255 3300025321 Ga0207656_10005610 Ga0207656_100056104 443
1256 3300035113 Ga0373936_0000012 Ga0373936_0000012_101813_103144 443
1257 3300046453 Ga0495627_003213 Ga0495627_003213_2418_3749 443
1258 3300046474 Ga0495605_0061269 Ga0495605_0061269_215_1681 443
1259 3300046512 Ga0495610_0000138 Ga0495610_0000138_22047_23378 443
1260 3300046515 Ga0495620_0014504 Ga0495620_0014504_1180_2511 443
1261 3300046520 Ga0495637_0010199 Ga0495637_0010199_1287_2648 443
1262 3300046616 Ga0495668_0031490 Ga0495668_0031490_65_1408 443
1263 3300046665 Ga0495661_0011508 Ga0495661_0011508_1410_2741 443
1264 3300047469 Ga0495673_0020162 Ga0495673_0020162_154_1485 443
1265 3300048904 Ga0496101_0011098 Ga0496101_0011098_176_1510 443
1266 3300048924 Ga0496121_0006454 Ga0496121_0006454_11064_12395 443
1267 3300048927 Ga0496124_0005729 Ga0496124_0005729_4205_5536 443
1268 3300048927 Ga0496124_0029306 Ga0496124_0029306_1730_3106 443
1269 iso_pu_bacteria 2643221689 2644498061 443
1270 iso_pu_bacteria 2738541307 2738879637 443
1271 iso_pu_bacteria 2894772417 2894776557 443
1272 iso_pu_bacteria 2919450847 2919454889 443
1273 3300005347 Ga0070668_100000734 Ga0070668_10000073411 444
1274 3300005353 Ga0070669_100120838 Ga0070669_1001208382 444
1275 3300005367 Ga0070667_100001509 Ga0070667_10000150911 444
1276 3300005435 Ga0070714_100004196 Ga0070714_10000419610 444
1277 3300005436 Ga0070713_100009387 Ga0070713_1000093877 444
1278 3300005437 Ga0070710_10004116 Ga0070710_100041169 444
1279 3300005439 Ga0070711_100004725 Ga0070711_1000047255 444
1280 3300005843 Ga0068860_100000265 Ga0068860_10000026534 444
1281 3300006173 Ga0070716_100005587 Ga0070716_1000055876 444
1282 3300025898 Ga0207692_10001246 Ga0207692_1000124610 444
1283 3300025906 Ga0207699_10000763 Ga0207699_100007633 444
1284 3300025916 Ga0207663_10042162 Ga0207663_100421623 444
1285 3300025923 Ga0207681_10060130 Ga0207681_100601303 444
1286 3300025928 Ga0207700_10064987 Ga0207700_100649872 444
1287 3300025929 Ga0207664_10019001 Ga0207664_100190014 444
1288 3300025939 Ga0207665_10002269 Ga0207665_100022693 444
1289 3300025972 Ga0207668_10000033 Ga0207668_1000003329 444
1290 3300025972 Ga0207668_10012379 Ga0207668_100123792 444
1291 3300025986 Ga0207658_10001268 Ga0207658_100012686 444
1292 3300028381 Ga0268264_10000318 Ga0268264_1000031834 444
1293 3300035086 Ga0373934_0028433 Ga0373934_0028433_42_1388 444
1294 3300035117 Ga0373953_0011634 Ga0373953_0011634_933_2279 444
1295 3300035119 Ga0373956_0002213 Ga0373956_0002213_4025_5371 444
1296 3300035724 Ga0373933_0000746 Ga0373933_0000746_8822_10168 444
1297 3300036401 Ga0373937_0000413 Ga0373937_0000413_24494_25840 444
1298 3300039450 Ga0436363_1329538 Ga0436363_1329538_87_1421 444
1299 3300046454 Ga0495592_0000629 Ga0495592_0000629_17001_18347 444
1300 3300046459 Ga0495629_0000948 Ga0495629_0000948_21831_23177 444
1301 3300046460 Ga0495638_0000120 Ga0495638_0000120_120414_121748 444
1302 3300046462 Ga0495651_0000319 Ga0495651_0000319_21007_22353 444
1303 3300046463 Ga0495653_0000391 Ga0495653_0000391_10350_11696 444
1304 3300046511 Ga0495608_0000916 Ga0495608_0000916_11725_13071 444
1305 3300046529 Ga0495652_0001170 Ga0495652_0001170_26861_28207 444
1306 3300046536 Ga0495587_0001521 Ga0495587_0001521_592_1938 444
1307 3300046559 Ga0495667_0002351 Ga0495667_0002351_1750_3096 444
1308 3300046642 Ga0495634_0003266 Ga0495634_0003266_1140_2486 444
1309 3300046663 Ga0495635_0003651 Ga0495635_0003651_2363_3709 444
1310 3300046675 Ga0495657_0011228 Ga0495657_0011228_3481_4827 444
1311 3300046678 Ga0495599_0001494 Ga0495599_0001494_5834_7180 444
1312 3300047315 Ga0495581_0026545 Ga0495581_0026545_21_1367 444
1313 3300047317 Ga0495604_0000580 Ga0495604_0000580_19909_21255 444
1314 3300047319 Ga0495674_0001292 Ga0495674_0001292_3455_4801 444
1315 3300047322 Ga0495680_0000636 Ga0495680_0000636_19258_20604 444
1316 3300047444 Ga0495675_0007147 Ga0495675_0007147_4306_5652 444
1317 3300048088 Ga0495602_0004623 Ga0495602_0004623_150_1496 444
1318 3300048918 Ga0496115_0070947 Ga0496115_0070947_74_1411 444
1319 3300048925 Ga0496122_0000428 Ga0496122_0000428_2514_3848 444
1320 3300048926 Ga0496123_0001068 Ga0496123_0001068_2520_3854 444
1321 3300048927 Ga0496124_0016064 Ga0496124_0016064_4741_6075 444
1322 3300049571 Ga0501034_0091961 Ga0501034_0091961_354_1715 444
1323 3300049586 Ga0501070_0053039 Ga0501070_0053039_1054_2415 444
1324 3300049589 Ga0501073_0010956 Ga0501073_0010956_1889_3250 444
1325 3300053077 Ga0495601_0020150 Ga0495601_0020150_341_1687 444
1326 3300053078 Ga0495612_0004607 Ga0495612_0004607_2556_3902 444
1327 3300053084 Ga0495595_0000112 Ga0495595_0000112_35177_36523 444
1328 3300053085 Ga0495619_0001541 Ga0495619_0001541_5405_6751 444
1329 3300053103 Ga0500555_003622 Ga0500555_003622_2070_3404 444
1330 3300053139 Ga0500568_0000323 Ga0500568_0000323_22705_24039 444
1331 3300053140 Ga0500573_0021953 Ga0500573_0021953_567_1901 444
1332 iso_pu_bacteria 2501025504 2501407805 444
1333 iso_pu_bacteria 2510917014 2511097681 444
1334 iso_pu_bacteria 2510917022 2511137257 444
1335 iso_pu_bacteria 2512875016 2512929370 444
1336 iso_pu_bacteria 2512875024 2512964167 444
1337 iso_pu_bacteria 2513237164 2514034089 444
1338 iso_pu_bacteria 2582581307 2585274084 444
1339 iso_pu_bacteria 2582581308 2585280502 444
1340 iso_pu_bacteria 2582581315 2585322774 444
1341 iso_pu_bacteria 2582581316 2585330942 444
1342 iso_pu_bacteria 2585427527 2585532729 444
1343 iso_pu_bacteria 2585427530 2585554255 444
1344 iso_pu_bacteria 2585427531 2585560534 444
1345 iso_pu_bacteria 2585427608 2585898746 444
1346 iso_pu_bacteria 2585427609 2585903683 444
1347 iso_pu_bacteria 2585428125 2587981198 444
1348 iso_pu_bacteria 2588253730 2588514939 444
1349 iso_pu_bacteria 2615840698 2616554743 444
1350 iso_pu_bacteria 2617270742 2617383096 444
1351 iso_pu_bacteria 2667528174 2671111980 444
1352 iso_pu_bacteria 2775507266 2778175818 444
1353 iso_pu_bacteria 2818991448 2819609796 444
1354 iso_pu_bacteria 2818991453 2819639898 444
1355 iso_pu_bacteria 2838029111 2838034019 444
1356 iso_pu_bacteria 2842324504 2842326981 444
1357 iso_pu_bacteria 2842348783 2842350586 444
1358 iso_pu_bacteria 2842475841 2842480813 444
1359 iso_pu_bacteria 2842482326 2842483582 444
1360 iso_pu_bacteria 2842502639 2842507376 444
1361 iso_pu_bacteria 2852387548 2852390957 444
1362 iso_pu_bacteria 2876363079 2876367072 444
1363 iso_pu_bacteria 2903448605 2903453459 444
1364 iso_pu_bacteria 2903521522 2903526563 444
1365 iso_pu_bacteria 2903528002 2903530818 444
1366 iso_pu_bacteria 2919408235 2919410484 444
1367 iso_pu_bacteria 2963644680 2963649865 444
1368 iso_pu_bacteria 2968083720 2968086823 444
1369 iso_pu_bacteria 2977986579 2977990746 444
1370 iso_pu_bacteria 2987666974 2987671272 444
1371 iso_pu_bacteria 2996310559 2996312991 444
1372 iso_pu_bacteria 3005416602 3005418684 444
1373 iso_pu_bacteria 637000159 637079119 444
1374 iso_pu_bacteria 642555113 642617685 444
1375 iso_pu_bacteria 8005314921 8005318424 444
1376 iso_pu_bacteria 8005484373 8005488692 444
1377 iso_pu_bacteria 8005645114 8005645927 444
1378 iso_pu_bacteria 8005682033 8005682395 444
1379 iso_pu_bacteria 8046767195 8046772499 444
1380 iso_pu_bacteria 8057575449 8057577042 444
1381 3300005356 Ga0070674_100144345 Ga0070674_1001443452 445
1382 3300021361 Ga0213872_10007327 Ga0213872_100073273 445
1383 3300039447 Ga0436361_0144287 Ga0436361_0144287_7823_9175 445
1384 3300047319 Ga0495674_0257629 Ga0495674_0257629_17_1354 445
1385 3300048907 Ga0496104_0005539 Ga0496104_0005539_8331_9677 445
1386 3300048918 Ga0496115_0068101 Ga0496115_0068101_1019_2365 445
1387 3300048929 Ga0496126_0012038 Ga0496126_0012038_3399_4736 445
1388 3300003762 Ga0055542_1000463 Ga0055542_100046331 446
1389 3300005539 Ga0068853_100118484 Ga0068853_1001184842 446
1390 3300005616 Ga0068852_100215524 Ga0068852_1002155241 446
1391 3300006038 Ga0075365_10025473 Ga0075365_100254732 446
1392 3300009011 Ga0105251_10001467 Ga0105251_1000146714 446
1393 3300009036 Ga0105244_10034350 Ga0105244_100343503 446
1394 3300009093 Ga0105240_10142232 Ga0105240_101422322 446
1395 3300009148 Ga0105243_10017593 Ga0105243_100175932 446
1396 3300009174 Ga0105241_10144679 Ga0105241_101446792 446
1397 3300009545 Ga0105237_10006864 Ga0105237_100068645 446
1398 3300009551 Ga0105238_10018527 Ga0105238_100185273 446
1399 3300025254 Ga0209148_1000057 Ga0209148_1000057146 446
1400 3300025272 Ga0209455_1000205 Ga0209455_100020543 446
1401 3300025728 Ga0207655_1000014 Ga0207655_1000014462 446
1402 3300025735 Ga0207713_1006493 Ga0207713_10064933 446
1403 3300025913 Ga0207695_10096753 Ga0207695_100967532 446
1404 3300025914 Ga0207671_10020040 Ga0207671_100200401 446
1405 3300025924 Ga0207694_10004900 Ga0207694_100049004 446
1406 3300026041 Ga0207639_10007940 Ga0207639_100079402 446
1407 3300037418 Ga0395900_0126534 Ga0395900_0126534_632_1981 446
1408 3300046506 Ga0495583_0009346 Ga0495583_0009346_1525_2865 446
1409 3300048923 Ga0496120_0004614 Ga0496120_0004614_1315_2664 446
1410 iso_pu_bacteria 2738543016 2739264136 446
1411 3300005467 Ga0070706_100170110 Ga0070706_1001701101 447
1412 3300005471 Ga0070698_100000351 Ga0070698_10000035116 447
1413 3300005564 Ga0070664_100041024 Ga0070664_1000410243 447
1414 3300005614 Ga0068856_100124864 Ga0068856_1001248642 447
1415 3300005937 Ga0081455_10000058 Ga0081455_1000005819 447
1416 3300005937 Ga0081455_10000366 Ga0081455_1000036651 447
1417 3300005937 Ga0081455_10001795 Ga0081455_100017952 447
1418 3300005981 Ga0081538_10026519 Ga0081538_100265192 447
1419 3300006038 Ga0075365_10002455 Ga0075365_1000245510 447
1420 3300006178 Ga0075367_10026312 Ga0075367_100263123 447
1421 3300006195 Ga0075366_10008450 Ga0075366_100084505 447
1422 3300006358 Ga0068871_100219901 Ga0068871_1002199012 447
1423 3300006852 Ga0075433_10001198 Ga0075433_100011989 447
1424 3300006871 Ga0075434_100005705 Ga0075434_1000057052 447
1425 3300009094 Ga0111539_10004293 Ga0111539_100042935 447
1426 3300009098 Ga0105245_10069337 Ga0105245_100693374 447
1427 3300013104 Ga0157370_10094735 Ga0157370_100947353 447
1428 3300021441 Ga0213871_10000078 Ga0213871_100000788 447
1429 3300025924 Ga0207694_10069419 Ga0207694_100694193 447
1430 3300027907 Ga0207428_10039670 Ga0207428_100396702 447
1431 3300028573 Ga0265334_10012389 Ga0265334_100123893 447
1432 3300031247 Ga0265340_10059627 Ga0265340_100596272 447
1433 3300035088 Ga0373940_0014749 Ga0373940_0014749_266_1618 447
1434 3300035242 Ga0373962_0001722 Ga0373962_0001722_2398_3750 447
1435 3300035691 Ga0373931_0003739 Ga0373931_0003739_2117_3487 447
1436 3300035691 Ga0373931_0023668 Ga0373931_0023668_1417_2769 447
1437 3300035691 Ga0373931_0064578 Ga0373931_0064578_219_1568 447
1438 3300037068 Ga0373925_0013237 Ga0373925_0013237_710_2053 447
1439 3300037312 Ga0395899_0003559 Ga0395899_0003559_5231_6574 447
1440 3300037312 Ga0395899_0030722 Ga0395899_0030722_1864_3207 447
1441 3300037418 Ga0395900_0028557 Ga0395900_0028557_3123_4466 447
1442 3300037418 Ga0395900_0087840 Ga0395900_0087840_153_1496 447
1443 3300037853 Ga0436364_0867524 Ga0436364_0867524_11588_12934 447
1444 3300038443 Ga0395901_0029508 Ga0395901_0029508_2527_3870 447
1445 3300038443 Ga0395901_0060827 Ga0395901_0060827_187_1530 447
1446 3300039438 Ga0436360_1295423 Ga0436360_1295423_23016_24359 447
1447 3300039447 Ga0436361_0256362 Ga0436361_0256362_1690_3051 447
1448 3300039447 Ga0436361_1199195 Ga0436361_1199195_90_1433 447
1449 3300046472 Ga0495580_0007113 Ga0495580_0007113_371_1714 447
1450 3300046507 Ga0495606_0003058 Ga0495606_0003058_7931_9274 447
1451 3300046517 Ga0495630_0025184 Ga0495630_0025184_2997_4340 447
1452 3300046524 Ga0495648_0049091 Ga0495648_0049091_1230_2576 447
1453 3300046681 Ga0495647_0026488 Ga0495647_0026488_627_1970 447
1454 3300046692 Ga0495671_0086739 Ga0495671_0086739_105_1451 447
1455 3300049571 Ga0501034_0001751 Ga0501034_0001751_22663_24006 447
1456 3300049583 Ga0501067_0120805 Ga0501067_0120805_53_1405 447
1457 3300050491 nmdc:mga00v17_2987_c1 nmdc:mga00v17_2987_c1_3617_4963 447
1458 3300050492 nmdc:mga0yw44_575_c1 nmdc:mga0yw44_575_c1_6857_8203 447
1459 3300050511 nmdc:mga08y16_83612_c1 nmdc:mga08y16_83612_c1_1454_2806 447
1460 3300050512 nmdc:mga0n895_1221_c1 nmdc:mga0n895_1221_c1_533_1885 447
1461 3300002704 JGI25155J39150_1000007 JGI25155J39150_1000007199 448
1462 3300002705 JGI25156J39149_1000050 JGI25156J39149_100005053 448
1463 3300002737 JGI25162J39368_1000908 JGI25162J39368_10009089 448
1464 3300002738 JGI25154J39366_1000035 JGI25154J39366_1000035114 448
1465 3300002741 JGI25157J39369_1000036 JGI25157J39369_100003698 448
1466 3300003214 JGI25165J46597_1000375 JGI25165J46597_100037541 448
1467 3300003214 JGI25165J46597_1002256 JGI25165J46597_10022563 448
1468 3300003214 JGI25165J46597_1003958 JGI25165J46597_10039582 448
1469 3300005331 Ga0070670_100000359 Ga0070670_10000035913 448
1470 3300005456 Ga0070678_100016493 Ga0070678_1000164931 448
1471 3300005548 Ga0070665_100056340 Ga0070665_1000563403 448
1472 3300005614 Ga0068856_100145970 Ga0068856_1001459702 448
1473 3300005983 Ga0081540_1000040 Ga0081540_100004080 448
1474 3300005985 Ga0081539_10009227 Ga0081539_100092276 448
1475 3300009093 Ga0105240_10000019 Ga0105240_10000019385 448
1476 3300009148 Ga0105243_10024978 Ga0105243_100249783 448
1477 3300009545 Ga0105237_10002159 Ga0105237_1000215919 448
1478 3300010375 Ga0105239_10002299 Ga0105239_1000229919 448
1479 3300013104 Ga0157370_10000131 Ga0157370_100001319 448
1480 3300013105 Ga0157369_10101511 Ga0157369_101015112 448
1481 3300014325 Ga0163163_10092729 Ga0163163_100927293 448
1482 3300014497 Ga0182008_10037101 Ga0182008_100371012 448
1483 3300014969 Ga0157376_10137365 Ga0157376_101373653 448
1484 3300025206 Ga0209435_100005 Ga0209435_100005350 448
1485 3300025233 Ga0209437_100058 Ga0209437_100058232 448
1486 3300025233 Ga0209437_100060 Ga0209437_10006035 448
1487 3300025246 Ga0209646_1000011 Ga0209646_1000011350 448
1488 3300025246 Ga0209646_1007185 Ga0209646_10071851 448
1489 3300025250 Ga0209026_1000005 Ga0209026_1000005489 448
1490 3300025250 Ga0209026_1000008 Ga0209026_1000008350 448
1491 3300025250 Ga0209026_1002172 Ga0209026_10021725 448
1492 3300025256 Ga0209759_1000004 Ga0209759_1000004350 448
1493 3300025256 Ga0209759_1000265 Ga0209759_100026562 448
1494 3300025261 Ga0209233_1000240 Ga0209233_100024048 448
1495 3300025261 Ga0209233_1000275 Ga0209233_100027540 448
1496 3300025261 Ga0209233_1000814 Ga0209233_10008149 448
1497 3300025913 Ga0207695_10000049 Ga0207695_10000049388 448
1498 3300025913 Ga0207695_10198549 Ga0207695_101985492 448
1499 3300025914 Ga0207671_10001771 Ga0207671_1000177119 448
1500 3300025925 Ga0207650_10000295 Ga0207650_1000029520 448
1501 3300025935 Ga0207709_10019621 Ga0207709_100196214 448
1502 3300025941 Ga0207711_10149314 Ga0207711_101493142 448
1503 3300025981 Ga0207640_10107267 Ga0207640_101072672 448
1504 3300026078 Ga0207702_10006542 Ga0207702_100065429 448
1505 3300026078 Ga0207702_10170448 Ga0207702_101704482 448
1506 3300026088 Ga0207641_10115717 Ga0207641_101157172 448
1507 3300027312 Ga0209371_1003295 Ga0209371_10032954 448
1508 3300028379 Ga0268266_10104048 Ga0268266_101040482 448
1509 3300030500 Ga0268256_1002990 Ga0268256_10029906 448
1510 3300031251 Ga0265327_10002922 Ga0265327_1000292211 448
1511 3300037418 Ga0395900_0130163 Ga0395900_0130163_976_2322 448
1512 3300044765 Ga0466970_0010203 Ga0466970_0010203_1146_2492 448
1513 3300047472 Ga0495686_0004287 Ga0495686_0004287_3273_4619 448
1514 3300047472 Ga0495686_0014472 Ga0495686_0014472_68_1414 448
1515 3300048915 Ga0496112_0105054 Ga0496112_0105054_686_2041 448
1516 3300048919 Ga0496116_0002293 Ga0496116_0002293_7163_8509 448
1517 3300048920 Ga0496117_0001162 Ga0496117_0001162_7498_8844 448
1518 3300048921 Ga0496118_0000729 Ga0496118_0000729_44278_45624 448
1519 3300048921 Ga0496118_0038443 Ga0496118_0038443_1268_2647 448
1520 3300048921 Ga0496118_0093332 Ga0496118_0093332_657_2012 448
1521 3300048922 Ga0496119_0002625 Ga0496119_0002625_7498_8844 448
1522 3300048923 Ga0496120_0003787 Ga0496120_0003787_4825_6171 448
1523 3300048924 Ga0496121_0000570 Ga0496121_0000570_47478_48824 448
1524 3300048925 Ga0496122_0006539 Ga0496122_0006539_7495_8841 448
1525 3300048925 Ga0496122_0084221 Ga0496122_0084221_35_1429 448
1526 3300048926 Ga0496123_0005027 Ga0496123_0005027_7609_8955 448
1527 3300048927 Ga0496124_0021308 Ga0496124_0021308_141_1487 448
1528 3300048929 Ga0496126_0039056 Ga0496126_0039056_1248_2594 448
1529 3300050489 nmdc:mga03683_718_c1 nmdc:mga03683_718_c1_1285_2631 448
1530 3300050516 nmdc:mga0sz30_8616_c1 nmdc:mga0sz30_8616_c1_402_1748 448
1531 3300053119 Ga0500595_011111 Ga0500595_011111_149_1498 448
1532 3300053153 Ga0500616_0009600 Ga0500616_0009600_1716_3077 448

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

11

376

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tlc-assembly1.cif.gz_A crystal structure of bdsa from bacillus subtilis wu-s2b 0.9414 6 432
5tlc-assembly1.cif.gz_D crystal structure of bdsa from bacillus subtilis wu-s2b 0.9411 6 432
5tlc-assembly1.cif.gz_B crystal structure of bdsa from bacillus subtilis wu-s2b 0.9363 6 432
5xkd-assembly1.cif.gz_B crystal structure of dibenzothiophene sulfone monooxygenase bdsa in complex with fmn at 2.4 angstrom 0.9342 5 436
5tlc-assembly1.cif.gz_D crystal structure of bdsa from bacillus subtilis wu-s2b 0.934 6 432
ID Description Score Start End Superfamily
5tlcD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9411 6 432 3.20.20.30
5tlcB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9363 6 432 3.20.20.30
5tlcD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.934 6 432 3.20.20.30
3sdoB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9339 4 440 3.20.20.30
3sdoB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9316 4 440 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A5J6N0G9-F1-model_v4 Nrd protein 0.984 2 441 GO:0004497
GO:0016705
AF-A0A529XC09-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9835 80 225 GO:0016705
AF-A0A810Y8Z0-F1-model_v4 deleted 0.9825 13 442
AF-A0A810Y8Z0-F1-model_v4 deleted 0.9802 13 442
AF-A0A3S1H9R1-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9789 1 283 GO:0004497
GO:0016705

Feature Viewer

pLDDT pTM Quality
90.99 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map