F494609
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1532 | 936 | 1044 | 442 |
Family's Representative Sequence
| Representative Sequence | 3300025728|Ga0207655_1001748|Ga0207655_100174812 |
| Length | 428 |
| Sequence | MSTTARQMKLGAFLMATGHHVAAWRHPDVPAGAGLDFKHYRHVARVAEAAKFDALFVADSVAAATGDIASRMARSDHFEPLTLLSALSSVTEHIGLIATATTTYNEPYHVARKFASLDHLSGGRAGWNLVTSDAAAEAQNFGRREFHQVVTGLWDSWADNAFTRDKASGEYYNPARLHVLDHQGEHFSVKGPLNVARSPQGQPVVVQAGSSEVGRDLAAQTAEVVFTAQTSLAGAQAFYADIKGRLSAYGRDVDSLKIMPGVFIVVAETEALAKAKFESFQALVEPQVGVALLGRMLGNFDLSGYPLDGPLPELPLTDSGQRSRQKLLTELADQENLTLAQLGRRIAGGRGHYSLIGTPEQIADELQRWFEQGSADGFNVLVPHLPGGLEDVAQLLVPELQRRGLFRTEYEGTTLRENLGLQRPAYRF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 2 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 3 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 4 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 5 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 6 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 7 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 8 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 9 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 10 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 11 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 12 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 13 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 14 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 15 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 16 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 17 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 18 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 19 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 20 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 21 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 22 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 23 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 24 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 25 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 26 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 27 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 28 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 29 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 30 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 31 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 32 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 33 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 34 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 35 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 36 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 37 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 38 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 39 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 40 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 41 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 42 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 43 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 44 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 45 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 46 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 47 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 48 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 49 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 50 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 51 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 52 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 53 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 54 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 55 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 56 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 57 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 58 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 59 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 60 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 61 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 62 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 63 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 64 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 65 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 66 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 67 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 68 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 69 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 70 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 71 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 72 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 73 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 74 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 75 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 76 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 77 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 78 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 79 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 80 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 81 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 82 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 83 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 84 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 85 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 86 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 87 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 88 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 89 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 90 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 91 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 92 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 93 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 94 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 95 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 96 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 97 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 98 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 99 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 100 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 101 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 102 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 103 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 104 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 105 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 106 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 107 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 108 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 109 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 110 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 111 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 112 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 113 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 114 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 115 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 116 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 117 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 118 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 119 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 120 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 121 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 122 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 123 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 124 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 125 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 126 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 127 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 128 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 129 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 130 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 131 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 132 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 133 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 134 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 135 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 136 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 137 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 138 | 2791355199 | |||
| 139 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 140 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 141 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 142 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 143 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 144 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 145 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 146 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 147 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 148 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 149 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 150 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 151 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 152 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 153 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 154 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 155 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 156 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 157 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 158 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 159 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 160 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 161 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 162 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 163 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 164 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 165 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 166 | 2831426010 | Nostoc sp. 106C | Isolate | Unclassified |
| 167 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 168 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 169 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 170 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 171 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 172 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 173 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 174 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 175 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 176 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 177 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 178 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 179 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 180 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 181 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 182 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 183 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 184 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 185 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 186 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 187 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 188 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 189 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 190 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 191 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 192 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 193 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 194 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 195 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 196 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 197 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 198 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 199 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 200 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 201 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 202 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 203 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 204 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 205 | 2849660919 | Nostoc sp. T09 | Isolate | Unclassified |
| 206 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 207 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 208 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 209 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 210 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 211 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 212 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 213 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 214 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 215 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 216 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 217 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 218 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 219 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 220 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 221 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 222 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 223 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 224 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 225 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 226 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 227 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 228 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 229 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 230 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 231 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 232 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 233 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 234 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 235 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 236 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 237 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 238 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 239 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 240 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 241 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 242 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 243 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 244 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 245 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 246 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 247 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 248 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 249 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 250 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 251 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 252 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 253 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 254 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 255 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 256 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 257 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 258 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 259 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 260 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 261 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 262 | 2886627955 | Nostoc sp. PA-18-2419 JC1668 | Isolate | Unclassified |
| 263 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 264 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 265 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 266 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 267 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 268 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 269 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 270 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 271 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 272 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 273 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 274 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 275 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 276 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 277 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 278 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 279 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 280 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 281 | 2904699407 | |||
| 282 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 283 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 284 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 285 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 286 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 287 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 288 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 289 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 290 | 2906610324 | |||
| 291 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 292 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 293 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 294 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 295 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 296 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 297 | 2913844669 | Nostocales cyanobacterium LEGE 12452 | Isolate | Unclassified |
| 298 | 2913939268 | Nostoc sp. LEGE 12447 | Isolate | Unclassified |
| 299 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 300 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 301 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 302 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 303 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 304 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 305 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 306 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 307 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 308 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 309 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 310 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 311 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 312 | 2922425934 | |||
| 313 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 314 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 315 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 316 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 317 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 318 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 319 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 320 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 321 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 322 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 323 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 324 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 325 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 326 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 327 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 328 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 329 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 330 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 331 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 332 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 333 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 334 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 335 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 336 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 337 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 338 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 339 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 340 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 341 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 342 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 343 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 344 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 345 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 346 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 347 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 348 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 349 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 350 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 351 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 352 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 353 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 354 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 355 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 356 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 357 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 358 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 359 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 360 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 361 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 362 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 363 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 364 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 365 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 366 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 367 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 368 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 369 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 370 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 371 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 372 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 373 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 374 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 375 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 376 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 377 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 378 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 379 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 380 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 381 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 382 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 383 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 384 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 385 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 386 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 387 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 388 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 389 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 390 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 391 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 392 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 393 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 394 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 395 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 396 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 397 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 398 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 399 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 400 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 401 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 402 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 403 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 404 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 405 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 406 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 407 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 408 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 409 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 410 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 411 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 412 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 413 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 414 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 415 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 416 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 417 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 418 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 419 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 420 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 421 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 422 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 423 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 424 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 425 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 426 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 427 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 428 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 429 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 430 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 431 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 432 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 433 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 434 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 435 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 436 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 437 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 438 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 439 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 440 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 441 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 442 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 443 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 444 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 445 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 446 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 447 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 448 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 449 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 450 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 451 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 452 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 453 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 454 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 455 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 456 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 457 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 458 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 459 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 460 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 461 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 462 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 463 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 464 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 465 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 466 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 467 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 468 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 469 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 470 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 471 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 472 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 473 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 474 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 475 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 476 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 477 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 478 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 479 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 480 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 481 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 482 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 483 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 484 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 485 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 486 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 487 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 488 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 489 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 490 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 491 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 492 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 493 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 494 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 495 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 496 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 497 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 498 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 499 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 500 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 501 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 502 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 503 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 504 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 505 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 506 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 507 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 508 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 509 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 510 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 511 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 512 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 513 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 514 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 515 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 516 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 517 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 518 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 519 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 520 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 521 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 522 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 523 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 524 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 525 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 526 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 527 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 528 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 529 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 530 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 531 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 532 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 533 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 534 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 535 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 536 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 537 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 538 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 539 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 540 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 541 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 542 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 543 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 544 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 545 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 546 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 547 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 548 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 549 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 550 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 551 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 552 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 553 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 554 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 555 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 556 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 557 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 558 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 559 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 560 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 561 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 562 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 563 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 564 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 565 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 566 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 567 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 568 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 569 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 570 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 571 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 572 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 573 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 574 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 575 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 576 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 577 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 578 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 579 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 580 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 581 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 582 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 583 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 584 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 585 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 586 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 587 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 588 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 589 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 590 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 591 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 592 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 593 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 594 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 595 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 596 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 597 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 598 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 599 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 600 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 601 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 602 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 603 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 604 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 605 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 606 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 607 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 608 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 609 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 610 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 611 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 612 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 613 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 614 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 615 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 616 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 617 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 618 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 619 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 620 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 621 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 622 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 623 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 624 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 625 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 626 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 627 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 628 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 629 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 630 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 631 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 632 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 633 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 634 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 635 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 636 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 637 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 638 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 639 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 640 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 641 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 642 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 643 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 644 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 645 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 646 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 647 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 648 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 649 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 650 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 651 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 652 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 653 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 654 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 655 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 656 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 657 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 658 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 659 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 660 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 661 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 662 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 663 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 664 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 665 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 666 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 667 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 668 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 669 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 670 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 671 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 672 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 673 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 674 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 675 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 676 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 677 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 678 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 679 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 680 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 681 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 682 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 683 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 684 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 685 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 686 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 687 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 688 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 689 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 690 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 691 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 692 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 693 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 694 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 695 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 696 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 697 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 698 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 699 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 700 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 701 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 702 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 703 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 704 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 705 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 706 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 707 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 708 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 709 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 710 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 711 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 712 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 713 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 714 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 715 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 716 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 717 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 718 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 719 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 720 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 721 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 722 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 723 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 724 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 725 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 726 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 727 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 728 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 729 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 730 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 731 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 732 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 733 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 734 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 735 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 736 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 737 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 738 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 739 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 740 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 741 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 742 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 743 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 744 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 745 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 746 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 747 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 748 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 749 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 750 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 751 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 752 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 753 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 754 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 755 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 756 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 757 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 758 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 759 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 760 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 761 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 762 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 763 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 764 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 765 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 766 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 767 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 768 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 769 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 770 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 771 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 772 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 773 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 774 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 775 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 776 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 777 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 778 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 779 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 780 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 781 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 782 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 783 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 784 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 785 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 786 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 787 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 788 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 789 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 790 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 791 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 792 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 793 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 794 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 795 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 796 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 797 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 798 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 799 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 800 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 801 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 802 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 803 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 804 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 805 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 806 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 807 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 808 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 809 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 810 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 811 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 812 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 813 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 814 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 815 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 816 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 817 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 818 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 819 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 820 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 821 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 822 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 823 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 824 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 825 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 826 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 827 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 828 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 829 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 830 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 831 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 832 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 833 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 834 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 835 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 836 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 837 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 838 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 839 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 840 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 841 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 842 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 843 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 844 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 845 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 846 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 847 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 848 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 849 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 850 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 851 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 852 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 853 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 854 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 855 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 856 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 857 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 858 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 859 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 860 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 861 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 862 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 863 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 864 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 865 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 866 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 867 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 868 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 869 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 870 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 871 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 872 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 873 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 874 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 875 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 876 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 877 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 878 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 879 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 880 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 881 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 882 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 883 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 884 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 885 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 886 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 887 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 888 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 889 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 890 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 891 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 892 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 893 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 894 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 895 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 896 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 897 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 898 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 899 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 900 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 901 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 902 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 903 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 904 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 905 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 906 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 907 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 908 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 909 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 910 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 911 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 912 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 913 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 914 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 915 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 916 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 917 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 918 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 919 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 920 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 921 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 922 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 923 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 924 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 925 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 926 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 927 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 928 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 929 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 930 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 931 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 932 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 933 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
| 934 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
| 935 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 936 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 68.39 |
| Metatranscriptomes | 0 |
| Isolates | 31.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.26 |
| Bulb | 0 |
| Endosphere | 11.81 |
| Nodule | 16.91 |
| Rhizoplane | 4.83 |
| Rhizosphere | 49.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000007 | 3300002704 | Bacteria | 238857 |
| 2 | JGI25156J39149_1000050 | 3300002705 | Bacteria | 89634 |
| 3 | JGI25156J39149_1000295 | 3300002705 | Bacteria | 33633 |
| 4 | JGI25162J39368_1000908 | 3300002737 | Bacteria | 19122 |
| 5 | JGI25154J39366_1000035 | 3300002738 | Bacteria | 172224 |
| 6 | JGI25157J39369_1000036 | 3300002741 | Bacteria | 133671 |
| 7 | JGI25152J39213_1001356 | 3300002773 | Bacteria | 10707 |
| 8 | JGI25150J39212_1002705 | 3300002774 | Bacteria | 4319 |
| 9 | JGI25159J45721_1004063 | 3300002987 | Bacteria | 4966 |
| 10 | JGI25151J46595_10000613 | 3300003187 | Bacteria | 31227 |
| 11 | JGI25151J46595_10003952 | 3300003187 | Bacteria | 7995 |
| 12 | JGI25151J46595_10039711 | 3300003187 | Bacteria | 1734 |
| 13 | JGI25406J46586_10000006 | 3300003203 | Bacteria | 114937 |
| 14 | JGI25406J46586_10002914 | 3300003203 | Bacteria | 8066 |
| 15 | JGI25165J46597_1000375 | 3300003214 | Bacteria | 49445 |
| 16 | JGI25165J46597_1002256 | 3300003214 | Bacteria | 6664 |
| 17 | JGI25165J46597_1003958 | 3300003214 | Bacteria | 3396 |
| 18 | JGI25153J46596_10005791 | 3300003215 | Bacteria | 6427 |
| 19 | JGI25153J46596_10042717 | 3300003215 | Bacteria | 1381 |
| 20 | JGI25160J50197_1002431 | 3300003354 | Bacteria | 8678 |
| 21 | JGI25160J50197_1007040 | 3300003354 | Bacteria | 4454 |
| 22 | JGI25160J50197_1015074 | 3300003354 | Bacteria | 2554 |
| 23 | JGI25161J50226_1001494 | 3300003374 | Bacteria | 6959 |
| 24 | Ga0055539_1000102 | 3300003752 | Bacteria | 98557 |
| 25 | Ga0055533_1000110 | 3300003756 | Bacteria | 98557 |
| 26 | Ga0055532_1000138 | 3300003758 | Bacteria | 71966 |
| 27 | Ga0055532_1000254 | 3300003758 | Bacteria | 36666 |
| 28 | Ga0055525_1000187 | 3300003759 | Bacteria | 75518 |
| 29 | Ga0055535_1002320 | 3300003761 | Bacteria | 6920 |
| 30 | Ga0055535_1002951 | 3300003761 | Bacteria | 5259 |
| 31 | Ga0055542_1000021 | 3300003762 | Bacteria | 331499 |
| 32 | Ga0055542_1000463 | 3300003762 | Bacteria | 38338 |
| 33 | Ga0055526_1003161 | 3300003771 | Bacteria | 10671 |
| 34 | Ga0055537_1000827 | 3300003773 | Bacteria | 15208 |
| 35 | Ga0055524_1002061 | 3300003775 | Bacteria | 10671 |
| 36 | Ga0055524_1009264 | 3300003775 | Bacteria | 4025 |
| 37 | Ga0055536_1000093 | 3300003781 | Bacteria | 77156 |
| 38 | Ga0055536_1000216 | 3300003781 | Bacteria | 47208 |
| 39 | Ga0055534_1002463 | 3300003784 | Bacteria | 6391 |
| 40 | Ga0055528_1001194 | 3300003790 | Bacteria | 16759 |
| 41 | Ga0055528_1001347 | 3300003790 | Bacteria | 15208 |
| 42 | Ga0055528_1007556 | 3300003790 | Bacteria | 4791 |
| 43 | Ga0055530_10000034 | 3300003791 | Bacteria | 118012 |
| 44 | Ga0055530_10002982 | 3300003791 | Bacteria | 10179 |
| 45 | Ga0055540_1000064 | 3300003792 | Bacteria | 127318 |
| 46 | Ga0055540_1000429 | 3300003792 | Bacteria | 33431 |
| 47 | Ga0055531_10000039 | 3300003794 | Bacteria | 141103 |
| 48 | Ga0055541_1000068 | 3300003841 | Bacteria | 98557 |
| 49 | Ga0058692_1002826 | 3300003856 | Bacteria | 5691 |
| 50 | Ga0055543_1000909 | 3300004625 | Bacteria | 13859 |
| 51 | Ga0065165_1000393 | 3300005262 | Bacteria | 71081 |
| 52 | Ga0065165_1005554 | 3300005262 | Bacteria | 7018 |
| 53 | Ga0065714_10011017 | 3300005288 | Bacteria | 3091 |
| 54 | Ga0065704_10081044 | 3300005289 | Bacteria | 3807 |
| 55 | Ga0065712_10000260 | 3300005290 | Bacteria | 16444 |
| 56 | Ga0070658_10197786 | 3300005327 | Bacteria | 1695 |
| 57 | Ga0070658_10198021 | 3300005327 | Bacteria | 1694 |
| 58 | Ga0070683_100056257 | 3300005329 | Bacteria | 3653 |
| 59 | Ga0070683_100071169 | 3300005329 | Bacteria | 3245 |
| 60 | Ga0070670_100000359 | 3300005331 | Bacteria | 38101 |
| 61 | Ga0070680_100074218 | 3300005336 | Bacteria | 2799 |
| 62 | Ga0070682_100077440 | 3300005337 | Bacteria | 2143 |
| 63 | Ga0070668_100000734 | 3300005347 | Bacteria | 22404 |
| 64 | Ga0070668_100006327 | 3300005347 | Bacteria | 8769 |
| 65 | Ga0070668_100019325 | 3300005347 | Bacteria | 5127 |
| 66 | Ga0070668_100048293 | 3300005347 | Bacteria | 3273 |
| 67 | Ga0070668_100093749 | 3300005347 | Bacteria | 2370 |
| 68 | Ga0070669_100003483 | 3300005353 | Bacteria | 11344 |
| 69 | Ga0070669_100032753 | 3300005353 | Bacteria | 3755 |
| 70 | Ga0070669_100120838 | 3300005353 | Bacteria | 1998 |
| 71 | Ga0070674_100144345 | 3300005356 | Bacteria | 1790 |
| 72 | Ga0070667_100001509 | 3300005367 | Bacteria | 20831 |
| 73 | Ga0070667_100003665 | 3300005367 | Bacteria | 13078 |
| 74 | Ga0070709_10004497 | 3300005434 | Bacteria | 7524 |
| 75 | Ga0070709_10026694 | 3300005434 | Bacteria | 3426 |
| 76 | Ga0070714_100004196 | 3300005435 | Bacteria | 10848 |
| 77 | Ga0070714_100091486 | 3300005435 | Bacteria | 2666 |
| 78 | Ga0070713_100009387 | 3300005436 | Bacteria | 6999 |
| 79 | Ga0070713_100067291 | 3300005436 | Bacteria | 3016 |
| 80 | Ga0070713_100086405 | 3300005436 | Bacteria | 2689 |
| 81 | Ga0070713_100091636 | 3300005436 | Bacteria | 2615 |
| 82 | Ga0070713_100117112 | 3300005436 | Bacteria | 2331 |
| 83 | Ga0070710_10004116 | 3300005437 | Bacteria | 6901 |
| 84 | Ga0070711_100004725 | 3300005439 | Bacteria | 8066 |
| 85 | Ga0070711_100055615 | 3300005439 | Bacteria | 2734 |
| 86 | Ga0070711_100064628 | 3300005439 | Bacteria | 2557 |
| 87 | Ga0070678_100016493 | 3300005456 | Bacteria | 4729 |
| 88 | Ga0070681_10044250 | 3300005458 | Bacteria | 4455 |
| 89 | Ga0070706_100170110 | 3300005467 | Bacteria | 2034 |
| 90 | Ga0070698_100000351 | 3300005471 | Bacteria | 47558 |
| 91 | Ga0070679_100016753 | 3300005530 | Bacteria | 7082 |
| 92 | Ga0070684_100158321 | 3300005535 | Bacteria | 2054 |
| 93 | Ga0070697_100047675 | 3300005536 | Bacteria | 3473 |
| 94 | Ga0070697_100052582 | 3300005536 | Bacteria | 3310 |
| 95 | Ga0068853_100055368 | 3300005539 | Bacteria | 3418 |
| 96 | Ga0068853_100061917 | 3300005539 | Bacteria | 3237 |
| 97 | Ga0068853_100118484 | 3300005539 | Bacteria | 2359 |
| 98 | Ga0070665_100001296 | 3300005548 | Bacteria | 29934 |
| 99 | Ga0070665_100011759 | 3300005548 | Bacteria | 8837 |
| 100 | Ga0070665_100023461 | 3300005548 | Bacteria | 6212 |
| 101 | Ga0070665_100056340 | 3300005548 | Bacteria | 3941 |
| 102 | Ga0068855_100048315 | 3300005563 | Bacteria | 5023 |
| 103 | Ga0070664_100041024 | 3300005564 | Bacteria | 3904 |
| 104 | Ga0068854_100044261 | 3300005578 | Bacteria | 3159 |
| 105 | Ga0068856_100000427 | 3300005614 | Bacteria | 46259 |
| 106 | Ga0068856_100124864 | 3300005614 | Bacteria | 2577 |
| 107 | Ga0068856_100145970 | 3300005614 | Bacteria | 2374 |
| 108 | Ga0068852_100215524 | 3300005616 | Bacteria | 1824 |
| 109 | Ga0068859_100002889 | 3300005617 | Bacteria | 17455 |
| 110 | Ga0068859_100197269 | 3300005617 | Bacteria | 2097 |
| 111 | Ga0068851_10029404 | 3300005834 | Bacteria | 2720 |
| 112 | Ga0068851_10035695 | 3300005834 | Bacteria | 2487 |
| 113 | Ga0068863_100245583 | 3300005841 | Bacteria | 1728 |
| 114 | Ga0068860_100000265 | 3300005843 | Bacteria | 76672 |
| 115 | Ga0068860_100294113 | 3300005843 | Bacteria | 1590 |
| 116 | Ga0068862_100070026 | 3300005844 | Bacteria | 3028 |
| 117 | Ga0068862_100258304 | 3300005844 | Bacteria | 1589 |
| 118 | Ga0081455_10000058 | 3300005937 | Bacteria | 119171 |
| 119 | Ga0081455_10000366 | 3300005937 | Bacteria | 59625 |
| 120 | Ga0081455_10000764 | 3300005937 | Bacteria | 41761 |
| 121 | Ga0081455_10001795 | 3300005937 | Bacteria | 25921 |
| 122 | Ga0081538_10005836 | 3300005981 | Bacteria | 10970 |
| 123 | Ga0081538_10026519 | 3300005981 | Bacteria | 4049 |
| 124 | Ga0081540_1000040 | 3300005983 | Bacteria | 136968 |
| 125 | Ga0081540_1000916 | 3300005983 | Bacteria | 26580 |
| 126 | Ga0081540_1001739 | 3300005983 | Bacteria | 18329 |
| 127 | Ga0081540_1002782 | 3300005983 | Bacteria | 14184 |
| 128 | Ga0081540_1013100 | 3300005983 | Bacteria | 5415 |
| 129 | Ga0081540_1021438 | 3300005983 | Bacteria | 3846 |
| 130 | Ga0081540_1049839 | 3300005983 | Bacteria | 2085 |
| 131 | Ga0081539_10000176 | 3300005985 | Bacteria | 150292 |
| 132 | Ga0081539_10000231 | 3300005985 | Bacteria | 131197 |
| 133 | Ga0081539_10009227 | 3300005985 | Bacteria | 8305 |
| 134 | Ga0081539_10062309 | 3300005985 | Bacteria | 2039 |
| 135 | Ga0070717_10076107 | 3300006028 | Bacteria | 2808 |
| 136 | Ga0075365_10002455 | 3300006038 | Bacteria | 9101 |
| 137 | Ga0075365_10002499 | 3300006038 | Bacteria | 9051 |
| 138 | Ga0075365_10025473 | 3300006038 | Bacteria | 3745 |
| 139 | Ga0075368_10002158 | 3300006042 | Bacteria | 6361 |
| 140 | Ga0075363_100002264 | 3300006048 | Bacteria | 7796 |
| 141 | Ga0070716_100005587 | 3300006173 | Bacteria | 6104 |
| 142 | Ga0070716_100078614 | 3300006173 | Bacteria | 1962 |
| 143 | Ga0070712_100028636 | 3300006175 | Bacteria | 3728 |
| 144 | Ga0070712_100066082 | 3300006175 | Bacteria | 2569 |
| 145 | Ga0075367_10026312 | 3300006178 | Bacteria | 3299 |
| 146 | Ga0075366_10008450 | 3300006195 | Bacteria | 5727 |
| 147 | Ga0075370_10098471 | 3300006353 | Bacteria | 1691 |
| 148 | Ga0068871_100219901 | 3300006358 | Bacteria | 1645 |
| 149 | Ga0075430_100155975 | 3300006846 | Bacteria | 1901 |
| 150 | Ga0075431_100001187 | 3300006847 | Bacteria | 23494 |
| 151 | Ga0075433_10001198 | 3300006852 | Bacteria | 18880 |
| 152 | Ga0075433_10212747 | 3300006852 | Bacteria | 1718 |
| 153 | Ga0075434_100005705 | 3300006871 | Bacteria | 11367 |
| 154 | Ga0097620_100002889 | 3300006931 | Bacteria | 17455 |
| 155 | Ga0097620_100197255 | 3300006931 | Bacteria | 2097 |
| 156 | Ga0099824_1006719 | 3300006942 | Bacteria | 15641 |
| 157 | Ga0099822_1001392 | 3300006943 | Bacteria | 27954 |
| 158 | Ga0099826_10007333 | 3300006948 | Bacteria | 8130 |
| 159 | Ga0075435_100096255 | 3300007076 | Bacteria | 2449 |
| 160 | Ga0099794_10048101 | 3300007265 | Bacteria | 2046 |
| 161 | Ga0105251_10000274 | 3300009011 | Bacteria | 51694 |
| 162 | Ga0105251_10001467 | 3300009011 | Bacteria | 20259 |
| 163 | Ga0105244_10000607 | 3300009036 | Bacteria | 31826 |
| 164 | Ga0105244_10013667 | 3300009036 | Bacteria | 4731 |
| 165 | Ga0105244_10023885 | 3300009036 | Bacteria | 3344 |
| 166 | Ga0105244_10034350 | 3300009036 | Bacteria | 2670 |
| 167 | Ga0105244_10047892 | 3300009036 | Bacteria | 2190 |
| 168 | Ga0105250_10000078 | 3300009092 | Bacteria | 84506 |
| 169 | Ga0105250_10000191 | 3300009092 | Bacteria | 52429 |
| 170 | Ga0105250_10001522 | 3300009092 | Bacteria | 12502 |
| 171 | Ga0105250_10030412 | 3300009092 | Bacteria | 2171 |
| 172 | Ga0105240_10000019 | 3300009093 | Bacteria | 406211 |
| 173 | Ga0105240_10067903 | 3300009093 | Bacteria | 4418 |
| 174 | Ga0105240_10086641 | 3300009093 | Bacteria | 3836 |
| 175 | Ga0105240_10142232 | 3300009093 | Bacteria | 2867 |
| 176 | Ga0111539_10004293 | 3300009094 | Bacteria | 18644 |
| 177 | Ga0111539_10026576 | 3300009094 | Bacteria | 7077 |
| 178 | Ga0105245_10069337 | 3300009098 | Bacteria | 3197 |
| 179 | Ga0114129_10033150 | 3300009147 | Bacteria | 7299 |
| 180 | Ga0105243_10003033 | 3300009148 | Bacteria | 13848 |
| 181 | Ga0105243_10004474 | 3300009148 | Bacteria | 11050 |
| 182 | Ga0105243_10017593 | 3300009148 | Bacteria | 5406 |
| 183 | Ga0105243_10024978 | 3300009148 | Bacteria | 4562 |
| 184 | Ga0105241_10074952 | 3300009174 | Bacteria | 2636 |
| 185 | Ga0105241_10144679 | 3300009174 | Bacteria | 1939 |
| 186 | Ga0105241_10230665 | 3300009174 | Bacteria | 1560 |
| 187 | Ga0105237_10001204 | 3300009545 | Bacteria | 34612 |
| 188 | Ga0105237_10002159 | 3300009545 | Bacteria | 24750 |
| 189 | Ga0105237_10006864 | 3300009545 | Bacteria | 12549 |
| 190 | Ga0105237_10026637 | 3300009545 | Bacteria | 5908 |
| 191 | Ga0105237_10216874 | 3300009545 | Bacteria | 1913 |
| 192 | Ga0105238_10007002 | 3300009551 | Bacteria | 11276 |
| 193 | Ga0105238_10018527 | 3300009551 | Bacteria | 7085 |
| 194 | Ga0105249_10295590 | 3300009553 | Bacteria | 1622 |
| 195 | Ga0105249_10315408 | 3300009553 | Bacteria | 1573 |
| 196 | Ga0123342_1026161 | 3300009766 | Bacteria | 3421 |
| 197 | Ga0105239_10001427 | 3300010375 | Bacteria | 31882 |
| 198 | Ga0105239_10002299 | 3300010375 | Bacteria | 24398 |
| 199 | Ga0105239_10064579 | 3300010375 | Bacteria | 4018 |
| 200 | Ga0105239_10091118 | 3300010375 | Bacteria | 3364 |
| 201 | Ga0105239_10098729 | 3300010375 | Bacteria | 3228 |
| 202 | Ga0105246_10001379 | 3300011119 | Bacteria | 14334 |
| 203 | Ga0105246_10009601 | 3300011119 | Bacteria | 5963 |
| 204 | Ga0157345_1000006 | 3300012498 | Bacteria | 72396 |
| 205 | Ga0157373_10020395 | 3300013100 | Bacteria | 4818 |
| 206 | Ga0157373_10109812 | 3300013100 | Bacteria | 1939 |
| 207 | Ga0157371_10000042 | 3300013102 | Bacteria | 198938 |
| 208 | Ga0157371_10004709 | 3300013102 | Bacteria | 11792 |
| 209 | Ga0157371_10083815 | 3300013102 | Bacteria | 2257 |
| 210 | Ga0157370_10000035 | 3300013104 | Bacteria | 137103 |
| 211 | Ga0157370_10000131 | 3300013104 | Bacteria | 89805 |
| 212 | Ga0157370_10069515 | 3300013104 | Bacteria | 3325 |
| 213 | Ga0157370_10094735 | 3300013104 | Bacteria | 2801 |
| 214 | Ga0157370_10126123 | 3300013104 | Bacteria | 2389 |
| 215 | Ga0157370_10227157 | 3300013104 | Bacteria | 1728 |
| 216 | Ga0157369_10005587 | 3300013105 | Bacteria | 14604 |
| 217 | Ga0157369_10006177 | 3300013105 | Bacteria | 13901 |
| 218 | Ga0157369_10009585 | 3300013105 | Bacteria | 11074 |
| 219 | Ga0157369_10010643 | 3300013105 | Bacteria | 10470 |
| 220 | Ga0157369_10067587 | 3300013105 | Bacteria | 3841 |
| 221 | Ga0157369_10101511 | 3300013105 | Bacteria | 3066 |
| 222 | Ga0157369_10115729 | 3300013105 | Bacteria | 2847 |
| 223 | Ga0157369_10142127 | 3300013105 | Bacteria | 2539 |
| 224 | Ga0157374_10033704 | 3300013296 | Bacteria | 4674 |
| 225 | Ga0157374_10037116 | 3300013296 | Bacteria | 4470 |
| 226 | Ga0157374_10072122 | 3300013296 | Bacteria | 3257 |
| 227 | Ga0157378_10009614 | 3300013297 | Bacteria | 8418 |
| 228 | Ga0163162_10000199 | 3300013306 | Bacteria | 55532 |
| 229 | Ga0157372_10005780 | 3300013307 | Bacteria | 13176 |
| 230 | Ga0157375_10000820 | 3300013308 | Bacteria | 27191 |
| 231 | Ga0157375_10019193 | 3300013308 | Bacteria | 6212 |
| 232 | Ga0157375_10296274 | 3300013308 | Bacteria | 1781 |
| 233 | Ga0163163_10092729 | 3300014325 | Bacteria | 3036 |
| 234 | Ga0182008_10002472 | 3300014497 | Bacteria | 11564 |
| 235 | Ga0182008_10037101 | 3300014497 | Bacteria | 2439 |
| 236 | Ga0157376_10137365 | 3300014969 | Bacteria | 2189 |
| 237 | Ga0182006_1001883 | 3300015261 | Bacteria | 11976 |
| 238 | Ga0182006_1003283 | 3300015261 | Bacteria | 8358 |
| 239 | Ga0183362_10008 | 3300015683 | Bacteria | 223037 |
| 240 | Ga0163161_10000139 | 3300017792 | Bacteria | 67878 |
| 241 | Ga0163161_10006288 | 3300017792 | Bacteria | 8220 |
| 242 | Ga0163161_10038439 | 3300017792 | Bacteria | 3433 |
| 243 | Ga0213872_10007327 | 3300021361 | Bacteria | 5444 |
| 244 | Ga0213872_10023178 | 3300021361 | Bacteria | 2857 |
| 245 | Ga0213876_10038944 | 3300021384 | Bacteria | 2510 |
| 246 | Ga0213871_10000078 | 3300021441 | Bacteria | 8306 |
| 247 | Ga0209435_100005 | 3300025206 | Bacteria | 573745 |
| 248 | Ga0209435_100373 | 3300025206 | Bacteria | 10012 |
| 249 | Ga0209436_108537 | 3300025208 | Bacteria | 2031 |
| 250 | Ga0209784_100057 | 3300025224 | Bacteria | 167476 |
| 251 | Ga0209566_100073 | 3300025225 | Bacteria | 167476 |
| 252 | Ga0209674_100095 | 3300025226 | Bacteria | 167476 |
| 253 | Ga0209672_100295 | 3300025228 | Bacteria | 34529 |
| 254 | Ga0209147_100021 | 3300025229 | Bacteria | 464719 |
| 255 | Ga0209147_100092 | 3300025229 | Bacteria | 167476 |
| 256 | Ga0209563_100093 | 3300025230 | Bacteria | 167476 |
| 257 | Ga0209563_101932 | 3300025230 | Bacteria | 5007 |
| 258 | Ga0209437_100058 | 3300025233 | Bacteria | 357279 |
| 259 | Ga0209437_100060 | 3300025233 | Bacteria | 355034 |
| 260 | Ga0209258_100058 | 3300025242 | Bacteria | 331567 |
| 261 | Ga0209258_100300 | 3300025242 | Bacteria | 80484 |
| 262 | Ga0207425_1000157 | 3300025245 | Bacteria | 57625 |
| 263 | Ga0209646_1000011 | 3300025246 | Bacteria | 573745 |
| 264 | Ga0209646_1000617 | 3300025246 | Bacteria | 13677 |
| 265 | Ga0209646_1007185 | 3300025246 | Bacteria | 1830 |
| 266 | Ga0209026_1000005 | 3300025250 | Bacteria | 731387 |
| 267 | Ga0209026_1000008 | 3300025250 | Bacteria | 573745 |
| 268 | Ga0209026_1002172 | 3300025250 | Bacteria | 7614 |
| 269 | Ga0209677_100054 | 3300025253 | Bacteria | 167476 |
| 270 | Ga0209677_101475 | 3300025253 | Bacteria | 10119 |
| 271 | Ga0209148_1000057 | 3300025254 | Bacteria | 360463 |
| 272 | Ga0209148_1000071 | 3300025254 | Bacteria | 331551 |
| 273 | Ga0209759_1000004 | 3300025256 | Bacteria | 573745 |
| 274 | Ga0209759_1000082 | 3300025256 | Bacteria | 169562 |
| 275 | Ga0209759_1000265 | 3300025256 | Bacteria | 75472 |
| 276 | Ga0209759_1010198 | 3300025256 | Bacteria | 2772 |
| 277 | Ga0209129_1000483 | 3300025258 | Bacteria | 29091 |
| 278 | Ga0209129_1002306 | 3300025258 | Bacteria | 9481 |
| 279 | Ga0209233_1000240 | 3300025261 | Bacteria | 90758 |
| 280 | Ga0209233_1000275 | 3300025261 | Bacteria | 72941 |
| 281 | Ga0209233_1000814 | 3300025261 | Bacteria | 13897 |
| 282 | Ga0209233_1004380 | 3300025261 | Bacteria | 4812 |
| 283 | Ga0209565_1000038 | 3300025263 | Bacteria | 286433 |
| 284 | Ga0209455_1000205 | 3300025272 | Bacteria | 84765 |
| 285 | Ga0209455_1003651 | 3300025272 | Bacteria | 5340 |
| 286 | Ga0209673_1000362 | 3300025273 | Bacteria | 81651 |
| 287 | Ga0209673_1001694 | 3300025273 | Bacteria | 18740 |
| 288 | Ga0209673_1012725 | 3300025273 | Bacteria | 3370 |
| 289 | Ga0209130_1000061 | 3300025284 | Bacteria | 200990 |
| 290 | Ga0209130_1000664 | 3300025284 | Bacteria | 31314 |
| 291 | Ga0209130_1001275 | 3300025284 | Bacteria | 17462 |
| 292 | Ga0209675_1000102 | 3300025291 | Bacteria | 123742 |
| 293 | Ga0209675_1002094 | 3300025291 | Bacteria | 10587 |
| 294 | Ga0209676_1000025 | 3300025292 | Bacteria | 577569 |
| 295 | Ga0209676_1000032 | 3300025292 | Bacteria | 469558 |
| 296 | Ga0209676_1000404 | 3300025292 | Bacteria | 77964 |
| 297 | Ga0209676_1003421 | 3300025292 | Bacteria | 9780 |
| 298 | Ga0209025_1000056 | 3300025294 | Bacteria | 316188 |
| 299 | Ga0209025_1000486 | 3300025294 | Bacteria | 76804 |
| 300 | Ga0209025_1002869 | 3300025294 | Bacteria | 17281 |
| 301 | Ga0209025_1011019 | 3300025294 | Bacteria | 6029 |
| 302 | Ga0209025_1041756 | 3300025294 | Bacteria | 1959 |
| 303 | Ga0209564_1000542 | 3300025295 | Bacteria | 60997 |
| 304 | Ga0209564_1004853 | 3300025295 | Bacteria | 7994 |
| 305 | Ga0209758_1000044 | 3300025297 | Bacteria | 398448 |
| 306 | Ga0209758_1001732 | 3300025297 | Bacteria | 24300 |
| 307 | Ga0209758_1001986 | 3300025297 | Bacteria | 22053 |
| 308 | Ga0209758_1002282 | 3300025297 | Bacteria | 19849 |
| 309 | Ga0209758_1003333 | 3300025297 | Bacteria | 14770 |
| 310 | Ga0209758_1003786 | 3300025297 | Bacteria | 13331 |
| 311 | Ga0209758_1023382 | 3300025297 | Bacteria | 2796 |
| 312 | Ga0209050_1000025 | 3300025298 | Bacteria | 528225 |
| 313 | Ga0209050_1000099 | 3300025298 | Bacteria | 232176 |
| 314 | Ga0209256_1000020 | 3300025299 | Bacteria | 542402 |
| 315 | Ga0209256_1001947 | 3300025299 | Bacteria | 18747 |
| 316 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 317 | Ga0207426_1000451 | 3300025302 | Bacteria | 65459 |
| 318 | Ga0207426_1002786 | 3300025302 | Bacteria | 10498 |
| 319 | Ga0209051_1000026 | 3300025303 | Bacteria | 413311 |
| 320 | Ga0209051_1000039 | 3300025303 | Bacteria | 319632 |
| 321 | Ga0209051_1000047 | 3300025303 | Bacteria | 293227 |
| 322 | Ga0209051_1003798 | 3300025303 | Bacteria | 9663 |
| 323 | Ga0209051_1011280 | 3300025303 | Bacteria | 4427 |
| 324 | Ga0209257_1000034 | 3300025304 | Bacteria | 662719 |
| 325 | Ga0209257_1001689 | 3300025304 | Bacteria | 24828 |
| 326 | Ga0207656_10005610 | 3300025321 | Bacteria | 4451 |
| 327 | Ga0207696_1000071 | 3300025711 | Bacteria | 225219 |
| 328 | Ga0207696_1000078 | 3300025711 | Bacteria | 207623 |
| 329 | Ga0207696_1000212 | 3300025711 | Bacteria | 87811 |
| 330 | Ga0207696_1000961 | 3300025711 | Bacteria | 17531 |
| 331 | Ga0207696_1021437 | 3300025711 | Bacteria | 2069 |
| 332 | Ga0207655_1000014 | 3300025728 | Bacteria | 607124 |
| 333 | Ga0207655_1000441 | 3300025728 | Bacteria | 55196 |
| 334 | Ga0207655_1001362 | 3300025728 | Bacteria | 22923 |
| 335 | Ga0207655_1001748 | 3300025728 | Bacteria | 19046 |
| 336 | Ga0207655_1006386 | 3300025728 | Bacteria | 7825 |
| 337 | Ga0207655_1014596 | 3300025728 | Bacteria | 4428 |
| 338 | Ga0207713_1000010 | 3300025735 | Bacteria | 528374 |
| 339 | Ga0207713_1001597 | 3300025735 | Bacteria | 17721 |
| 340 | Ga0207713_1003526 | 3300025735 | Bacteria | 10607 |
| 341 | Ga0207713_1006493 | 3300025735 | Bacteria | 7112 |
| 342 | Ga0207713_1011892 | 3300025735 | Bacteria | 4696 |
| 343 | Ga0207713_1014554 | 3300025735 | Bacteria | 4082 |
| 344 | Ga0207692_10001246 | 3300025898 | Bacteria | 9460 |
| 345 | Ga0207699_10000763 | 3300025906 | Bacteria | 15426 |
| 346 | Ga0207699_10062447 | 3300025906 | Bacteria | 2246 |
| 347 | Ga0207645_10043988 | 3300025907 | Bacteria | 2858 |
| 348 | Ga0207705_10163338 | 3300025909 | Bacteria | 1674 |
| 349 | Ga0207684_10114167 | 3300025910 | Bacteria | 2313 |
| 350 | Ga0207654_10086047 | 3300025911 | Bacteria | 1904 |
| 351 | Ga0207707_10029007 | 3300025912 | Bacteria | 4836 |
| 352 | Ga0207707_10056027 | 3300025912 | Bacteria | 3429 |
| 353 | Ga0207707_10080667 | 3300025912 | Bacteria | 2841 |
| 354 | Ga0207695_10000049 | 3300025913 | Bacteria | 406233 |
| 355 | Ga0207695_10003498 | 3300025913 | Bacteria | 22039 |
| 356 | Ga0207695_10043878 | 3300025913 | Bacteria | 4760 |
| 357 | Ga0207695_10096753 | 3300025913 | Bacteria | 2954 |
| 358 | Ga0207695_10198549 | 3300025913 | Bacteria | 1921 |
| 359 | Ga0207671_10001771 | 3300025914 | Bacteria | 24269 |
| 360 | Ga0207671_10009517 | 3300025914 | Bacteria | 8114 |
| 361 | Ga0207671_10020040 | 3300025914 | Bacteria | 5101 |
| 362 | Ga0207671_10040867 | 3300025914 | Bacteria | 3432 |
| 363 | Ga0207671_10050623 | 3300025914 | Bacteria | 3076 |
| 364 | Ga0207671_10082481 | 3300025914 | Bacteria | 2413 |
| 365 | Ga0207693_10081334 | 3300025915 | Bacteria | 2536 |
| 366 | Ga0207663_10042162 | 3300025916 | Bacteria | 2787 |
| 367 | Ga0207663_10111722 | 3300025916 | Bacteria | 1855 |
| 368 | Ga0207663_10135336 | 3300025916 | Bacteria | 1709 |
| 369 | Ga0207660_10003538 | 3300025917 | Bacteria | 10179 |
| 370 | Ga0207660_10154060 | 3300025917 | Bacteria | 1768 |
| 371 | Ga0207657_10085467 | 3300025919 | Bacteria | 2643 |
| 372 | Ga0207652_10010392 | 3300025921 | Bacteria | 7494 |
| 373 | Ga0207652_10057070 | 3300025921 | Bacteria | 3362 |
| 374 | Ga0207681_10001048 | 3300025923 | Bacteria | 17940 |
| 375 | Ga0207681_10001413 | 3300025923 | Bacteria | 15506 |
| 376 | Ga0207681_10060130 | 3300025923 | Bacteria | 2607 |
| 377 | Ga0207694_10004900 | 3300025924 | Bacteria | 10394 |
| 378 | Ga0207694_10069419 | 3300025924 | Bacteria | 2753 |
| 379 | Ga0207650_10000295 | 3300025925 | Bacteria | 50101 |
| 380 | Ga0207650_10002333 | 3300025925 | Bacteria | 13220 |
| 381 | Ga0207700_10032960 | 3300025928 | Bacteria | 3702 |
| 382 | Ga0207700_10053019 | 3300025928 | Bacteria | 3036 |
| 383 | Ga0207700_10064987 | 3300025928 | Bacteria | 2782 |
| 384 | Ga0207664_10019001 | 3300025929 | Bacteria | 5071 |
| 385 | Ga0207664_10097018 | 3300025929 | Bacteria | 2428 |
| 386 | Ga0207644_10218694 | 3300025931 | Bacteria | 1509 |
| 387 | Ga0207706_10153171 | 3300025933 | Bacteria | 2028 |
| 388 | Ga0207709_10000040 | 3300025935 | Bacteria | 259497 |
| 389 | Ga0207709_10019621 | 3300025935 | Bacteria | 3804 |
| 390 | Ga0207665_10002269 | 3300025939 | Bacteria | 12975 |
| 391 | Ga0207665_10119013 | 3300025939 | Bacteria | 1864 |
| 392 | Ga0207711_10084540 | 3300025941 | Bacteria | 2778 |
| 393 | Ga0207711_10149314 | 3300025941 | Bacteria | 2108 |
| 394 | Ga0207689_10046690 | 3300025942 | Bacteria | 3579 |
| 395 | Ga0207661_10034196 | 3300025944 | Bacteria | 3951 |
| 396 | Ga0207667_10046644 | 3300025949 | Bacteria | 4588 |
| 397 | Ga0207667_10161664 | 3300025949 | Bacteria | 2303 |
| 398 | Ga0207712_10184219 | 3300025961 | Bacteria | 1643 |
| 399 | Ga0207668_10000033 | 3300025972 | Bacteria | 121080 |
| 400 | Ga0207668_10012379 | 3300025972 | Bacteria | 5221 |
| 401 | Ga0207668_10042899 | 3300025972 | Bacteria | 3066 |
| 402 | Ga0207640_10030435 | 3300025981 | Bacteria | 3324 |
| 403 | Ga0207640_10107267 | 3300025981 | Bacteria | 1972 |
| 404 | Ga0207640_10138929 | 3300025981 | Bacteria | 1768 |
| 405 | Ga0207658_10001268 | 3300025986 | Bacteria | 19958 |
| 406 | Ga0207658_10004077 | 3300025986 | Bacteria | 10198 |
| 407 | Ga0207703_10260727 | 3300026035 | Bacteria | 1567 |
| 408 | Ga0207639_10007940 | 3300026041 | Bacteria | 7250 |
| 409 | Ga0207639_10075984 | 3300026041 | Bacteria | 2643 |
| 410 | Ga0207639_10088242 | 3300026041 | Bacteria | 2474 |
| 411 | Ga0207702_10002818 | 3300026078 | Bacteria | 16258 |
| 412 | Ga0207702_10006542 | 3300026078 | Bacteria | 10021 |
| 413 | Ga0207702_10043495 | 3300026078 | Bacteria | 3771 |
| 414 | Ga0207702_10083796 | 3300026078 | Bacteria | 2774 |
| 415 | Ga0207702_10170448 | 3300026078 | Bacteria | 1995 |
| 416 | Ga0207641_10115717 | 3300026088 | Bacteria | 2385 |
| 417 | Ga0207674_10092290 | 3300026116 | Bacteria | 3018 |
| 418 | Ga0207683_10044288 | 3300026121 | Bacteria | 3890 |
| 419 | Ga0207683_10158234 | 3300026121 | Bacteria | 2047 |
| 420 | Ga0209389_1000068 | 3300027296 | Bacteria | 98954 |
| 421 | Ga0209371_1000003 | 3300027312 | Bacteria | 1122971 |
| 422 | Ga0209371_1003295 | 3300027312 | Bacteria | 7996 |
| 423 | Ga0209371_1004989 | 3300027312 | Bacteria | 5487 |
| 424 | Ga0209589_1000023 | 3300027357 | Bacteria | 177856 |
| 425 | Ga0209489_100032 | 3300027361 | Bacteria | 177856 |
| 426 | Ga0209489_113471 | 3300027361 | Bacteria | 6562 |
| 427 | Ga0209700_100040 | 3300027363 | Bacteria | 177856 |
| 428 | Ga0209700_100117 | 3300027363 | Bacteria | 115595 |
| 429 | Ga0209282_1013642 | 3300027666 | Bacteria | 5171 |
| 430 | Ga0207428_10039670 | 3300027907 | Bacteria | 3824 |
| 431 | Ga0268266_10004462 | 3300028379 | Bacteria | 13381 |
| 432 | Ga0268266_10007442 | 3300028379 | Bacteria | 9880 |
| 433 | Ga0268266_10014083 | 3300028379 | Bacteria | 6884 |
| 434 | Ga0268266_10034015 | 3300028379 | Bacteria | 4332 |
| 435 | Ga0268266_10056761 | 3300028379 | Bacteria | 3368 |
| 436 | Ga0268266_10104048 | 3300028379 | Bacteria | 2506 |
| 437 | Ga0268266_10166119 | 3300028379 | Bacteria | 1999 |
| 438 | Ga0268266_10192613 | 3300028379 | Bacteria | 1862 |
| 439 | Ga0268264_10000318 | 3300028381 | Bacteria | 76687 |
| 440 | Ga0265334_10012389 | 3300028573 | Bacteria | 3584 |
| 441 | Ga0265334_10017805 | 3300028573 | Bacteria | 2931 |
| 442 | Ga0265318_10006964 | 3300028577 | Bacteria | 5152 |
| 443 | Ga0307515_10082124 | 3300028794 | Bacteria | 4174 |
| 444 | Ga0268256_1000004 | 3300030500 | Bacteria | 1122967 |
| 445 | Ga0268256_1002990 | 3300030500 | Bacteria | 7996 |
| 446 | Ga0307511_10086694 | 3300030521 | Bacteria | 2155 |
| 447 | Ga0316181_1206187 | 3300030744 | Bacteria | 10221 |
| 448 | Ga0316182_1118994 | 3300030745 | Bacteria | 1556 |
| 449 | Ga0265340_10004049 | 3300031247 | Bacteria | 8231 |
| 450 | Ga0265340_10059627 | 3300031247 | Bacteria | 1830 |
| 451 | Ga0265327_10002922 | 3300031251 | Bacteria | 17100 |
| 452 | Ga0307509_10147409 | 3300031507 | Bacteria | 2276 |
| 453 | Ga0307508_10000010 | 3300031616 | Bacteria | 255747 |
| 454 | Ga0265314_10047018 | 3300031711 | Bacteria | 3040 |
| 455 | Ga0307416_100284656 | 3300032002 | Bacteria | 1632 |
| 456 | Ga0307411_10006188 | 3300032005 | Bacteria | 5960 |
| 457 | Ga0307507_10063344 | 3300033179 | Bacteria | 3424 |
| 458 | Ga0307510_10000085 | 3300033180 | Bacteria | 70352 |
| 459 | Ga0307510_10007185 | 3300033180 | Bacteria | 13262 |
| 460 | Ga0315911_1000029 | 3300033442 | Bacteria | 82350 |
| 461 | Ga0373934_0006326 | 3300035086 | Bacteria | 4390 |
| 462 | Ga0373934_0028433 | 3300035086 | Bacteria | 2179 |
| 463 | Ga0373940_0014749 | 3300035088 | Bacteria | 1911 |
| 464 | Ga0373949_0014712 | 3300035090 | Bacteria | 1744 |
| 465 | Ga0373936_0000012 | 3300035113 | Bacteria | 228915 |
| 466 | Ga0373936_0000048 | 3300035113 | Bacteria | 69508 |
| 467 | Ga0373936_0052766 | 3300035113 | Bacteria | 1648 |
| 468 | Ga0373953_0000640 | 3300035117 | Bacteria | 9722 |
| 469 | Ga0373953_0011634 | 3300035117 | Bacteria | 3095 |
| 470 | Ga0373954_0000067 | 3300035118 | Bacteria | 37060 |
| 471 | Ga0373956_0002213 | 3300035119 | Bacteria | 8017 |
| 472 | Ga0373956_0012978 | 3300035119 | Bacteria | 3462 |
| 473 | Ga0373957_0001550 | 3300035120 | Bacteria | 6266 |
| 474 | Ga0373955_0003543 | 3300035172 | Bacteria | 6870 |
| 475 | Ga0373955_0009025 | 3300035172 | Bacteria | 4656 |
| 476 | Ga0373962_0001722 | 3300035242 | Bacteria | 5202 |
| 477 | Ga0373924_0000928 | 3300035410 | Bacteria | 9241 |
| 478 | Ga0373924_0006108 | 3300035410 | Bacteria | 4301 |
| 479 | Ga0373931_0003739 | 3300035691 | Bacteria | 6883 |
| 480 | Ga0373931_0023668 | 3300035691 | Bacteria | 3103 |
| 481 | Ga0373931_0064578 | 3300035691 | Bacteria | 1982 |
| 482 | Ga0373935_0093265 | 3300035692 | Bacteria | 1974 |
| 483 | Ga0373935_0107883 | 3300035692 | Bacteria | 1844 |
| 484 | Ga0373935_0141194 | 3300035692 | Bacteria | 1627 |
| 485 | Ga0373927_0017434 | 3300035695 | Bacteria | 4725 |
| 486 | Ga0373927_0162396 | 3300035695 | Bacteria | 1464 |
| 487 | Ga0373933_0000324 | 3300035724 | Bacteria | 30843 |
| 488 | Ga0373933_0000746 | 3300035724 | Bacteria | 19870 |
| 489 | Ga0373933_0006219 | 3300035724 | Bacteria | 6496 |
| 490 | Ga0373933_0022874 | 3300035724 | Bacteria | 3564 |
| 491 | Ga0373947_0011851 | 3300035725 | Bacteria | 4997 |
| 492 | Ga0373947_0015707 | 3300035725 | Bacteria | 4349 |
| 493 | Ga0373937_0000413 | 3300036401 | Bacteria | 39908 |
| 494 | Ga0373937_0001425 | 3300036401 | Bacteria | 19991 |
| 495 | Ga0373937_0001548 | 3300036401 | Bacteria | 19310 |
| 496 | Ga0373937_0023468 | 3300036401 | Bacteria | 5554 |
| 497 | Ga0373937_0025703 | 3300036401 | Bacteria | 5318 |
| 498 | Ga0373925_0013237 | 3300037068 | Bacteria | 5970 |
| 499 | Ga0373925_0063685 | 3300037068 | Bacteria | 2775 |
| 500 | Ga0373925_0086422 | 3300037068 | Bacteria | 2392 |
| 501 | Ga0395899_0003559 | 3300037312 | Bacteria | 12330 |
| 502 | Ga0395899_0030722 | 3300037312 | Bacteria | 4039 |
| 503 | Ga0395900_0001064 | 3300037418 | Bacteria | 35026 |
| 504 | Ga0395900_0025676 | 3300037418 | Bacteria | 6031 |
| 505 | Ga0395900_0028557 | 3300037418 | Bacteria | 5716 |
| 506 | Ga0395900_0087840 | 3300037418 | Bacteria | 3195 |
| 507 | Ga0395900_0126534 | 3300037418 | Bacteria | 2621 |
| 508 | Ga0395900_0130163 | 3300037418 | Bacteria | 2579 |
| 509 | Ga0395900_0291392 | 3300037418 | Bacteria | 1621 |
| 510 | Ga0395898_0128102 | 3300037466 | Bacteria | 2432 |
| 511 | Ga0395898_0151633 | 3300037466 | Bacteria | 2217 |
| 512 | Ga0395905_0035462 | 3300037471 | Bacteria | 4684 |
| 513 | Ga0395905_0171592 | 3300037471 | Bacteria | 2037 |
| 514 | Ga0436364_0867524 | 3300037853 | Bacteria | 16925 |
| 515 | Ga0395901_0029508 | 3300038443 | Bacteria | 5648 |
| 516 | Ga0395901_0035567 | 3300038443 | Bacteria | 5147 |
| 517 | Ga0395901_0060827 | 3300038443 | Bacteria | 3930 |
| 518 | Ga0395901_0256413 | 3300038443 | Bacteria | 1821 |
| 519 | Ga0237819_02648 | 3300038705 | Bacteria | 3502 |
| 520 | Ga0436365_0871323 | 3300039437 | Bacteria | 58014 |
| 521 | Ga0436365_1607850 | 3300039437 | Bacteria | 28034 |
| 522 | Ga0436360_1295423 | 3300039438 | Bacteria | 34613 |
| 523 | Ga0436361_0144287 | 3300039447 | Bacteria | 22519 |
| 524 | Ga0436361_0183072 | 3300039447 | Bacteria | 4156 |
| 525 | Ga0436361_0256362 | 3300039447 | Bacteria | 3344 |
| 526 | Ga0436361_0294136 | 3300039447 | Bacteria | 3610 |
| 527 | Ga0436361_0488499 | 3300039447 | Bacteria | 8012 |
| 528 | Ga0436361_0983753 | 3300039447 | Bacteria | 1638 |
| 529 | Ga0436361_1199195 | 3300039447 | Bacteria | 1589 |
| 530 | Ga0436363_1134489 | 3300039450 | Bacteria | 2109 |
| 531 | Ga0436363_1329538 | 3300039450 | Bacteria | 2770 |
| 532 | Ga0439465_0020010 | 3300041413 | Bacteria | 2094 |
| 533 | Ga0451793_1407387 | 3300041452 | Bacteria | 3413 |
| 534 | Ga0451797_0747061 | 3300041453 | Bacteria | 3557 |
| 535 | Ga0451807_0031918 | 3300041486 | Bacteria | 10646 |
| 536 | Ga0439451_007601 | 3300042009 | Bacteria | 2205 |
| 537 | Ga0439463_000088 | 3300042016 | Bacteria | 21428 |
| 538 | Ga0450911_000132 | 3300042115 | Bacteria | 29769 |
| 539 | Ga0450904_001603 | 3300042139 | Bacteria | 3069 |
| 540 | Ga0466972_0000076 | 3300044658 | Bacteria | 92672 |
| 541 | Ga0466966_0014368 | 3300044684 | Bacteria | 5241 |
| 542 | Ga0466961_0000600 | 3300044693 | Bacteria | 22699 |
| 543 | Ga0466963_0066091 | 3300044694 | Bacteria | 2425 |
| 544 | Ga0466970_0010203 | 3300044765 | Bacteria | 4760 |
| 545 | Ga0466960_0006169 | 3300044901 | Bacteria | 4798 |
| 546 | Ga0466959_0000651 | 3300045049 | Bacteria | 20259 |
| 547 | Ga0466959_0003113 | 3300045049 | Bacteria | 10757 |
| 548 | Ga0466958_0050355 | 3300045836 | Bacteria | 2522 |
| 549 | Ga0495627_000962 | 3300046453 | Bacteria | 19713 |
| 550 | Ga0495627_001135 | 3300046453 | Bacteria | 17214 |
| 551 | Ga0495627_003213 | 3300046453 | Bacteria | 7353 |
| 552 | Ga0495592_0000629 | 3300046454 | Bacteria | 24609 |
| 553 | Ga0495592_0001030 | 3300046454 | Bacteria | 19355 |
| 554 | Ga0495603_0059365 | 3300046455 | Bacteria | 2261 |
| 555 | Ga0495591_001034 | 3300046458 | Bacteria | 18824 |
| 556 | Ga0495591_001961 | 3300046458 | Bacteria | 12020 |
| 557 | Ga0495591_003002 | 3300046458 | Bacteria | 8990 |
| 558 | Ga0495591_006316 | 3300046458 | Bacteria | 5265 |
| 559 | Ga0495591_025435 | 3300046458 | Bacteria | 1857 |
| 560 | Ga0495629_0000398 | 3300046459 | Bacteria | 36605 |
| 561 | Ga0495629_0000948 | 3300046459 | Bacteria | 23342 |
| 562 | Ga0495638_0000120 | 3300046460 | Bacteria | 127382 |
| 563 | Ga0495638_0000830 | 3300046460 | Bacteria | 32408 |
| 564 | Ga0495638_0007158 | 3300046460 | Bacteria | 8039 |
| 565 | Ga0495638_0010795 | 3300046460 | Bacteria | 6317 |
| 566 | Ga0495651_0000319 | 3300046462 | Bacteria | 37294 |
| 567 | Ga0495651_0004166 | 3300046462 | Bacteria | 11071 |
| 568 | Ga0495653_0000391 | 3300046463 | Bacteria | 35079 |
| 569 | Ga0495653_0000598 | 3300046463 | Bacteria | 27691 |
| 570 | Ga0495653_0002549 | 3300046463 | Bacteria | 14521 |
| 571 | Ga0495650_0020937 | 3300046471 | Bacteria | 3175 |
| 572 | Ga0495650_0059865 | 3300046471 | Bacteria | 1531 |
| 573 | Ga0495580_0007113 | 3300046472 | Bacteria | 9013 |
| 574 | Ga0495582_0094401 | 3300046473 | Bacteria | 1670 |
| 575 | Ga0495582_0116066 | 3300046473 | Bacteria | 1506 |
| 576 | Ga0495605_0000158 | 3300046474 | Bacteria | 86829 |
| 577 | Ga0495605_0000164 | 3300046474 | Bacteria | 84623 |
| 578 | Ga0495605_0000220 | 3300046474 | Bacteria | 70521 |
| 579 | Ga0495605_0009203 | 3300046474 | Bacteria | 5553 |
| 580 | Ga0495605_0043870 | 3300046474 | Bacteria | 2214 |
| 581 | Ga0495605_0061269 | 3300046474 | Bacteria | 1801 |
| 582 | Ga0495664_0000849 | 3300046477 | Bacteria | 15703 |
| 583 | Ga0495584_0057027 | 3300046491 | Bacteria | 1965 |
| 584 | Ga0495585_0033962 | 3300046492 | Bacteria | 2884 |
| 585 | Ga0495585_0054980 | 3300046492 | Bacteria | 2200 |
| 586 | Ga0495585_0104414 | 3300046492 | Bacteria | 1512 |
| 587 | Ga0495596_0011116 | 3300046500 | Bacteria | 3893 |
| 588 | Ga0495607_0000013 | 3300046501 | Bacteria | 189755 |
| 589 | Ga0495607_0000032 | 3300046501 | Bacteria | 153288 |
| 590 | Ga0495607_0000082 | 3300046501 | Bacteria | 96822 |
| 591 | Ga0495607_0002081 | 3300046501 | Bacteria | 16718 |
| 592 | Ga0495607_0003493 | 3300046501 | Bacteria | 12023 |
| 593 | Ga0495607_0007523 | 3300046501 | Bacteria | 7524 |
| 594 | Ga0495607_0053320 | 3300046501 | Bacteria | 2338 |
| 595 | Ga0495607_0077763 | 3300046501 | Bacteria | 1832 |
| 596 | Ga0495607_0084209 | 3300046501 | Bacteria | 1740 |
| 597 | Ga0495583_0000086 | 3300046506 | Bacteria | 165176 |
| 598 | Ga0495583_0000226 | 3300046506 | Bacteria | 95293 |
| 599 | Ga0495583_0009346 | 3300046506 | Bacteria | 5869 |
| 600 | Ga0495606_0000061 | 3300046507 | Bacteria | 185384 |
| 601 | Ga0495606_0003058 | 3300046507 | Bacteria | 18238 |
| 602 | Ga0495606_0004653 | 3300046507 | Bacteria | 13571 |
| 603 | Ga0495606_0005451 | 3300046507 | Bacteria | 12180 |
| 604 | Ga0495606_0088820 | 3300046507 | Bacteria | 1905 |
| 605 | Ga0495606_0117021 | 3300046507 | Bacteria | 1600 |
| 606 | Ga0495606_0133929 | 3300046507 | Eukaryota | 1470 |
| 607 | Ga0495608_0000916 | 3300046511 | Bacteria | 20676 |
| 608 | Ga0495608_0002252 | 3300046511 | Bacteria | 13923 |
| 609 | Ga0495608_0003379 | 3300046511 | Bacteria | 11423 |
| 610 | Ga0495608_0071490 | 3300046511 | Bacteria | 2263 |
| 611 | Ga0495610_0000138 | 3300046512 | Bacteria | 81842 |
| 612 | Ga0495610_0005026 | 3300046512 | Bacteria | 9562 |
| 613 | Ga0495610_0008977 | 3300046512 | Bacteria | 6391 |
| 614 | Ga0495610_0016998 | 3300046512 | Bacteria | 4163 |
| 615 | Ga0495616_0003497 | 3300046513 | Bacteria | 10047 |
| 616 | Ga0495616_0003740 | 3300046513 | Bacteria | 9705 |
| 617 | Ga0495616_0003971 | 3300046513 | Bacteria | 9413 |
| 618 | Ga0495616_0038331 | 3300046513 | Bacteria | 2461 |
| 619 | Ga0495616_0081280 | 3300046513 | Bacteria | 1550 |
| 620 | Ga0495616_0084874 | 3300046513 | Bacteria | 1509 |
| 621 | Ga0495620_0000047 | 3300046515 | Bacteria | 107032 |
| 622 | Ga0495620_0001699 | 3300046515 | Bacteria | 12996 |
| 623 | Ga0495620_0014504 | 3300046515 | Bacteria | 4004 |
| 624 | Ga0495628_0017882 | 3300046516 | Bacteria | 5884 |
| 625 | Ga0495628_0030305 | 3300046516 | Bacteria | 4381 |
| 626 | Ga0495630_0025184 | 3300046517 | Bacteria | 4398 |
| 627 | Ga0495631_0019496 | 3300046518 | Bacteria | 3179 |
| 628 | Ga0495632_0000719 | 3300046519 | Bacteria | 30093 |
| 629 | Ga0495632_0011234 | 3300046519 | Bacteria | 5238 |
| 630 | Ga0495632_0034577 | 3300046519 | Bacteria | 2585 |
| 631 | Ga0495632_0060532 | 3300046519 | Bacteria | 1839 |
| 632 | Ga0495637_0002352 | 3300046520 | Bacteria | 10476 |
| 633 | Ga0495637_0010199 | 3300046520 | Bacteria | 4553 |
| 634 | Ga0495637_0011909 | 3300046520 | Bacteria | 4168 |
| 635 | Ga0495637_0042753 | 3300046520 | Bacteria | 1937 |
| 636 | Ga0495643_0008772 | 3300046522 | Bacteria | 6370 |
| 637 | Ga0495643_0044851 | 3300046522 | Bacteria | 2401 |
| 638 | Ga0495643_0065956 | 3300046522 | Bacteria | 1910 |
| 639 | Ga0495648_0000552 | 3300046524 | Bacteria | 40192 |
| 640 | Ga0495648_0001770 | 3300046524 | Bacteria | 20832 |
| 641 | Ga0495648_0003462 | 3300046524 | Bacteria | 13885 |
| 642 | Ga0495648_0005888 | 3300046524 | Bacteria | 10079 |
| 643 | Ga0495648_0036428 | 3300046524 | Bacteria | 3175 |
| 644 | Ga0495648_0049091 | 3300046524 | Bacteria | 2591 |
| 645 | Ga0495666_0064554 | 3300046526 | Bacteria | 1747 |
| 646 | Ga0495652_0001170 | 3300046529 | Bacteria | 29592 |
| 647 | Ga0495652_0009435 | 3300046529 | Bacteria | 8863 |
| 648 | Ga0495654_0000117 | 3300046530 | Bacteria | 89307 |
| 649 | Ga0495654_0000224 | 3300046530 | Bacteria | 52709 |
| 650 | Ga0495654_0000732 | 3300046530 | Bacteria | 25488 |
| 651 | Ga0495654_0001955 | 3300046530 | Bacteria | 13613 |
| 652 | Ga0495654_0003210 | 3300046530 | Bacteria | 10121 |
| 653 | Ga0495654_0019243 | 3300046530 | Bacteria | 3572 |
| 654 | Ga0495665_0088474 | 3300046531 | Bacteria | 1628 |
| 655 | Ga0495640_0035357 | 3300046533 | Bacteria | 3536 |
| 656 | Ga0495640_0103047 | 3300046533 | Bacteria | 1872 |
| 657 | Ga0495587_0001521 | 3300046536 | Bacteria | 15413 |
| 658 | Ga0495587_0008765 | 3300046536 | Bacteria | 6488 |
| 659 | Ga0495587_0018340 | 3300046536 | Bacteria | 4340 |
| 660 | Ga0495609_0000156 | 3300046538 | Bacteria | 70241 |
| 661 | Ga0495609_0006521 | 3300046538 | Bacteria | 5945 |
| 662 | Ga0495609_0037939 | 3300046538 | Bacteria | 2173 |
| 663 | Ga0495597_0000013 | 3300046542 | Bacteria | 203829 |
| 664 | Ga0495597_0002855 | 3300046542 | Bacteria | 10559 |
| 665 | Ga0495597_0033929 | 3300046542 | Bacteria | 2308 |
| 666 | Ga0495645_0013413 | 3300046543 | Bacteria | 5792 |
| 667 | Ga0495645_0090314 | 3300046543 | Bacteria | 2189 |
| 668 | Ga0495645_0112991 | 3300046543 | Bacteria | 1920 |
| 669 | Ga0495622_0001594 | 3300046557 | Bacteria | 11206 |
| 670 | Ga0495633_0000453 | 3300046558 | Bacteria | 42087 |
| 671 | Ga0495633_0023805 | 3300046558 | Bacteria | 3031 |
| 672 | Ga0495633_0030237 | 3300046558 | Bacteria | 2632 |
| 673 | Ga0495633_0052648 | 3300046558 | Bacteria | 1917 |
| 674 | Ga0495667_0000305 | 3300046559 | Bacteria | 31224 |
| 675 | Ga0495667_0002351 | 3300046559 | Bacteria | 12645 |
| 676 | Ga0495667_0013747 | 3300046559 | Bacteria | 5467 |
| 677 | Ga0495667_0043230 | 3300046559 | Bacteria | 2986 |
| 678 | Ga0495656_0005918 | 3300046615 | Bacteria | 4255 |
| 679 | Ga0495668_0001200 | 3300046616 | Bacteria | 26319 |
| 680 | Ga0495668_0031490 | 3300046616 | Bacteria | 2989 |
| 681 | Ga0495668_0057348 | 3300046616 | Bacteria | 2149 |
| 682 | Ga0495634_0001959 | 3300046642 | Bacteria | 17575 |
| 683 | Ga0495634_0003266 | 3300046642 | Bacteria | 13085 |
| 684 | Ga0495634_0084101 | 3300046642 | Bacteria | 2075 |
| 685 | Ga0495611_0000339 | 3300046648 | Bacteria | 30358 |
| 686 | Ga0495625_0004731 | 3300046660 | Bacteria | 12748 |
| 687 | Ga0495625_0005554 | 3300046660 | Bacteria | 11447 |
| 688 | Ga0495625_0006484 | 3300046660 | Bacteria | 10402 |
| 689 | Ga0495625_0032089 | 3300046660 | Bacteria | 3900 |
| 690 | Ga0495625_0066117 | 3300046660 | Bacteria | 2547 |
| 691 | Ga0495635_0000102 | 3300046663 | Bacteria | 50623 |
| 692 | Ga0495635_0003651 | 3300046663 | Bacteria | 10674 |
| 693 | Ga0495635_0069033 | 3300046663 | Bacteria | 2423 |
| 694 | Ga0495661_0000007 | 3300046665 | Bacteria | 411832 |
| 695 | Ga0495661_0000154 | 3300046665 | Bacteria | 80795 |
| 696 | Ga0495661_0000172 | 3300046665 | Bacteria | 74827 |
| 697 | Ga0495661_0011508 | 3300046665 | Bacteria | 6002 |
| 698 | Ga0495661_0012271 | 3300046665 | Bacteria | 5787 |
| 699 | Ga0495661_0036529 | 3300046665 | Bacteria | 3076 |
| 700 | Ga0495588_0012716 | 3300046674 | Bacteria | 3987 |
| 701 | Ga0495657_0000677 | 3300046675 | Bacteria | 30671 |
| 702 | Ga0495657_0011228 | 3300046675 | Bacteria | 6710 |
| 703 | Ga0495599_0001494 | 3300046678 | Bacteria | 13444 |
| 704 | Ga0495599_0001882 | 3300046678 | Bacteria | 12160 |
| 705 | Ga0495599_0021326 | 3300046678 | Bacteria | 4041 |
| 706 | Ga0495623_0005677 | 3300046679 | Bacteria | 8147 |
| 707 | Ga0495646_0005928 | 3300046680 | Bacteria | 7744 |
| 708 | Ga0495646_0007052 | 3300046680 | Bacteria | 7139 |
| 709 | Ga0495646_0067017 | 3300046680 | Bacteria | 2123 |
| 710 | Ga0495647_0026488 | 3300046681 | Bacteria | 2125 |
| 711 | Ga0495613_0046524 | 3300046689 | Bacteria | 3208 |
| 712 | Ga0495613_0183622 | 3300046689 | Bacteria | 1480 |
| 713 | Ga0495624_0002316 | 3300046690 | Bacteria | 14498 |
| 714 | Ga0495624_0053891 | 3300046690 | Bacteria | 2538 |
| 715 | Ga0495670_0002847 | 3300046691 | Bacteria | 8553 |
| 716 | Ga0495670_0009646 | 3300046691 | Bacteria | 4744 |
| 717 | Ga0495671_0029777 | 3300046692 | Bacteria | 2800 |
| 718 | Ga0495671_0086739 | 3300046692 | Bacteria | 1533 |
| 719 | Ga0495649_0000685 | 3300046694 | Bacteria | 27597 |
| 720 | Ga0495649_0008434 | 3300046694 | Bacteria | 6202 |
| 721 | Ga0495649_0021189 | 3300046694 | Bacteria | 3642 |
| 722 | Ga0495649_0048237 | 3300046694 | Bacteria | 2314 |
| 723 | Ga0495649_0066095 | 3300046694 | Bacteria | 1940 |
| 724 | Ga0495649_0069243 | 3300046694 | Bacteria | 1893 |
| 725 | Ga0495589_0010970 | 3300046794 | Bacteria | 4704 |
| 726 | Ga0495589_0015004 | 3300046794 | Bacteria | 3986 |
| 727 | Ga0495589_0053544 | 3300046794 | Bacteria | 1991 |
| 728 | Ga0495589_0054925 | 3300046794 | Bacteria | 1963 |
| 729 | Ga0495660_0000333 | 3300046810 | Bacteria | 41657 |
| 730 | Ga0495660_0003395 | 3300046810 | Bacteria | 9852 |
| 731 | Ga0495660_0015649 | 3300046810 | Bacteria | 4380 |
| 732 | Ga0495660_0036141 | 3300046810 | Bacteria | 2756 |
| 733 | Ga0495660_0056579 | 3300046810 | Bacteria | 2118 |
| 734 | Ga0495660_0065580 | 3300046810 | Bacteria | 1938 |
| 735 | Ga0495581_0026545 | 3300047315 | Bacteria | 3357 |
| 736 | Ga0495604_0000580 | 3300047317 | Bacteria | 32005 |
| 737 | Ga0495604_0001099 | 3300047317 | Bacteria | 22454 |
| 738 | Ga0495604_0063570 | 3300047317 | Bacteria | 2815 |
| 739 | Ga0495674_0001292 | 3300047319 | Bacteria | 24333 |
| 740 | Ga0495674_0013937 | 3300047319 | Bacteria | 7542 |
| 741 | Ga0495674_0071933 | 3300047319 | Bacteria | 2984 |
| 742 | Ga0495674_0257629 | 3300047319 | Bacteria | 1434 |
| 743 | Ga0495672_0004828 | 3300047320 | Bacteria | 10864 |
| 744 | Ga0495672_0029603 | 3300047320 | Bacteria | 3446 |
| 745 | Ga0495672_0036625 | 3300047320 | Bacteria | 3011 |
| 746 | Ga0495672_0041227 | 3300047320 | Bacteria | 2793 |
| 747 | Ga0495672_0077600 | 3300047320 | Bacteria | 1861 |
| 748 | Ga0495680_0000636 | 3300047322 | Bacteria | 39417 |
| 749 | Ga0495680_0018405 | 3300047322 | Bacteria | 5932 |
| 750 | Ga0495680_0156163 | 3300047322 | Bacteria | 1659 |
| 751 | Ga0495683_0000099 | 3300047323 | Bacteria | 88483 |
| 752 | Ga0495683_0000113 | 3300047323 | Bacteria | 82670 |
| 753 | Ga0495687_000572 | 3300047443 | Bacteria | 43367 |
| 754 | Ga0495687_035975 | 3300047443 | Bacteria | 2220 |
| 755 | Ga0495687_052619 | 3300047443 | Bacteria | 1720 |
| 756 | Ga0495675_0007147 | 3300047444 | Bacteria | 6873 |
| 757 | Ga0495675_0024914 | 3300047444 | Bacteria | 3816 |
| 758 | Ga0495679_000549 | 3300047446 | Bacteria | 26435 |
| 759 | Ga0495679_007354 | 3300047446 | Bacteria | 4600 |
| 760 | Ga0495679_023488 | 3300047446 | Bacteria | 2090 |
| 761 | Ga0495679_028495 | 3300047446 | Bacteria | 1832 |
| 762 | Ga0495673_0003314 | 3300047469 | Bacteria | 10675 |
| 763 | Ga0495673_0003583 | 3300047469 | Bacteria | 10190 |
| 764 | Ga0495673_0020162 | 3300047469 | Bacteria | 3324 |
| 765 | Ga0495673_0052489 | 3300047469 | Bacteria | 1781 |
| 766 | Ga0495673_0074076 | 3300047469 | Bacteria | 1425 |
| 767 | Ga0495681_0002645 | 3300047470 | Bacteria | 12709 |
| 768 | Ga0495681_0002739 | 3300047470 | Bacteria | 12474 |
| 769 | Ga0495681_0003661 | 3300047470 | Bacteria | 10675 |
| 770 | Ga0495681_0004812 | 3300047470 | Bacteria | 9146 |
| 771 | Ga0495681_0037021 | 3300047470 | Bacteria | 2408 |
| 772 | Ga0495681_0056181 | 3300047470 | Bacteria | 1832 |
| 773 | Ga0495684_0000088 | 3300047471 | Bacteria | 64704 |
| 774 | Ga0495684_0112571 | 3300047471 | Bacteria | 2052 |
| 775 | Ga0495684_0220346 | 3300047471 | Bacteria | 1391 |
| 776 | Ga0495686_0001608 | 3300047472 | Bacteria | 23795 |
| 777 | Ga0495686_0004287 | 3300047472 | Bacteria | 11814 |
| 778 | Ga0495686_0014472 | 3300047472 | Bacteria | 5426 |
| 779 | Ga0495686_0015085 | 3300047472 | Bacteria | 5292 |
| 780 | Ga0495686_0039136 | 3300047472 | Bacteria | 3030 |
| 781 | Ga0495593_0009454 | 3300047673 | Bacteria | 5657 |
| 782 | Ga0495602_0000162 | 3300048088 | Bacteria | 62143 |
| 783 | Ga0495602_0004623 | 3300048088 | Bacteria | 14359 |
| 784 | Ga0495602_0006564 | 3300048088 | Bacteria | 12199 |
| 785 | Ga0495602_0028311 | 3300048088 | Bacteria | 5364 |
| 786 | Ga0495626_0000162 | 3300048091 | Bacteria | 81809 |
| 787 | Ga0495626_0004818 | 3300048091 | Bacteria | 8135 |
| 788 | Ga0496100_0010556 | 3300048903 | Bacteria | 5230 |
| 789 | Ga0496100_0018696 | 3300048903 | Bacteria | 4117 |
| 790 | Ga0496101_0008338 | 3300048904 | Bacteria | 6770 |
| 791 | Ga0496101_0011098 | 3300048904 | Bacteria | 5970 |
| 792 | Ga0496101_0117825 | 3300048904 | Bacteria | 2005 |
| 793 | Ga0496102_0000613 | 3300048905 | Bacteria | 36995 |
| 794 | Ga0496102_0002326 | 3300048905 | Bacteria | 16233 |
| 795 | Ga0496103_0002825 | 3300048906 | Bacteria | 10796 |
| 796 | Ga0496103_0008910 | 3300048906 | Bacteria | 5948 |
| 797 | Ga0496103_0090578 | 3300048906 | Bacteria | 1930 |
| 798 | Ga0496104_0002277 | 3300048907 | Bacteria | 16556 |
| 799 | Ga0496104_0005539 | 3300048907 | Bacteria | 11061 |
| 800 | Ga0496104_0036850 | 3300048907 | Bacteria | 4573 |
| 801 | Ga0496104_0038908 | 3300048907 | Bacteria | 4451 |
| 802 | Ga0496104_0096350 | 3300048907 | Bacteria | 2830 |
| 803 | Ga0496105_0001309 | 3300048908 | Bacteria | 17421 |
| 804 | Ga0496105_0055730 | 3300048908 | Bacteria | 3263 |
| 805 | Ga0496106_0001425 | 3300048909 | Bacteria | 17950 |
| 806 | Ga0496107_0003742 | 3300048910 | Eukaryota | 10217 |
| 807 | Ga0496107_0014938 | 3300048910 | Bacteria | 5438 |
| 808 | Ga0496108_0029179 | 3300048911 | Bacteria | 4568 |
| 809 | Ga0496108_0139543 | 3300048911 | Bacteria | 2088 |
| 810 | Ga0496110_0041157 | 3300048913 | Bacteria | 4031 |
| 811 | Ga0496110_0142856 | 3300048913 | Bacteria | 2164 |
| 812 | Ga0496110_0294871 | 3300048913 | Bacteria | 1477 |
| 813 | Ga0496111_0098314 | 3300048914 | Bacteria | 2149 |
| 814 | Ga0496112_0016228 | 3300048915 | Bacteria | 6969 |
| 815 | Ga0496112_0105054 | 3300048915 | Bacteria | 2794 |
| 816 | Ga0496112_0215061 | 3300048915 | Bacteria | 1879 |
| 817 | Ga0496113_0000100 | 3300048916 | Bacteria | 36225 |
| 818 | Ga0496113_0179574 | 3300048916 | Bacteria | 1678 |
| 819 | Ga0496114_0081585 | 3300048917 | Bacteria | 2732 |
| 820 | Ga0496114_0120405 | 3300048917 | Bacteria | 2257 |
| 821 | Ga0496115_0003736 | 3300048918 | Bacteria | 10949 |
| 822 | Ga0496115_0068101 | 3300048918 | Bacteria | 2881 |
| 823 | Ga0496115_0070947 | 3300048918 | Bacteria | 2825 |
| 824 | Ga0496116_0000042 | 3300048919 | Bacteria | 330516 |
| 825 | Ga0496116_0002293 | 3300048919 | Bacteria | 20293 |
| 826 | Ga0496117_0000036 | 3300048920 | Bacteria | 325635 |
| 827 | Ga0496117_0000218 | 3300048920 | Bacteria | 109766 |
| 828 | Ga0496117_0001162 | 3300048920 | Bacteria | 39563 |
| 829 | Ga0496117_0017563 | 3300048920 | Bacteria | 5969 |
| 830 | Ga0496117_0022908 | 3300048920 | Bacteria | 4998 |
| 831 | Ga0496117_0032539 | 3300048920 | Bacteria | 3960 |
| 832 | Ga0496117_0043984 | 3300048920 | Bacteria | 3239 |
| 833 | Ga0496117_0070470 | 3300048920 | Bacteria | 2348 |
| 834 | Ga0496117_0086916 | 3300048920 | Bacteria | 2029 |
| 835 | Ga0496117_0098792 | 3300048920 | Bacteria | 1854 |
| 836 | Ga0496118_0000729 | 3300048921 | Bacteria | 53121 |
| 837 | Ga0496118_0002112 | 3300048921 | Bacteria | 27854 |
| 838 | Ga0496118_0017938 | 3300048921 | Bacteria | 6417 |
| 839 | Ga0496118_0037856 | 3300048921 | Bacteria | 3874 |
| 840 | Ga0496118_0038443 | 3300048921 | Bacteria | 3835 |
| 841 | Ga0496118_0044009 | 3300048921 | Bacteria | 3500 |
| 842 | Ga0496118_0093332 | 3300048921 | Bacteria | 2062 |
| 843 | Ga0496119_0002625 | 3300048922 | Bacteria | 19507 |
| 844 | Ga0496119_0003738 | 3300048922 | Bacteria | 15572 |
| 845 | Ga0496119_0005237 | 3300048922 | Bacteria | 12498 |
| 846 | Ga0496119_0012527 | 3300048922 | Bacteria | 6877 |
| 847 | Ga0496119_0032141 | 3300048922 | Bacteria | 3502 |
| 848 | Ga0496119_0047055 | 3300048922 | Bacteria | 2687 |
| 849 | Ga0496120_0000036 | 3300048923 | Bacteria | 206505 |
| 850 | Ga0496120_0003787 | 3300048923 | Bacteria | 13333 |
| 851 | Ga0496120_0003789 | 3300048923 | Bacteria | 13331 |
| 852 | Ga0496120_0004614 | 3300048923 | Bacteria | 11431 |
| 853 | Ga0496120_0004974 | 3300048923 | Bacteria | 10797 |
| 854 | Ga0496120_0072515 | 3300048923 | Bacteria | 1887 |
| 855 | Ga0496121_0000033 | 3300048924 | Bacteria | 377542 |
| 856 | Ga0496121_0000077 | 3300048924 | Bacteria | 235293 |
| 857 | Ga0496121_0000570 | 3300048924 | Bacteria | 69574 |
| 858 | Ga0496121_0000664 | 3300048924 | Bacteria | 64277 |
| 859 | Ga0496121_0006454 | 3300048924 | Bacteria | 14545 |
| 860 | Ga0496121_0009406 | 3300048924 | Bacteria | 11240 |
| 861 | Ga0496121_0016116 | 3300048924 | Bacteria | 7743 |
| 862 | Ga0496121_0019411 | 3300048924 | Bacteria | 6796 |
| 863 | Ga0496121_0023336 | 3300048924 | Bacteria | 5962 |
| 864 | Ga0496121_0052814 | 3300048924 | Bacteria | 3409 |
| 865 | Ga0496121_0057807 | 3300048924 | Bacteria | 3211 |
| 866 | Ga0496121_0087611 | 3300048924 | Bacteria | 2443 |
| 867 | Ga0496122_0000002 | 3300048925 | Bacteria | 905834 |
| 868 | Ga0496122_0000428 | 3300048925 | Bacteria | 88816 |
| 869 | Ga0496122_0000996 | 3300048925 | Bacteria | 50450 |
| 870 | Ga0496122_0006539 | 3300048925 | Bacteria | 13331 |
| 871 | Ga0496122_0021606 | 3300048925 | Bacteria | 5753 |
| 872 | Ga0496122_0028116 | 3300048925 | Bacteria | 4784 |
| 873 | Ga0496122_0066047 | 3300048925 | Bacteria | 2617 |
| 874 | Ga0496122_0084221 | 3300048925 | Bacteria | 2200 |
| 875 | Ga0496122_0138454 | 3300048925 | Bacteria | 1528 |
| 876 | Ga0496123_0000002 | 3300048926 | Bacteria | 1811682 |
| 877 | Ga0496123_0000337 | 3300048926 | Bacteria | 88727 |
| 878 | Ga0496123_0001068 | 3300048926 | Bacteria | 41396 |
| 879 | Ga0496123_0004528 | 3300048926 | Bacteria | 14519 |
| 880 | Ga0496123_0005027 | 3300048926 | Bacteria | 13532 |
| 881 | Ga0496123_0011126 | 3300048926 | Bacteria | 7845 |
| 882 | Ga0496123_0041597 | 3300048926 | Bacteria | 3183 |
| 883 | Ga0496123_0046469 | 3300048926 | Bacteria | 2944 |
| 884 | Ga0496123_0050340 | 3300048926 | Bacteria | 2784 |
| 885 | Ga0496124_0000259 | 3300048927 | Bacteria | 101764 |
| 886 | Ga0496124_0000812 | 3300048927 | Bacteria | 50806 |
| 887 | Ga0496124_0001166 | 3300048927 | Bacteria | 41149 |
| 888 | Ga0496124_0001679 | 3300048927 | Bacteria | 31447 |
| 889 | Ga0496124_0002048 | 3300048927 | Bacteria | 27374 |
| 890 | Ga0496124_0005729 | 3300048927 | Bacteria | 13838 |
| 891 | Ga0496124_0016064 | 3300048927 | Bacteria | 7142 |
| 892 | Ga0496124_0021308 | 3300048927 | Bacteria | 5973 |
| 893 | Ga0496124_0029306 | 3300048927 | Bacteria | 4907 |
| 894 | Ga0496124_0051980 | 3300048927 | Bacteria | 3483 |
| 895 | Ga0496124_0081579 | 3300048927 | Bacteria | 2657 |
| 896 | Ga0496125_0000235 | 3300048928 | Bacteria | 113379 |
| 897 | Ga0496125_0000681 | 3300048928 | Bacteria | 56691 |
| 898 | Ga0496125_0000760 | 3300048928 | Bacteria | 52776 |
| 899 | Ga0496125_0006813 | 3300048928 | Bacteria | 12261 |
| 900 | Ga0496125_0039434 | 3300048928 | Bacteria | 4067 |
| 901 | Ga0496125_0050297 | 3300048928 | Bacteria | 3452 |
| 902 | Ga0496125_0066080 | 3300048928 | Bacteria | 2860 |
| 903 | Ga0496125_0127718 | 3300048928 | Bacteria | 1798 |
| 904 | Ga0496126_0001647 | 3300048929 | Bacteria | 33697 |
| 905 | Ga0496126_0002030 | 3300048929 | Bacteria | 28578 |
| 906 | Ga0496126_0004349 | 3300048929 | Bacteria | 16993 |
| 907 | Ga0496126_0010785 | 3300048929 | Bacteria | 9540 |
| 908 | Ga0496126_0012038 | 3300048929 | Bacteria | 8889 |
| 909 | Ga0496126_0016102 | 3300048929 | Bacteria | 7492 |
| 910 | Ga0496126_0039056 | 3300048929 | Bacteria | 4408 |
| 911 | Ga0496126_0040697 | 3300048929 | Bacteria | 4307 |
| 912 | Ga0496126_0057675 | 3300048929 | Bacteria | 3504 |
| 913 | Ga0496126_0103810 | 3300048929 | Bacteria | 2483 |
| 914 | Ga0496126_0127421 | 3300048929 | Bacteria | 2202 |
| 915 | Ga0496126_0213249 | 3300048929 | Bacteria | 1624 |
| 916 | Ga0495678_000124 | 3300049459 | Bacteria | 90202 |
| 917 | Ga0495678_026948 | 3300049459 | Bacteria | 2444 |
| 918 | Ga0495678_043782 | 3300049459 | Bacteria | 1775 |
| 919 | Ga0501031_0000620 | 3300049568 | Bacteria | 20973 |
| 920 | Ga0501032_0003195 | 3300049569 | Bacteria | 12615 |
| 921 | Ga0501033_0000241 | 3300049570 | Bacteria | 52500 |
| 922 | Ga0501033_0026589 | 3300049570 | Bacteria | 4354 |
| 923 | Ga0501033_0049249 | 3300049570 | Bacteria | 3127 |
| 924 | Ga0501034_0000021 | 3300049571 | Bacteria | 266023 |
| 925 | Ga0501034_0000109 | 3300049571 | Bacteria | 151550 |
| 926 | Ga0501034_0001751 | 3300049571 | Bacteria | 27824 |
| 927 | Ga0501034_0091961 | 3300049571 | Bacteria | 3031 |
| 928 | Ga0501036_0000055 | 3300049572 | Bacteria | 73738 |
| 929 | Ga0501037_0000398 | 3300049573 | Bacteria | 36170 |
| 930 | Ga0501038_0001235 | 3300049574 | Bacteria | 23202 |
| 931 | Ga0501039_0000293 | 3300049575 | Bacteria | 35520 |
| 932 | Ga0501043_0000033 | 3300049579 | Bacteria | 139500 |
| 933 | Ga0501046_0000452 | 3300049580 | Bacteria | 41240 |
| 934 | Ga0501046_0158687 | 3300049580 | Bacteria | 1702 |
| 935 | Ga0501047_0000574 | 3300049581 | Bacteria | 39096 |
| 936 | Ga0501048_0000261 | 3300049582 | Bacteria | 35293 |
| 937 | Ga0501067_0000045 | 3300049583 | Bacteria | 73394 |
| 938 | Ga0501067_0120805 | 3300049583 | Bacteria | 1458 |
| 939 | Ga0501068_0003740 | 3300049584 | Bacteria | 8231 |
| 940 | Ga0501068_0019486 | 3300049584 | Bacteria | 3941 |
| 941 | Ga0501069_0003820 | 3300049585 | Bacteria | 7754 |
| 942 | Ga0501070_0002498 | 3300049586 | Bacteria | 16116 |
| 943 | Ga0501070_0006242 | 3300049586 | Bacteria | 10144 |
| 944 | Ga0501070_0053039 | 3300049586 | Bacteria | 3365 |
| 945 | Ga0501071_0017446 | 3300049587 | Bacteria | 4951 |
| 946 | Ga0501072_0010633 | 3300049588 | Bacteria | 7009 |
| 947 | Ga0501073_0010956 | 3300049589 | Bacteria | 6634 |
| 948 | Ga0501073_0023935 | 3300049589 | Bacteria | 4385 |
| 949 | Ga0501073_0034888 | 3300049589 | Bacteria | 3578 |
| 950 | Ga0501074_0003795 | 3300049590 | Bacteria | 10738 |
| 951 | Ga0501074_0015583 | 3300049590 | Bacteria | 5525 |
| 952 | Ga0501077_0023333 | 3300049593 | Bacteria | 3923 |
| 953 | Ga0501077_0030316 | 3300049593 | Bacteria | 3442 |
| 954 | Ga0501080_0004826 | 3300049742 | Bacteria | 12024 |
| 955 | Ga0501081_0034632 | 3300049743 | Bacteria | 3436 |
| 956 | Ga0501083_0000182 | 3300049744 | Bacteria | 40680 |
| 957 | Ga0501035_0000241 | 3300049822 | Bacteria | 65546 |
| 958 | Ga0501035_0111993 | 3300049822 | Bacteria | 2391 |
| 959 | Ga0501044_0000640 | 3300049823 | Bacteria | 42246 |
| 960 | Ga0501044_0034874 | 3300049823 | Bacteria | 5273 |
| 961 | Ga0501045_0088025 | 3300049824 | Bacteria | 2294 |
| 962 | nmdc:mga03683_718_c1 | 3300050489 | Bacteria | 9504 |
| 963 | nmdc:mga03n38_2026_c1 | 3300050490 | Bacteria | 6103 |
| 964 | nmdc:mga00v17_19_c1 | 3300050491 | Bacteria | 115002 |
| 965 | nmdc:mga00v17_2987_c1 | 3300050491 | Bacteria | 8682 |
| 966 | nmdc:mga0yw44_386_c1 | 3300050492 | Bacteria | 15352 |
| 967 | nmdc:mga0yw44_575_c1 | 3300050492 | Bacteria | 13288 |
| 968 | nmdc:mga09592_38638_c1 | 3300050508 | Bacteria | 4007 |
| 969 | nmdc:mga0qj67_106915_c1 | 3300050509 | Bacteria | 2257 |
| 970 | nmdc:mga08y16_13395_c1 | 3300050511 | Bacteria | 8625 |
| 971 | nmdc:mga08y16_46635_c1 | 3300050511 | Bacteria | 4537 |
| 972 | nmdc:mga08y16_83612_c1 | 3300050511 | Bacteria | 3327 |
| 973 | nmdc:mga0n895_1221_c1 | 3300050512 | Bacteria | 18979 |
| 974 | nmdc:mga0sz30_8616_c1 | 3300050516 | Bacteria | 3855 |
| 975 | Ga0495601_0002864 | 3300053077 | Bacteria | 9804 |
| 976 | Ga0495601_0012935 | 3300053077 | Bacteria | 5011 |
| 977 | Ga0495601_0020150 | 3300053077 | Bacteria | 4071 |
| 978 | Ga0495601_0098530 | 3300053077 | Bacteria | 1887 |
| 979 | Ga0495612_0004607 | 3300053078 | Bacteria | 5715 |
| 980 | Ga0495612_0016518 | 3300053078 | Bacteria | 2957 |
| 981 | Ga0500610_0004055 | 3300053079 | Bacteria | 5742 |
| 982 | Ga0495595_0000112 | 3300053084 | Bacteria | 37201 |
| 983 | Ga0495595_0003426 | 3300053084 | Bacteria | 6293 |
| 984 | Ga0495619_0000166 | 3300053085 | Bacteria | 48296 |
| 985 | Ga0495619_0001541 | 3300053085 | Bacteria | 15178 |
| 986 | Ga0495619_0027730 | 3300053085 | Bacteria | 3651 |
| 987 | Ga0495619_0027922 | 3300053085 | Bacteria | 3640 |
| 988 | Ga0500578_0100810 | 3300053086 | Bacteria | 1827 |
| 989 | Ga0500643_000362 | 3300053087 | Bacteria | 35932 |
| 990 | Ga0500643_043512 | 3300053087 | Bacteria | 1309 |
| 991 | Ga0500566_0002077 | 3300053094 | Bacteria | 11838 |
| 992 | Ga0500641_0054968 | 3300053096 | Bacteria | 1647 |
| 993 | Ga0500555_003622 | 3300053103 | Bacteria | 4398 |
| 994 | Ga0500556_0000030 | 3300053104 | Bacteria | 165098 |
| 995 | Ga0500556_0001124 | 3300053104 | Bacteria | 13249 |
| 996 | Ga0500557_000223 | 3300053105 | Bacteria | 8865 |
| 997 | Ga0500560_000050 | 3300053107 | Bacteria | 11659 |
| 998 | Ga0500560_001099 | 3300053107 | Bacteria | 4423 |
| 999 | Ga0500572_000055 | 3300053111 | Bacteria | 34260 |
| 1000 | Ga0500572_001371 | 3300053111 | Bacteria | 6719 |
| 1001 | Ga0500572_001447 | 3300053111 | Bacteria | 6498 |
| 1002 | Ga0500572_020641 | 3300053111 | Bacteria | 1735 |
| 1003 | Ga0500591_051586 | 3300053115 | Bacteria | 1928 |
| 1004 | Ga0500595_008373 | 3300053119 | Bacteria | 4226 |
| 1005 | Ga0500595_011111 | 3300053119 | Bacteria | 3541 |
| 1006 | Ga0500595_015948 | 3300053119 | Bacteria | 2807 |
| 1007 | Ga0500595_024033 | 3300053119 | Bacteria | 2132 |
| 1008 | Ga0500595_035614 | 3300053119 | Bacteria | 1637 |
| 1009 | Ga0500608_015526 | 3300053122 | Bacteria | 3423 |
| 1010 | Ga0500618_006987 | 3300053125 | Bacteria | 3261 |
| 1011 | Ga0500658_0072713 | 3300053134 | Bacteria | 1454 |
| 1012 | Ga0500559_0000678 | 3300053136 | Bacteria | 22700 |
| 1013 | Ga0500559_0000870 | 3300053136 | Bacteria | 19374 |
| 1014 | Ga0500559_0001368 | 3300053136 | Bacteria | 13979 |
| 1015 | Ga0500559_0003497 | 3300053136 | Bacteria | 7705 |
| 1016 | Ga0500559_0029135 | 3300053136 | Bacteria | 2362 |
| 1017 | Ga0500568_0000323 | 3300053139 | Bacteria | 37840 |
| 1018 | Ga0500568_0000361 | 3300053139 | Bacteria | 35246 |
| 1019 | Ga0500573_0014832 | 3300053140 | Bacteria | 4413 |
| 1020 | Ga0500573_0021953 | 3300053140 | Bacteria | 3663 |
| 1021 | Ga0500573_0074730 | 3300053140 | Bacteria | 1930 |
| 1022 | Ga0500603_001487 | 3300053150 | Bacteria | 5345 |
| 1023 | Ga0500604_0028580 | 3300053151 | Bacteria | 1620 |
| 1024 | Ga0500616_0009600 | 3300053153 | Bacteria | 5871 |
| 1025 | Ga0500622_0015058 | 3300053156 | Bacteria | 4147 |
| 1026 | Ga0500624_000424 | 3300053157 | Bacteria | 12877 |
| 1027 | Ga0500624_002884 | 3300053157 | Bacteria | 2279 |
| 1028 | Ga0500627_0000105 | 3300053158 | Bacteria | 28056 |
| 1029 | Ga0500627_0008706 | 3300053158 | Bacteria | 3621 |
| 1030 | Ga0500630_032865 | 3300053159 | Bacteria | 2545 |
| 1031 | Ga0500634_0006837 | 3300053161 | Bacteria | 5557 |
| 1032 | Ga0500634_0022929 | 3300053161 | Bacteria | 3391 |
| 1033 | Ga0500639_000004 | 3300053163 | Bacteria | 216921 |
| 1034 | Ga0500636_0000367 | 3300053177 | Bacteria | 24765 |
| 1035 | Ga0500636_0003604 | 3300053177 | Bacteria | 8733 |
| 1036 | Ga0500637_0000106 | 3300053178 | Bacteria | 29937 |
| 1037 | Ga0500645_001373 | 3300053730 | Bacteria | 12495 |
| 1038 | Ga0500645_001822 | 3300053730 | Bacteria | 10210 |
| 1039 | Ga0500596_000144 | 3300053735 | Bacteria | 10776 |
| 1040 | Ga0500596_007152 | 3300053735 | Bacteria | 1842 |
| 1041 | Ga0501084_0016986 | 3300054114 | Bacteria | 6047 |
| 1042 | Ga0501084_0118168 | 3300054114 | Bacteria | 2229 |
| 1043 | Ga0501082_0055942 | 3300060353 | Bacteria | 3398 |
| 1044 | Ga0530510_0202558 | 3300061734 | Bacteria | 1474 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8016583857 | 8016593001 | 395 |
| 2 | 3300046513 | Ga0495616_0003497 | Ga0495616_0003497_4716_5918 | 397 |
| 3 | 3300048920 | Ga0496117_0086916 | Ga0496117_0086916_765_1976 | 403 |
| 4 | 3300048925 | Ga0496122_0138454 | Ga0496122_0138454_268_1479 | 403 |
| 5 | 3300005548 | Ga0070665_100001296 | Ga0070665_1000012966 | 406 |
| 6 | 3300028379 | Ga0268266_10007442 | Ga0268266_1000744213 | 406 |
| 7 | 3300053087 | Ga0500643_043512 | Ga0500643_043512_47_1267 | 406 |
| 8 | 3300046473 | Ga0495582_0094401 | Ga0495582_0094401_410_1657 | 409 |
| 9 | 3300046642 | Ga0495634_0001959 | Ga0495634_0001959_14_1249 | 409 |
| 10 | 3300046471 | Ga0495650_0059865 | Ga0495650_0059865_272_1516 | 411 |
| 11 | 3300047470 | Ga0495681_0002739 | Ga0495681_0002739_7413_8738 | 411 |
| 12 | 3300053107 | Ga0500560_001099 | Ga0500560_001099_2592_3917 | 411 |
| 13 | iso_pu_bacteria | 2965089291 | 2965089892 | 413 |
| 14 | 3300006948 | Ga0099826_10007333 | Ga0099826_100073335 | 415 |
| 15 | 3300027666 | Ga0209282_1013642 | Ga0209282_10136423 | 415 |
| 16 | 3300030744 | Ga0316181_1206187 | Ga0316181_12061874 | 415 |
| 17 | 3300027312 | Ga0209371_1000003 | Ga0209371_1000003129 | 416 |
| 18 | 3300030500 | Ga0268256_1000004 | Ga0268256_1000004922 | 416 |
| 19 | 3300030745 | Ga0316182_1118994 | Ga0316182_11189941 | 416 |
| 20 | 3300047472 | Ga0495686_0001608 | Ga0495686_0001608_3544_4896 | 416 |
| 21 | 3300009036 | Ga0105244_10000607 | Ga0105244_100006074 | 418 |
| 22 | 3300009148 | Ga0105243_10004474 | Ga0105243_100044745 | 418 |
| 23 | 3300037418 | Ga0395900_0025676 | Ga0395900_0025676_2060_3325 | 418 |
| 24 | 3300037471 | Ga0395905_0171592 | Ga0395905_0171592_94_1359 | 418 |
| 25 | 3300038443 | Ga0395901_0256413 | Ga0395901_0256413_287_1552 | 418 |
| 26 | 3300046558 | Ga0495633_0023805 | Ga0495633_0023805_1753_3021 | 419 |
| 27 | 3300046660 | Ga0495625_0066117 | Ga0495625_0066117_943_2295 | 420 |
| 28 | iso_pu_bacteria | 8016566248 | 8016574197 | 420 |
| 29 | 3300003856 | Ga0058692_1002826 | Ga0058692_10028262 | 422 |
| 30 | 3300027312 | Ga0209371_1004989 | Ga0209371_10049895 | 422 |
| 31 | 3300025294 | Ga0209025_1011019 | Ga0209025_10110197 | 423 |
| 32 | 3300025728 | Ga0207655_1001748 | Ga0207655_100174812 | 424 |
| 33 | 3300013100 | Ga0157373_10020395 | Ga0157373_100203952 | 425 |
| 34 | 3300046458 | Ga0495591_006316 | Ga0495591_006316_16_1302 | 425 |
| 35 | 3300046794 | Ga0495589_0015004 | Ga0495589_0015004_2690_3976 | 425 |
| 36 | 3300047320 | Ga0495672_0041227 | Ga0495672_0041227_1497_2783 | 425 |
| 37 | iso_pu_bacteria | 2857509624 | 2857510430 | 426 |
| 38 | iso_pu_bacteria | 2968138860 | 2968139851 | 426 |
| 39 | 3300053161 | Ga0500634_0022929 | Ga0500634_0022929_703_2031 | 428 |
| 40 | 3300048919 | Ga0496116_0000042 | Ga0496116_0000042_78915_80234 | 429 |
| 41 | 3300005985 | Ga0081539_10062309 | Ga0081539_100623092 | 430 |
| 42 | 3300026078 | Ga0207702_10083796 | Ga0207702_100837962 | 430 |
| 43 | 3300035695 | Ga0373927_0162396 | Ga0373927_0162396_40_1332 | 430 |
| 44 | 3300037418 | Ga0395900_0291392 | Ga0395900_0291392_38_1330 | 430 |
| 45 | 3300037466 | Ga0395898_0128102 | Ga0395898_0128102_1046_2338 | 430 |
| 46 | 3300044684 | Ga0466966_0014368 | Ga0466966_0014368_14_1306 | 430 |
| 47 | 3300046531 | Ga0495665_0088474 | Ga0495665_0088474_51_1343 | 430 |
| 48 | 3300046559 | Ga0495667_0043230 | Ga0495667_0043230_1678_2970 | 430 |
| 49 | 3300047471 | Ga0495684_0220346 | Ga0495684_0220346_84_1376 | 430 |
| 50 | 3300048913 | Ga0496110_0294871 | Ga0496110_0294871_15_1307 | 430 |
| 51 | 3300048924 | Ga0496121_0000664 | Ga0496121_0000664_6363_7655 | 430 |
| 52 | 3300048924 | Ga0496121_0052814 | Ga0496121_0052814_962_2254 | 430 |
| 53 | 3300049568 | Ga0501031_0000620 | Ga0501031_0000620_16930_18222 | 430 |
| 54 | 3300049569 | Ga0501032_0003195 | Ga0501032_0003195_7480_8772 | 430 |
| 55 | 3300049570 | Ga0501033_0000241 | Ga0501033_0000241_18849_20141 | 430 |
| 56 | 3300049571 | Ga0501034_0000021 | Ga0501034_0000021_117019_118311 | 430 |
| 57 | 3300049572 | Ga0501036_0000055 | Ga0501036_0000055_7760_9052 | 430 |
| 58 | 3300049573 | Ga0501037_0000398 | Ga0501037_0000398_10971_12263 | 430 |
| 59 | 3300049574 | Ga0501038_0001235 | Ga0501038_0001235_14151_15443 | 430 |
| 60 | 3300049575 | Ga0501039_0000293 | Ga0501039_0000293_33249_34541 | 430 |
| 61 | 3300049579 | Ga0501043_0000033 | Ga0501043_0000033_36142_37434 | 430 |
| 62 | 3300049580 | Ga0501046_0000452 | Ga0501046_0000452_19396_20688 | 430 |
| 63 | 3300049581 | Ga0501047_0000574 | Ga0501047_0000574_22671_23963 | 430 |
| 64 | 3300049582 | Ga0501048_0000261 | Ga0501048_0000261_10214_11506 | 430 |
| 65 | 3300049584 | Ga0501068_0003740 | Ga0501068_0003740_4827_6119 | 430 |
| 66 | 3300049585 | Ga0501069_0003820 | Ga0501069_0003820_2614_3906 | 430 |
| 67 | 3300049586 | Ga0501070_0002498 | Ga0501070_0002498_3763_5055 | 430 |
| 68 | 3300049587 | Ga0501071_0017446 | Ga0501071_0017446_2685_3977 | 430 |
| 69 | 3300049588 | Ga0501072_0010633 | Ga0501072_0010633_2240_3532 | 430 |
| 70 | 3300049590 | Ga0501074_0003795 | Ga0501074_0003795_7496_8788 | 430 |
| 71 | 3300049744 | Ga0501083_0000182 | Ga0501083_0000182_36690_37982 | 430 |
| 72 | 3300049822 | Ga0501035_0000241 | Ga0501035_0000241_22670_23962 | 430 |
| 73 | 3300049823 | Ga0501044_0000640 | Ga0501044_0000640_20066_21358 | 430 |
| 74 | 3300053087 | Ga0500643_000362 | Ga0500643_000362_19291_20643 | 430 |
| 75 | 3300053122 | Ga0500608_015526 | Ga0500608_015526_1978_3270 | 430 |
| 76 | 3300053134 | Ga0500658_0072713 | Ga0500658_0072713_137_1429 | 430 |
| 77 | 3300053151 | Ga0500604_0028580 | Ga0500604_0028580_20_1312 | 430 |
| 78 | 3300054114 | Ga0501084_0016986 | Ga0501084_0016986_145_1437 | 430 |
| 79 | 3300003773 | Ga0055537_1000827 | Ga0055537_10008279 | 431 |
| 80 | 3300003790 | Ga0055528_1001347 | Ga0055528_10013479 | 431 |
| 81 | 3300004625 | Ga0055543_1000909 | Ga0055543_10009094 | 431 |
| 82 | 3300028573 | Ga0265334_10017805 | Ga0265334_100178052 | 431 |
| 83 | 3300049570 | Ga0501033_0049249 | Ga0501033_0049249_178_1473 | 431 |
| 84 | 3300006852 | Ga0075433_10212747 | Ga0075433_102127471 | 432 |
| 85 | 3300013102 | Ga0157371_10004709 | Ga0157371_100047097 | 432 |
| 86 | 3300013104 | Ga0157370_10126123 | Ga0157370_101261232 | 432 |
| 87 | 3300013105 | Ga0157369_10115729 | Ga0157369_101157292 | 432 |
| 88 | 3300031247 | Ga0265340_10004049 | Ga0265340_100040496 | 432 |
| 89 | 3300046615 | Ga0495656_0005918 | Ga0495656_0005918_1432_2730 | 432 |
| 90 | 3300046810 | Ga0495660_0036141 | Ga0495660_0036141_1439_2740 | 432 |
| 91 | 3300053086 | Ga0500578_0100810 | Ga0500578_0100810_515_1813 | 432 |
| 92 | iso_pu_bacteria | 2511231010 | 2511288980 | 432 |
| 93 | iso_pu_bacteria | 2511231011 | 2511295893 | 432 |
| 94 | iso_pu_bacteria | 2511231023 | 2511371945 | 432 |
| 95 | iso_pu_bacteria | 2511231031 | 2511415384 | 432 |
| 96 | iso_pu_bacteria | 2582581865 | 2585390209 | 432 |
| 97 | iso_pu_bacteria | 2600255318 | 2601797647 | 432 |
| 98 | iso_pu_bacteria | 2603880185 | 2606076871 | 432 |
| 99 | iso_pu_bacteria | 2603880199 | 2606128716 | 432 |
| 100 | iso_pu_bacteria | 2623620443 | 2624478023 | 432 |
| 101 | iso_pu_bacteria | 2713897149 | 2715754289 | 432 |
| 102 | iso_pu_bacteria | 2738543025 | 2739311084 | 432 |
| 103 | iso_pu_bacteria | 2773857673 | 2774134534 | 432 |
| 104 | iso_pu_bacteria | 2784132063 | 2784261257 | 432 |
| 105 | iso_pu_bacteria | 2808606445 | 2809217784 | 432 |
| 106 | iso_pu_bacteria | 2818991456 | 2819657048 | 432 |
| 107 | iso_pu_bacteria | 2842843487 | 2842846543 | 432 |
| 108 | iso_pu_bacteria | 2849660919 | 2849660932 | 432 |
| 109 | iso_pu_bacteria | 2852657418 | 2852661523 | 432 |
| 110 | iso_pu_bacteria | 2878029506 | 2878029968 | 432 |
| 111 | iso_pu_bacteria | 2880230671 | 2880230926 | 432 |
| 112 | iso_pu_bacteria | 2904518522 | 2904519386 | 432 |
| 113 | iso_pu_bacteria | 2919063839 | 2919066344 | 432 |
| 114 | iso_pu_bacteria | 2929189879 | 2929193336 | 432 |
| 115 | iso_pu_bacteria | 2974289157 | 2974293533 | 432 |
| 116 | iso_pu_bacteria | 3004334049 | 3004338906 | 432 |
| 117 | iso_pu_bacteria | 3007614139 | 3007615629 | 432 |
| 118 | iso_pu_bacteria | 3007718800 | 3007723414 | 432 |
| 119 | iso_pu_bacteria | 3007861166 | 3007864600 | 432 |
| 120 | iso_pu_bacteria | 8056569372 | 8056572132 | 432 |
| 121 | 3300002705 | JGI25156J39149_1000295 | JGI25156J39149_100029526 | 433 |
| 122 | 3300003758 | Ga0055532_1000254 | Ga0055532_10002547 | 433 |
| 123 | 3300025229 | Ga0209147_100021 | Ga0209147_100021284 | 433 |
| 124 | 3300025256 | Ga0209759_1000082 | Ga0209759_1000082135 | 433 |
| 125 | 3300046530 | Ga0495654_0000224 | Ga0495654_0000224_22617_23918 | 433 |
| 126 | 3300046616 | Ga0495668_0001200 | Ga0495668_0001200_21163_22464 | 433 |
| 127 | 3300053158 | Ga0500627_0000105 | Ga0500627_0000105_23046_24347 | 433 |
| 128 | 3300046501 | Ga0495607_0000082 | Ga0495607_0000082_24526_25830 | 434 |
| 129 | 3300048910 | Ga0496107_0003742 | Ga0496107_0003742_4949_6262 | 434 |
| 130 | 3300053730 | Ga0500645_001373 | Ga0500645_001373_10512_11825 | 434 |
| 131 | iso_pu_bacteria | 2597489887 | 2597855466 | 434 |
| 132 | iso_pu_bacteria | 2599185155 | 2599331195 | 434 |
| 133 | iso_pu_bacteria | 2599185185 | 2599485351 | 434 |
| 134 | iso_pu_bacteria | 2599185257 | 2599806496 | 434 |
| 135 | iso_pu_bacteria | 2671180172 | 2671772147 | 434 |
| 136 | iso_pu_bacteria | 2826581358 | 2826582538 | 434 |
| 137 | iso_pu_bacteria | 2842815866 | 2842817612 | 434 |
| 138 | iso_pu_bacteria | 2842849001 | 2842851573 | 434 |
| 139 | iso_pu_bacteria | 3007619802 | 3007624718 | 434 |
| 140 | iso_pu_bacteria | 8057101203 | 8057105826 | 434 |
| 141 | 3300003781 | Ga0055536_1000216 | Ga0055536_10002167 | 435 |
| 142 | 3300003791 | Ga0055530_10002982 | Ga0055530_100029822 | 435 |
| 143 | 3300003792 | Ga0055540_1000064 | Ga0055540_100006455 | 435 |
| 144 | 3300003794 | Ga0055531_10000039 | Ga0055531_1000003969 | 435 |
| 145 | 3300005353 | Ga0070669_100003483 | Ga0070669_1000034836 | 435 |
| 146 | 3300009036 | Ga0105244_10047892 | Ga0105244_100478922 | 435 |
| 147 | 3300009092 | Ga0105250_10001522 | Ga0105250_100015226 | 435 |
| 148 | 3300009148 | Ga0105243_10003033 | Ga0105243_100030335 | 435 |
| 149 | 3300012498 | Ga0157345_1000006 | Ga0157345_100000611 | 435 |
| 150 | 3300013100 | Ga0157373_10109812 | Ga0157373_101098122 | 435 |
| 151 | 3300013105 | Ga0157369_10005587 | Ga0157369_100055878 | 435 |
| 152 | 3300013306 | Ga0163162_10000199 | Ga0163162_1000019912 | 435 |
| 153 | 3300013307 | Ga0157372_10005780 | Ga0157372_100057807 | 435 |
| 154 | 3300013308 | Ga0157375_10296274 | Ga0157375_102962742 | 435 |
| 155 | 3300014497 | Ga0182008_10002472 | Ga0182008_100024727 | 435 |
| 156 | 3300015261 | Ga0182006_1001883 | Ga0182006_10018837 | 435 |
| 157 | 3300015261 | Ga0182006_1003283 | Ga0182006_10032837 | 435 |
| 158 | 3300017792 | Ga0163161_10006288 | Ga0163161_100062882 | 435 |
| 159 | 3300025230 | Ga0209563_101932 | Ga0209563_1019323 | 435 |
| 160 | 3300025291 | Ga0209675_1002094 | Ga0209675_10020945 | 435 |
| 161 | 3300025292 | Ga0209676_1000025 | Ga0209676_1000025450 | 435 |
| 162 | 3300025292 | Ga0209676_1000404 | Ga0209676_100040417 | 435 |
| 163 | 3300025298 | Ga0209050_1000099 | Ga0209050_100009996 | 435 |
| 164 | 3300025303 | Ga0209051_1000026 | Ga0209051_1000026245 | 435 |
| 165 | 3300025304 | Ga0209257_1000034 | Ga0209257_1000034450 | 435 |
| 166 | 3300025711 | Ga0207696_1000071 | Ga0207696_100007169 | 435 |
| 167 | 3300025711 | Ga0207696_1000961 | Ga0207696_10009619 | 435 |
| 168 | 3300025728 | Ga0207655_1000441 | Ga0207655_10004419 | 435 |
| 169 | 3300025728 | Ga0207655_1006386 | Ga0207655_10063865 | 435 |
| 170 | 3300025735 | Ga0207713_1001597 | Ga0207713_10015979 | 435 |
| 171 | 3300025735 | Ga0207713_1003526 | Ga0207713_10035266 | 435 |
| 172 | 3300025735 | Ga0207713_1014554 | Ga0207713_10145542 | 435 |
| 173 | 3300025923 | Ga0207681_10001048 | Ga0207681_1000104812 | 435 |
| 174 | 3300025933 | Ga0207706_10153171 | Ga0207706_101531712 | 435 |
| 175 | 3300025935 | Ga0207709_10000040 | Ga0207709_10000040128 | 435 |
| 176 | 3300028379 | Ga0268266_10034015 | Ga0268266_100340152 | 435 |
| 177 | 3300030521 | Ga0307511_10086694 | Ga0307511_100866942 | 435 |
| 178 | 3300032005 | Ga0307411_10006188 | Ga0307411_100061882 | 435 |
| 179 | 3300033180 | Ga0307510_10000085 | Ga0307510_1000008556 | 435 |
| 180 | 3300038705 | Ga0237819_02648 | Ga0237819_02648_1021_2340 | 435 |
| 181 | 3300039447 | Ga0436361_0183072 | Ga0436361_0183072_2624_3952 | 435 |
| 182 | 3300042139 | Ga0450904_001603 | Ga0450904_001603_1706_3025 | 435 |
| 183 | 3300046453 | Ga0495627_001135 | Ga0495627_001135_13532_14851 | 435 |
| 184 | 3300046458 | Ga0495591_001961 | Ga0495591_001961_4460_5779 | 435 |
| 185 | 3300046458 | Ga0495591_003002 | Ga0495591_003002_3299_4618 | 435 |
| 186 | 3300046458 | Ga0495591_025435 | Ga0495591_025435_75_1394 | 435 |
| 187 | 3300046460 | Ga0495638_0010795 | Ga0495638_0010795_4386_5705 | 435 |
| 188 | 3300046474 | Ga0495605_0043870 | Ga0495605_0043870_122_1441 | 435 |
| 189 | 3300046491 | Ga0495584_0057027 | Ga0495584_0057027_405_1724 | 435 |
| 190 | 3300046492 | Ga0495585_0054980 | Ga0495585_0054980_552_1871 | 435 |
| 191 | 3300046492 | Ga0495585_0104414 | Ga0495585_0104414_16_1335 | 435 |
| 192 | 3300046500 | Ga0495596_0011116 | Ga0495596_0011116_982_2301 | 435 |
| 193 | 3300046501 | Ga0495607_0002081 | Ga0495607_0002081_9750_11069 | 435 |
| 194 | 3300046501 | Ga0495607_0007523 | Ga0495607_0007523_3832_5151 | 435 |
| 195 | 3300046501 | Ga0495607_0077763 | Ga0495607_0077763_229_1548 | 435 |
| 196 | 3300046501 | Ga0495607_0084209 | Ga0495607_0084209_221_1540 | 435 |
| 197 | 3300046507 | Ga0495606_0005451 | Ga0495606_0005451_4280_5599 | 435 |
| 198 | 3300046512 | Ga0495610_0005026 | Ga0495610_0005026_3932_5251 | 435 |
| 199 | 3300046513 | Ga0495616_0003740 | Ga0495616_0003740_3447_4766 | 435 |
| 200 | 3300046513 | Ga0495616_0038331 | Ga0495616_0038331_963_2282 | 435 |
| 201 | 3300046513 | Ga0495616_0081280 | Ga0495616_0081280_55_1374 | 435 |
| 202 | 3300046515 | Ga0495620_0001699 | Ga0495620_0001699_4196_5515 | 435 |
| 203 | 3300046519 | Ga0495632_0000719 | Ga0495632_0000719_4132_5451 | 435 |
| 204 | 3300046519 | Ga0495632_0011234 | Ga0495632_0011234_821_2140 | 435 |
| 205 | 3300046520 | Ga0495637_0002352 | Ga0495637_0002352_4977_6296 | 435 |
| 206 | 3300046522 | Ga0495643_0008772 | Ga0495643_0008772_4248_5567 | 435 |
| 207 | 3300046524 | Ga0495648_0005888 | Ga0495648_0005888_4689_6008 | 435 |
| 208 | 3300046526 | Ga0495666_0064554 | Ga0495666_0064554_239_1558 | 435 |
| 209 | 3300046530 | Ga0495654_0003210 | Ga0495654_0003210_4618_5937 | 435 |
| 210 | 3300046538 | Ga0495609_0006521 | Ga0495609_0006521_2916_4235 | 435 |
| 211 | 3300046538 | Ga0495609_0037939 | Ga0495609_0037939_653_1972 | 435 |
| 212 | 3300046557 | Ga0495622_0001594 | Ga0495622_0001594_5790_7109 | 435 |
| 213 | 3300046616 | Ga0495668_0057348 | Ga0495668_0057348_528_1847 | 435 |
| 214 | 3300046642 | Ga0495634_0084101 | Ga0495634_0084101_186_1505 | 435 |
| 215 | 3300046648 | Ga0495611_0000339 | Ga0495611_0000339_4262_5581 | 435 |
| 216 | 3300046660 | Ga0495625_0005554 | Ga0495625_0005554_7351_8670 | 435 |
| 217 | 3300046665 | Ga0495661_0036529 | Ga0495661_0036529_72_1391 | 435 |
| 218 | 3300046680 | Ga0495646_0067017 | Ga0495646_0067017_540_1859 | 435 |
| 219 | 3300046689 | Ga0495613_0046524 | Ga0495613_0046524_910_2229 | 435 |
| 220 | 3300046690 | Ga0495624_0002316 | Ga0495624_0002316_8173_9492 | 435 |
| 221 | 3300046691 | Ga0495670_0002847 | Ga0495670_0002847_2884_4203 | 435 |
| 222 | 3300046692 | Ga0495671_0029777 | Ga0495671_0029777_1147_2466 | 435 |
| 223 | 3300046694 | Ga0495649_0021189 | Ga0495649_0021189_2261_3580 | 435 |
| 224 | 3300046694 | Ga0495649_0048237 | Ga0495649_0048237_210_1529 | 435 |
| 225 | 3300046694 | Ga0495649_0066095 | Ga0495649_0066095_559_1878 | 435 |
| 226 | 3300046694 | Ga0495649_0069243 | Ga0495649_0069243_292_1611 | 435 |
| 227 | 3300046794 | Ga0495589_0053544 | Ga0495589_0053544_475_1794 | 435 |
| 228 | 3300046810 | Ga0495660_0015649 | Ga0495660_0015649_756_2075 | 435 |
| 229 | 3300046810 | Ga0495660_0056579 | Ga0495660_0056579_484_1803 | 435 |
| 230 | 3300047320 | Ga0495672_0004828 | Ga0495672_0004828_5366_6685 | 435 |
| 231 | 3300047446 | Ga0495679_023488 | Ga0495679_023488_496_1815 | 435 |
| 232 | 3300047446 | Ga0495679_028495 | Ga0495679_028495_431_1750 | 435 |
| 233 | 3300047469 | Ga0495673_0003583 | Ga0495673_0003583_4625_5944 | 435 |
| 234 | 3300047469 | Ga0495673_0052489 | Ga0495673_0052489_168_1487 | 435 |
| 235 | 3300047469 | Ga0495673_0074076 | Ga0495673_0074076_38_1357 | 435 |
| 236 | 3300047470 | Ga0495681_0002645 | Ga0495681_0002645_6001_7320 | 435 |
| 237 | 3300047470 | Ga0495681_0004812 | Ga0495681_0004812_4308_5627 | 435 |
| 238 | 3300047470 | Ga0495681_0056181 | Ga0495681_0056181_32_1351 | 435 |
| 239 | 3300047471 | Ga0495684_0112571 | Ga0495684_0112571_198_1517 | 435 |
| 240 | 3300048088 | Ga0495602_0006564 | Ga0495602_0006564_5966_7285 | 435 |
| 241 | 3300048091 | Ga0495626_0004818 | Ga0495626_0004818_4517_5836 | 435 |
| 242 | 3300048913 | Ga0496110_0041157 | Ga0496110_0041157_2370_3692 | 435 |
| 243 | 3300048920 | Ga0496117_0022908 | Ga0496117_0022908_445_1764 | 435 |
| 244 | 3300048920 | Ga0496117_0032539 | Ga0496117_0032539_2413_3732 | 435 |
| 245 | 3300048921 | Ga0496118_0044009 | Ga0496118_0044009_232_1551 | 435 |
| 246 | 3300048922 | Ga0496119_0012527 | Ga0496119_0012527_5354_6673 | 435 |
| 247 | 3300048924 | Ga0496121_0019411 | Ga0496121_0019411_5422_6741 | 435 |
| 248 | 3300048925 | Ga0496122_0028116 | Ga0496122_0028116_2905_4224 | 435 |
| 249 | 3300048927 | Ga0496124_0081579 | Ga0496124_0081579_910_2229 | 435 |
| 250 | 3300049459 | Ga0495678_026948 | Ga0495678_026948_620_1939 | 435 |
| 251 | 3300049459 | Ga0495678_043782 | Ga0495678_043782_317_1636 | 435 |
| 252 | 3300053111 | Ga0500572_020641 | Ga0500572_020641_222_1541 | 435 |
| 253 | iso_pu_bacteria | 2510917026 | 2511173644 | 435 |
| 254 | iso_pu_bacteria | 2554235341 | 2555667199 | 435 |
| 255 | iso_pu_bacteria | 2585427634 | 2586003169 | 435 |
| 256 | iso_pu_bacteria | 2599185160 | 2599356424 | 435 |
| 257 | iso_pu_bacteria | 2599185161 | 2599363549 | 435 |
| 258 | iso_pu_bacteria | 2599185162 | 2599369499 | 435 |
| 259 | iso_pu_bacteria | 2599185163 | 2599376658 | 435 |
| 260 | iso_pu_bacteria | 2599185164 | 2599381529 | 435 |
| 261 | iso_pu_bacteria | 2599185165 | 2599388327 | 435 |
| 262 | iso_pu_bacteria | 2599185166 | 2599395146 | 435 |
| 263 | iso_pu_bacteria | 2599185168 | 2599406911 | 435 |
| 264 | iso_pu_bacteria | 2599185181 | 2599463257 | 435 |
| 265 | iso_pu_bacteria | 2599185182 | 2599469396 | 435 |
| 266 | iso_pu_bacteria | 2599185186 | 2599492274 | 435 |
| 267 | iso_pu_bacteria | 2599185356 | 2600215886 | 435 |
| 268 | iso_pu_bacteria | 2600255313 | 2601776053 | 435 |
| 269 | iso_pu_bacteria | 2667528171 | 2671100189 | 435 |
| 270 | iso_pu_bacteria | 2728368998 | 2728754482 | 435 |
| 271 | iso_pu_bacteria | 2818991461 | 2819682539 | 435 |
| 272 | iso_pu_bacteria | 2818991464 | 2819704995 | 435 |
| 273 | iso_pu_bacteria | 2844665904 | 2844667693 | 435 |
| 274 | iso_pu_bacteria | 2857531043 | 2857536804 | 435 |
| 275 | iso_pu_bacteria | 2869242130 | 2869245227 | 435 |
| 276 | iso_pu_bacteria | 2871481445 | 2871484786 | 435 |
| 277 | iso_pu_bacteria | 2874116593 | 2874120645 | 435 |
| 278 | iso_pu_bacteria | 2876386047 | 2876388684 | 435 |
| 279 | iso_pu_bacteria | 2876420981 | 2876426457 | 435 |
| 280 | iso_pu_bacteria | 2879083081 | 2879090806 | 435 |
| 281 | iso_pu_bacteria | 2906401398 | 2906403596 | 435 |
| 282 | iso_pu_bacteria | 2917070673 | 2917070948 | 435 |
| 283 | iso_pu_bacteria | 2924741084 | 2924744071 | 435 |
| 284 | iso_pu_bacteria | 2929138655 | 2929144123 | 435 |
| 285 | iso_pu_bacteria | 2935353572 | 2935358776 | 435 |
| 286 | iso_pu_bacteria | 2937861824 | 2937865105 | 435 |
| 287 | iso_pu_bacteria | 2937980651 | 2937984610 | 435 |
| 288 | iso_pu_bacteria | 2958108152 | 2958108768 | 435 |
| 289 | iso_pu_bacteria | 2961183825 | 2961188764 | 435 |
| 290 | iso_pu_bacteria | 2970532167 | 2970538152 | 435 |
| 291 | iso_pu_bacteria | 2970627176 | 2970631920 | 435 |
| 292 | iso_pu_bacteria | 2977851361 | 2977854737 | 435 |
| 293 | iso_pu_bacteria | 2977907340 | 2977909340 | 435 |
| 294 | iso_pu_bacteria | 2979764755 | 2979765997 | 435 |
| 295 | iso_pu_bacteria | 2979772303 | 2979773074 | 435 |
| 296 | iso_pu_bacteria | 3004248173 | 3004254369 | 435 |
| 297 | iso_pu_bacteria | 3007395558 | 3007397853 | 435 |
| 298 | iso_pu_bacteria | 637000220 | 637317599 | 435 |
| 299 | iso_pu_bacteria | 8018150411 | 8018153860 | 435 |
| 300 | 3300026121 | Ga0207683_10044288 | Ga0207683_100442883 | 436 |
| 301 | 3300046471 | Ga0495650_0020937 | Ga0495650_0020937_1544_2863 | 436 |
| 302 | 3300046474 | Ga0495605_0000164 | Ga0495605_0000164_16578_17897 | 436 |
| 303 | 3300046501 | Ga0495607_0053320 | Ga0495607_0053320_314_1633 | 436 |
| 304 | 3300046506 | Ga0495583_0000226 | Ga0495583_0000226_26839_28158 | 436 |
| 305 | 3300046512 | Ga0495610_0008977 | Ga0495610_0008977_1514_2833 | 436 |
| 306 | 3300046515 | Ga0495620_0000047 | Ga0495620_0000047_89264_90583 | 436 |
| 307 | 3300046518 | Ga0495631_0019496 | Ga0495631_0019496_579_1898 | 436 |
| 308 | 3300046520 | Ga0495637_0042753 | Ga0495637_0042753_333_1652 | 436 |
| 309 | 3300046524 | Ga0495648_0003462 | Ga0495648_0003462_7187_8506 | 436 |
| 310 | 3300046530 | Ga0495654_0001955 | Ga0495654_0001955_7664_8983 | 436 |
| 311 | 3300046538 | Ga0495609_0000156 | Ga0495609_0000156_16424_17743 | 436 |
| 312 | 3300046542 | Ga0495597_0002855 | Ga0495597_0002855_7637_8956 | 436 |
| 313 | 3300046558 | Ga0495633_0000453 | Ga0495633_0000453_24310_25629 | 436 |
| 314 | 3300046665 | Ga0495661_0000172 | Ga0495661_0000172_57117_58436 | 436 |
| 315 | 3300046794 | Ga0495589_0010970 | Ga0495589_0010970_3116_4435 | 436 |
| 316 | 3300047323 | Ga0495683_0000113 | Ga0495683_0000113_56874_58193 | 436 |
| 317 | 3300047446 | Ga0495679_000549 | Ga0495679_000549_883_2202 | 436 |
| 318 | 3300047469 | Ga0495673_0003314 | Ga0495673_0003314_9221_10540 | 436 |
| 319 | 3300047470 | Ga0495681_0003661 | Ga0495681_0003661_7923_9242 | 436 |
| 320 | 3300048925 | Ga0496122_0000996 | Ga0496122_0000996_3498_4811 | 436 |
| 321 | 3300048926 | Ga0496123_0000337 | Ga0496123_0000337_56641_57954 | 436 |
| 322 | 3300048926 | Ga0496123_0011126 | Ga0496123_0011126_1791_3110 | 436 |
| 323 | 3300048929 | Ga0496126_0001647 | Ga0496126_0001647_18415_19725 | 436 |
| 324 | 3300049459 | Ga0495678_000124 | Ga0495678_000124_72431_73750 | 436 |
| 325 | 3300050511 | nmdc:mga08y16_46635_c1 | nmdc:mga08y16_46635_c1_27_1346 | 436 |
| 326 | 3300053140 | Ga0500573_0074730 | Ga0500573_0074730_590_1900 | 436 |
| 327 | iso_pu_bacteria | 2510065059 | 2510316217 | 436 |
| 328 | iso_pu_bacteria | 2513237305 | 2514418842 | 436 |
| 329 | iso_pu_bacteria | 2537561587 | 2537873452 | 436 |
| 330 | iso_pu_bacteria | 2597489888 | 2597864819 | 436 |
| 331 | iso_pu_bacteria | 2597489889 | 2597870674 | 436 |
| 332 | iso_pu_bacteria | 2599185189 | 2599507002 | 436 |
| 333 | iso_pu_bacteria | 2599185210 | 2599605587 | 436 |
| 334 | iso_pu_bacteria | 2599185288 | 2599878156 | 436 |
| 335 | iso_pu_bacteria | 2600255296 | 2601689911 | 436 |
| 336 | iso_pu_bacteria | 2643221713 | 2644622365 | 436 |
| 337 | iso_pu_bacteria | 2687453392 | 2688597819 | 436 |
| 338 | iso_pu_bacteria | 2721755607 | 2723249577 | 436 |
| 339 | iso_pu_bacteria | 2738541294 | 2738809859 | 436 |
| 340 | iso_pu_bacteria | 2738541309 | 2738897219 | 436 |
| 341 | iso_pu_bacteria | 2756170246 | 2756676296 | 436 |
| 342 | iso_pu_bacteria | 2791355123 | 2792750065 | 436 |
| 343 | iso_pu_bacteria | 2818991439 | 2819557843 | 436 |
| 344 | iso_pu_bacteria | 2821443989 | 2821444435 | 436 |
| 345 | iso_pu_bacteria | 2841760612 | 2841762370 | 436 |
| 346 | iso_pu_bacteria | 2841859092 | 2841864071 | 436 |
| 347 | iso_pu_bacteria | 2842515876 | 2842520853 | 436 |
| 348 | iso_pu_bacteria | 2842826826 | 2842831187 | 436 |
| 349 | iso_pu_bacteria | 2842837860 | 2842842450 | 436 |
| 350 | iso_pu_bacteria | 2844002411 | 2844004785 | 436 |
| 351 | iso_pu_bacteria | 2844009547 | 2844009684 | 436 |
| 352 | iso_pu_bacteria | 2844104063 | 2844109908 | 436 |
| 353 | iso_pu_bacteria | 2851182111 | 2851186937 | 436 |
| 354 | iso_pu_bacteria | 2851246043 | 2851248383 | 436 |
| 355 | iso_pu_bacteria | 2856328259 | 2856329918 | 436 |
| 356 | iso_pu_bacteria | 2856334872 | 2856337072 | 436 |
| 357 | iso_pu_bacteria | 2857367948 | 2857371508 | 436 |
| 358 | iso_pu_bacteria | 2869234852 | 2869237173 | 436 |
| 359 | iso_pu_bacteria | 2869249662 | 2869252100 | 436 |
| 360 | iso_pu_bacteria | 2869256925 | 2869260440 | 436 |
| 361 | iso_pu_bacteria | 2869264136 | 2869270615 | 436 |
| 362 | iso_pu_bacteria | 2869271264 | 2869272248 | 436 |
| 363 | iso_pu_bacteria | 2871435913 | 2871443518 | 436 |
| 364 | iso_pu_bacteria | 2871459585 | 2871460389 | 436 |
| 365 | iso_pu_bacteria | 2874109183 | 2874115098 | 436 |
| 366 | iso_pu_bacteria | 2874131515 | 2874132505 | 436 |
| 367 | iso_pu_bacteria | 2874162495 | 2874163901 | 436 |
| 368 | iso_pu_bacteria | 2874168670 | 2874171232 | 436 |
| 369 | iso_pu_bacteria | 2876399893 | 2876401559 | 436 |
| 370 | iso_pu_bacteria | 2876406927 | 2876411095 | 436 |
| 371 | iso_pu_bacteria | 2878774303 | 2878774756 | 436 |
| 372 | iso_pu_bacteria | 2878781027 | 2878781769 | 436 |
| 373 | iso_pu_bacteria | 2899792073 | 2899793616 | 436 |
| 374 | iso_pu_bacteria | 2906363423 | 2906369306 | 436 |
| 375 | iso_pu_bacteria | 2906370794 | 2906371725 | 436 |
| 376 | iso_pu_bacteria | 2906386501 | 2906392923 | 436 |
| 377 | iso_pu_bacteria | 2906393657 | 2906399065 | 436 |
| 378 | iso_pu_bacteria | 2906408224 | 2906409588 | 436 |
| 379 | iso_pu_bacteria | 2908446538 | 2908450639 | 436 |
| 380 | iso_pu_bacteria | 2922151315 | 2922151578 | 436 |
| 381 | iso_pu_bacteria | 2922172374 | 2922178074 | 436 |
| 382 | iso_pu_bacteria | 2924710171 | 2924713991 | 436 |
| 383 | iso_pu_bacteria | 2924733363 | 2924740709 | 436 |
| 384 | iso_pu_bacteria | 2924748358 | 2924754662 | 436 |
| 385 | iso_pu_bacteria | 2933011516 | 2933016534 | 436 |
| 386 | iso_pu_bacteria | 2937071275 | 2937076418 | 436 |
| 387 | iso_pu_bacteria | 2937868953 | 2937874487 | 436 |
| 388 | iso_pu_bacteria | 2958122699 | 2958128337 | 436 |
| 389 | iso_pu_bacteria | 2958137437 | 2958144235 | 436 |
| 390 | iso_pu_bacteria | 2958158011 | 2958161550 | 436 |
| 391 | iso_pu_bacteria | 2961136820 | 2961138369 | 436 |
| 392 | iso_pu_bacteria | 2965025482 | 2965031107 | 436 |
| 393 | iso_pu_bacteria | 2965040258 | 2965045384 | 436 |
| 394 | iso_pu_bacteria | 2965047637 | 2965053659 | 436 |
| 395 | iso_pu_bacteria | 2965110997 | 2965115799 | 436 |
| 396 | iso_pu_bacteria | 2970489779 | 2970491448 | 436 |
| 397 | iso_pu_bacteria | 2970510686 | 2970517746 | 436 |
| 398 | iso_pu_bacteria | 2970547951 | 2970554598 | 436 |
| 399 | iso_pu_bacteria | 2970619444 | 2970624091 | 436 |
| 400 | iso_pu_bacteria | 2977872689 | 2977879290 | 436 |
| 401 | iso_pu_bacteria | 2977898635 | 2977906308 | 436 |
| 402 | iso_pu_bacteria | 2977915119 | 2977918174 | 436 |
| 403 | iso_pu_bacteria | 2977935797 | 2977937126 | 436 |
| 404 | iso_pu_bacteria | 2977950692 | 2977954058 | 436 |
| 405 | iso_pu_bacteria | 2977957713 | 2977958299 | 436 |
| 406 | iso_pu_bacteria | 2979100975 | 2979102884 | 436 |
| 407 | iso_pu_bacteria | 2979793036 | 2979798603 | 436 |
| 408 | iso_pu_bacteria | 2984509177 | 2984509227 | 436 |
| 409 | iso_pu_bacteria | 2984518228 | 2984520075 | 436 |
| 410 | iso_pu_bacteria | 2984537506 | 2984537556 | 436 |
| 411 | iso_pu_bacteria | 2984601300 | 2984604304 | 436 |
| 412 | iso_pu_bacteria | 2987645492 | 2987652122 | 436 |
| 413 | iso_pu_bacteria | 2987673487 | 2987674735 | 436 |
| 414 | iso_pu_bacteria | 2996386984 | 2996388436 | 436 |
| 415 | iso_pu_bacteria | 3002141150 | 3002144307 | 436 |
| 416 | iso_pu_bacteria | 3004167301 | 3004172004 | 436 |
| 417 | iso_pu_bacteria | 3004195979 | 3004198143 | 436 |
| 418 | iso_pu_bacteria | 3004232784 | 3004239716 | 436 |
| 419 | iso_pu_bacteria | 3004239961 | 3004242346 | 436 |
| 420 | iso_pu_bacteria | 3004268573 | 3004271531 | 436 |
| 421 | iso_pu_bacteria | 649633066 | 649872361 | 436 |
| 422 | iso_pu_bacteria | 8004300914 | 8004301392 | 436 |
| 423 | iso_pu_bacteria | 8004361976 | 8004369160 | 436 |
| 424 | iso_pu_bacteria | 8004695233 | 8004697003 | 436 |
| 425 | iso_pu_bacteria | 8054285046 | 8054289839 | 436 |
| 426 | iso_pu_bacteria | 8054347763 | 8054348639 | 436 |
| 427 | iso_pu_bacteria | 8054503363 | 8054507171 | 436 |
| 428 | iso_pu_bacteria | 8055817908 | 8055822099 | 436 |
| 429 | iso_pu_bacteria | 8057529695 | 8057535477 | 436 |
| 430 | 3300003781 | Ga0055536_1000093 | Ga0055536_10000939 | 437 |
| 431 | 3300003791 | Ga0055530_10000034 | Ga0055530_1000003483 | 437 |
| 432 | 3300003792 | Ga0055540_1000429 | Ga0055540_100042912 | 437 |
| 433 | 3300005289 | Ga0065704_10081044 | Ga0065704_100810442 | 437 |
| 434 | 3300005290 | Ga0065712_10000260 | Ga0065712_1000026011 | 437 |
| 435 | 3300025292 | Ga0209676_1000032 | Ga0209676_1000032156 | 437 |
| 436 | 3300025298 | Ga0209050_1000025 | Ga0209050_1000025157 | 437 |
| 437 | 3300025303 | Ga0209051_1000039 | Ga0209051_1000039120 | 437 |
| 438 | 3300025303 | Ga0209051_1000047 | Ga0209051_1000047120 | 437 |
| 439 | 3300042009 | Ga0439451_007601 | Ga0439451_007601_185_1552 | 437 |
| 440 | 3300042016 | Ga0439463_000088 | Ga0439463_000088_13613_14980 | 437 |
| 441 | 3300046460 | Ga0495638_0000830 | Ga0495638_0000830_30933_32258 | 437 |
| 442 | 3300046522 | Ga0495643_0044851 | Ga0495643_0044851_340_1665 | 437 |
| 443 | 3300046558 | Ga0495633_0052648 | Ga0495633_0052648_258_1583 | 437 |
| 444 | 3300046660 | Ga0495625_0006484 | Ga0495625_0006484_105_1430 | 437 |
| 445 | 3300047320 | Ga0495672_0077600 | Ga0495672_0077600_116_1441 | 437 |
| 446 | iso_pu_bacteria | 2508501128 | 2509153250 | 437 |
| 447 | iso_pu_bacteria | 2510917030 | 2511200207 | 437 |
| 448 | iso_pu_bacteria | 2511231006 | 2511264300 | 437 |
| 449 | iso_pu_bacteria | 2512047018 | 2512328877 | 437 |
| 450 | iso_pu_bacteria | 2513237096 | 2513659593 | 437 |
| 451 | iso_pu_bacteria | 2513237101 | 2513691643 | 437 |
| 452 | iso_pu_bacteria | 2513237102 | 2513705181 | 437 |
| 453 | iso_pu_bacteria | 2513237104 | 2513717626 | 437 |
| 454 | iso_pu_bacteria | 2513237137 | 2513859646 | 437 |
| 455 | iso_pu_bacteria | 2513237141 | 2513889395 | 437 |
| 456 | iso_pu_bacteria | 2513237145 | 2513921687 | 437 |
| 457 | iso_pu_bacteria | 2517572143 | 2517893274 | 437 |
| 458 | iso_pu_bacteria | 2524023205 | 2524439701 | 437 |
| 459 | iso_pu_bacteria | 2554235003 | 2554245873 | 437 |
| 460 | iso_pu_bacteria | 2558860242 | 2559296361 | 437 |
| 461 | iso_pu_bacteria | 2582580891 | 2583792927 | 437 |
| 462 | iso_pu_bacteria | 2582581298 | 2585222362 | 437 |
| 463 | iso_pu_bacteria | 2585427529 | 2585544686 | 437 |
| 464 | iso_pu_bacteria | 2599185212 | 2599616521 | 437 |
| 465 | iso_pu_bacteria | 2599185318 | 2600038721 | 437 |
| 466 | iso_pu_bacteria | 2599185322 | 2600062604 | 437 |
| 467 | iso_pu_bacteria | 2617270735 | 2617354038 | 437 |
| 468 | iso_pu_bacteria | 2617270741 | 2617376651 | 437 |
| 469 | iso_pu_bacteria | 2643221582 | 2643921976 | 437 |
| 470 | iso_pu_bacteria | 2643221643 | 2644240985 | 437 |
| 471 | iso_pu_bacteria | 2643221693 | 2644522837 | 437 |
| 472 | iso_pu_bacteria | 2667528175 | 2671117919 | 437 |
| 473 | iso_pu_bacteria | 2721755755 | 2723845937 | 437 |
| 474 | iso_pu_bacteria | 2740892503 | 2743738090 | 437 |
| 475 | iso_pu_bacteria | 2744054633 | 2745082156 | 437 |
| 476 | iso_pu_bacteria | 2791355197 | 2793069856 | 437 |
| 477 | iso_pu_bacteria | 2791355199 | 2793079741 | 437 |
| 478 | iso_pu_bacteria | 2808606387 | 2808988579 | 437 |
| 479 | iso_pu_bacteria | 2818991467 | 2819717596 | 437 |
| 480 | iso_pu_bacteria | 2824600985 | 2824606589 | 437 |
| 481 | iso_pu_bacteria | 2824609381 | 2824613091 | 437 |
| 482 | iso_pu_bacteria | 2824617872 | 2824624552 | 437 |
| 483 | iso_pu_bacteria | 2824626560 | 2824630701 | 437 |
| 484 | iso_pu_bacteria | 2824635225 | 2824640363 | 437 |
| 485 | iso_pu_bacteria | 2824644064 | 2824647842 | 437 |
| 486 | iso_pu_bacteria | 2824653114 | 2824655812 | 437 |
| 487 | iso_pu_bacteria | 2824696289 | 2824700649 | 437 |
| 488 | iso_pu_bacteria | 2824714736 | 2824718892 | 437 |
| 489 | iso_pu_bacteria | 2824723954 | 2824730568 | 437 |
| 490 | iso_pu_bacteria | 2824732956 | 2824735740 | 437 |
| 491 | iso_pu_bacteria | 2824746037 | 2824751684 | 437 |
| 492 | iso_pu_bacteria | 2838675328 | 2838679757 | 437 |
| 493 | iso_pu_bacteria | 2838714209 | 2838717473 | 437 |
| 494 | iso_pu_bacteria | 2838719591 | 2838724326 | 437 |
| 495 | iso_pu_bacteria | 2838724970 | 2838729357 | 437 |
| 496 | iso_pu_bacteria | 2841846520 | 2841850784 | 437 |
| 497 | iso_pu_bacteria | 2842124991 | 2842129589 | 437 |
| 498 | iso_pu_bacteria | 2842130223 | 2842134734 | 437 |
| 499 | iso_pu_bacteria | 2842152218 | 2842156748 | 437 |
| 500 | iso_pu_bacteria | 2842170452 | 2842173006 | 437 |
| 501 | iso_pu_bacteria | 2842175837 | 2842180366 | 437 |
| 502 | iso_pu_bacteria | 2842187318 | 2842191975 | 437 |
| 503 | iso_pu_bacteria | 2842211629 | 2842216291 | 437 |
| 504 | iso_pu_bacteria | 2842224351 | 2842229011 | 437 |
| 505 | iso_pu_bacteria | 2847930680 | 2847935077 | 437 |
| 506 | iso_pu_bacteria | 2847939898 | 2847945636 | 437 |
| 507 | iso_pu_bacteria | 2856320880 | 2856326250 | 437 |
| 508 | iso_pu_bacteria | 2857524615 | 2857530616 | 437 |
| 509 | iso_pu_bacteria | 2869278585 | 2869284127 | 437 |
| 510 | iso_pu_bacteria | 2874139085 | 2874144751 | 437 |
| 511 | iso_pu_bacteria | 2874604998 | 2874609407 | 437 |
| 512 | iso_pu_bacteria | 2874645413 | 2874651197 | 437 |
| 513 | iso_pu_bacteria | 2876808645 | 2876813208 | 437 |
| 514 | iso_pu_bacteria | 2878738818 | 2878743879 | 437 |
| 515 | iso_pu_bacteria | 2879110137 | 2879110370 | 437 |
| 516 | iso_pu_bacteria | 2881665667 | 2881673075 | 437 |
| 517 | iso_pu_bacteria | 2885326080 | 2885328942 | 437 |
| 518 | iso_pu_bacteria | 2885374607 | 2885374868 | 437 |
| 519 | iso_pu_bacteria | 2888378607 | 2888383063 | 437 |
| 520 | iso_pu_bacteria | 2888388044 | 2888394765 | 437 |
| 521 | iso_pu_bacteria | 2888419890 | 2888423521 | 437 |
| 522 | iso_pu_bacteria | 2889306138 | 2889307561 | 437 |
| 523 | iso_pu_bacteria | 2893066018 | 2893070261 | 437 |
| 524 | iso_pu_bacteria | 2899845264 | 2899848706 | 437 |
| 525 | iso_pu_bacteria | 2903748898 | 2903755738 | 437 |
| 526 | iso_pu_bacteria | 2904690495 | 2904696681 | 437 |
| 527 | iso_pu_bacteria | 2904699407 | 2904704330 | 437 |
| 528 | iso_pu_bacteria | 2906610324 | 2906617520 | 437 |
| 529 | iso_pu_bacteria | 2906635258 | 2906636177 | 437 |
| 530 | iso_pu_bacteria | 2906643746 | 2906647718 | 437 |
| 531 | iso_pu_bacteria | 2906660503 | 2906667980 | 437 |
| 532 | iso_pu_bacteria | 2908739725 | 2908743670 | 437 |
| 533 | iso_pu_bacteria | 2908756301 | 2908761302 | 437 |
| 534 | iso_pu_bacteria | 2919100787 | 2919102922 | 437 |
| 535 | iso_pu_bacteria | 2919114240 | 2919119225 | 437 |
| 536 | iso_pu_bacteria | 2922361189 | 2922367889 | 437 |
| 537 | iso_pu_bacteria | 2922393267 | 2922395454 | 437 |
| 538 | iso_pu_bacteria | 2922425934 | 2922429197 | 437 |
| 539 | iso_pu_bacteria | 2923153595 | 2923157138 | 437 |
| 540 | iso_pu_bacteria | 2924776078 | 2924781796 | 437 |
| 541 | iso_pu_bacteria | 2926754445 | 2926759256 | 437 |
| 542 | iso_pu_bacteria | 2926760298 | 2926763307 | 437 |
| 543 | iso_pu_bacteria | 2928959182 | 2928961953 | 437 |
| 544 | iso_pu_bacteria | 2932794094 | 2932796320 | 437 |
| 545 | iso_pu_bacteria | 2932801729 | 2932804374 | 437 |
| 546 | iso_pu_bacteria | 2933006813 | 2933011353 | 437 |
| 547 | iso_pu_bacteria | 2935630451 | 2935634212 | 437 |
| 548 | iso_pu_bacteria | 2935883170 | 2935888785 | 437 |
| 549 | iso_pu_bacteria | 2937836603 | 2937838504 | 437 |
| 550 | iso_pu_bacteria | 2937877337 | 2937884876 | 437 |
| 551 | iso_pu_bacteria | 2937972304 | 2937978148 | 437 |
| 552 | iso_pu_bacteria | 2941507105 | 2941511102 | 437 |
| 553 | iso_pu_bacteria | 2941515067 | 2941518486 | 437 |
| 554 | iso_pu_bacteria | 2941523033 | 2941527251 | 437 |
| 555 | iso_pu_bacteria | 2958034702 | 2958040516 | 437 |
| 556 | iso_pu_bacteria | 2958041894 | 2958055364 | 437 |
| 557 | iso_pu_bacteria | 2958084443 | 2958092185 | 437 |
| 558 | iso_pu_bacteria | 2968016561 | 2968021858 | 437 |
| 559 | iso_pu_bacteria | 2970469710 | 2970474448 | 437 |
| 560 | iso_pu_bacteria | 2970593180 | 2970598739 | 437 |
| 561 | iso_pu_bacteria | 2979089926 | 2979091660 | 437 |
| 562 | iso_pu_bacteria | 2979095461 | 2979097181 | 437 |
| 563 | iso_pu_bacteria | 2996348954 | 2996353857 | 437 |
| 564 | iso_pu_bacteria | 3004275668 | 3004280525 | 437 |
| 565 | iso_pu_bacteria | 3005445848 | 3005450857 | 437 |
| 566 | iso_pu_bacteria | 3005474847 | 3005479367 | 437 |
| 567 | iso_pu_bacteria | 3005483717 | 3005490047 | 437 |
| 568 | iso_pu_bacteria | 3005710791 | 3005713990 | 437 |
| 569 | iso_pu_bacteria | 3007395558 | 3007396052 | 437 |
| 570 | iso_pu_bacteria | 650716007 | 650842754 | 437 |
| 571 | iso_pu_bacteria | 8003570095 | 8003574644 | 437 |
| 572 | iso_pu_bacteria | 8006964411 | 8006968722 | 437 |
| 573 | iso_pu_bacteria | 8006984368 | 8006990537 | 437 |
| 574 | iso_pu_bacteria | 8015687852 | 8015691320 | 437 |
| 575 | iso_pu_bacteria | 8019555841 | 8019557689 | 437 |
| 576 | iso_pu_bacteria | 8019565922 | 8019567609 | 437 |
| 577 | iso_pu_bacteria | 8055770955 | 8055774496 | 437 |
| 578 | iso_pu_bacteria | 8056681323 | 8056684073 | 437 |
| 579 | iso_pu_bacteria | 8056689827 | 8056695773 | 437 |
| 580 | 3300009011 | Ga0105251_10000274 | Ga0105251_1000027426 | 438 |
| 581 | 3300009092 | Ga0105250_10000191 | Ga0105250_1000019128 | 438 |
| 582 | 3300009092 | Ga0105250_10030412 | Ga0105250_100304122 | 438 |
| 583 | 3300025711 | Ga0207696_1000078 | Ga0207696_1000078175 | 438 |
| 584 | 3300025711 | Ga0207696_1021437 | Ga0207696_10214372 | 438 |
| 585 | 3300025735 | Ga0207713_1000010 | Ga0207713_1000010329 | 438 |
| 586 | 3300046474 | Ga0495605_0009203 | Ga0495605_0009203_47_1363 | 438 |
| 587 | 3300046513 | Ga0495616_0003971 | Ga0495616_0003971_3587_4924 | 438 |
| 588 | 3300046519 | Ga0495632_0034577 | Ga0495632_0034577_842_2158 | 438 |
| 589 | 3300046660 | Ga0495625_0004731 | Ga0495625_0004731_11384_12700 | 438 |
| 590 | 3300046691 | Ga0495670_0009646 | Ga0495670_0009646_1030_2346 | 438 |
| 591 | 3300046810 | Ga0495660_0065580 | Ga0495660_0065580_443_1759 | 438 |
| 592 | 3300048091 | Ga0495626_0000162 | Ga0495626_0000162_18477_19814 | 438 |
| 593 | 3300049571 | Ga0501034_0000109 | Ga0501034_0000109_116542_117885 | 438 |
| 594 | 3300049584 | Ga0501068_0019486 | Ga0501068_0019486_873_2216 | 438 |
| 595 | 3300049823 | Ga0501044_0034874 | Ga0501044_0034874_740_2083 | 438 |
| 596 | 3300053079 | Ga0500610_0004055 | Ga0500610_0004055_3442_4758 | 438 |
| 597 | 3300053105 | Ga0500557_000223 | Ga0500557_000223_3969_5285 | 438 |
| 598 | iso_pu_bacteria | 2643221599 | 2644003071 | 438 |
| 599 | iso_pu_bacteria | 2643221634 | 2644191935 | 438 |
| 600 | iso_pu_bacteria | 2849076700 | 2849080186 | 438 |
| 601 | iso_pu_bacteria | 2857542790 | 2857546898 | 438 |
| 602 | iso_pu_bacteria | 3005452660 | 3005455211 | 438 |
| 603 | iso_pu_bacteria | 3007419365 | 3007419786 | 438 |
| 604 | 3300003752 | Ga0055539_1000102 | Ga0055539_100010266 | 439 |
| 605 | 3300003756 | Ga0055533_1000110 | Ga0055533_100011066 | 439 |
| 606 | 3300003758 | Ga0055532_1000138 | Ga0055532_100013842 | 439 |
| 607 | 3300003759 | Ga0055525_1000187 | Ga0055525_100018711 | 439 |
| 608 | 3300003761 | Ga0055535_1002951 | Ga0055535_10029512 | 439 |
| 609 | 3300003790 | Ga0055528_1001194 | Ga0055528_100119415 | 439 |
| 610 | 3300003841 | Ga0055541_1000068 | Ga0055541_100006841 | 439 |
| 611 | 3300009036 | Ga0105244_10013667 | Ga0105244_100136672 | 439 |
| 612 | 3300009036 | Ga0105244_10023885 | Ga0105244_100238852 | 439 |
| 613 | 3300009092 | Ga0105250_10000078 | Ga0105250_1000007848 | 439 |
| 614 | 3300011119 | Ga0105246_10009601 | Ga0105246_100096013 | 439 |
| 615 | 3300013105 | Ga0157369_10009585 | Ga0157369_100095857 | 439 |
| 616 | 3300013105 | Ga0157369_10142127 | Ga0157369_101421273 | 439 |
| 617 | 3300013296 | Ga0157374_10033704 | Ga0157374_100337046 | 439 |
| 618 | 3300013308 | Ga0157375_10000820 | Ga0157375_1000082014 | 439 |
| 619 | 3300013308 | Ga0157375_10019193 | Ga0157375_100191935 | 439 |
| 620 | 3300025206 | Ga0209435_100373 | Ga0209435_1003732 | 439 |
| 621 | 3300025224 | Ga0209784_100057 | Ga0209784_100057129 | 439 |
| 622 | 3300025225 | Ga0209566_100073 | Ga0209566_100073129 | 439 |
| 623 | 3300025226 | Ga0209674_100095 | Ga0209674_100095129 | 439 |
| 624 | 3300025229 | Ga0209147_100092 | Ga0209147_100092129 | 439 |
| 625 | 3300025230 | Ga0209563_100093 | Ga0209563_10009341 | 439 |
| 626 | 3300025242 | Ga0209258_100300 | Ga0209258_10030023 | 439 |
| 627 | 3300025246 | Ga0209646_1000617 | Ga0209646_100061711 | 439 |
| 628 | 3300025253 | Ga0209677_100054 | Ga0209677_100054129 | 439 |
| 629 | 3300025256 | Ga0209759_1010198 | Ga0209759_10101982 | 439 |
| 630 | 3300025273 | Ga0209673_1001694 | Ga0209673_10016943 | 439 |
| 631 | 3300025295 | Ga0209564_1004853 | Ga0209564_10048532 | 439 |
| 632 | 3300025299 | Ga0209256_1001947 | Ga0209256_10019473 | 439 |
| 633 | 3300025711 | Ga0207696_1000212 | Ga0207696_100021226 | 439 |
| 634 | 3300025728 | Ga0207655_1001362 | Ga0207655_10013624 | 439 |
| 635 | 3300025728 | Ga0207655_1014596 | Ga0207655_10145962 | 439 |
| 636 | 3300025735 | Ga0207713_1011892 | Ga0207713_10118922 | 439 |
| 637 | 3300025925 | Ga0207650_10002333 | Ga0207650_100023333 | 439 |
| 638 | 3300041452 | Ga0451793_1407387 | Ga0451793_1407387_298_1617 | 439 |
| 639 | 3300041453 | Ga0451797_0747061 | Ga0451797_0747061_1906_3225 | 439 |
| 640 | 3300041486 | Ga0451807_0031918 | Ga0451807_0031918_1919_3238 | 439 |
| 641 | 3300044901 | Ga0466960_0006169 | Ga0466960_0006169_2995_4314 | 439 |
| 642 | 3300046453 | Ga0495627_000962 | Ga0495627_000962_13366_14697 | 439 |
| 643 | 3300046458 | Ga0495591_001034 | Ga0495591_001034_5026_6357 | 439 |
| 644 | 3300046463 | Ga0495653_0002549 | Ga0495653_0002549_483_1838 | 439 |
| 645 | 3300046492 | Ga0495585_0033962 | Ga0495585_0033962_252_1607 | 439 |
| 646 | 3300046501 | Ga0495607_0003493 | Ga0495607_0003493_443_1774 | 439 |
| 647 | 3300046507 | Ga0495606_0000061 | Ga0495606_0000061_34589_35944 | 439 |
| 648 | 3300046507 | Ga0495606_0117021 | Ga0495606_0117021_74_1405 | 439 |
| 649 | 3300046512 | Ga0495610_0016998 | Ga0495610_0016998_502_1833 | 439 |
| 650 | 3300046513 | Ga0495616_0084874 | Ga0495616_0084874_110_1441 | 439 |
| 651 | 3300046519 | Ga0495632_0060532 | Ga0495632_0060532_348_1679 | 439 |
| 652 | 3300046520 | Ga0495637_0011909 | Ga0495637_0011909_2426_3757 | 439 |
| 653 | 3300046524 | Ga0495648_0001770 | Ga0495648_0001770_14329_15660 | 439 |
| 654 | 3300046530 | Ga0495654_0000732 | Ga0495654_0000732_17412_18743 | 439 |
| 655 | 3300046530 | Ga0495654_0019243 | Ga0495654_0019243_230_1561 | 439 |
| 656 | 3300046665 | Ga0495661_0000007 | Ga0495661_0000007_140215_141570 | 439 |
| 657 | 3300046665 | Ga0495661_0000154 | Ga0495661_0000154_52759_54090 | 439 |
| 658 | 3300046665 | Ga0495661_0012271 | Ga0495661_0012271_1290_2621 | 439 |
| 659 | 3300046694 | Ga0495649_0000685 | Ga0495649_0000685_13533_14864 | 439 |
| 660 | 3300046694 | Ga0495649_0008434 | Ga0495649_0008434_4486_5817 | 439 |
| 661 | 3300046794 | Ga0495589_0054925 | Ga0495589_0054925_234_1565 | 439 |
| 662 | 3300047323 | Ga0495683_0000099 | Ga0495683_0000099_59434_60765 | 439 |
| 663 | 3300047446 | Ga0495679_007354 | Ga0495679_007354_519_1850 | 439 |
| 664 | 3300048920 | Ga0496117_0000218 | Ga0496117_0000218_55365_56696 | 439 |
| 665 | 3300048920 | Ga0496117_0098792 | Ga0496117_0098792_54_1385 | 439 |
| 666 | 3300048921 | Ga0496118_0017938 | Ga0496118_0017938_1286_2605 | 439 |
| 667 | 3300048921 | Ga0496118_0037856 | Ga0496118_0037856_2370_3701 | 439 |
| 668 | 3300048922 | Ga0496119_0047055 | Ga0496119_0047055_259_1590 | 439 |
| 669 | 3300048923 | Ga0496120_0003789 | Ga0496120_0003789_4856_6187 | 439 |
| 670 | 3300048923 | Ga0496120_0072515 | Ga0496120_0072515_110_1429 | 439 |
| 671 | 3300048924 | Ga0496121_0000033 | Ga0496121_0000033_167771_169090 | 439 |
| 672 | 3300048924 | Ga0496121_0057807 | Ga0496121_0057807_1273_2604 | 439 |
| 673 | 3300048925 | Ga0496122_0066047 | Ga0496122_0066047_993_2324 | 439 |
| 674 | 3300048926 | Ga0496123_0041597 | Ga0496123_0041597_409_1728 | 439 |
| 675 | 3300048926 | Ga0496123_0046469 | Ga0496123_0046469_244_1563 | 439 |
| 676 | 3300048926 | Ga0496123_0050340 | Ga0496123_0050340_1011_2342 | 439 |
| 677 | 3300048927 | Ga0496124_0002048 | Ga0496124_0002048_21175_22506 | 439 |
| 678 | 3300048927 | Ga0496124_0051980 | Ga0496124_0051980_874_2193 | 439 |
| 679 | 3300048928 | Ga0496125_0000235 | Ga0496125_0000235_596_1927 | 439 |
| 680 | 3300048928 | Ga0496125_0000760 | Ga0496125_0000760_1067_2386 | 439 |
| 681 | 3300048928 | Ga0496125_0066080 | Ga0496125_0066080_585_1916 | 439 |
| 682 | 3300048929 | Ga0496126_0010785 | Ga0496126_0010785_7421_8752 | 439 |
| 683 | 3300053111 | Ga0500572_001371 | Ga0500572_001371_2663_3982 | 439 |
| 684 | 3300053161 | Ga0500634_0006837 | Ga0500634_0006837_1316_2647 | 439 |
| 685 | 3300053177 | Ga0500636_0000367 | Ga0500636_0000367_2291_3610 | 439 |
| 686 | iso_pu_bacteria | 2510065019 | 2510137779 | 439 |
| 687 | iso_pu_bacteria | 2510917028 | 2511183689 | 439 |
| 688 | iso_pu_bacteria | 2513237103 | 2513712757 | 439 |
| 689 | iso_pu_bacteria | 2513237138 | 2513871510 | 439 |
| 690 | iso_pu_bacteria | 2513237162 | 2514018973 | 439 |
| 691 | iso_pu_bacteria | 2515075009 | 2515109362 | 439 |
| 692 | iso_pu_bacteria | 2516653077 | 2517042235 | 439 |
| 693 | iso_pu_bacteria | 2517093000 | 2517099573 | 439 |
| 694 | iso_pu_bacteria | 2517287029 | 2517411774 | 439 |
| 695 | iso_pu_bacteria | 2582581867 | 2585400762 | 439 |
| 696 | iso_pu_bacteria | 2585427528 | 2585539365 | 439 |
| 697 | iso_pu_bacteria | 2585427590 | 2585819677 | 439 |
| 698 | iso_pu_bacteria | 2585427593 | 2585837319 | 439 |
| 699 | iso_pu_bacteria | 2599185214 | 2599626551 | 439 |
| 700 | iso_pu_bacteria | 2599185226 | 2599675615 | 439 |
| 701 | iso_pu_bacteria | 2599185227 | 2599684088 | 439 |
| 702 | iso_pu_bacteria | 2599185229 | 2599696102 | 439 |
| 703 | iso_pu_bacteria | 2602042107 | 2603859778 | 439 |
| 704 | iso_pu_bacteria | 2724679232 | 2725948178 | 439 |
| 705 | iso_pu_bacteria | 2791355260 | 2793322525 | 439 |
| 706 | iso_pu_bacteria | 2791355266 | 2793359904 | 439 |
| 707 | iso_pu_bacteria | 2842217011 | 2842222843 | 439 |
| 708 | iso_pu_bacteria | 2842775625 | 2842778766 | 439 |
| 709 | iso_pu_bacteria | 2857516855 | 2857522534 | 439 |
| 710 | iso_pu_bacteria | 2899924645 | 2899925008 | 439 |
| 711 | iso_pu_bacteria | 2919073203 | 2919076212 | 439 |
| 712 | iso_pu_bacteria | 2923556063 | 2923558115 | 439 |
| 713 | iso_pu_bacteria | 2928037797 | 2928038867 | 439 |
| 714 | iso_pu_bacteria | 2928044640 | 2928045528 | 439 |
| 715 | iso_pu_bacteria | 2928051484 | 2928053144 | 439 |
| 716 | iso_pu_bacteria | 2928064002 | 2928066750 | 439 |
| 717 | iso_pu_bacteria | 2928070936 | 2928071363 | 439 |
| 718 | iso_pu_bacteria | 2996887358 | 2996892465 | 439 |
| 719 | iso_pu_bacteria | 639633055 | 639645782 | 439 |
| 720 | iso_pu_bacteria | 8005258706 | 8005259765 | 439 |
| 721 | iso_pu_bacteria | 8005321885 | 8005326992 | 439 |
| 722 | iso_pu_bacteria | 8005460587 | 8005466490 | 439 |
| 723 | iso_pu_bacteria | 8005556819 | 8005558710 | 439 |
| 724 | iso_pu_bacteria | 8005563573 | 8005563681 | 439 |
| 725 | iso_pu_bacteria | 8018163183 | 8018164064 | 439 |
| 726 | iso_pu_bacteria | 8057874678 | 8057876884 | 439 |
| 727 | 3300003187 | JGI25151J46595_10000613 | JGI25151J46595_1000061325 | 440 |
| 728 | 3300003187 | JGI25151J46595_10039711 | JGI25151J46595_100397111 | 440 |
| 729 | 3300003354 | JGI25160J50197_1007040 | JGI25160J50197_10070403 | 440 |
| 730 | 3300005262 | Ga0065165_1000393 | Ga0065165_100039323 | 440 |
| 731 | 3300005337 | Ga0070682_100077440 | Ga0070682_1000774402 | 440 |
| 732 | 3300005436 | Ga0070713_100067291 | Ga0070713_1000672912 | 440 |
| 733 | 3300006847 | Ga0075431_100001187 | Ga0075431_1000011873 | 440 |
| 734 | 3300007076 | Ga0075435_100096255 | Ga0075435_1000962552 | 440 |
| 735 | 3300009094 | Ga0111539_10026576 | Ga0111539_100265763 | 440 |
| 736 | 3300009147 | Ga0114129_10033150 | Ga0114129_100331504 | 440 |
| 737 | 3300013102 | Ga0157371_10000042 | Ga0157371_10000042104 | 440 |
| 738 | 3300013104 | Ga0157370_10000035 | Ga0157370_1000003554 | 440 |
| 739 | 3300021361 | Ga0213872_10023178 | Ga0213872_100231782 | 440 |
| 740 | 3300021384 | Ga0213876_10038944 | Ga0213876_100389442 | 440 |
| 741 | 3300025284 | Ga0209130_1000061 | Ga0209130_100006125 | 440 |
| 742 | 3300025284 | Ga0209130_1001275 | Ga0209130_100127513 | 440 |
| 743 | 3300025294 | Ga0209025_1000486 | Ga0209025_100048625 | 440 |
| 744 | 3300025294 | Ga0209025_1002869 | Ga0209025_10028698 | 440 |
| 745 | 3300025294 | Ga0209025_1041756 | Ga0209025_10417561 | 440 |
| 746 | 3300025297 | Ga0209758_1002282 | Ga0209758_100228211 | 440 |
| 747 | 3300025302 | Ga0207426_1000451 | Ga0207426_100045134 | 440 |
| 748 | 3300039437 | Ga0436365_1607850 | Ga0436365_1607850_13092_14420 | 440 |
| 749 | 3300039447 | Ga0436361_0294136 | Ga0436361_0294136_1085_2407 | 440 |
| 750 | 3300046543 | Ga0495645_0112991 | Ga0495645_0112991_402_1739 | 440 |
| 751 | 3300046558 | Ga0495633_0030237 | Ga0495633_0030237_11_1339 | 440 |
| 752 | 3300048916 | Ga0496113_0179574 | Ga0496113_0179574_191_1519 | 440 |
| 753 | 3300048920 | Ga0496117_0000036 | Ga0496117_0000036_218386_219714 | 440 |
| 754 | 3300048922 | Ga0496119_0032141 | Ga0496119_0032141_2109_3437 | 440 |
| 755 | 3300048923 | Ga0496120_0000036 | Ga0496120_0000036_124124_125452 | 440 |
| 756 | 3300048925 | Ga0496122_0000002 | Ga0496122_0000002_661653_662981 | 440 |
| 757 | 3300048926 | Ga0496123_0000002 | Ga0496123_0000002_1148702_1150030 | 440 |
| 758 | 3300048926 | Ga0496123_0000002 | Ga0496123_0000002_661653_662981 | 440 |
| 759 | 3300048927 | Ga0496124_0000259 | Ga0496124_0000259_54560_55918 | 440 |
| 760 | 3300049593 | Ga0501077_0023333 | Ga0501077_0023333_2044_3369 | 440 |
| 761 | 3300049743 | Ga0501081_0034632 | Ga0501081_0034632_213_1538 | 440 |
| 762 | 3300049824 | Ga0501045_0088025 | Ga0501045_0088025_235_1560 | 440 |
| 763 | 3300050491 | nmdc:mga00v17_19_c1 | nmdc:mga00v17_19_c1_63963_65291 | 440 |
| 764 | 3300050492 | nmdc:mga0yw44_386_c1 | nmdc:mga0yw44_386_c1_11942_13270 | 440 |
| 765 | 3300050508 | nmdc:mga09592_38638_c1 | nmdc:mga09592_38638_c1_1039_2364 | 440 |
| 766 | 3300050509 | nmdc:mga0qj67_106915_c1 | nmdc:mga0qj67_106915_c1_465_1790 | 440 |
| 767 | 3300050511 | nmdc:mga08y16_13395_c1 | nmdc:mga08y16_13395_c1_1967_3304 | 440 |
| 768 | 3300053107 | Ga0500560_000050 | Ga0500560_000050_3461_4789 | 440 |
| 769 | 3300053157 | Ga0500624_000424 | Ga0500624_000424_8074_9402 | 440 |
| 770 | 3300054114 | Ga0501084_0118168 | Ga0501084_0118168_737_2062 | 440 |
| 771 | 3300060353 | Ga0501082_0055942 | Ga0501082_0055942_1986_3311 | 440 |
| 772 | 3300061734 | Ga0530510_0202558 | Ga0530510_0202558_39_1364 | 440 |
| 773 | iso_pu_bacteria | 2511231021 | 2511355673 | 440 |
| 774 | iso_pu_bacteria | 2738541277 | 2738717968 | 440 |
| 775 | iso_pu_bacteria | 2738543019 | 2739278654 | 440 |
| 776 | iso_pu_bacteria | 2831426010 | 2831428903 | 440 |
| 777 | iso_pu_bacteria | 2848694841 | 2848697371 | 440 |
| 778 | iso_pu_bacteria | 2946027586 | 2946031630 | 440 |
| 779 | 3300003203 | JGI25406J46586_10000006 | JGI25406J46586_100000063 | 441 |
| 780 | 3300003203 | JGI25406J46586_10002914 | JGI25406J46586_100029147 | 441 |
| 781 | 3300003215 | JGI25153J46596_10042717 | JGI25153J46596_100427171 | 441 |
| 782 | 3300005288 | Ga0065714_10011017 | Ga0065714_100110173 | 441 |
| 783 | 3300005329 | Ga0070683_100056257 | Ga0070683_1000562571 | 441 |
| 784 | 3300005329 | Ga0070683_100071169 | Ga0070683_1000711692 | 441 |
| 785 | 3300005336 | Ga0070680_100074218 | Ga0070680_1000742182 | 441 |
| 786 | 3300005347 | Ga0070668_100006327 | Ga0070668_1000063274 | 441 |
| 787 | 3300005347 | Ga0070668_100019325 | Ga0070668_1000193253 | 441 |
| 788 | 3300005347 | Ga0070668_100048293 | Ga0070668_1000482931 | 441 |
| 789 | 3300005353 | Ga0070669_100032753 | Ga0070669_1000327532 | 441 |
| 790 | 3300005367 | Ga0070667_100003665 | Ga0070667_1000036654 | 441 |
| 791 | 3300005434 | Ga0070709_10004497 | Ga0070709_100044978 | 441 |
| 792 | 3300005434 | Ga0070709_10026694 | Ga0070709_100266942 | 441 |
| 793 | 3300005435 | Ga0070714_100091486 | Ga0070714_1000914862 | 441 |
| 794 | 3300005436 | Ga0070713_100091636 | Ga0070713_1000916362 | 441 |
| 795 | 3300005436 | Ga0070713_100117112 | Ga0070713_1001171123 | 441 |
| 796 | 3300005439 | Ga0070711_100055615 | Ga0070711_1000556153 | 441 |
| 797 | 3300005458 | Ga0070681_10044250 | Ga0070681_100442503 | 441 |
| 798 | 3300005535 | Ga0070684_100158321 | Ga0070684_1001583211 | 441 |
| 799 | 3300005536 | Ga0070697_100047675 | Ga0070697_1000476754 | 441 |
| 800 | 3300005536 | Ga0070697_100052582 | Ga0070697_1000525822 | 441 |
| 801 | 3300005539 | Ga0068853_100055368 | Ga0068853_1000553682 | 441 |
| 802 | 3300005539 | Ga0068853_100061917 | Ga0068853_1000619173 | 441 |
| 803 | 3300005548 | Ga0070665_100011759 | Ga0070665_1000117591 | 441 |
| 804 | 3300005548 | Ga0070665_100023461 | Ga0070665_1000234615 | 441 |
| 805 | 3300005563 | Ga0068855_100048315 | Ga0068855_1000483154 | 441 |
| 806 | 3300005578 | Ga0068854_100044261 | Ga0068854_1000442612 | 441 |
| 807 | 3300005614 | Ga0068856_100000427 | Ga0068856_10000042722 | 441 |
| 808 | 3300005617 | Ga0068859_100002889 | Ga0068859_10000288912 | 441 |
| 809 | 3300005617 | Ga0068859_100197269 | Ga0068859_1001972691 | 441 |
| 810 | 3300005834 | Ga0068851_10035695 | Ga0068851_100356952 | 441 |
| 811 | 3300005841 | Ga0068863_100245583 | Ga0068863_1002455832 | 441 |
| 812 | 3300005843 | Ga0068860_100294113 | Ga0068860_1002941131 | 441 |
| 813 | 3300005844 | Ga0068862_100258304 | Ga0068862_1002583042 | 441 |
| 814 | 3300005937 | Ga0081455_10000764 | Ga0081455_1000076412 | 441 |
| 815 | 3300005981 | Ga0081538_10005836 | Ga0081538_100058369 | 441 |
| 816 | 3300005983 | Ga0081540_1000916 | Ga0081540_10009162 | 441 |
| 817 | 3300005983 | Ga0081540_1001739 | Ga0081540_10017392 | 441 |
| 818 | 3300005983 | Ga0081540_1002782 | Ga0081540_10027826 | 441 |
| 819 | 3300005983 | Ga0081540_1013100 | Ga0081540_10131005 | 441 |
| 820 | 3300005983 | Ga0081540_1021438 | Ga0081540_10214384 | 441 |
| 821 | 3300005983 | Ga0081540_1049839 | Ga0081540_10498392 | 441 |
| 822 | 3300005985 | Ga0081539_10000176 | Ga0081539_10000176120 | 441 |
| 823 | 3300005985 | Ga0081539_10000231 | Ga0081539_10000231124 | 441 |
| 824 | 3300006028 | Ga0070717_10076107 | Ga0070717_100761073 | 441 |
| 825 | 3300006042 | Ga0075368_10002158 | Ga0075368_100021583 | 441 |
| 826 | 3300006048 | Ga0075363_100002264 | Ga0075363_1000022645 | 441 |
| 827 | 3300006175 | Ga0070712_100028636 | Ga0070712_1000286365 | 441 |
| 828 | 3300006846 | Ga0075430_100155975 | Ga0075430_1001559752 | 441 |
| 829 | 3300006931 | Ga0097620_100002889 | Ga0097620_10000288912 | 441 |
| 830 | 3300006931 | Ga0097620_100197255 | Ga0097620_1001972551 | 441 |
| 831 | 3300006942 | Ga0099824_1006719 | Ga0099824_10067195 | 441 |
| 832 | 3300006943 | Ga0099822_1001392 | Ga0099822_10013925 | 441 |
| 833 | 3300007265 | Ga0099794_10048101 | Ga0099794_100481011 | 441 |
| 834 | 3300009093 | Ga0105240_10086641 | Ga0105240_100866412 | 441 |
| 835 | 3300009174 | Ga0105241_10230665 | Ga0105241_102306651 | 441 |
| 836 | 3300009545 | Ga0105237_10026637 | Ga0105237_100266375 | 441 |
| 837 | 3300009545 | Ga0105237_10216874 | Ga0105237_102168742 | 441 |
| 838 | 3300009551 | Ga0105238_10007002 | Ga0105238_100070022 | 441 |
| 839 | 3300009553 | Ga0105249_10315408 | Ga0105249_103154081 | 441 |
| 840 | 3300010375 | Ga0105239_10064579 | Ga0105239_100645792 | 441 |
| 841 | 3300010375 | Ga0105239_10091118 | Ga0105239_100911181 | 441 |
| 842 | 3300013102 | Ga0157371_10083815 | Ga0157371_100838152 | 441 |
| 843 | 3300013104 | Ga0157370_10227157 | Ga0157370_102271571 | 441 |
| 844 | 3300013105 | Ga0157369_10006177 | Ga0157369_1000617711 | 441 |
| 845 | 3300013296 | Ga0157374_10037116 | Ga0157374_100371164 | 441 |
| 846 | 3300013296 | Ga0157374_10072122 | Ga0157374_100721221 | 441 |
| 847 | 3300013297 | Ga0157378_10009614 | Ga0157378_100096145 | 441 |
| 848 | 3300025297 | Ga0209758_1001732 | Ga0209758_100173213 | 441 |
| 849 | 3300025297 | Ga0209758_1001986 | Ga0209758_10019866 | 441 |
| 850 | 3300025297 | Ga0209758_1003786 | Ga0209758_100378610 | 441 |
| 851 | 3300025297 | Ga0209758_1023382 | Ga0209758_10233822 | 441 |
| 852 | 3300025906 | Ga0207699_10062447 | Ga0207699_100624471 | 441 |
| 853 | 3300025907 | Ga0207645_10043988 | Ga0207645_100439883 | 441 |
| 854 | 3300025909 | Ga0207705_10163338 | Ga0207705_101633381 | 441 |
| 855 | 3300025910 | Ga0207684_10114167 | Ga0207684_101141671 | 441 |
| 856 | 3300025912 | Ga0207707_10029007 | Ga0207707_100290076 | 441 |
| 857 | 3300025912 | Ga0207707_10056027 | Ga0207707_100560272 | 441 |
| 858 | 3300025912 | Ga0207707_10080667 | Ga0207707_100806672 | 441 |
| 859 | 3300025913 | Ga0207695_10043878 | Ga0207695_100438782 | 441 |
| 860 | 3300025914 | Ga0207671_10009517 | Ga0207671_100095178 | 441 |
| 861 | 3300025914 | Ga0207671_10050623 | Ga0207671_100506232 | 441 |
| 862 | 3300025914 | Ga0207671_10082481 | Ga0207671_100824812 | 441 |
| 863 | 3300025916 | Ga0207663_10111722 | Ga0207663_101117222 | 441 |
| 864 | 3300025917 | Ga0207660_10003538 | Ga0207660_100035385 | 441 |
| 865 | 3300025919 | Ga0207657_10085467 | Ga0207657_100854672 | 441 |
| 866 | 3300025921 | Ga0207652_10010392 | Ga0207652_100103925 | 441 |
| 867 | 3300025921 | Ga0207652_10057070 | Ga0207652_100570704 | 441 |
| 868 | 3300025923 | Ga0207681_10001413 | Ga0207681_100014133 | 441 |
| 869 | 3300025928 | Ga0207700_10032960 | Ga0207700_100329602 | 441 |
| 870 | 3300025928 | Ga0207700_10053019 | Ga0207700_100530193 | 441 |
| 871 | 3300025929 | Ga0207664_10097018 | Ga0207664_100970181 | 441 |
| 872 | 3300025931 | Ga0207644_10218694 | Ga0207644_102186941 | 441 |
| 873 | 3300025941 | Ga0207711_10084540 | Ga0207711_100845401 | 441 |
| 874 | 3300025942 | Ga0207689_10046690 | Ga0207689_100466902 | 441 |
| 875 | 3300025944 | Ga0207661_10034196 | Ga0207661_100341962 | 441 |
| 876 | 3300025949 | Ga0207667_10046644 | Ga0207667_100466441 | 441 |
| 877 | 3300025949 | Ga0207667_10161664 | Ga0207667_101616643 | 441 |
| 878 | 3300025961 | Ga0207712_10184219 | Ga0207712_101842191 | 441 |
| 879 | 3300025972 | Ga0207668_10042899 | Ga0207668_100428994 | 441 |
| 880 | 3300025981 | Ga0207640_10030435 | Ga0207640_100304354 | 441 |
| 881 | 3300025981 | Ga0207640_10138929 | Ga0207640_101389291 | 441 |
| 882 | 3300025986 | Ga0207658_10004077 | Ga0207658_100040773 | 441 |
| 883 | 3300026035 | Ga0207703_10260727 | Ga0207703_102607271 | 441 |
| 884 | 3300026041 | Ga0207639_10075984 | Ga0207639_100759842 | 441 |
| 885 | 3300026041 | Ga0207639_10088242 | Ga0207639_100882422 | 441 |
| 886 | 3300026078 | Ga0207702_10002818 | Ga0207702_100028186 | 441 |
| 887 | 3300026078 | Ga0207702_10043495 | Ga0207702_100434953 | 441 |
| 888 | 3300026116 | Ga0207674_10092290 | Ga0207674_100922901 | 441 |
| 889 | 3300026121 | Ga0207683_10158234 | Ga0207683_101582341 | 441 |
| 890 | 3300027357 | Ga0209589_1000023 | Ga0209589_1000023176 | 441 |
| 891 | 3300027361 | Ga0209489_100032 | Ga0209489_100032176 | 441 |
| 892 | 3300027363 | Ga0209700_100040 | Ga0209700_100040176 | 441 |
| 893 | 3300028379 | Ga0268266_10004462 | Ga0268266_100044622 | 441 |
| 894 | 3300028379 | Ga0268266_10014083 | Ga0268266_100140832 | 441 |
| 895 | 3300028379 | Ga0268266_10056761 | Ga0268266_100567612 | 441 |
| 896 | 3300028379 | Ga0268266_10166119 | Ga0268266_101661192 | 441 |
| 897 | 3300028379 | Ga0268266_10192613 | Ga0268266_101926131 | 441 |
| 898 | 3300028794 | Ga0307515_10082124 | Ga0307515_100821243 | 441 |
| 899 | 3300031507 | Ga0307509_10147409 | Ga0307509_101474092 | 441 |
| 900 | 3300031616 | Ga0307508_10000010 | Ga0307508_10000010245 | 441 |
| 901 | 3300031711 | Ga0265314_10047018 | Ga0265314_100470183 | 441 |
| 902 | 3300032002 | Ga0307416_100284656 | Ga0307416_1002846561 | 441 |
| 903 | 3300033179 | Ga0307507_10063344 | Ga0307507_100633442 | 441 |
| 904 | 3300033180 | Ga0307510_10007185 | Ga0307510_1000718512 | 441 |
| 905 | 3300033442 | Ga0315911_1000029 | Ga0315911_100002914 | 441 |
| 906 | 3300035086 | Ga0373934_0006326 | Ga0373934_0006326_114_1439 | 441 |
| 907 | 3300035090 | Ga0373949_0014712 | Ga0373949_0014712_361_1689 | 441 |
| 908 | 3300035113 | Ga0373936_0052766 | Ga0373936_0052766_212_1537 | 441 |
| 909 | 3300035117 | Ga0373953_0000640 | Ga0373953_0000640_7338_8663 | 441 |
| 910 | 3300035118 | Ga0373954_0000067 | Ga0373954_0000067_11604_12929 | 441 |
| 911 | 3300035120 | Ga0373957_0001550 | Ga0373957_0001550_787_2112 | 441 |
| 912 | 3300035172 | Ga0373955_0003543 | Ga0373955_0003543_2900_4225 | 441 |
| 913 | 3300035410 | Ga0373924_0006108 | Ga0373924_0006108_2905_4230 | 441 |
| 914 | 3300035692 | Ga0373935_0093265 | Ga0373935_0093265_332_1657 | 441 |
| 915 | 3300035692 | Ga0373935_0141194 | Ga0373935_0141194_226_1551 | 441 |
| 916 | 3300035695 | Ga0373927_0017434 | Ga0373927_0017434_1635_2960 | 441 |
| 917 | 3300035724 | Ga0373933_0000324 | Ga0373933_0000324_6768_8093 | 441 |
| 918 | 3300035725 | Ga0373947_0011851 | Ga0373947_0011851_3086_4411 | 441 |
| 919 | 3300035725 | Ga0373947_0015707 | Ga0373947_0015707_248_1573 | 441 |
| 920 | 3300036401 | Ga0373937_0001425 | Ga0373937_0001425_17574_18899 | 441 |
| 921 | 3300036401 | Ga0373937_0025703 | Ga0373937_0025703_1532_2857 | 441 |
| 922 | 3300037068 | Ga0373925_0063685 | Ga0373925_0063685_1121_2446 | 441 |
| 923 | 3300037068 | Ga0373925_0086422 | Ga0373925_0086422_753_2105 | 441 |
| 924 | 3300037418 | Ga0395900_0001064 | Ga0395900_0001064_12079_13404 | 441 |
| 925 | 3300037466 | Ga0395898_0151633 | Ga0395898_0151633_58_1383 | 441 |
| 926 | 3300037471 | Ga0395905_0035462 | Ga0395905_0035462_2056_3393 | 441 |
| 927 | 3300038443 | Ga0395901_0035567 | Ga0395901_0035567_2871_4196 | 441 |
| 928 | 3300039437 | Ga0436365_0871323 | Ga0436365_0871323_132_1457 | 441 |
| 929 | 3300039447 | Ga0436361_0488499 | Ga0436361_0488499_1819_3144 | 441 |
| 930 | 3300039447 | Ga0436361_0983753 | Ga0436361_0983753_288_1613 | 441 |
| 931 | 3300039450 | Ga0436363_1134489 | Ga0436363_1134489_36_1361 | 441 |
| 932 | 3300041413 | Ga0439465_0020010 | Ga0439465_0020010_97_1422 | 441 |
| 933 | 3300044658 | Ga0466972_0000076 | Ga0466972_0000076_69119_70444 | 441 |
| 934 | 3300044693 | Ga0466961_0000600 | Ga0466961_0000600_13667_14992 | 441 |
| 935 | 3300044694 | Ga0466963_0066091 | Ga0466963_0066091_985_2310 | 441 |
| 936 | 3300045049 | Ga0466959_0000651 | Ga0466959_0000651_17785_19110 | 441 |
| 937 | 3300045049 | Ga0466959_0003113 | Ga0466959_0003113_5496_6821 | 441 |
| 938 | 3300045836 | Ga0466958_0050355 | Ga0466958_0050355_84_1409 | 441 |
| 939 | 3300046454 | Ga0495592_0001030 | Ga0495592_0001030_10059_11384 | 441 |
| 940 | 3300046455 | Ga0495603_0059365 | Ga0495603_0059365_449_1774 | 441 |
| 941 | 3300046459 | Ga0495629_0000398 | Ga0495629_0000398_6461_7786 | 441 |
| 942 | 3300046462 | Ga0495651_0004166 | Ga0495651_0004166_1481_2806 | 441 |
| 943 | 3300046463 | Ga0495653_0000598 | Ga0495653_0000598_25741_27066 | 441 |
| 944 | 3300046473 | Ga0495582_0116066 | Ga0495582_0116066_108_1433 | 441 |
| 945 | 3300046474 | Ga0495605_0000158 | Ga0495605_0000158_17456_18814 | 441 |
| 946 | 3300046474 | Ga0495605_0000220 | Ga0495605_0000220_60977_62314 | 441 |
| 947 | 3300046501 | Ga0495607_0000013 | Ga0495607_0000013_104177_105514 | 441 |
| 948 | 3300046501 | Ga0495607_0000032 | Ga0495607_0000032_104204_105604 | 441 |
| 949 | 3300046506 | Ga0495583_0000086 | Ga0495583_0000086_58319_59644 | 441 |
| 950 | 3300046507 | Ga0495606_0004653 | Ga0495606_0004653_2509_3834 | 441 |
| 951 | 3300046507 | Ga0495606_0088820 | Ga0495606_0088820_567_1892 | 441 |
| 952 | 3300046511 | Ga0495608_0071490 | Ga0495608_0071490_902_2227 | 441 |
| 953 | 3300046516 | Ga0495628_0017882 | Ga0495628_0017882_2137_3534 | 441 |
| 954 | 3300046516 | Ga0495628_0030305 | Ga0495628_0030305_1787_3112 | 441 |
| 955 | 3300046522 | Ga0495643_0065956 | Ga0495643_0065956_569_1894 | 441 |
| 956 | 3300046524 | Ga0495648_0000552 | Ga0495648_0000552_35113_36438 | 441 |
| 957 | 3300046529 | Ga0495652_0009435 | Ga0495652_0009435_2423_3748 | 441 |
| 958 | 3300046530 | Ga0495654_0000117 | Ga0495654_0000117_5189_6514 | 441 |
| 959 | 3300046536 | Ga0495587_0018340 | Ga0495587_0018340_2423_3748 | 441 |
| 960 | 3300046542 | Ga0495597_0000013 | Ga0495597_0000013_113953_115290 | 441 |
| 961 | 3300046542 | Ga0495597_0033929 | Ga0495597_0033929_415_1773 | 441 |
| 962 | 3300046543 | Ga0495645_0090314 | Ga0495645_0090314_732_2057 | 441 |
| 963 | 3300046559 | Ga0495667_0000305 | Ga0495667_0000305_21928_23253 | 441 |
| 964 | 3300046660 | Ga0495625_0032089 | Ga0495625_0032089_576_1913 | 441 |
| 965 | 3300046663 | Ga0495635_0000102 | Ga0495635_0000102_27371_28696 | 441 |
| 966 | 3300046663 | Ga0495635_0069033 | Ga0495635_0069033_816_2141 | 441 |
| 967 | 3300046674 | Ga0495588_0012716 | Ga0495588_0012716_594_1919 | 441 |
| 968 | 3300046675 | Ga0495657_0000677 | Ga0495657_0000677_28721_30046 | 441 |
| 969 | 3300046678 | Ga0495599_0001882 | Ga0495599_0001882_7570_8895 | 441 |
| 970 | 3300046679 | Ga0495623_0005677 | Ga0495623_0005677_489_1814 | 441 |
| 971 | 3300046680 | Ga0495646_0005928 | Ga0495646_0005928_3034_4359 | 441 |
| 972 | 3300046689 | Ga0495613_0183622 | Ga0495613_0183622_33_1430 | 441 |
| 973 | 3300046690 | Ga0495624_0053891 | Ga0495624_0053891_507_1832 | 441 |
| 974 | 3300046810 | Ga0495660_0000333 | Ga0495660_0000333_37866_39203 | 441 |
| 975 | 3300046810 | Ga0495660_0003395 | Ga0495660_0003395_1639_2976 | 441 |
| 976 | 3300047317 | Ga0495604_0001099 | Ga0495604_0001099_3761_5086 | 441 |
| 977 | 3300047319 | Ga0495674_0013937 | Ga0495674_0013937_2823_4148 | 441 |
| 978 | 3300047320 | Ga0495672_0029603 | Ga0495672_0029603_491_1816 | 441 |
| 979 | 3300047320 | Ga0495672_0036625 | Ga0495672_0036625_74_1474 | 441 |
| 980 | 3300047322 | Ga0495680_0018405 | Ga0495680_0018405_3141_4466 | 441 |
| 981 | 3300047443 | Ga0495687_000572 | Ga0495687_000572_15155_16480 | 441 |
| 982 | 3300047443 | Ga0495687_035975 | Ga0495687_035975_624_1949 | 441 |
| 983 | 3300047443 | Ga0495687_052619 | Ga0495687_052619_319_1644 | 441 |
| 984 | 3300047444 | Ga0495675_0024914 | Ga0495675_0024914_626_1951 | 441 |
| 985 | 3300047470 | Ga0495681_0037021 | Ga0495681_0037021_765_2090 | 441 |
| 986 | 3300047471 | Ga0495684_0000088 | Ga0495684_0000088_25883_27208 | 441 |
| 987 | 3300047673 | Ga0495593_0009454 | Ga0495593_0009454_3265_4590 | 441 |
| 988 | 3300048088 | Ga0495602_0028311 | Ga0495602_0028311_3138_4463 | 441 |
| 989 | 3300048903 | Ga0496100_0010556 | Ga0496100_0010556_1233_2675 | 441 |
| 990 | 3300048903 | Ga0496100_0018696 | Ga0496100_0018696_2093_3418 | 441 |
| 991 | 3300048904 | Ga0496101_0008338 | Ga0496101_0008338_1204_2646 | 441 |
| 992 | 3300048904 | Ga0496101_0117825 | Ga0496101_0117825_25_1350 | 441 |
| 993 | 3300048905 | Ga0496102_0000613 | Ga0496102_0000613_1233_2675 | 441 |
| 994 | 3300048905 | Ga0496102_0002326 | Ga0496102_0002326_6422_7747 | 441 |
| 995 | 3300048906 | Ga0496103_0002825 | Ga0496103_0002825_8122_9564 | 441 |
| 996 | 3300048906 | Ga0496103_0008910 | Ga0496103_0008910_109_1434 | 441 |
| 997 | 3300048906 | Ga0496103_0090578 | Ga0496103_0090578_336_1661 | 441 |
| 998 | 3300048907 | Ga0496104_0002277 | Ga0496104_0002277_13882_15324 | 441 |
| 999 | 3300048907 | Ga0496104_0036850 | Ga0496104_0036850_3133_4458 | 441 |
| 1000 | 3300048907 | Ga0496104_0038908 | Ga0496104_0038908_1262_2587 | 441 |
| 1001 | 3300048907 | Ga0496104_0096350 | Ga0496104_0096350_609_1934 | 441 |
| 1002 | 3300048908 | Ga0496105_0001309 | Ga0496105_0001309_1233_2675 | 441 |
| 1003 | 3300048908 | Ga0496105_0055730 | Ga0496105_0055730_994_2319 | 441 |
| 1004 | 3300048909 | Ga0496106_0001425 | Ga0496106_0001425_16243_17568 | 441 |
| 1005 | 3300048910 | Ga0496107_0014938 | Ga0496107_0014938_3945_5270 | 441 |
| 1006 | 3300048911 | Ga0496108_0029179 | Ga0496108_0029179_210_1535 | 441 |
| 1007 | 3300048911 | Ga0496108_0139543 | Ga0496108_0139543_168_1493 | 441 |
| 1008 | 3300048913 | Ga0496110_0142856 | Ga0496110_0142856_44_1369 | 441 |
| 1009 | 3300048914 | Ga0496111_0098314 | Ga0496111_0098314_174_1499 | 441 |
| 1010 | 3300048915 | Ga0496112_0016228 | Ga0496112_0016228_1720_3162 | 441 |
| 1011 | 3300048915 | Ga0496112_0215061 | Ga0496112_0215061_98_1423 | 441 |
| 1012 | 3300048916 | Ga0496113_0000100 | Ga0496113_0000100_8137_9579 | 441 |
| 1013 | 3300048917 | Ga0496114_0081585 | Ga0496114_0081585_1066_2391 | 441 |
| 1014 | 3300048917 | Ga0496114_0120405 | Ga0496114_0120405_95_1420 | 441 |
| 1015 | 3300048918 | Ga0496115_0003736 | Ga0496115_0003736_261_1586 | 441 |
| 1016 | 3300048920 | Ga0496117_0017563 | Ga0496117_0017563_1213_2655 | 441 |
| 1017 | 3300048920 | Ga0496117_0043984 | Ga0496117_0043984_1505_2830 | 441 |
| 1018 | 3300048921 | Ga0496118_0002112 | Ga0496118_0002112_22560_23885 | 441 |
| 1019 | 3300048922 | Ga0496119_0003738 | Ga0496119_0003738_12898_14340 | 441 |
| 1020 | 3300048922 | Ga0496119_0005237 | Ga0496119_0005237_1127_2452 | 441 |
| 1021 | 3300048923 | Ga0496120_0004974 | Ga0496120_0004974_1225_2667 | 441 |
| 1022 | 3300048924 | Ga0496121_0000077 | Ga0496121_0000077_225283_226608 | 441 |
| 1023 | 3300048924 | Ga0496121_0009406 | Ga0496121_0009406_1077_2519 | 441 |
| 1024 | 3300048924 | Ga0496121_0023336 | Ga0496121_0023336_806_2131 | 441 |
| 1025 | 3300048925 | Ga0496122_0021606 | Ga0496122_0021606_3079_4521 | 441 |
| 1026 | 3300048926 | Ga0496123_0004528 | Ga0496123_0004528_11845_13287 | 441 |
| 1027 | 3300048927 | Ga0496124_0000812 | Ga0496124_0000812_4958_6349 | 441 |
| 1028 | 3300048927 | Ga0496124_0001166 | Ga0496124_0001166_32218_33543 | 441 |
| 1029 | 3300048927 | Ga0496124_0001679 | Ga0496124_0001679_12721_14163 | 441 |
| 1030 | 3300048928 | Ga0496125_0000681 | Ga0496125_0000681_1471_2799 | 441 |
| 1031 | 3300048928 | Ga0496125_0006813 | Ga0496125_0006813_9587_11029 | 441 |
| 1032 | 3300048928 | Ga0496125_0127718 | Ga0496125_0127718_437_1762 | 441 |
| 1033 | 3300048929 | Ga0496126_0002030 | Ga0496126_0002030_9615_10940 | 441 |
| 1034 | 3300048929 | Ga0496126_0004349 | Ga0496126_0004349_14319_15761 | 441 |
| 1035 | 3300048929 | Ga0496126_0040697 | Ga0496126_0040697_220_1545 | 441 |
| 1036 | 3300048929 | Ga0496126_0103810 | Ga0496126_0103810_1070_2395 | 441 |
| 1037 | 3300048929 | Ga0496126_0127421 | Ga0496126_0127421_504_1829 | 441 |
| 1038 | 3300049580 | Ga0501046_0158687 | Ga0501046_0158687_99_1424 | 441 |
| 1039 | 3300049586 | Ga0501070_0006242 | Ga0501070_0006242_7616_8941 | 441 |
| 1040 | 3300049589 | Ga0501073_0023935 | Ga0501073_0023935_109_1434 | 441 |
| 1041 | 3300049590 | Ga0501074_0015583 | Ga0501074_0015583_2022_3347 | 441 |
| 1042 | 3300049593 | Ga0501077_0030316 | Ga0501077_0030316_1784_3109 | 441 |
| 1043 | 3300049742 | Ga0501080_0004826 | Ga0501080_0004826_2179_3504 | 441 |
| 1044 | 3300050490 | nmdc:mga03n38_2026_c1 | nmdc:mga03n38_2026_c1_3491_4816 | 441 |
| 1045 | 3300053077 | Ga0495601_0012935 | Ga0495601_0012935_406_1731 | 441 |
| 1046 | 3300053077 | Ga0495601_0098530 | Ga0495601_0098530_80_1405 | 441 |
| 1047 | 3300053084 | Ga0495595_0003426 | Ga0495595_0003426_4461_5786 | 441 |
| 1048 | 3300053085 | Ga0495619_0000166 | Ga0495619_0000166_10152_11477 | 441 |
| 1049 | 3300053085 | Ga0495619_0027922 | Ga0495619_0027922_2245_3570 | 441 |
| 1050 | 3300053096 | Ga0500641_0054968 | Ga0500641_0054968_307_1632 | 441 |
| 1051 | 3300053104 | Ga0500556_0000030 | Ga0500556_0000030_148359_149684 | 441 |
| 1052 | 3300053111 | Ga0500572_001447 | Ga0500572_001447_3292_4617 | 441 |
| 1053 | 3300053119 | Ga0500595_008373 | Ga0500595_008373_1038_2363 | 441 |
| 1054 | 3300053119 | Ga0500595_015948 | Ga0500595_015948_835_2160 | 441 |
| 1055 | 3300053119 | Ga0500595_024033 | Ga0500595_024033_504_1829 | 441 |
| 1056 | 3300053119 | Ga0500595_035614 | Ga0500595_035614_175_1500 | 441 |
| 1057 | 3300053136 | Ga0500559_0000870 | Ga0500559_0000870_6184_7509 | 441 |
| 1058 | 3300053136 | Ga0500559_0029135 | Ga0500559_0029135_327_1652 | 441 |
| 1059 | 3300053140 | Ga0500573_0014832 | Ga0500573_0014832_2377_3702 | 441 |
| 1060 | 3300053158 | Ga0500627_0008706 | Ga0500627_0008706_2058_3383 | 441 |
| 1061 | 3300053735 | Ga0500596_007152 | Ga0500596_007152_363_1688 | 441 |
| 1062 | iso_pu_bacteria | 2883577096 | 2883578052 | 441 |
| 1063 | iso_pu_bacteria | 2886627955 | 2886628645 | 441 |
| 1064 | iso_pu_bacteria | 2913844669 | 2913848143 | 441 |
| 1065 | iso_pu_bacteria | 2913939268 | 2913943507 | 441 |
| 1066 | 3300005327 | Ga0070658_10197786 | Ga0070658_101977861 | 442 |
| 1067 | 3300005327 | Ga0070658_10198021 | Ga0070658_101980211 | 442 |
| 1068 | 3300005436 | Ga0070713_100086405 | Ga0070713_1000864053 | 442 |
| 1069 | 3300005439 | Ga0070711_100064628 | Ga0070711_1000646281 | 442 |
| 1070 | 3300005844 | Ga0068862_100070026 | Ga0068862_1000700262 | 442 |
| 1071 | 3300006173 | Ga0070716_100078614 | Ga0070716_1000786142 | 442 |
| 1072 | 3300006175 | Ga0070712_100066082 | Ga0070712_1000660823 | 442 |
| 1073 | 3300009174 | Ga0105241_10074952 | Ga0105241_100749522 | 442 |
| 1074 | 3300009545 | Ga0105237_10001204 | Ga0105237_100012042 | 442 |
| 1075 | 3300010375 | Ga0105239_10001427 | Ga0105239_1000142712 | 442 |
| 1076 | 3300011119 | Ga0105246_10001379 | Ga0105246_100013792 | 442 |
| 1077 | 3300013104 | Ga0157370_10069515 | Ga0157370_100695152 | 442 |
| 1078 | 3300013105 | Ga0157369_10067587 | Ga0157369_100675872 | 442 |
| 1079 | 3300017792 | Ga0163161_10038439 | Ga0163161_100384392 | 442 |
| 1080 | 3300025253 | Ga0209677_101475 | Ga0209677_1014758 | 442 |
| 1081 | 3300025261 | Ga0209233_1004380 | Ga0209233_10043805 | 442 |
| 1082 | 3300025272 | Ga0209455_1003651 | Ga0209455_10036514 | 442 |
| 1083 | 3300025297 | Ga0209758_1003333 | Ga0209758_100333312 | 442 |
| 1084 | 3300025911 | Ga0207654_10086047 | Ga0207654_100860471 | 442 |
| 1085 | 3300025913 | Ga0207695_10003498 | Ga0207695_1000349816 | 442 |
| 1086 | 3300025914 | Ga0207671_10040867 | Ga0207671_100408673 | 442 |
| 1087 | 3300025915 | Ga0207693_10081334 | Ga0207693_100813342 | 442 |
| 1088 | 3300025916 | Ga0207663_10135336 | Ga0207663_101353361 | 442 |
| 1089 | 3300025917 | Ga0207660_10154060 | Ga0207660_101540602 | 442 |
| 1090 | 3300025939 | Ga0207665_10119013 | Ga0207665_101190132 | 442 |
| 1091 | 3300027296 | Ga0209389_1000068 | Ga0209389_100006832 | 442 |
| 1092 | 3300027361 | Ga0209489_113471 | Ga0209489_1134712 | 442 |
| 1093 | 3300027363 | Ga0209700_100117 | Ga0209700_10011771 | 442 |
| 1094 | 3300028577 | Ga0265318_10006964 | Ga0265318_100069644 | 442 |
| 1095 | 3300035113 | Ga0373936_0000048 | Ga0373936_0000048_47995_49338 | 442 |
| 1096 | 3300035119 | Ga0373956_0012978 | Ga0373956_0012978_933_2261 | 442 |
| 1097 | 3300035172 | Ga0373955_0009025 | Ga0373955_0009025_713_2041 | 442 |
| 1098 | 3300035410 | Ga0373924_0000928 | Ga0373924_0000928_775_2103 | 442 |
| 1099 | 3300035692 | Ga0373935_0107883 | Ga0373935_0107883_26_1354 | 442 |
| 1100 | 3300035724 | Ga0373933_0006219 | Ga0373933_0006219_2324_3652 | 442 |
| 1101 | 3300035724 | Ga0373933_0022874 | Ga0373933_0022874_1866_3194 | 442 |
| 1102 | 3300036401 | Ga0373937_0001548 | Ga0373937_0001548_6919_8247 | 442 |
| 1103 | 3300036401 | Ga0373937_0023468 | Ga0373937_0023468_2100_3428 | 442 |
| 1104 | 3300042115 | Ga0450911_000132 | Ga0450911_000132_5938_7266 | 442 |
| 1105 | 3300046460 | Ga0495638_0007158 | Ga0495638_0007158_6117_7445 | 442 |
| 1106 | 3300046477 | Ga0495664_0000849 | Ga0495664_0000849_9379_10707 | 442 |
| 1107 | 3300046507 | Ga0495606_0133929 | Ga0495606_0133929_79_1422 | 442 |
| 1108 | 3300046511 | Ga0495608_0002252 | Ga0495608_0002252_10390_11718 | 442 |
| 1109 | 3300046511 | Ga0495608_0003379 | Ga0495608_0003379_7075_8403 | 442 |
| 1110 | 3300046524 | Ga0495648_0036428 | Ga0495648_0036428_913_2241 | 442 |
| 1111 | 3300046533 | Ga0495640_0035357 | Ga0495640_0035357_2101_3429 | 442 |
| 1112 | 3300046533 | Ga0495640_0103047 | Ga0495640_0103047_393_1721 | 442 |
| 1113 | 3300046536 | Ga0495587_0008765 | Ga0495587_0008765_3796_5124 | 442 |
| 1114 | 3300046543 | Ga0495645_0013413 | Ga0495645_0013413_925_2253 | 442 |
| 1115 | 3300046559 | Ga0495667_0013747 | Ga0495667_0013747_554_1882 | 442 |
| 1116 | 3300046678 | Ga0495599_0021326 | Ga0495599_0021326_2179_3507 | 442 |
| 1117 | 3300046680 | Ga0495646_0007052 | Ga0495646_0007052_336_1664 | 442 |
| 1118 | 3300047317 | Ga0495604_0063570 | Ga0495604_0063570_966_2294 | 442 |
| 1119 | 3300047319 | Ga0495674_0071933 | Ga0495674_0071933_1464_2792 | 442 |
| 1120 | 3300047322 | Ga0495680_0156163 | Ga0495680_0156163_84_1412 | 442 |
| 1121 | 3300047472 | Ga0495686_0015085 | Ga0495686_0015085_3670_4998 | 442 |
| 1122 | 3300047472 | Ga0495686_0039136 | Ga0495686_0039136_1443_2774 | 442 |
| 1123 | 3300048088 | Ga0495602_0000162 | Ga0495602_0000162_12084_13412 | 442 |
| 1124 | 3300048920 | Ga0496117_0070470 | Ga0496117_0070470_615_1955 | 442 |
| 1125 | 3300048924 | Ga0496121_0016116 | Ga0496121_0016116_1020_2348 | 442 |
| 1126 | 3300048924 | Ga0496121_0087611 | Ga0496121_0087611_743_2083 | 442 |
| 1127 | 3300048928 | Ga0496125_0039434 | Ga0496125_0039434_446_1777 | 442 |
| 1128 | 3300048928 | Ga0496125_0050297 | Ga0496125_0050297_880_2208 | 442 |
| 1129 | 3300048929 | Ga0496126_0016102 | Ga0496126_0016102_4717_6057 | 442 |
| 1130 | 3300048929 | Ga0496126_0057675 | Ga0496126_0057675_187_1518 | 442 |
| 1131 | 3300048929 | Ga0496126_0213249 | Ga0496126_0213249_191_1576 | 442 |
| 1132 | 3300049570 | Ga0501033_0026589 | Ga0501033_0026589_2185_3513 | 442 |
| 1133 | 3300049583 | Ga0501067_0000045 | Ga0501067_0000045_25339_26667 | 442 |
| 1134 | 3300049589 | Ga0501073_0034888 | Ga0501073_0034888_2229_3557 | 442 |
| 1135 | 3300049822 | Ga0501035_0111993 | Ga0501035_0111993_336_1664 | 442 |
| 1136 | 3300053077 | Ga0495601_0002864 | Ga0495601_0002864_6491_7819 | 442 |
| 1137 | 3300053078 | Ga0495612_0016518 | Ga0495612_0016518_621_1949 | 442 |
| 1138 | 3300053085 | Ga0495619_0027730 | Ga0495619_0027730_1361_2689 | 442 |
| 1139 | 3300053094 | Ga0500566_0002077 | Ga0500566_0002077_9997_11391 | 442 |
| 1140 | 3300053104 | Ga0500556_0001124 | Ga0500556_0001124_10016_11344 | 442 |
| 1141 | 3300053111 | Ga0500572_000055 | Ga0500572_000055_19025_20500 | 442 |
| 1142 | 3300053115 | Ga0500591_051586 | Ga0500591_051586_329_1804 | 442 |
| 1143 | 3300053125 | Ga0500618_006987 | Ga0500618_006987_1662_3056 | 442 |
| 1144 | 3300053136 | Ga0500559_0000678 | Ga0500559_0000678_6763_8157 | 442 |
| 1145 | 3300053136 | Ga0500559_0001368 | Ga0500559_0001368_5431_6771 | 442 |
| 1146 | 3300053136 | Ga0500559_0003497 | Ga0500559_0003497_5078_6553 | 442 |
| 1147 | 3300053139 | Ga0500568_0000361 | Ga0500568_0000361_31861_33207 | 442 |
| 1148 | 3300053150 | Ga0500603_001487 | Ga0500603_001487_2884_4359 | 442 |
| 1149 | 3300053156 | Ga0500622_0015058 | Ga0500622_0015058_778_2106 | 442 |
| 1150 | 3300053157 | Ga0500624_002884 | Ga0500624_002884_588_1922 | 442 |
| 1151 | 3300053159 | Ga0500630_032865 | Ga0500630_032865_21_1451 | 442 |
| 1152 | 3300053163 | Ga0500639_000004 | Ga0500639_000004_131338_132813 | 442 |
| 1153 | 3300053177 | Ga0500636_0003604 | Ga0500636_0003604_3785_5179 | 442 |
| 1154 | 3300053178 | Ga0500637_0000106 | Ga0500637_0000106_21747_23081 | 442 |
| 1155 | 3300053730 | Ga0500645_001822 | Ga0500645_001822_8342_9670 | 442 |
| 1156 | 3300053735 | Ga0500596_000144 | Ga0500596_000144_2822_4297 | 442 |
| 1157 | iso_pu_bacteria | 2513237090 | 2513607968 | 442 |
| 1158 | iso_pu_bacteria | 2513237139 | 2513879375 | 442 |
| 1159 | iso_pu_bacteria | 2582581299 | 2585230307 | 442 |
| 1160 | iso_pu_bacteria | 2693429783 | 2694632755 | 442 |
| 1161 | iso_pu_bacteria | 2693429784 | 2694639516 | 442 |
| 1162 | iso_pu_bacteria | 2721755686 | 2723577870 | 442 |
| 1163 | iso_pu_bacteria | 2802429603 | 2805920273 | 442 |
| 1164 | iso_pu_bacteria | 2816332527 | 2818240357 | 442 |
| 1165 | iso_pu_bacteria | 2835312727 | 2835313151 | 442 |
| 1166 | iso_pu_bacteria | 2856364286 | 2856365217 | 442 |
| 1167 | iso_pu_bacteria | 2857349434 | 2857354643 | 442 |
| 1168 | iso_pu_bacteria | 2869285874 | 2869288685 | 442 |
| 1169 | iso_pu_bacteria | 2871429161 | 2871432043 | 442 |
| 1170 | iso_pu_bacteria | 2874146452 | 2874150684 | 442 |
| 1171 | iso_pu_bacteria | 2874155637 | 2874156139 | 442 |
| 1172 | iso_pu_bacteria | 2876413966 | 2876416724 | 442 |
| 1173 | iso_pu_bacteria | 2878745973 | 2878748707 | 442 |
| 1174 | iso_pu_bacteria | 2889010040 | 2889013580 | 442 |
| 1175 | iso_pu_bacteria | 2889016732 | 2889021702 | 442 |
| 1176 | iso_pu_bacteria | 2903492973 | 2903503011 | 442 |
| 1177 | iso_pu_bacteria | 2906308376 | 2906311118 | 442 |
| 1178 | iso_pu_bacteria | 2906321335 | 2906323158 | 442 |
| 1179 | iso_pu_bacteria | 2922130491 | 2922134655 | 442 |
| 1180 | iso_pu_bacteria | 2922185730 | 2922193513 | 442 |
| 1181 | iso_pu_bacteria | 2937813078 | 2937818761 | 442 |
| 1182 | iso_pu_bacteria | 2937848649 | 2937850418 | 442 |
| 1183 | iso_pu_bacteria | 2938014810 | 2938017913 | 442 |
| 1184 | iso_pu_bacteria | 2958100919 | 2958107159 | 442 |
| 1185 | iso_pu_bacteria | 2958130278 | 2958133082 | 442 |
| 1186 | iso_pu_bacteria | 2958172287 | 2958173269 | 442 |
| 1187 | iso_pu_bacteria | 2958179912 | 2958182776 | 442 |
| 1188 | iso_pu_bacteria | 2961077736 | 2961080633 | 442 |
| 1189 | iso_pu_bacteria | 2965119406 | 2965123352 | 442 |
| 1190 | iso_pu_bacteria | 2968117919 | 2968118767 | 442 |
| 1191 | iso_pu_bacteria | 2977843712 | 2977844442 | 442 |
| 1192 | iso_pu_bacteria | 2977922695 | 2977927894 | 442 |
| 1193 | iso_pu_bacteria | 2977942078 | 2977946422 | 442 |
| 1194 | iso_pu_bacteria | 2979710463 | 2979717145 | 442 |
| 1195 | iso_pu_bacteria | 2987636660 | 2987643245 | 442 |
| 1196 | iso_pu_bacteria | 2987652177 | 2987652394 | 442 |
| 1197 | iso_pu_bacteria | 3004203850 | 3004206792 | 442 |
| 1198 | iso_pu_bacteria | 3004211236 | 3004213722 | 442 |
| 1199 | iso_pu_bacteria | 3004218560 | 3004223313 | 442 |
| 1200 | iso_pu_bacteria | 3005718088 | 3005721439 | 442 |
| 1201 | iso_pu_bacteria | 8001845381 | 8001849370 | 442 |
| 1202 | iso_pu_bacteria | 8004387939 | 8004390764 | 442 |
| 1203 | iso_pu_bacteria | 8004640170 | 8004645896 | 442 |
| 1204 | iso_pu_bacteria | 8004714634 | 8004717342 | 442 |
| 1205 | 3300002773 | JGI25152J39213_1001356 | JGI25152J39213_10013566 | 443 |
| 1206 | 3300002774 | JGI25150J39212_1002705 | JGI25150J39212_10027053 | 443 |
| 1207 | 3300002987 | JGI25159J45721_1004063 | JGI25159J45721_10040634 | 443 |
| 1208 | 3300003187 | JGI25151J46595_10003952 | JGI25151J46595_100039523 | 443 |
| 1209 | 3300003215 | JGI25153J46596_10005791 | JGI25153J46596_100057912 | 443 |
| 1210 | 3300003354 | JGI25160J50197_1002431 | JGI25160J50197_10024315 | 443 |
| 1211 | 3300003354 | JGI25160J50197_1015074 | JGI25160J50197_10150742 | 443 |
| 1212 | 3300003374 | JGI25161J50226_1001494 | JGI25161J50226_10014946 | 443 |
| 1213 | 3300003761 | Ga0055535_1002320 | Ga0055535_10023205 | 443 |
| 1214 | 3300003762 | Ga0055542_1000021 | Ga0055542_1000021157 | 443 |
| 1215 | 3300003771 | Ga0055526_1003161 | Ga0055526_10031615 | 443 |
| 1216 | 3300003775 | Ga0055524_1002061 | Ga0055524_10020615 | 443 |
| 1217 | 3300003775 | Ga0055524_1009264 | Ga0055524_10092642 | 443 |
| 1218 | 3300003784 | Ga0055534_1002463 | Ga0055534_10024632 | 443 |
| 1219 | 3300003790 | Ga0055528_1007556 | Ga0055528_10075562 | 443 |
| 1220 | 3300005262 | Ga0065165_1005554 | Ga0065165_10055545 | 443 |
| 1221 | 3300005347 | Ga0070668_100093749 | Ga0070668_1000937493 | 443 |
| 1222 | 3300005530 | Ga0070679_100016753 | Ga0070679_1000167536 | 443 |
| 1223 | 3300005834 | Ga0068851_10029404 | Ga0068851_100294043 | 443 |
| 1224 | 3300006038 | Ga0075365_10002499 | Ga0075365_100024995 | 443 |
| 1225 | 3300006353 | Ga0075370_10098471 | Ga0075370_100984711 | 443 |
| 1226 | 3300009093 | Ga0105240_10067903 | Ga0105240_100679032 | 443 |
| 1227 | 3300009553 | Ga0105249_10295590 | Ga0105249_102955901 | 443 |
| 1228 | 3300009766 | Ga0123342_1026161 | Ga0123342_10261612 | 443 |
| 1229 | 3300010375 | Ga0105239_10098729 | Ga0105239_100987293 | 443 |
| 1230 | 3300013105 | Ga0157369_10010643 | Ga0157369_100106436 | 443 |
| 1231 | 3300015683 | Ga0183362_10008 | Ga0183362_10008179 | 443 |
| 1232 | 3300017792 | Ga0163161_10000139 | Ga0163161_1000013926 | 443 |
| 1233 | 3300025208 | Ga0209436_108537 | Ga0209436_1085372 | 443 |
| 1234 | 3300025228 | Ga0209672_100295 | Ga0209672_10029524 | 443 |
| 1235 | 3300025242 | Ga0209258_100058 | Ga0209258_100058157 | 443 |
| 1236 | 3300025245 | Ga0207425_1000157 | Ga0207425_10001579 | 443 |
| 1237 | 3300025254 | Ga0209148_1000071 | Ga0209148_1000071157 | 443 |
| 1238 | 3300025258 | Ga0209129_1000483 | Ga0209129_100048316 | 443 |
| 1239 | 3300025258 | Ga0209129_1002306 | Ga0209129_10023063 | 443 |
| 1240 | 3300025263 | Ga0209565_1000038 | Ga0209565_100003845 | 443 |
| 1241 | 3300025273 | Ga0209673_1000362 | Ga0209673_100036264 | 443 |
| 1242 | 3300025273 | Ga0209673_1012725 | Ga0209673_10127252 | 443 |
| 1243 | 3300025284 | Ga0209130_1000664 | Ga0209130_10006649 | 443 |
| 1244 | 3300025291 | Ga0209675_1000102 | Ga0209675_1000102100 | 443 |
| 1245 | 3300025292 | Ga0209676_1003421 | Ga0209676_10034212 | 443 |
| 1246 | 3300025294 | Ga0209025_1000056 | Ga0209025_1000056239 | 443 |
| 1247 | 3300025295 | Ga0209564_1000542 | Ga0209564_100054248 | 443 |
| 1248 | 3300025297 | Ga0209758_1000044 | Ga0209758_1000044226 | 443 |
| 1249 | 3300025299 | Ga0209256_1000020 | Ga0209256_1000020229 | 443 |
| 1250 | 3300025302 | Ga0207426_1000001 | Ga0207426_1000001864 | 443 |
| 1251 | 3300025302 | Ga0207426_1002786 | Ga0207426_100278617 | 443 |
| 1252 | 3300025303 | Ga0209051_1003798 | Ga0209051_10037988 | 443 |
| 1253 | 3300025303 | Ga0209051_1011280 | Ga0209051_10112804 | 443 |
| 1254 | 3300025304 | Ga0209257_1001689 | Ga0209257_10016897 | 443 |
| 1255 | 3300025321 | Ga0207656_10005610 | Ga0207656_100056104 | 443 |
| 1256 | 3300035113 | Ga0373936_0000012 | Ga0373936_0000012_101813_103144 | 443 |
| 1257 | 3300046453 | Ga0495627_003213 | Ga0495627_003213_2418_3749 | 443 |
| 1258 | 3300046474 | Ga0495605_0061269 | Ga0495605_0061269_215_1681 | 443 |
| 1259 | 3300046512 | Ga0495610_0000138 | Ga0495610_0000138_22047_23378 | 443 |
| 1260 | 3300046515 | Ga0495620_0014504 | Ga0495620_0014504_1180_2511 | 443 |
| 1261 | 3300046520 | Ga0495637_0010199 | Ga0495637_0010199_1287_2648 | 443 |
| 1262 | 3300046616 | Ga0495668_0031490 | Ga0495668_0031490_65_1408 | 443 |
| 1263 | 3300046665 | Ga0495661_0011508 | Ga0495661_0011508_1410_2741 | 443 |
| 1264 | 3300047469 | Ga0495673_0020162 | Ga0495673_0020162_154_1485 | 443 |
| 1265 | 3300048904 | Ga0496101_0011098 | Ga0496101_0011098_176_1510 | 443 |
| 1266 | 3300048924 | Ga0496121_0006454 | Ga0496121_0006454_11064_12395 | 443 |
| 1267 | 3300048927 | Ga0496124_0005729 | Ga0496124_0005729_4205_5536 | 443 |
| 1268 | 3300048927 | Ga0496124_0029306 | Ga0496124_0029306_1730_3106 | 443 |
| 1269 | iso_pu_bacteria | 2643221689 | 2644498061 | 443 |
| 1270 | iso_pu_bacteria | 2738541307 | 2738879637 | 443 |
| 1271 | iso_pu_bacteria | 2894772417 | 2894776557 | 443 |
| 1272 | iso_pu_bacteria | 2919450847 | 2919454889 | 443 |
| 1273 | 3300005347 | Ga0070668_100000734 | Ga0070668_10000073411 | 444 |
| 1274 | 3300005353 | Ga0070669_100120838 | Ga0070669_1001208382 | 444 |
| 1275 | 3300005367 | Ga0070667_100001509 | Ga0070667_10000150911 | 444 |
| 1276 | 3300005435 | Ga0070714_100004196 | Ga0070714_10000419610 | 444 |
| 1277 | 3300005436 | Ga0070713_100009387 | Ga0070713_1000093877 | 444 |
| 1278 | 3300005437 | Ga0070710_10004116 | Ga0070710_100041169 | 444 |
| 1279 | 3300005439 | Ga0070711_100004725 | Ga0070711_1000047255 | 444 |
| 1280 | 3300005843 | Ga0068860_100000265 | Ga0068860_10000026534 | 444 |
| 1281 | 3300006173 | Ga0070716_100005587 | Ga0070716_1000055876 | 444 |
| 1282 | 3300025898 | Ga0207692_10001246 | Ga0207692_1000124610 | 444 |
| 1283 | 3300025906 | Ga0207699_10000763 | Ga0207699_100007633 | 444 |
| 1284 | 3300025916 | Ga0207663_10042162 | Ga0207663_100421623 | 444 |
| 1285 | 3300025923 | Ga0207681_10060130 | Ga0207681_100601303 | 444 |
| 1286 | 3300025928 | Ga0207700_10064987 | Ga0207700_100649872 | 444 |
| 1287 | 3300025929 | Ga0207664_10019001 | Ga0207664_100190014 | 444 |
| 1288 | 3300025939 | Ga0207665_10002269 | Ga0207665_100022693 | 444 |
| 1289 | 3300025972 | Ga0207668_10000033 | Ga0207668_1000003329 | 444 |
| 1290 | 3300025972 | Ga0207668_10012379 | Ga0207668_100123792 | 444 |
| 1291 | 3300025986 | Ga0207658_10001268 | Ga0207658_100012686 | 444 |
| 1292 | 3300028381 | Ga0268264_10000318 | Ga0268264_1000031834 | 444 |
| 1293 | 3300035086 | Ga0373934_0028433 | Ga0373934_0028433_42_1388 | 444 |
| 1294 | 3300035117 | Ga0373953_0011634 | Ga0373953_0011634_933_2279 | 444 |
| 1295 | 3300035119 | Ga0373956_0002213 | Ga0373956_0002213_4025_5371 | 444 |
| 1296 | 3300035724 | Ga0373933_0000746 | Ga0373933_0000746_8822_10168 | 444 |
| 1297 | 3300036401 | Ga0373937_0000413 | Ga0373937_0000413_24494_25840 | 444 |
| 1298 | 3300039450 | Ga0436363_1329538 | Ga0436363_1329538_87_1421 | 444 |
| 1299 | 3300046454 | Ga0495592_0000629 | Ga0495592_0000629_17001_18347 | 444 |
| 1300 | 3300046459 | Ga0495629_0000948 | Ga0495629_0000948_21831_23177 | 444 |
| 1301 | 3300046460 | Ga0495638_0000120 | Ga0495638_0000120_120414_121748 | 444 |
| 1302 | 3300046462 | Ga0495651_0000319 | Ga0495651_0000319_21007_22353 | 444 |
| 1303 | 3300046463 | Ga0495653_0000391 | Ga0495653_0000391_10350_11696 | 444 |
| 1304 | 3300046511 | Ga0495608_0000916 | Ga0495608_0000916_11725_13071 | 444 |
| 1305 | 3300046529 | Ga0495652_0001170 | Ga0495652_0001170_26861_28207 | 444 |
| 1306 | 3300046536 | Ga0495587_0001521 | Ga0495587_0001521_592_1938 | 444 |
| 1307 | 3300046559 | Ga0495667_0002351 | Ga0495667_0002351_1750_3096 | 444 |
| 1308 | 3300046642 | Ga0495634_0003266 | Ga0495634_0003266_1140_2486 | 444 |
| 1309 | 3300046663 | Ga0495635_0003651 | Ga0495635_0003651_2363_3709 | 444 |
| 1310 | 3300046675 | Ga0495657_0011228 | Ga0495657_0011228_3481_4827 | 444 |
| 1311 | 3300046678 | Ga0495599_0001494 | Ga0495599_0001494_5834_7180 | 444 |
| 1312 | 3300047315 | Ga0495581_0026545 | Ga0495581_0026545_21_1367 | 444 |
| 1313 | 3300047317 | Ga0495604_0000580 | Ga0495604_0000580_19909_21255 | 444 |
| 1314 | 3300047319 | Ga0495674_0001292 | Ga0495674_0001292_3455_4801 | 444 |
| 1315 | 3300047322 | Ga0495680_0000636 | Ga0495680_0000636_19258_20604 | 444 |
| 1316 | 3300047444 | Ga0495675_0007147 | Ga0495675_0007147_4306_5652 | 444 |
| 1317 | 3300048088 | Ga0495602_0004623 | Ga0495602_0004623_150_1496 | 444 |
| 1318 | 3300048918 | Ga0496115_0070947 | Ga0496115_0070947_74_1411 | 444 |
| 1319 | 3300048925 | Ga0496122_0000428 | Ga0496122_0000428_2514_3848 | 444 |
| 1320 | 3300048926 | Ga0496123_0001068 | Ga0496123_0001068_2520_3854 | 444 |
| 1321 | 3300048927 | Ga0496124_0016064 | Ga0496124_0016064_4741_6075 | 444 |
| 1322 | 3300049571 | Ga0501034_0091961 | Ga0501034_0091961_354_1715 | 444 |
| 1323 | 3300049586 | Ga0501070_0053039 | Ga0501070_0053039_1054_2415 | 444 |
| 1324 | 3300049589 | Ga0501073_0010956 | Ga0501073_0010956_1889_3250 | 444 |
| 1325 | 3300053077 | Ga0495601_0020150 | Ga0495601_0020150_341_1687 | 444 |
| 1326 | 3300053078 | Ga0495612_0004607 | Ga0495612_0004607_2556_3902 | 444 |
| 1327 | 3300053084 | Ga0495595_0000112 | Ga0495595_0000112_35177_36523 | 444 |
| 1328 | 3300053085 | Ga0495619_0001541 | Ga0495619_0001541_5405_6751 | 444 |
| 1329 | 3300053103 | Ga0500555_003622 | Ga0500555_003622_2070_3404 | 444 |
| 1330 | 3300053139 | Ga0500568_0000323 | Ga0500568_0000323_22705_24039 | 444 |
| 1331 | 3300053140 | Ga0500573_0021953 | Ga0500573_0021953_567_1901 | 444 |
| 1332 | iso_pu_bacteria | 2501025504 | 2501407805 | 444 |
| 1333 | iso_pu_bacteria | 2510917014 | 2511097681 | 444 |
| 1334 | iso_pu_bacteria | 2510917022 | 2511137257 | 444 |
| 1335 | iso_pu_bacteria | 2512875016 | 2512929370 | 444 |
| 1336 | iso_pu_bacteria | 2512875024 | 2512964167 | 444 |
| 1337 | iso_pu_bacteria | 2513237164 | 2514034089 | 444 |
| 1338 | iso_pu_bacteria | 2582581307 | 2585274084 | 444 |
| 1339 | iso_pu_bacteria | 2582581308 | 2585280502 | 444 |
| 1340 | iso_pu_bacteria | 2582581315 | 2585322774 | 444 |
| 1341 | iso_pu_bacteria | 2582581316 | 2585330942 | 444 |
| 1342 | iso_pu_bacteria | 2585427527 | 2585532729 | 444 |
| 1343 | iso_pu_bacteria | 2585427530 | 2585554255 | 444 |
| 1344 | iso_pu_bacteria | 2585427531 | 2585560534 | 444 |
| 1345 | iso_pu_bacteria | 2585427608 | 2585898746 | 444 |
| 1346 | iso_pu_bacteria | 2585427609 | 2585903683 | 444 |
| 1347 | iso_pu_bacteria | 2585428125 | 2587981198 | 444 |
| 1348 | iso_pu_bacteria | 2588253730 | 2588514939 | 444 |
| 1349 | iso_pu_bacteria | 2615840698 | 2616554743 | 444 |
| 1350 | iso_pu_bacteria | 2617270742 | 2617383096 | 444 |
| 1351 | iso_pu_bacteria | 2667528174 | 2671111980 | 444 |
| 1352 | iso_pu_bacteria | 2775507266 | 2778175818 | 444 |
| 1353 | iso_pu_bacteria | 2818991448 | 2819609796 | 444 |
| 1354 | iso_pu_bacteria | 2818991453 | 2819639898 | 444 |
| 1355 | iso_pu_bacteria | 2838029111 | 2838034019 | 444 |
| 1356 | iso_pu_bacteria | 2842324504 | 2842326981 | 444 |
| 1357 | iso_pu_bacteria | 2842348783 | 2842350586 | 444 |
| 1358 | iso_pu_bacteria | 2842475841 | 2842480813 | 444 |
| 1359 | iso_pu_bacteria | 2842482326 | 2842483582 | 444 |
| 1360 | iso_pu_bacteria | 2842502639 | 2842507376 | 444 |
| 1361 | iso_pu_bacteria | 2852387548 | 2852390957 | 444 |
| 1362 | iso_pu_bacteria | 2876363079 | 2876367072 | 444 |
| 1363 | iso_pu_bacteria | 2903448605 | 2903453459 | 444 |
| 1364 | iso_pu_bacteria | 2903521522 | 2903526563 | 444 |
| 1365 | iso_pu_bacteria | 2903528002 | 2903530818 | 444 |
| 1366 | iso_pu_bacteria | 2919408235 | 2919410484 | 444 |
| 1367 | iso_pu_bacteria | 2963644680 | 2963649865 | 444 |
| 1368 | iso_pu_bacteria | 2968083720 | 2968086823 | 444 |
| 1369 | iso_pu_bacteria | 2977986579 | 2977990746 | 444 |
| 1370 | iso_pu_bacteria | 2987666974 | 2987671272 | 444 |
| 1371 | iso_pu_bacteria | 2996310559 | 2996312991 | 444 |
| 1372 | iso_pu_bacteria | 3005416602 | 3005418684 | 444 |
| 1373 | iso_pu_bacteria | 637000159 | 637079119 | 444 |
| 1374 | iso_pu_bacteria | 642555113 | 642617685 | 444 |
| 1375 | iso_pu_bacteria | 8005314921 | 8005318424 | 444 |
| 1376 | iso_pu_bacteria | 8005484373 | 8005488692 | 444 |
| 1377 | iso_pu_bacteria | 8005645114 | 8005645927 | 444 |
| 1378 | iso_pu_bacteria | 8005682033 | 8005682395 | 444 |
| 1379 | iso_pu_bacteria | 8046767195 | 8046772499 | 444 |
| 1380 | iso_pu_bacteria | 8057575449 | 8057577042 | 444 |
| 1381 | 3300005356 | Ga0070674_100144345 | Ga0070674_1001443452 | 445 |
| 1382 | 3300021361 | Ga0213872_10007327 | Ga0213872_100073273 | 445 |
| 1383 | 3300039447 | Ga0436361_0144287 | Ga0436361_0144287_7823_9175 | 445 |
| 1384 | 3300047319 | Ga0495674_0257629 | Ga0495674_0257629_17_1354 | 445 |
| 1385 | 3300048907 | Ga0496104_0005539 | Ga0496104_0005539_8331_9677 | 445 |
| 1386 | 3300048918 | Ga0496115_0068101 | Ga0496115_0068101_1019_2365 | 445 |
| 1387 | 3300048929 | Ga0496126_0012038 | Ga0496126_0012038_3399_4736 | 445 |
| 1388 | 3300003762 | Ga0055542_1000463 | Ga0055542_100046331 | 446 |
| 1389 | 3300005539 | Ga0068853_100118484 | Ga0068853_1001184842 | 446 |
| 1390 | 3300005616 | Ga0068852_100215524 | Ga0068852_1002155241 | 446 |
| 1391 | 3300006038 | Ga0075365_10025473 | Ga0075365_100254732 | 446 |
| 1392 | 3300009011 | Ga0105251_10001467 | Ga0105251_1000146714 | 446 |
| 1393 | 3300009036 | Ga0105244_10034350 | Ga0105244_100343503 | 446 |
| 1394 | 3300009093 | Ga0105240_10142232 | Ga0105240_101422322 | 446 |
| 1395 | 3300009148 | Ga0105243_10017593 | Ga0105243_100175932 | 446 |
| 1396 | 3300009174 | Ga0105241_10144679 | Ga0105241_101446792 | 446 |
| 1397 | 3300009545 | Ga0105237_10006864 | Ga0105237_100068645 | 446 |
| 1398 | 3300009551 | Ga0105238_10018527 | Ga0105238_100185273 | 446 |
| 1399 | 3300025254 | Ga0209148_1000057 | Ga0209148_1000057146 | 446 |
| 1400 | 3300025272 | Ga0209455_1000205 | Ga0209455_100020543 | 446 |
| 1401 | 3300025728 | Ga0207655_1000014 | Ga0207655_1000014462 | 446 |
| 1402 | 3300025735 | Ga0207713_1006493 | Ga0207713_10064933 | 446 |
| 1403 | 3300025913 | Ga0207695_10096753 | Ga0207695_100967532 | 446 |
| 1404 | 3300025914 | Ga0207671_10020040 | Ga0207671_100200401 | 446 |
| 1405 | 3300025924 | Ga0207694_10004900 | Ga0207694_100049004 | 446 |
| 1406 | 3300026041 | Ga0207639_10007940 | Ga0207639_100079402 | 446 |
| 1407 | 3300037418 | Ga0395900_0126534 | Ga0395900_0126534_632_1981 | 446 |
| 1408 | 3300046506 | Ga0495583_0009346 | Ga0495583_0009346_1525_2865 | 446 |
| 1409 | 3300048923 | Ga0496120_0004614 | Ga0496120_0004614_1315_2664 | 446 |
| 1410 | iso_pu_bacteria | 2738543016 | 2739264136 | 446 |
| 1411 | 3300005467 | Ga0070706_100170110 | Ga0070706_1001701101 | 447 |
| 1412 | 3300005471 | Ga0070698_100000351 | Ga0070698_10000035116 | 447 |
| 1413 | 3300005564 | Ga0070664_100041024 | Ga0070664_1000410243 | 447 |
| 1414 | 3300005614 | Ga0068856_100124864 | Ga0068856_1001248642 | 447 |
| 1415 | 3300005937 | Ga0081455_10000058 | Ga0081455_1000005819 | 447 |
| 1416 | 3300005937 | Ga0081455_10000366 | Ga0081455_1000036651 | 447 |
| 1417 | 3300005937 | Ga0081455_10001795 | Ga0081455_100017952 | 447 |
| 1418 | 3300005981 | Ga0081538_10026519 | Ga0081538_100265192 | 447 |
| 1419 | 3300006038 | Ga0075365_10002455 | Ga0075365_1000245510 | 447 |
| 1420 | 3300006178 | Ga0075367_10026312 | Ga0075367_100263123 | 447 |
| 1421 | 3300006195 | Ga0075366_10008450 | Ga0075366_100084505 | 447 |
| 1422 | 3300006358 | Ga0068871_100219901 | Ga0068871_1002199012 | 447 |
| 1423 | 3300006852 | Ga0075433_10001198 | Ga0075433_100011989 | 447 |
| 1424 | 3300006871 | Ga0075434_100005705 | Ga0075434_1000057052 | 447 |
| 1425 | 3300009094 | Ga0111539_10004293 | Ga0111539_100042935 | 447 |
| 1426 | 3300009098 | Ga0105245_10069337 | Ga0105245_100693374 | 447 |
| 1427 | 3300013104 | Ga0157370_10094735 | Ga0157370_100947353 | 447 |
| 1428 | 3300021441 | Ga0213871_10000078 | Ga0213871_100000788 | 447 |
| 1429 | 3300025924 | Ga0207694_10069419 | Ga0207694_100694193 | 447 |
| 1430 | 3300027907 | Ga0207428_10039670 | Ga0207428_100396702 | 447 |
| 1431 | 3300028573 | Ga0265334_10012389 | Ga0265334_100123893 | 447 |
| 1432 | 3300031247 | Ga0265340_10059627 | Ga0265340_100596272 | 447 |
| 1433 | 3300035088 | Ga0373940_0014749 | Ga0373940_0014749_266_1618 | 447 |
| 1434 | 3300035242 | Ga0373962_0001722 | Ga0373962_0001722_2398_3750 | 447 |
| 1435 | 3300035691 | Ga0373931_0003739 | Ga0373931_0003739_2117_3487 | 447 |
| 1436 | 3300035691 | Ga0373931_0023668 | Ga0373931_0023668_1417_2769 | 447 |
| 1437 | 3300035691 | Ga0373931_0064578 | Ga0373931_0064578_219_1568 | 447 |
| 1438 | 3300037068 | Ga0373925_0013237 | Ga0373925_0013237_710_2053 | 447 |
| 1439 | 3300037312 | Ga0395899_0003559 | Ga0395899_0003559_5231_6574 | 447 |
| 1440 | 3300037312 | Ga0395899_0030722 | Ga0395899_0030722_1864_3207 | 447 |
| 1441 | 3300037418 | Ga0395900_0028557 | Ga0395900_0028557_3123_4466 | 447 |
| 1442 | 3300037418 | Ga0395900_0087840 | Ga0395900_0087840_153_1496 | 447 |
| 1443 | 3300037853 | Ga0436364_0867524 | Ga0436364_0867524_11588_12934 | 447 |
| 1444 | 3300038443 | Ga0395901_0029508 | Ga0395901_0029508_2527_3870 | 447 |
| 1445 | 3300038443 | Ga0395901_0060827 | Ga0395901_0060827_187_1530 | 447 |
| 1446 | 3300039438 | Ga0436360_1295423 | Ga0436360_1295423_23016_24359 | 447 |
| 1447 | 3300039447 | Ga0436361_0256362 | Ga0436361_0256362_1690_3051 | 447 |
| 1448 | 3300039447 | Ga0436361_1199195 | Ga0436361_1199195_90_1433 | 447 |
| 1449 | 3300046472 | Ga0495580_0007113 | Ga0495580_0007113_371_1714 | 447 |
| 1450 | 3300046507 | Ga0495606_0003058 | Ga0495606_0003058_7931_9274 | 447 |
| 1451 | 3300046517 | Ga0495630_0025184 | Ga0495630_0025184_2997_4340 | 447 |
| 1452 | 3300046524 | Ga0495648_0049091 | Ga0495648_0049091_1230_2576 | 447 |
| 1453 | 3300046681 | Ga0495647_0026488 | Ga0495647_0026488_627_1970 | 447 |
| 1454 | 3300046692 | Ga0495671_0086739 | Ga0495671_0086739_105_1451 | 447 |
| 1455 | 3300049571 | Ga0501034_0001751 | Ga0501034_0001751_22663_24006 | 447 |
| 1456 | 3300049583 | Ga0501067_0120805 | Ga0501067_0120805_53_1405 | 447 |
| 1457 | 3300050491 | nmdc:mga00v17_2987_c1 | nmdc:mga00v17_2987_c1_3617_4963 | 447 |
| 1458 | 3300050492 | nmdc:mga0yw44_575_c1 | nmdc:mga0yw44_575_c1_6857_8203 | 447 |
| 1459 | 3300050511 | nmdc:mga08y16_83612_c1 | nmdc:mga08y16_83612_c1_1454_2806 | 447 |
| 1460 | 3300050512 | nmdc:mga0n895_1221_c1 | nmdc:mga0n895_1221_c1_533_1885 | 447 |
| 1461 | 3300002704 | JGI25155J39150_1000007 | JGI25155J39150_1000007199 | 448 |
| 1462 | 3300002705 | JGI25156J39149_1000050 | JGI25156J39149_100005053 | 448 |
| 1463 | 3300002737 | JGI25162J39368_1000908 | JGI25162J39368_10009089 | 448 |
| 1464 | 3300002738 | JGI25154J39366_1000035 | JGI25154J39366_1000035114 | 448 |
| 1465 | 3300002741 | JGI25157J39369_1000036 | JGI25157J39369_100003698 | 448 |
| 1466 | 3300003214 | JGI25165J46597_1000375 | JGI25165J46597_100037541 | 448 |
| 1467 | 3300003214 | JGI25165J46597_1002256 | JGI25165J46597_10022563 | 448 |
| 1468 | 3300003214 | JGI25165J46597_1003958 | JGI25165J46597_10039582 | 448 |
| 1469 | 3300005331 | Ga0070670_100000359 | Ga0070670_10000035913 | 448 |
| 1470 | 3300005456 | Ga0070678_100016493 | Ga0070678_1000164931 | 448 |
| 1471 | 3300005548 | Ga0070665_100056340 | Ga0070665_1000563403 | 448 |
| 1472 | 3300005614 | Ga0068856_100145970 | Ga0068856_1001459702 | 448 |
| 1473 | 3300005983 | Ga0081540_1000040 | Ga0081540_100004080 | 448 |
| 1474 | 3300005985 | Ga0081539_10009227 | Ga0081539_100092276 | 448 |
| 1475 | 3300009093 | Ga0105240_10000019 | Ga0105240_10000019385 | 448 |
| 1476 | 3300009148 | Ga0105243_10024978 | Ga0105243_100249783 | 448 |
| 1477 | 3300009545 | Ga0105237_10002159 | Ga0105237_1000215919 | 448 |
| 1478 | 3300010375 | Ga0105239_10002299 | Ga0105239_1000229919 | 448 |
| 1479 | 3300013104 | Ga0157370_10000131 | Ga0157370_100001319 | 448 |
| 1480 | 3300013105 | Ga0157369_10101511 | Ga0157369_101015112 | 448 |
| 1481 | 3300014325 | Ga0163163_10092729 | Ga0163163_100927293 | 448 |
| 1482 | 3300014497 | Ga0182008_10037101 | Ga0182008_100371012 | 448 |
| 1483 | 3300014969 | Ga0157376_10137365 | Ga0157376_101373653 | 448 |
| 1484 | 3300025206 | Ga0209435_100005 | Ga0209435_100005350 | 448 |
| 1485 | 3300025233 | Ga0209437_100058 | Ga0209437_100058232 | 448 |
| 1486 | 3300025233 | Ga0209437_100060 | Ga0209437_10006035 | 448 |
| 1487 | 3300025246 | Ga0209646_1000011 | Ga0209646_1000011350 | 448 |
| 1488 | 3300025246 | Ga0209646_1007185 | Ga0209646_10071851 | 448 |
| 1489 | 3300025250 | Ga0209026_1000005 | Ga0209026_1000005489 | 448 |
| 1490 | 3300025250 | Ga0209026_1000008 | Ga0209026_1000008350 | 448 |
| 1491 | 3300025250 | Ga0209026_1002172 | Ga0209026_10021725 | 448 |
| 1492 | 3300025256 | Ga0209759_1000004 | Ga0209759_1000004350 | 448 |
| 1493 | 3300025256 | Ga0209759_1000265 | Ga0209759_100026562 | 448 |
| 1494 | 3300025261 | Ga0209233_1000240 | Ga0209233_100024048 | 448 |
| 1495 | 3300025261 | Ga0209233_1000275 | Ga0209233_100027540 | 448 |
| 1496 | 3300025261 | Ga0209233_1000814 | Ga0209233_10008149 | 448 |
| 1497 | 3300025913 | Ga0207695_10000049 | Ga0207695_10000049388 | 448 |
| 1498 | 3300025913 | Ga0207695_10198549 | Ga0207695_101985492 | 448 |
| 1499 | 3300025914 | Ga0207671_10001771 | Ga0207671_1000177119 | 448 |
| 1500 | 3300025925 | Ga0207650_10000295 | Ga0207650_1000029520 | 448 |
| 1501 | 3300025935 | Ga0207709_10019621 | Ga0207709_100196214 | 448 |
| 1502 | 3300025941 | Ga0207711_10149314 | Ga0207711_101493142 | 448 |
| 1503 | 3300025981 | Ga0207640_10107267 | Ga0207640_101072672 | 448 |
| 1504 | 3300026078 | Ga0207702_10006542 | Ga0207702_100065429 | 448 |
| 1505 | 3300026078 | Ga0207702_10170448 | Ga0207702_101704482 | 448 |
| 1506 | 3300026088 | Ga0207641_10115717 | Ga0207641_101157172 | 448 |
| 1507 | 3300027312 | Ga0209371_1003295 | Ga0209371_10032954 | 448 |
| 1508 | 3300028379 | Ga0268266_10104048 | Ga0268266_101040482 | 448 |
| 1509 | 3300030500 | Ga0268256_1002990 | Ga0268256_10029906 | 448 |
| 1510 | 3300031251 | Ga0265327_10002922 | Ga0265327_1000292211 | 448 |
| 1511 | 3300037418 | Ga0395900_0130163 | Ga0395900_0130163_976_2322 | 448 |
| 1512 | 3300044765 | Ga0466970_0010203 | Ga0466970_0010203_1146_2492 | 448 |
| 1513 | 3300047472 | Ga0495686_0004287 | Ga0495686_0004287_3273_4619 | 448 |
| 1514 | 3300047472 | Ga0495686_0014472 | Ga0495686_0014472_68_1414 | 448 |
| 1515 | 3300048915 | Ga0496112_0105054 | Ga0496112_0105054_686_2041 | 448 |
| 1516 | 3300048919 | Ga0496116_0002293 | Ga0496116_0002293_7163_8509 | 448 |
| 1517 | 3300048920 | Ga0496117_0001162 | Ga0496117_0001162_7498_8844 | 448 |
| 1518 | 3300048921 | Ga0496118_0000729 | Ga0496118_0000729_44278_45624 | 448 |
| 1519 | 3300048921 | Ga0496118_0038443 | Ga0496118_0038443_1268_2647 | 448 |
| 1520 | 3300048921 | Ga0496118_0093332 | Ga0496118_0093332_657_2012 | 448 |
| 1521 | 3300048922 | Ga0496119_0002625 | Ga0496119_0002625_7498_8844 | 448 |
| 1522 | 3300048923 | Ga0496120_0003787 | Ga0496120_0003787_4825_6171 | 448 |
| 1523 | 3300048924 | Ga0496121_0000570 | Ga0496121_0000570_47478_48824 | 448 |
| 1524 | 3300048925 | Ga0496122_0006539 | Ga0496122_0006539_7495_8841 | 448 |
| 1525 | 3300048925 | Ga0496122_0084221 | Ga0496122_0084221_35_1429 | 448 |
| 1526 | 3300048926 | Ga0496123_0005027 | Ga0496123_0005027_7609_8955 | 448 |
| 1527 | 3300048927 | Ga0496124_0021308 | Ga0496124_0021308_141_1487 | 448 |
| 1528 | 3300048929 | Ga0496126_0039056 | Ga0496126_0039056_1248_2594 | 448 |
| 1529 | 3300050489 | nmdc:mga03683_718_c1 | nmdc:mga03683_718_c1_1285_2631 | 448 |
| 1530 | 3300050516 | nmdc:mga0sz30_8616_c1 | nmdc:mga0sz30_8616_c1_402_1748 | 448 |
| 1531 | 3300053119 | Ga0500595_011111 | Ga0500595_011111_149_1498 | 448 |
| 1532 | 3300053153 | Ga0500616_0009600 | Ga0500616_0009600_1716_3077 | 448 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5tlc-assembly1.cif.gz_A | crystal structure of bdsa from bacillus subtilis wu-s2b | 0.9414 | 6 | 432 |
| 5tlc-assembly1.cif.gz_D | crystal structure of bdsa from bacillus subtilis wu-s2b | 0.9411 | 6 | 432 |
| 5tlc-assembly1.cif.gz_B | crystal structure of bdsa from bacillus subtilis wu-s2b | 0.9363 | 6 | 432 |
| 5xkd-assembly1.cif.gz_B | crystal structure of dibenzothiophene sulfone monooxygenase bdsa in complex with fmn at 2.4 angstrom | 0.9342 | 5 | 436 |
| 5tlc-assembly1.cif.gz_D | crystal structure of bdsa from bacillus subtilis wu-s2b | 0.934 | 6 | 432 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5tlcD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9411 | 6 | 432 | 3.20.20.30 |
| 5tlcB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9363 | 6 | 432 | 3.20.20.30 |
| 5tlcD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.934 | 6 | 432 | 3.20.20.30 |
| 3sdoB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9339 | 4 | 440 | 3.20.20.30 |
| 3sdoB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9316 | 4 | 440 | 3.20.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5J6N0G9-F1-model_v4 | Nrd protein | 0.984 | 2 | 441 |
GO:0004497
GO:0016705 |
| AF-A0A529XC09-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9835 | 80 | 225 |
GO:0016705
|
| AF-A0A810Y8Z0-F1-model_v4 | deleted | 0.9825 | 13 | 442 |
|
| AF-A0A810Y8Z0-F1-model_v4 | deleted | 0.9802 | 13 | 442 |
|
| AF-A0A3S1H9R1-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9789 | 1 | 283 |
GO:0004497
GO:0016705 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar