F494565

General Info

Members Datasets Scaffolds Average Seq Length
1525 1193 662 274

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100026208|Ga0207675_1000262087
Length 294
Sequence MTAMTMTTPPTLVTMLMTRPKRIVGTIAHRGAILLYIFFALFPLYWLLKVSVTPNDLLYSEGVRLWPSRTSIQHYLFVLEHSDFPRFFRNSVIVSGATAFIVTILASCAGYALSRFTFRGKYWIVALMLLTQMFPLVMLVAPIFKMLSPLGLTNSLTGLVIVYVAFNVPFATFLMQSFFDGIPKDLEEAAMIDGATRFRAFSQIILPLTLPGIAATLGFVFTAAWSELLFALMLISSAGASTFPVGLLSFVSKFSVDFGQMMAAGVLALIPACLFFLFIQRYLVQGLTAGAVKG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
3 2508501050 Microvirga lupini Lut6 Isolate Nodule
4 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
5 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
6 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
7 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
8 2509276019 Ensifer aridi TW10 Isolate Nodule
9 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
10 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
11 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
12 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
13 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
14 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
15 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
16 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
17 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
18 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
19 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
20 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
21 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
22 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
23 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
24 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
25 2512875024 Mesorhizobium loti R88b Isolate Nodule
26 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
27 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
28 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
29 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
30 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
31 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
32 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
33 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
34 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
35 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
36 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
37 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
38 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
39 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
40 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
41 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
42 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
43 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
44 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
45 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
46 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
47 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
48 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
49 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
50 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
51 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
52 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
53 2516143018 Ensifer sp. BR816 Isolate Nodule
54 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
55 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
56 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
57 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
58 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
59 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
60 2519899620 Rhizobium sp. Pop5 Isolate Nodule
61 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
62 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
63 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
64 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
65 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
66 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
67 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
68 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
69 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
70 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
71 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
72 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
73 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
74 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
75 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
76 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
77 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
78 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
79 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
80 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
81 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
82 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
83 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
84 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
85 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
86 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
87 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
88 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
89 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
90 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
91 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
92 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
93 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
94 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
95 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
96 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
97 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
98 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
99 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
100 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
101 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
102 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
103 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
104 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
105 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
106 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
107 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
108 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
109 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
110 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
111 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
112 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
113 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
114 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
115 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
116 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
117 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
118 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
119 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
120 2643221557 Ensifer sp. Root558 Isolate Unclassified
121 2643221568 Rhizobium sp. Root564 Isolate Unclassified
122 2643221582 Rhizobium sp. Root651 Isolate Unclassified
123 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
124 2643221599 Rhizobium sp. Root708 Isolate Unclassified
125 2643221607 Rhizobium sp. Root73 Isolate Unclassified
126 2643221610 Ensifer sp. Root74 Isolate Unclassified
127 2643221618 Ensifer sp. Root231 Isolate Unclassified
128 2643221626 Ensifer sp. Root31 Isolate Unclassified
129 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
130 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
131 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
132 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
133 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
134 2643221655 Ensifer sp. Root1252 Isolate Unclassified
135 2643221659 Ensifer sp. Root127 Isolate Unclassified
136 2643221668 Ensifer sp. Root423 Isolate Unclassified
137 2643221675 Ensifer sp. Root1298 Isolate Unclassified
138 2643221680 Ensifer sp. Root1312 Isolate Unclassified
139 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
140 2643221688 Rhizobium sp. Root482 Isolate Unclassified
141 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
142 2643221693 Rhizobium sp. Root491 Isolate Unclassified
143 2643221698 Ensifer sp. Root142 Isolate Unclassified
144 2643221712 Ensifer sp. Root258 Isolate Unclassified
145 2643221718 Rhizobium sp. Root268 Isolate Unclassified
146 2643221723 Ensifer sp. Root278 Isolate Unclassified
147 2643221726 Ensifer sp. Root954 Isolate Unclassified
148 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
149 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
150 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
151 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
152 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
153 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
154 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
155 2718217882 Rhizobium sp. N741 Isolate Nodule
156 2718217927 Rhizobium sp. N324 Isolate Nodule
157 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
158 2718218009 Rhizobium sp. N561 Isolate Nodule
159 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
160 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
161 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
162 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
163 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
164 2718218363 Rhizobium sp. N113 Isolate Nodule
165 2718218365 Rhizobium sp. N731 Isolate Nodule
166 2718218366 Rhizobium sp. N621 Isolate Nodule
167 2718218423 Rhizobium sp. N941 Isolate Nodule
168 2721755514 Rhizobium sp. N6212 Isolate Nodule
169 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
170 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
171 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
172 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
173 2721755809 Rhizobium sp. N541 Isolate Nodule
174 2721755810 Rhizobium sp. N871 Isolate Nodule
175 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
176 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
177 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
178 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
179 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
180 2728369365 Rhizobium sp. N1341 Isolate Nodule
181 2728369397 Rhizobium sp. N1314 Isolate Nodule
182 2738541293 Rhizobium sp. GV031 Isolate Unclassified
183 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
184 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
185 2738543024 Aminobacter sp. AP02 Isolate Unclassified
186 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
187 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
188 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
189 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
190 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
191 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
192 2773857925 Microvirga vignae BR3299 Isolate Unclassified
193 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
194 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
195 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
196 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
197 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
198 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
199 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
200 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
201 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
202 2791355256 Rhizobium sp. M10 Isolate Nodule
203 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
204 2791355260 Rhizobium sp. L9 Isolate Nodule
205 2791355261 Rhizobium sp. J15 Isolate Nodule
206 2791355262 Rhizobium sp. M1 Isolate Nodule
207 2791355263 Rhizobium chutanense C5 Isolate Nodule
208 2791355264 Rhizobium sp. S9 Isolate Nodule
209 2791355265 Rhizobium sp. H4 Isolate Nodule
210 2791355266 Rhizobium sp. L43 Isolate Nodule
211 2791355267 Rhizobium sp. L18 Isolate Nodule
212 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
213 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
214 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
215 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
216 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
217 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
218 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
219 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
220 2802429633 Rhizobium anhuiense J3 Isolate Nodule
221 2802429634 Rhizobium anhuiense S10 Isolate Nodule
222 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
223 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
224 2802429637 Rhizobium anhuiense C15 Isolate Nodule
225 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
226 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
227 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
228 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
229 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
230 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
231 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
232 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
233 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
234 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
235 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
236 2838048938 Rhizobium pisi 27/80 Isolate Nodule
237 2838061910 Rhizobium phaseoli L15 Isolate Nodule
238 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
239 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
240 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
241 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
242 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
243 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
244 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
245 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
246 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
247 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
248 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
249 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
250 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
251 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
252 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
253 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
254 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
255 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
256 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
257 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
258 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
259 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
260 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
261 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
262 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
263 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
264 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
265 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
266 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
267 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
268 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
269 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
270 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
271 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
272 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
273 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
274 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
275 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
276 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
277 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
278 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
279 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
280 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
281 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
282 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
283 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
284 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
285 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
286 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
287 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
288 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
289 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
290 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
291 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
292 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
293 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
294 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
295 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
296 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
297 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
298 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
299 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
300 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
301 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
302 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
303 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
304 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
305 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
306 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
307 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
308 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
309 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
310 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
311 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
312 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
313 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
314 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
315 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
316 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
317 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
318 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
319 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
320 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
321 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
322 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
323 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
324 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
325 2844163670 Ensifer sp. 1H6 Isolate Unclassified
326 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
327 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
328 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
329 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
330 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
331 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
332 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
333 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
334 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
335 2854911287 Brucella lupini LUP21 Isolate Unclassified
336 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
337 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
338 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
339 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
340 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
341 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
342 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
343 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
344 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
345 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
346 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
347 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
348 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
349 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
350 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
351 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
352 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
353 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
354 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
355 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
356 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
357 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
358 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
359 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
360 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
361 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
362 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
363 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
364 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
365 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
366 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
367 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
368 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
369 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
370 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
371 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
372 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
373 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
374 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
375 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
376 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
377 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
378 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
379 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
380 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
381 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
382 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
383 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
384 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
385 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
386 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
387 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
388 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
389 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
390 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
391 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
392 2876601092 Pantoea endophytica 596 Isolate Unclassified
393 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
394 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
395 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
396 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
397 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
398 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
399 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
400 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
401 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
402 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
403 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
404 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
405 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
406 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
407 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
408 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
409 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
410 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
411 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
412 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
413 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
414 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
415 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
416 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
417 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
418 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
419 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
420 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
421 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
422 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
423 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
424 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
425 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
426 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
427 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
428 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
429 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
430 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
431 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
432 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
433 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
434 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
435 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
436 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
437 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
438 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
439 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
440 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
441 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
442 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
443 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
444 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
445 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
446 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
447 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
448 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
449 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
450 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
451 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
452 2909042592 Labrys sp. LIt4 Isolate Nodule
453 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
454 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
455 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
456 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
457 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
458 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
459 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
460 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
461 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
462 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
463 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
464 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
465 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
466 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
467 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
468 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
469 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
470 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
471 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
472 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
473 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
474 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
475 2919150387 Rahnella aceris 1817 Isolate Unclassified
476 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
477 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
478 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
479 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
480 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
481 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
482 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
483 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
484 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
485 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
486 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
487 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
488 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
489 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
490 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
491 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
492 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
493 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
494 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
495 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
496 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
497 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
498 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
499 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
500 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
501 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
502 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
503 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
504 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
505 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
506 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
507 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
508 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
509 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
510 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
511 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
512 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
513 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
514 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
515 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
516 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
517 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
518 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
519 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
520 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
521 2927143783 Rahnella sp. 2050 Isolate Unclassified
522 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
523 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
524 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
525 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
526 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
527 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
528 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
529 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
530 2933599457 Rhizobium phaseoli M3 Isolate Nodule
531 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
532 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
533 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
534 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
535 2936381700 Rhizobium chutanense C16 Isolate Unclassified
536 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
537 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
538 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
539 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
540 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
541 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
542 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
543 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
544 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
545 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
546 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
547 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
548 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
549 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
550 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
551 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
552 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
553 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
554 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
555 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
556 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
557 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
558 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
559 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
560 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
561 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
562 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
563 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
564 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
565 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
566 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
567 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
568 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
569 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
570 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
571 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
572 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
573 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
574 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
575 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
576 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
577 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
578 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
579 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
580 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
581 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
582 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
583 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
584 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
585 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
586 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
587 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
588 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
589 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
590 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
591 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
592 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
593 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
594 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
595 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
596 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
597 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
598 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
599 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
600 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
601 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
602 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
603 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
604 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
605 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
606 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
607 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
608 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
609 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
610 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
611 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
612 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
613 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
614 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
615 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
616 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
617 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
618 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
619 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
620 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
621 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
622 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
623 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
624 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
625 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
626 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
627 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
628 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
629 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
630 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
631 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
632 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
633 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
634 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
635 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
636 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
637 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
638 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
639 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
640 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
641 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
642 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
643 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
644 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
645 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
646 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
647 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
648 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
649 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
650 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
651 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
652 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
653 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
654 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
655 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
656 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
657 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
658 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
659 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
660 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
661 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
662 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
663 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
664 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
665 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
666 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
667 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
668 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
669 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
670 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
671 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
672 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
673 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
674 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
675 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
676 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
677 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
678 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
679 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
680 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
681 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
682 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
683 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
684 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
685 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
686 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
687 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
688 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
689 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
690 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
691 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
692 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
693 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
694 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
695 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
696 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
697 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
698 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
699 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
700 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
701 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
702 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
703 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
704 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
705 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
706 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
707 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
708 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
709 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
710 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
711 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
712 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
713 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
714 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
715 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
716 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
717 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
718 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
719 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
720 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
721 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
722 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
723 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
724 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
725 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
726 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
727 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
728 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
729 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
730 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
731 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
732 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
733 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
734 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
735 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
736 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
737 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
738 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
739 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
740 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
741 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
742 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
743 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
744 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
745 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
746 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
747 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
748 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
749 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
750 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
751 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
752 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
753 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
754 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
755 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
756 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
757 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
758 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
759 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
760 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
761 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
762 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
763 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
764 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
765 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
766 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
767 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
768 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
769 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
770 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
771 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
772 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
773 2996887358 Rhizobium sp. R711 Isolate Nodule
774 2996893221 Rhizobium sp. R635 Isolate Nodule
775 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
776 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
777 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
778 3004167301 Mesorhizobium loti 582 Isolate Unclassified
779 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
780 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
781 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
782 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
783 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
784 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
785 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
786 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
787 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
788 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
789 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
790 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
791 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
792 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
793 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
794 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
795 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
796 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
797 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
798 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
799 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
800 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
801 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
802 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
803 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
804 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
805 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
806 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
807 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
808 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
809 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
810 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
811 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
812 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
813 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
814 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
815 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
816 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
817 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
818 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
819 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
820 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
821 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
822 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
823 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
824 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
825 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
826 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
827 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
828 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
829 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
830 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
831 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
832 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
833 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
834 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
835 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
836 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
837 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
838 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
839 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
840 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
841 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
842 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
843 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
844 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
845 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
846 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
847 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
848 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
849 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
850 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
851 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
852 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
853 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
854 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
855 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
856 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
857 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
858 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
859 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
860 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
861 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
862 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
863 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
864 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
865 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
866 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
867 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
868 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
869 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
870 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
871 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
872 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
873 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
874 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
875 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
876 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
877 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
878 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
879 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
880 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
881 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
882 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
883 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
884 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
885 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
886 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
887 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
888 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
889 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
890 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
891 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
892 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
893 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
894 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
895 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
896 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
897 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
898 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
899 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
900 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
901 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
902 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
903 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
904 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
905 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
906 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
907 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
908 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
909 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
910 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
911 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
912 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
913 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
914 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
915 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
916 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
917 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
918 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
919 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
920 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
921 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
922 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
923 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
924 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
925 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
926 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
927 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
928 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
929 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
930 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
931 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
932 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
933 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
934 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
935 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
936 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
937 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
938 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
939 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
940 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
941 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
942 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
943 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
944 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
945 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
946 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
947 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
948 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
949 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
950 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
951 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
952 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
953 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
954 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
955 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
956 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
957 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
958 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
959 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
960 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
961 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
962 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
963 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
964 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
965 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
966 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
967 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
968 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
969 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
970 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
971 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
972 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
973 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
974 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
975 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
976 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
977 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
978 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
979 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
980 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
981 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
982 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
983 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
984 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
985 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
986 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
987 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
988 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
989 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
990 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
991 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
992 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
993 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
994 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
995 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
996 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
997 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
998 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
999 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
1000 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
1001 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
1002 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
1003 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
1004 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
1005 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
1006 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
1007 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
1008 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
1009 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
1010 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
1011 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
1012 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
1013 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
1014 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
1015 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
1016 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
1017 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
1018 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
1019 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
1020 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
1021 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
1022 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
1023 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
1024 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
1025 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
1026 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
1027 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
1028 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
1029 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
1030 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
1031 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
1032 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
1033 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
1034 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
1035 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
1036 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
1037 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
1038 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
1039 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
1040 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
1041 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
1042 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
1043 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
1044 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
1045 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
1046 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1047 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
1048 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
1049 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1050 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1051 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1052 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1053 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1054 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1055 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1056 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1057 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1058 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1059 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1060 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1061 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1062 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1063 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1064 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1065 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1066 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1067 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
1068 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
1069 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1070 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1071 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1072 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1073 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1074 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1075 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1076 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1077 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1078 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1079 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
1080 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1081 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1082 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1083 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1084 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1085 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1086 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1087 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1088 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
1089 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1090 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
1091 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
1092 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1093 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
1094 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
1095 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
1096 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
1097 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1098 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
1099 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
1100 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
1101 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
1102 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
1103 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
1104 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
1105 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1106 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
1107 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1108 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1109 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
1110 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
1111 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1112 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1113 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
1114 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1115 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
1116 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1117 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
1118 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1119 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1120 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
1121 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
1122 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1123 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
1124 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
1125 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
1126 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1127 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
1128 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1129 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1130 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1131 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1132 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1133 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1134 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1135 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1136 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1137 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1138 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1139 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1140 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1141 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1142 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1143 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1144 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1145 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1146 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1147 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1148 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1149 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1150 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1151 8005258706 Rhizobium sp. R693 Isolate Nodule
1152 8005275841 Rhizobium sp. N4311 Isolate Nodule
1153 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1154 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1155 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1156 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1157 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1158 8005321885 Rhizobium sp. R72 Isolate Nodule
1159 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1160 8005382845 Rhizobium sp. R634 Isolate Nodule
1161 8005395548 Rhizobium sp. R339 Isolate Nodule
1162 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1163 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1164 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1165 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1166 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1167 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1168 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1169 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1170 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1171 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1172 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1173 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1174 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1175 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1176 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1177 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
1178 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1179 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1180 8018176218 Rhizobium sp. N122 Isolate Nodule
1181 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
1182 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1183 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1184 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1185 8024501048 Rhizobium sp. H4 Isolate Nodule
1186 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1187 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1188 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1189 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1190 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1191 8056382006 Rhizobium croatiense 13T Isolate Nodule
1192 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1193 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 43.41
Metatranscriptomes 0.07
Isolates 56.52

Biome Distribution

Category Percentage (%)
Aerial Root 0.07
Bulb 0
Endosphere 16.07
Nodule 44.52
Rhizoplane 1.38
Rhizosphere 22.62
Stem 0
Stem Tuber 0
Unclassified 15.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_999527 2162886007 Bacteria 5204
2 JGI25155J39150_1000015 3300002704 Bacteria 178839
3 JGI25156J39149_1000007 3300002705 Bacteria 252108
4 JGI25156J39149_1009617 3300002705 Bacteria 2335
5 JGI25162J39368_1000009 3300002737 Bacteria 389795
6 JGI25162J39368_1000119 3300002737 Bacteria 87157
7 JGI25162J39368_1000489 3300002737 Bacteria 30241
8 JGI25154J39366_1000145 3300002738 Bacteria 55861
9 JGI25158J39367_1000094 3300002739 Bacteria 20606
10 JGI25157J39369_1000012 3300002741 Bacteria 205167
11 JGI25157J39369_1003024 3300002741 Bacteria 3672
12 JGI25163J39215_1000765 3300002771 Bacteria 7902
13 JGI25164J39214_1000002 3300002772 Bacteria 406570
14 JGI25152J39213_1002953 3300002773 Bacteria 6053
15 JGI25152J39213_1013083 3300002773 Bacteria 1746
16 JGI25152J39213_1015131 3300002773 Bacteria 1532
17 JGI25152J39213_1016662 3300002773 Bacteria 1410
18 JGI25150J39212_1000103 3300002774 Bacteria 49029
19 JGI25150J39212_1006873 3300002774 Bacteria 2318
20 JGI25150J39212_1014069 3300002774 Bacteria 1368
21 JGI25159J45721_1001078 3300002987 Bacteria 11655
22 JGI25159J45721_1003115 3300002987 Bacteria 5982
23 JGI25151J46595_10000085 3300003187 Bacteria 127212
24 JGI25151J46595_10001194 3300003187 Bacteria 18647
25 JGI25151J46595_10014672 3300003187 Bacteria 3481
26 JGI25165J46597_1000206 3300003214 Bacteria 84821
27 JGI25165J46597_1000211 3300003214 Bacteria 82463
28 JGI25165J46597_1001070 3300003214 Bacteria 17582
29 JGI25165J46597_1004826 3300003214 Bacteria 2755
30 JGI25153J46596_10000103 3300003215 Bacteria 96279
31 JGI25153J46596_10001488 3300003215 Bacteria 13974
32 JGI25153J46596_10005550 3300003215 Bacteria 6594
33 JGI25153J46596_10009848 3300003215 Bacteria 4386
34 JGI25153J46596_10022279 3300003215 Bacteria 2340
35 JGI25153J46596_10037724 3300003215 Bacteria 1532
36 JGI25153J46596_10037747 3300003215 Bacteria 1532
37 JGI25160J50197_1000023 3300003354 Bacteria 200692
38 JGI25160J50197_1000033 3300003354 Bacteria 172667
39 JGI25160J50197_1000726 3300003354 Bacteria 18068
40 JGI25160J50197_1001657 3300003354 Bacteria 10887
41 JGI25161J50226_1000012 3300003374 Bacteria 200668
42 JGI25161J50226_1000508 3300003374 Bacteria 17047
43 JGI25161J50226_1001989 3300003374 Bacteria 5608
44 JGI25161J50226_1004573 3300003374 Bacteria 2865
45 Ga0006562J51391_1050521 3300003578 Bacteria 2458
46 Ga0055538_1000015 3300003751 Bacteria 311166
47 Ga0055539_1000009 3300003752 Bacteria 406566
48 Ga0055533_1000012 3300003756 Bacteria 406566
49 Ga0055525_1000014 3300003759 Bacteria 406566
50 Ga0055542_1000947 3300003762 Bacteria 19060
51 Ga0055542_1001298 3300003762 Bacteria 13317
52 Ga0055529_1005284 3300003763 Bacteria 1881
53 Ga0055526_1002294 3300003771 Bacteria 13055
54 Ga0055526_1008324 3300003771 Bacteria 5199
55 Ga0055526_1016818 3300003771 Bacteria 2834
56 Ga0055526_1016912 3300003771 Bacteria 2820
57 Ga0055526_1017729 3300003771 Bacteria 2702
58 Ga0055526_1028335 3300003771 Bacteria 1697
59 Ga0055524_1003993 3300003775 Bacteria 6961
60 Ga0055524_1007275 3300003775 Bacteria 4724
61 Ga0055524_1014578 3300003775 Bacteria 2906
62 Ga0055524_1023454 3300003775 Bacteria 1985
63 Ga0055536_1012578 3300003781 Bacteria 3126
64 Ga0055528_1000519 3300003790 Bacteria 30154
65 Ga0055528_1004148 3300003790 Bacteria 7059
66 Ga0055528_1014232 3300003790 Bacteria 2957
67 Ga0055528_1027463 3300003790 Bacteria 1601
68 Ga0055528_1031970 3300003790 Bacteria 1356
69 Ga0055530_10022847 3300003791 Bacteria 1811
70 Ga0055540_1000050 3300003792 Bacteria 145565
71 Ga0055540_1005332 3300003792 Bacteria 5457
72 Ga0055540_1012166 3300003792 Bacteria 2721
73 Ga0055540_1022297 3300003792 Bacteria 1623
74 Ga0055531_10016516 3300003794 Bacteria 3179
75 Ga0055531_10017593 3300003794 Bacteria 3006
76 Ga0055541_1000006 3300003841 Bacteria 406566
77 Ga0058692_1008266 3300003856 Bacteria 2693
78 Ga0058692_1017728 3300003856 Bacteria 1556
79 Ga0055543_1000009 3300004625 Bacteria 200706
80 Ga0055543_1000021 3300004625 Bacteria 150116
81 Ga0055543_1000315 3300004625 Bacteria 33655
82 Ga0055543_1003043 3300004625 Bacteria 5170
83 Ga0065165_1000064 3300005262 Bacteria 175153
84 Ga0065165_1000513 3300005262 Bacteria 59506
85 Ga0065165_1005453 3300005262 Bacteria 7139
86 Ga0065165_1006135 3300005262 Bacteria 6429
87 Ga0065165_1008941 3300005262 Bacteria 4588
88 Ga0065165_1047904 3300005262 Bacteria 1231
89 Ga0065704_10000959 3300005289 Bacteria 34794
90 Ga0065715_10033325 3300005293 Bacteria 1939
91 Ga0065707_10026737 3300005295 Bacteria 1507
92 Ga0070670_100000287 3300005331 Bacteria 44454
93 Ga0068868_100250245 3300005338 Bacteria 1491
94 Ga0070660_100128224 3300005339 Bacteria 2029
95 Ga0070668_100127067 3300005347 Bacteria 2043
96 Ga0070669_100010155 3300005353 Bacteria 6694
97 Ga0070671_100380979 3300005355 Bacteria 1205
98 Ga0070674_100001722 3300005356 Bacteria 11851
99 Ga0070667_100442686 3300005367 Bacteria 1187
100 Ga0070711_100205272 3300005439 Bacteria 1523
101 Ga0068867_100270193 3300005459 Bacteria 1390
102 Ga0070707_100007996 3300005468 Bacteria 9825
103 Ga0070698_100496819 3300005471 Bacteria 1158
104 Ga0070699_100241157 3300005518 Bacteria 1614
105 Ga0068853_100357110 3300005539 Bacteria 1360
106 Ga0070696_100073348 3300005546 Bacteria 2411
107 Ga0070696_100341458 3300005546 Bacteria 1157
108 Ga0070665_100105349 3300005548 Bacteria 2822
109 Ga0070665_100177473 3300005548 Bacteria 2131
110 Ga0070665_100263818 3300005548 Bacteria 1724
111 Ga0070665_100483833 3300005548 Bacteria 1249
112 Ga0070665_100511960 3300005548 Bacteria 1212
113 Ga0068857_100169903 3300005577 Bacteria 1982
114 Ga0068854_100067701 3300005578 Bacteria 2602
115 Ga0068856_100022838 3300005614 Bacteria 6084
116 Ga0068856_100485317 3300005614 Bacteria 1257
117 Ga0068852_100237316 3300005616 Bacteria 1741
118 Ga0068861_100327653 3300005719 Bacteria 1336
119 Ga0068851_10135295 3300005834 Bacteria 1336
120 Ga0068862_100090252 3300005844 Bacteria 2667
121 Ga0068862_100157312 3300005844 Bacteria 2026
122 Ga0081455_10035366 3300005937 Bacteria 4466
123 Ga0081455_10124862 3300005937 Bacteria 2022
124 Ga0081538_10002181 3300005981 Bacteria 19427
125 Ga0081538_10015390 3300005981 Bacteria 5923
126 Ga0081540_1041947 3300005983 Bacteria 2366
127 Ga0081540_1071406 3300005983 Bacteria 1604
128 Ga0081539_10010083 3300005985 Bacteria 7761
129 Ga0075365_10010840 3300006038 Bacteria 5331
130 Ga0075365_10190182 3300006038 Bacteria 1436
131 Ga0075365_10303480 3300006038 Bacteria 1124
132 Ga0075368_10088341 3300006042 Bacteria 1266
133 Ga0075363_100129012 3300006048 Bacteria 1417
134 Ga0075363_100272121 3300006048 Bacteria 978
135 Ga0075364_10013563 3300006051 Bacteria 5014
136 Ga0075364_10096538 3300006051 Bacteria 1965
137 Ga0075364_10326887 3300006051 Bacteria 1044
138 Ga0075367_10021014 3300006178 Bacteria 3643
139 Ga0075369_10007134 3300006186 Bacteria 4247
140 Ga0075369_10035944 3300006186 Bacteria 2106
141 Ga0075366_10003448 3300006195 Bacteria 8344
142 Ga0075366_10151175 3300006195 Bacteria 1406
143 Ga0075370_10003108 3300006353 Bacteria 7837
144 Ga0075370_10070369 3300006353 Bacteria 2001
145 Ga0068865_100362889 3300006881 Bacteria 1177
146 Ga0068865_100577500 3300006881 Bacteria 947
147 Ga0079104_1001270 3300006946 Bacteria 17502
148 Ga0079104_1024320 3300006946 Bacteria 1596
149 Ga0099826_10000181 3300006948 Bacteria 26466
150 Ga0099826_10035342 3300006948 Bacteria 3556
151 Ga0105251_10030323 3300009011 Bacteria 2717
152 Ga0105251_10055843 3300009011 Bacteria 1871
153 Ga0105244_10001340 3300009036 Bacteria 20097
154 Ga0105244_10001791 3300009036 Bacteria 16834
155 Ga0105244_10014154 3300009036 Bacteria 4625
156 Ga0105244_10122047 3300009036 Bacteria 1261
157 Ga0105250_10004385 3300009092 Bacteria 6501
158 Ga0105240_10000217 3300009093 Bacteria 115649
159 Ga0105240_10330935 3300009093 Bacteria 1733
160 Ga0105240_10542647 3300009093 Bacteria 1287
161 Ga0111539_10000123 3300009094 Bacteria 87000
162 Ga0105245_10346920 3300009098 Bacteria 1470
163 Ga0105245_10601596 3300009098 Bacteria 1126
164 Ga0105245_10933278 3300009098 Bacteria 910
165 Ga0105243_10032808 3300009148 Bacteria 4014
166 Ga0105243_10293898 3300009148 Bacteria 1469
167 Ga0105243_10410444 3300009148 Bacteria 1260
168 Ga0105241_10032823 3300009174 Bacteria 3895
169 Ga0105241_10560250 3300009174 Bacteria 1027
170 Ga0105248_10046083 3300009177 Bacteria 4887
171 Ga0105248_10736661 3300009177 Bacteria 1112
172 Ga0105237_10001458 3300009545 Bacteria 31192
173 Ga0105237_10023149 3300009545 Bacteria 6369
174 Ga0105237_10283541 3300009545 Bacteria 1659
175 Ga0105238_10014472 3300009551 Bacteria 7979
176 Ga0105238_10377350 3300009551 Bacteria 1409
177 Ga0105238_10823791 3300009551 Bacteria 944
178 Ga0105249_10239161 3300009553 Bacteria 1794
179 Ga0105249_10353592 3300009553 Bacteria 1489
180 Ga0123341_1000109 3300009765 Bacteria 36496
181 Ga0123342_1014735 3300009766 Bacteria 7361
182 Ga0105239_10001164 3300010375 Bacteria 36154
183 Ga0105239_10078102 3300010375 Bacteria 3643
184 Ga0105239_10230990 3300010375 Bacteria 2075
185 Ga0105239_10440443 3300010375 Bacteria 1477
186 Ga0105239_10475843 3300010375 Bacteria 1419
187 Ga0105246_10010396 3300011119 Bacteria 5757
188 Ga0105246_10097688 3300011119 Bacteria 2132
189 Ga0157373_10004331 3300013100 Bacteria 10686
190 Ga0157373_10030840 3300013100 Bacteria 3858
191 Ga0157373_10240529 3300013100 Bacteria 1280
192 Ga0157371_10000002 3300013102 Bacteria 665040
193 Ga0157371_10001454 3300013102 Bacteria 24558
194 Ga0157370_10001439 3300013104 Bacteria 29445
195 Ga0157370_10001923 3300013104 Bacteria 25548
196 Ga0157369_10107178 3300013105 Bacteria 2973
197 Ga0171463_1007 3300013249 Bacteria 301198
198 Ga0157374_10469475 3300013296 Bacteria 1261
199 Ga0182008_10100750 3300014497 Bacteria 1427
200 Ga0182007_10000324 3300015262 Bacteria 30329
201 Ga0182005_1001504 3300015265 Bacteria 9294
202 Ga0183363_1153 3300015690 Bacteria 17205
203 Ga0214544_1000010 3300021320 Bacteria 270164
204 Ga0214542_1000023 3300021321 Bacteria 191557
205 Ga0214542_1018351 3300021321 Bacteria 5949
206 Ga0214543_1000019 3300021327 Bacteria 267908
207 Ga0214543_1001578 3300021327 Bacteria 44277
208 Ga0213872_10002824 3300021361 Bacteria 9940
209 Ga0213872_10009103 3300021361 Bacteria 4773
210 Ga0228711_1000017 3300022739 Bacteria 121084
211 Ga0228710_1000005 3300022740 Bacteria 233531
212 Ga0209435_100006 3300025206 Bacteria 542459
213 Ga0209760_100051 3300025207 Bacteria 105257
214 Ga0209436_101959 3300025208 Bacteria 6600
215 Ga0209436_109923 3300025208 Bacteria 1775
216 Ga0209784_100001 3300025224 Bacteria 3600592
217 Ga0209566_100001 3300025225 Bacteria 3600765
218 Ga0209674_100002 3300025226 Bacteria 3600592
219 Ga0209563_100002 3300025230 Bacteria 2045675
220 Ga0207427_100020 3300025231 Bacteria 507515
221 Ga0209437_100001 3300025233 Bacteria 2045675
222 Ga0209437_100042 3300025233 Bacteria 444095
223 Ga0209437_100062 3300025233 Bacteria 336900
224 Ga0207425_1000065 3300025245 Bacteria 127264
225 Ga0207425_1008594 3300025245 Bacteria 2599
226 Ga0207425_1009532 3300025245 Bacteria 2408
227 Ga0209646_1000015 3300025246 Bacteria 542459
228 Ga0209646_1003792 3300025246 Bacteria 2894
229 Ga0209026_1000046 3300025250 Bacteria 262031
230 Ga0209026_1000050 3300025250 Bacteria 254994
231 Ga0209677_100002 3300025253 Bacteria 2045675
232 Ga0209677_100429 3300025253 Bacteria 24814
233 Ga0209148_1000050 3300025254 Bacteria 413178
234 Ga0209759_1000005 3300025256 Bacteria 542459
235 Ga0209759_1000229 3300025256 Bacteria 83575
236 Ga0209129_1000019 3300025258 Bacteria 460802
237 Ga0209129_1000132 3300025258 Bacteria 127262
238 Ga0209129_1001521 3300025258 Bacteria 12809
239 Ga0209129_1002872 3300025258 Bacteria 7945
240 Ga0209129_1004004 3300025258 Bacteria 6048
241 Ga0209129_1006071 3300025258 Bacteria 4038
242 Ga0209129_1010911 3300025258 Bacteria 2218
243 Ga0209233_1000034 3300025261 Bacteria 578898
244 Ga0209233_1000082 3300025261 Bacteria 336320
245 Ga0209233_1000103 3300025261 Bacteria 284123
246 Ga0209233_1000288 3300025261 Bacteria 66882
247 Ga0209233_1005432 3300025261 Bacteria 4229
248 Ga0209455_1000507 3300025272 Bacteria 27901
249 Ga0209673_1000023 3300025273 Bacteria 411385
250 Ga0209673_1000132 3300025273 Bacteria 162349
251 Ga0209673_1001968 3300025273 Bacteria 16055
252 Ga0209673_1002729 3300025273 Bacteria 11649
253 Ga0209673_1002876 3300025273 Bacteria 10948
254 Ga0209673_1003829 3300025273 Bacteria 8509
255 Ga0209130_1000001 3300025284 Bacteria 831557
256 Ga0209130_1000017 3300025284 Bacteria 388431
257 Ga0209130_1000048 3300025284 Bacteria 233357
258 Ga0209130_1001748 3300025284 Bacteria 12937
259 Ga0209130_1010463 3300025284 Bacteria 2552
260 Ga0209130_1015688 3300025284 Bacteria 1857
261 Ga0209676_1021257 3300025292 Bacteria 2183
262 Ga0209025_1000072 3300025294 Bacteria 283452
263 Ga0209025_1000077 3300025294 Bacteria 271958
264 Ga0209025_1000153 3300025294 Bacteria 170548
265 Ga0209025_1000247 3300025294 Bacteria 127264
266 Ga0209025_1000666 3300025294 Bacteria 59408
267 Ga0209025_1002519 3300025294 Bacteria 19180
268 Ga0209025_1005892 3300025294 Bacteria 9796
269 Ga0209025_1019188 3300025294 Bacteria 3817
270 Ga0209025_1019195 3300025294 Bacteria 3816
271 Ga0209025_1049715 3300025294 Bacteria 1683
272 Ga0209564_1000100 3300025295 Bacteria 224016
273 Ga0209564_1000372 3300025295 Bacteria 83053
274 Ga0209564_1001437 3300025295 Bacteria 24420
275 Ga0209564_1002441 3300025295 Bacteria 14707
276 Ga0209564_1011402 3300025295 Bacteria 3987
277 Ga0209564_1034239 3300025295 Bacteria 1493
278 Ga0209758_1000053 3300025297 Bacteria 337751
279 Ga0209758_1000212 3300025297 Bacteria 127597
280 Ga0209758_1000239 3300025297 Bacteria 114761
281 Ga0209758_1000712 3300025297 Bacteria 49095
282 Ga0209758_1002011 3300025297 Bacteria 21870
283 Ga0209758_1002735 3300025297 Bacteria 17345
284 Ga0209758_1004308 3300025297 Bacteria 11994
285 Ga0209758_1005005 3300025297 Bacteria 10575
286 Ga0209758_1014984 3300025297 Bacteria 4056
287 Ga0209758_1022928 3300025297 Bacteria 2841
288 Ga0209758_1030212 3300025297 Bacteria 2249
289 Ga0209758_1034485 3300025297 Bacteria 2011
290 Ga0209758_1049788 3300025297 Bacteria 1475
291 Ga0209050_1002669 3300025298 Bacteria 14559
292 Ga0209050_1006906 3300025298 Bacteria 6569
293 Ga0209050_1009761 3300025298 Bacteria 4848
294 Ga0209256_1000401 3300025299 Bacteria 68618
295 Ga0209256_1000458 3300025299 Bacteria 61611
296 Ga0209256_1000735 3300025299 Bacteria 43205
297 Ga0209256_1000818 3300025299 Bacteria 39749
298 Ga0209256_1002923 3300025299 Bacteria 12843
299 Ga0209256_1003989 3300025299 Bacteria 9683
300 Ga0207426_1000005 3300025302 Bacteria 1037188
301 Ga0207426_1000006 3300025302 Bacteria 1025969
302 Ga0207426_1000035 3300025302 Bacteria 448327
303 Ga0207426_1000136 3300025302 Bacteria 201401
304 Ga0207426_1000141 3300025302 Bacteria 194453
305 Ga0207426_1028627 3300025302 Bacteria 1845
306 Ga0209051_1000062 3300025303 Bacteria 251081
307 Ga0209051_1003152 3300025303 Bacteria 11077
308 Ga0209051_1005006 3300025303 Bacteria 7897
309 Ga0209051_1035479 3300025303 Bacteria 1855
310 Ga0209257_1001119 3300025304 Bacteria 34613
311 Ga0209257_1010746 3300025304 Bacteria 4556
312 Ga0207696_1000076 3300025711 Bacteria 210418
313 Ga0207696_1000396 3300025711 Bacteria 40779
314 Ga0207655_1000413 3300025728 Bacteria 58877
315 Ga0207655_1014385 3300025728 Bacteria 4475
316 Ga0207655_1071084 3300025728 Bacteria 1293
317 Ga0207713_1038463 3300025735 Bacteria 2029
318 Ga0207680_10246153 3300025903 Bacteria 1234
319 Ga0207647_10081824 3300025904 Bacteria 1934
320 Ga0207645_10056949 3300025907 Bacteria 2495
321 Ga0207695_10000613 3300025913 Bacteria 71568
322 Ga0207695_10011879 3300025913 Bacteria 10494
323 Ga0207671_10001160 3300025914 Bacteria 31428
324 Ga0207671_10088960 3300025914 Bacteria 2324
325 Ga0207657_10054577 3300025919 Bacteria 3455
326 Ga0207646_10047164 3300025922 Bacteria 3865
327 Ga0207694_10032771 3300025924 Bacteria 3978
328 Ga0207650_10001289 3300025925 Bacteria 18184
329 Ga0207700_10206085 3300025928 Bacteria 1660
330 Ga0207709_10036345 3300025935 Bacteria 2919
331 Ga0207669_10006701 3300025937 Bacteria 5282
332 Ga0207704_10346230 3300025938 Bacteria 1155
333 Ga0207691_10187455 3300025940 Bacteria 1805
334 Ga0207711_10334835 3300025941 Bacteria 1400
335 Ga0207712_10181007 3300025961 Bacteria 1655
336 Ga0207668_10106081 3300025972 Bacteria 2098
337 Ga0207668_10510421 3300025972 Bacteria 1036
338 Ga0207678_10159191 3300026067 Bacteria 1928
339 Ga0207708_10110635 3300026075 Bacteria 2132
340 Ga0207702_10014348 3300026078 Bacteria 6578
341 Ga0207702_10487839 3300026078 Bacteria 1200
342 Ga0207648_10236538 3300026089 Bacteria 1626
343 Ga0207648_10613942 3300026089 Bacteria 1003
344 Ga0207674_10432554 3300026116 Bacteria 1272
345 Ga0207675_100026208 3300026118 Bacteria 5427
346 Ga0207675_100122019 3300026118 Bacteria 2466
347 Ga0207683_10039107 3300026121 Bacteria 4138
348 Ga0207683_10198925 3300026121 Bacteria 1821
349 Ga0207698_10084832 3300026142 Bacteria 2569
350 Ga0209281_1000082 3300027111 Bacteria 257684
351 Ga0209281_1001229 3300027111 Bacteria 17082
352 Ga0209371_1004328 3300027312 Bacteria 6261
353 Ga0209371_1004561 3300027312 Bacteria 5941
354 Ga0209371_1004841 3300027312 Bacteria 5645
355 Ga0209282_1000006 3300027666 Bacteria 276998
356 Ga0209282_1000176 3300027666 Bacteria 35300
357 Ga0209282_1036197 3300027666 Bacteria 2982
358 Ga0207428_10000133 3300027907 Bacteria 100902
359 Ga0268266_10005342 3300028379 Bacteria 12018
360 Ga0268266_10127196 3300028379 Bacteria 2275
361 Ga0268266_10190337 3300028379 Bacteria 1873
362 Ga0268266_10198257 3300028379 Bacteria 1836
363 Ga0268266_10240919 3300028379 Bacteria 1669
364 Ga0268266_10361384 3300028379 Bacteria 1366
365 Ga0268265_10171350 3300028380 Bacteria 1855
366 Ga0268265_10392935 3300028380 Bacteria 1280
367 Ga0307517_10207732 3300028786 Bacteria 1212
368 Ga0307515_10002150 3300028794 Bacteria 43260
369 Ga0307515_10033865 3300028794 Bacteria 8393
370 Ga0307515_10168799 3300028794 Bacteria 2192
371 Ga0268256_1003641 3300030500 Bacteria 6841
372 Ga0268256_1003966 3300030500 Bacteria 6378
373 Ga0268256_1004619 3300030500 Bacteria 5645
374 Ga0268256_1015885 3300030500 Bacteria 2178
375 Ga0316181_1067070 3300030744 Bacteria 2047
376 Ga0265330_10046801 3300031235 Bacteria 1905
377 Ga0307513_10000463 3300031456 Bacteria 58389
378 Ga0307513_10028096 3300031456 Bacteria 6441
379 Ga0307513_10166943 3300031456 Bacteria 2084
380 Ga0307513_10185890 3300031456 Bacteria 1935
381 Ga0307513_10355592 3300031456 Bacteria 1211
382 Ga0307508_10081823 3300031616 Bacteria 2810
383 Ga0307508_10210604 3300031616 Bacteria 1544
384 Ga0307508_10335188 3300031616 Bacteria 1104
385 Ga0265314_10018857 3300031711 Bacteria 5359
386 Ga0307413_10050395 3300031824 Bacteria 2501
387 Ga0307410_10203197 3300031852 Bacteria 1514
388 Ga0307412_10019356 3300031911 Bacteria 4120
389 Ga0307412_10286358 3300031911 Bacteria 1296
390 Ga0315914_1000003 3300031967 Bacteria 314370
391 Ga0307409_100033770 3300031995 Bacteria 3727
392 Ga0307409_100116671 3300031995 Bacteria 2251
393 Ga0307409_100653424 3300031995 Bacteria 1046
394 Ga0307416_100202641 3300032002 Bacteria 1884
395 Ga0307414_10365263 3300032004 Bacteria 1243
396 Ga0307411_10060082 3300032005 Bacteria 2522
397 Ga0315913_1000001 3300033430 Bacteria 284459
398 Ga0315915_1000008 3300033464 Bacteria 258517
399 Ga0373927_0000266 3300035695 Bacteria 41356
400 Ga0373947_0133152 3300035725 Bacteria 1589
401 Ga0373937_0593115 3300036401 Bacteria 1052
402 Ga0373925_0001672 3300037068 Bacteria 18664
403 Ga0373925_0060324 3300037068 Bacteria 2849
404 Ga0395900_0018190 3300037418 Bacteria 7169
405 Ga0395905_0002837 3300037471 Bacteria 18981
406 Ga0395905_0003927 3300037471 Bacteria 15643
407 Ga0395905_0048313 3300037471 Bacteria 3988
408 Ga0395905_0093038 3300037471 Bacteria 2827
409 Ga0395905_0122973 3300037471 Bacteria 2440
410 Ga0395901_0108026 3300038443 Bacteria 2921
411 Ga0395901_0116451 3300038443 Bacteria 2807
412 Ga0400483_065417 3300039062 Bacteria 3409
413 Ga0436365_0671760 3300039437 Bacteria 1347
414 Ga0436361_0027550 3300039447 Bacteria 11259
415 Ga0436361_0034602 3300039447 Bacteria 1517
416 Ga0436361_0137889 3300039447 Bacteria 2935
417 Ga0436361_0570105 3300039447 Bacteria 9679
418 Ga0436363_0274728 3300039450 Bacteria 6466
419 Ga0436363_1315970 3300039450 Bacteria 3880
420 Ga0439436_0000195 3300041404 Bacteria 14462
421 Ga0439447_048680 3300041407 Bacteria 1017
422 Ga0439465_0075847 3300041413 Bacteria 1133
423 Ga0439465_0142491 3300041413 Bacteria 852
424 Ga0451835_0331121 3300041492 Bacteria 1390
425 Ga0451839_0268492 3300041496 Bacteria 1451
426 Ga0451845_0189427 3300041501 Bacteria 2701
427 Ga0451847_0010441 3300041503 Bacteria 1131
428 Ga0451843_0065299 3300041509 Bacteria 1037
429 Ga0451853_2758235 3300041512 Bacteria 1143
430 Ga0439449_0017545 3300042007 Bacteria 2688
431 Ga0439455_0022511 3300042012 Bacteria 1511
432 Ga0439462_0027122 3300042015 Bacteria 1511
433 Ga0439462_0042290 3300042015 Bacteria 1217
434 Ga0450906_029307 3300042145 Bacteria 973
435 Ga0466972_0046222 3300044658 Bacteria 2108
436 Ga0466972_0084169 3300044658 Bacteria 1512
437 Ga0466970_0169294 3300044765 Bacteria 1210
438 Ga0466960_0168679 3300044901 Bacteria 1180
439 Ga0466959_0052281 3300045049 Bacteria 2993
440 Ga0495592_0075679 3300046454 Bacteria 2444
441 Ga0495591_000803 3300046458 Bacteria 22249
442 Ga0495629_0040880 3300046459 Bacteria 3262
443 Ga0495638_0123397 3300046460 Bacteria 1528
444 Ga0495638_0210983 3300046460 Bacteria 1091
445 Ga0495650_0000043 3300046471 Bacteria 357197
446 Ga0495650_0000113 3300046471 Bacteria 196536
447 Ga0495605_0099869 3300046474 Bacteria 1335
448 Ga0495639_0081012 3300046475 Bacteria 1512
449 Ga0495662_0007616 3300046476 Bacteria 5343
450 Ga0495584_0002744 3300046491 Bacteria 9858
451 Ga0495585_0140841 3300046492 Bacteria 1263
452 Ga0495606_0000374 3300046507 Bacteria 76132
453 Ga0495606_0001618 3300046507 Bacteria 29389
454 Ga0495606_0023645 3300046507 Bacteria 4446
455 Ga0495610_0009644 3300046512 Bacteria 6081
456 Ga0495616_0116708 3300046513 Bacteria 1235
457 Ga0495620_0107319 3300046515 Bacteria 1109
458 Ga0495631_0036456 3300046518 Bacteria 2196
459 Ga0495631_0077215 3300046518 Bacteria 1437
460 Ga0495632_0086599 3300046519 Bacteria 1490
461 Ga0495643_0088441 3300046522 Bacteria 1601
462 Ga0495644_0001112 3300046523 Bacteria 11067
463 Ga0495648_0018790 3300046524 Bacteria 4878
464 Ga0495654_0000124 3300046530 Bacteria 86154
465 Ga0495654_0000694 3300046530 Bacteria 26403
466 Ga0495587_0121886 3300046536 Bacteria 1493
467 Ga0495622_0023211 3300046557 Bacteria 2892
468 Ga0495633_0005760 3300046558 Bacteria 7486
469 Ga0495656_0110939 3300046615 Bacteria 1283
470 Ga0495668_0196902 3300046616 Bacteria 1103
471 Ga0495625_0082577 3300046660 Bacteria 2234
472 Ga0495625_0105065 3300046660 Bacteria 1935
473 Ga0495625_0110977 3300046660 Bacteria 1874
474 Ga0495625_0371288 3300046660 Bacteria 900
475 Ga0495588_0073614 3300046674 Bacteria 1779
476 Ga0495657_0149954 3300046675 Bacteria 1448
477 Ga0495649_0158143 3300046694 Bacteria 1189
478 Ga0495589_0039901 3300046794 Bacteria 2345
479 Ga0495660_0000012 3300046810 Bacteria 350701
480 Ga0495660_0000034 3300046810 Bacteria 201261
481 Ga0495660_0051547 3300046810 Bacteria 2239
482 Ga0495604_0021553 3300047317 Bacteria 5143
483 Ga0495674_0451548 3300047319 Bacteria 1033
484 Ga0495672_0000029 3300047320 Bacteria 305231
485 Ga0495673_0000092 3300047469 Bacteria 187963
486 Ga0495681_0002695 3300047470 Bacteria 12583
487 Ga0495681_0061718 3300047470 Bacteria 1726
488 Ga0495686_0000795 3300047472 Bacteria 41055
489 Ga0495615_0040446 3300048090 Bacteria 1161
490 Ga0496101_0000023 3300048904 Bacteria 209923
491 Ga0496104_0131911 3300048907 Bacteria 2400
492 Ga0496105_0294200 3300048908 Bacteria 1307
493 Ga0496106_0351713 3300048909 Bacteria 1183
494 Ga0496110_0283493 3300048913 Bacteria 1509
495 Ga0496111_0123945 3300048914 Bacteria 1910
496 Ga0496112_0028761 3300048915 Bacteria 5369
497 Ga0496112_0047536 3300048915 Bacteria 4210
498 Ga0496112_0622845 3300048915 Bacteria 1010
499 Ga0496115_0100983 3300048918 Bacteria 2365
500 Ga0496116_0000042 3300048919 Bacteria 330516
501 Ga0496116_0000066 3300048919 Bacteria 264035
502 Ga0496116_0005820 3300048919 Bacteria 11323
503 Ga0496116_0007217 3300048919 Bacteria 9916
504 Ga0496116_0009455 3300048919 Bacteria 8303
505 Ga0496116_0019687 3300048919 Bacteria 5159
506 Ga0496116_0120858 3300048919 Bacteria 1516
507 Ga0496117_0000036 3300048920 Bacteria 325635
508 Ga0496117_0013982 3300048920 Bacteria 6954
509 Ga0496117_0019866 3300048920 Bacteria 5499
510 Ga0496117_0026327 3300048920 Bacteria 4553
511 Ga0496117_0070372 3300048920 Bacteria 2350
512 Ga0496117_0160660 3300048920 Bacteria 1317
513 Ga0496118_0012231 3300048921 Bacteria 8269
514 Ga0496118_0015347 3300048921 Bacteria 7096
515 Ga0496118_0022829 3300048921 Bacteria 5454
516 Ga0496118_0041334 3300048921 Bacteria 3651
517 Ga0496119_0004655 3300048922 Bacteria 13530
518 Ga0496119_0010451 3300048922 Bacteria 7812
519 Ga0496119_0011716 3300048922 Bacteria 7217
520 Ga0496119_0015192 3300048922 Bacteria 5957
521 Ga0496119_0016484 3300048922 Bacteria 5621
522 Ga0496119_0028726 3300048922 Bacteria 3788
523 Ga0496119_0045882 3300048922 Bacteria 2734
524 Ga0496119_0058948 3300048922 Bacteria 2310
525 Ga0496120_0000032 3300048923 Bacteria 220255
526 Ga0496120_0000777 3300048923 Bacteria 46134
527 Ga0496120_0001086 3300048923 Bacteria 35695
528 Ga0496120_0001523 3300048923 Bacteria 27295
529 Ga0496120_0001949 3300048923 Bacteria 22617
530 Ga0496120_0008032 3300048923 Bacteria 7762
531 Ga0496120_0008096 3300048923 Bacteria 7725
532 Ga0496121_0000001 3300048924 Bacteria 1830318
533 Ga0496121_0000239 3300048924 Bacteria 118051
534 Ga0496121_0002342 3300048924 Bacteria 29248
535 Ga0496121_0018876 3300048924 Bacteria 6922
536 Ga0496122_0000002 3300048925 Bacteria 905834
537 Ga0496122_0000072 3300048925 Bacteria 222436
538 Ga0496122_0000110 3300048925 Bacteria 190142
539 Ga0496122_0006562 3300048925 Bacteria 13298
540 Ga0496122_0022649 3300048925 Bacteria 5575
541 Ga0496122_0024700 3300048925 Bacteria 5250
542 Ga0496122_0038214 3300048925 Bacteria 3850
543 Ga0496122_0055595 3300048925 Bacteria 2959
544 Ga0496122_0102534 3300048925 Bacteria 1907
545 Ga0496123_0000002 3300048926 Bacteria 1811682
546 Ga0496123_0000035 3300048926 Bacteria 267288
547 Ga0496123_0000081 3300048926 Bacteria 190142
548 Ga0496123_0019603 3300048926 Bacteria 5327
549 Ga0496123_0131675 3300048926 Bacteria 1384
550 Ga0496123_0169793 3300048926 Bacteria 1152
551 Ga0496124_0000530 3300048927 Bacteria 65033
552 Ga0496124_0003541 3300048927 Bacteria 18992
553 Ga0496124_0010305 3300048927 Bacteria 9485
554 Ga0496124_0015678 3300048927 Bacteria 7249
555 Ga0496124_0018541 3300048927 Bacteria 6514
556 Ga0496124_0034006 3300048927 Bacteria 4479
557 Ga0496124_0236713 3300048927 Bacteria 1361
558 Ga0496124_0265687 3300048927 Bacteria 1260
559 Ga0496125_0000001 3300048928 Bacteria 1766138
560 Ga0496125_0000033 3300048928 Bacteria 351850
561 Ga0496125_0032307 3300048928 Bacteria 4650
562 Ga0496125_0106619 3300048928 Bacteria 2044
563 Ga0496126_0000053 3300048929 Bacteria 311989
564 Ga0496126_0001066 3300048929 Bacteria 46225
565 Ga0496126_0048035 3300048929 Bacteria 3905
566 Ga0496126_0050721 3300048929 Bacteria 3781
567 Ga0496126_0061199 3300048929 Bacteria 3382
568 Ga0496126_0082583 3300048929 Bacteria 2838
569 Ga0496126_0186957 3300048929 Bacteria 1756
570 Ga0496126_0241908 3300048929 Bacteria 1507
571 Ga0496126_0342842 3300048929 Bacteria 1224
572 Ga0495678_001299 3300049459 Bacteria 20174
573 Ga0495678_036076 3300049459 Bacteria 2021
574 Ga0495682_0000003 3300049460 Bacteria 515787
575 Ga0501031_0182755 3300049568 Bacteria 1370
576 Ga0501032_0256322 3300049569 Bacteria 1135
577 Ga0501034_0001016 3300049571 Bacteria 40222
578 Ga0501038_0097401 3300049574 Bacteria 2454
579 Ga0501042_0062880 3300049578 Bacteria 2653
580 Ga0501043_0159367 3300049579 Bacteria 1764
581 Ga0501046_0129194 3300049580 Bacteria 1917
582 Ga0501047_0015869 3300049581 Bacteria 7177
583 Ga0501067_0081931 3300049583 Bacteria 1789
584 Ga0501073_0001099 3300049589 Bacteria 19587
585 Ga0501075_0334746 3300049591 Bacteria 1154
586 Ga0501080_0022705 3300049742 Bacteria 5813
587 Ga0501080_0043791 3300049742 Bacteria 4168
588 Ga0501083_0019699 3300049744 Bacteria 4698
589 Ga0501035_0112926 3300049822 Bacteria 2380
590 Ga0501035_0448403 3300049822 Bacteria 1068
591 Ga0501044_0007436 3300049823 Bacteria 12046
592 Ga0501044_0017995 3300049823 Bacteria 7577
593 Ga0501044_0019019 3300049823 Bacteria 7355
594 Ga0501044_0063397 3300049823 Bacteria 3776
595 nmdc:mga03n38_21958_c1 3300050490 Bacteria 2576
596 nmdc:mga03n38_92522_c1 3300050490 Bacteria 1443
597 nmdc:mga00v17_152240_c1 3300050491 Bacteria 1486
598 nmdc:mga00v17_18899_c1 3300050491 Bacteria 3923
599 nmdc:mga00v17_230_c1 3300050491 Bacteria 33351
600 nmdc:mga00v17_24063_c1 3300050491 Bacteria 3528
601 nmdc:mga00v17_24964_c1 3300050491 Bacteria 3469
602 nmdc:mga0yw44_13281_c2 3300050492 Bacteria 3956
603 nmdc:mga0yw44_184551_c1 3300050492 Bacteria 1374
604 nmdc:mga0yw44_36719_c1 3300050492 Bacteria 2889
605 nmdc:mga0yw44_53094_c1 3300050492 Bacteria 2460
606 nmdc:mga06z11_243744_c1 3300050494 Bacteria 1056
607 nmdc:mga06z11_67034_c1 3300050494 Bacteria 1889
608 nmdc:mga04h51_76042_c1 3300050495 Bacteria 1183
609 nmdc:mga07m45_31123_c1 3300050496 Bacteria 2956
610 nmdc:mga07m45_50630_c1 3300050496 Bacteria 2341
611 nmdc:mga07m45_65030_c1 3300050496 Bacteria 2070
612 nmdc:mga05p37_305941_c1 3300050507 Bacteria 1886
613 nmdc:mga08y16_44_c1 3300050511 Bacteria 121496
614 nmdc:mga0sz30_107108_c1 3300050516 Bacteria 1223
615 nmdc:mga0sz30_16417_c1 3300050516 Bacteria 2940
616 nmdc:mga0sz30_6234_c1 3300050516 Bacteria 4422
617 Ga0500610_0050322 3300053079 Bacteria 2168
618 Ga0495619_0058978 3300053085 Bacteria 2549
619 Ga0500578_0041834 3300053086 Bacteria 2942
620 Ga0500646_0002763 3300053090 Bacteria 4529
621 Ga0500651_0086229 3300053093 Bacteria 1940
622 Ga0500641_0055833 3300053096 Bacteria 1635
623 Ga0500555_026090 3300053103 Bacteria 1670
624 Ga0500557_026116 3300053105 Bacteria 1725
625 Ga0500594_0033298 3300053118 Bacteria 1370
626 Ga0500595_006666 3300053119 Bacteria 4871
627 Ga0500621_000006 3300053126 Bacteria 245480
628 Ga0500642_0002981 3300053130 Bacteria 5046
629 Ga0500658_0001819 3300053134 Bacteria 8407
630 Ga0500561_0000110 3300053137 Bacteria 15825
631 Ga0500568_0000109 3300053139 Bacteria 76714
632 Ga0500568_0021697 3300053139 Bacteria 2759
633 Ga0500573_0018384 3300053140 Bacteria 3985
634 Ga0500588_0008069 3300053146 Bacteria 2446
635 Ga0500588_0049259 3300053146 Bacteria 1306
636 Ga0500588_0063539 3300053146 Bacteria 1190
637 Ga0500590_000792 3300053148 Bacteria 11720
638 Ga0500604_0002453 3300053151 Bacteria 5056
639 Ga0500604_0014031 3300053151 Bacteria 2177
640 Ga0500616_0001121 3300053153 Bacteria 27611
641 Ga0500616_0002733 3300053153 Bacteria 14294
642 Ga0500616_0035927 3300053153 Bacteria 2692
643 Ga0500616_0039388 3300053153 Bacteria 2548
644 Ga0500620_000841 3300053155 Bacteria 5328
645 Ga0500622_0002690 3300053156 Bacteria 12594
646 Ga0500624_000296 3300053157 Bacteria 17030
647 Ga0500627_0098481 3300053158 Bacteria 1312
648 Ga0500633_0085069 3300053160 Bacteria 1149
649 Ga0500634_0000796 3300053161 Bacteria 11018
650 Ga0500634_0010247 3300053161 Bacteria 4780
651 Ga0500636_0000026 3300053177 Bacteria 84046
652 Ga0500636_0000083 3300053177 Bacteria 47142
653 Ga0500611_028575 3300053727 Bacteria 1133
654 Ga0500609_000048 3300053731 Bacteria 15782
655 Ga0500609_012055 3300053731 Bacteria 1169
656 Ga0501084_0218865 3300054114 Bacteria 1607
657 Ga0590071_004505 3300059421 Bacteria 3380
658 Ga0590075_002537 3300059424 Bacteria 4364
659 Ga0590077_010994 3300059426 Bacteria 1866
660 Ga0501082_0116708 3300060353 Bacteria 2312
661 Ga0501082_0131532 3300060353 Bacteria 2171
662 Ga0530510_0214334 3300061734 Bacteria 1431

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026089 Ga0207648_10613942 Ga0207648_106139421 217
2 iso_pu_bacteria 2977898635 2977904808 219
3 3300021361 Ga0213872_10009103 Ga0213872_100091034 221
4 3300039447 Ga0436361_0570105 Ga0436361_0570105_3415_4239 221
5 3300039447 Ga0436361_0137889 Ga0436361_0137889_555_1370 224
6 3300046512 Ga0495610_0009644 Ga0495610_0009644_3413_4264 228
7 iso_pu_bacteria 2965110997 2965113533 228
8 3300039450 Ga0436363_1315970 Ga0436363_1315970_2809_3657 229
9 3300002987 JGI25159J45721_1003115 JGI25159J45721_10031152 233
10 3300005262 Ga0065165_1047904 Ga0065165_10479042 233
11 3300021361 Ga0213872_10002824 Ga0213872_100028245 233
12 3300025284 Ga0209130_1001748 Ga0209130_10017484 233
13 3300025302 Ga0207426_1000141 Ga0207426_10001414 233
14 3300039447 Ga0436361_0027550 Ga0436361_0027550_8075_8893 233
15 3300041407 Ga0439447_048680 Ga0439447_048680_119_970 233
16 iso_pu_bacteria 2958144490 2958150398 236
17 3300045049 Ga0466959_0052281 Ga0466959_0052281_414_1238 237
18 3300053155 Ga0500620_000841 Ga0500620_000841_1656_2504 237
19 3300005937 Ga0081455_10124862 Ga0081455_101248621 238
20 3300005983 Ga0081540_1041947 Ga0081540_10419472 238
21 3300003354 JGI25160J50197_1000726 JGI25160J50197_10007262 239
22 3300003771 Ga0055526_1016818 Ga0055526_10168183 239
23 3300026121 Ga0207683_10039107 Ga0207683_100391071 240
24 3300037471 Ga0395905_0122973 Ga0395905_0122973_496_1344 241
25 3300005548 Ga0070665_100511960 Ga0070665_1005119602 242
26 3300009545 Ga0105237_10023149 Ga0105237_100231493 242
27 3300009545 Ga0105237_10283541 Ga0105237_102835412 242
28 3300009551 Ga0105238_10014472 Ga0105238_100144722 242
29 3300010375 Ga0105239_10078102 Ga0105239_100781024 242
30 3300025284 Ga0209130_1010463 Ga0209130_10104633 242
31 3300025914 Ga0207671_10088960 Ga0207671_100889602 242
32 3300025924 Ga0207694_10032771 Ga0207694_100327714 242
33 3300048920 Ga0496117_0160660 Ga0496117_0160660_436_1284 242
34 3300048929 Ga0496126_0048035 Ga0496126_0048035_2179_3027 242
35 3300006946 Ga0079104_1001270 Ga0079104_10012707 243
36 3300006946 Ga0079104_1024320 Ga0079104_10243201 243
37 3300006948 Ga0099826_10035342 Ga0099826_100353422 243
38 3300021320 Ga0214544_1000010 Ga0214544_1000010196 243
39 3300021321 Ga0214542_1000023 Ga0214542_100002355 243
40 3300021321 Ga0214542_1018351 Ga0214542_10183515 243
41 3300021327 Ga0214543_1000019 Ga0214543_1000019130 243
42 3300021327 Ga0214543_1001578 Ga0214543_100157839 243
43 3300022739 Ga0228711_1000017 Ga0228711_100001719 243
44 3300022740 Ga0228710_1000005 Ga0228710_1000005234 243
45 3300025294 Ga0209025_1000666 Ga0209025_100066651 243
46 3300027111 Ga0209281_1000082 Ga0209281_1000082182 243
47 3300027111 Ga0209281_1001229 Ga0209281_10012296 243
48 3300027312 Ga0209371_1004841 Ga0209371_10048413 243
49 3300027666 Ga0209282_1000006 Ga0209282_1000006204 243
50 3300027666 Ga0209282_1036197 Ga0209282_10361973 243
51 3300030500 Ga0268256_1003641 Ga0268256_10036414 243
52 3300030500 Ga0268256_1004619 Ga0268256_10046193 243
53 3300031852 Ga0307410_10203197 Ga0307410_102031972 243
54 3300031967 Ga0315914_1000003 Ga0315914_1000003259 243
55 3300031995 Ga0307409_100116671 Ga0307409_1001166712 243
56 3300033430 Ga0315913_1000001 Ga0315913_1000001210 243
57 3300033464 Ga0315915_1000008 Ga0315915_100000877 243
58 3300035695 Ga0373927_0000266 Ga0373927_0000266_995_1828 243
59 3300037068 Ga0373925_0001672 Ga0373925_0001672_12449_13282 243
60 3300038443 Ga0395901_0116451 Ga0395901_0116451_334_1182 243
61 3300042007 Ga0439449_0017545 Ga0439449_0017545_1795_2628 243
62 3300048926 Ga0496123_0131675 Ga0496123_0131675_395_1225 243
63 3300005577 Ga0068857_100169903 Ga0068857_1001699032 244
64 3300005937 Ga0081455_10035366 Ga0081455_100353663 244
65 3300009174 Ga0105241_10032823 Ga0105241_100328232 244
66 3300025913 Ga0207695_10011879 Ga0207695_100118792 244
67 3300026116 Ga0207674_10432554 Ga0207674_104325542 244
68 3300026118 Ga0207675_100122019 Ga0207675_1001220192 244
69 3300044658 Ga0466972_0084169 Ga0466972_0084169_345_1193 244
70 3300046460 Ga0495638_0210983 Ga0495638_0210983_47_895 244
71 3300046515 Ga0495620_0107319 Ga0495620_0107319_167_1015 244
72 3300046522 Ga0495643_0088441 Ga0495643_0088441_710_1558 244
73 3300046660 Ga0495625_0105065 Ga0495625_0105065_324_1172 244
74 3300046694 Ga0495649_0158143 Ga0495649_0158143_186_1034 244
75 3300047470 Ga0495681_0061718 Ga0495681_0061718_697_1545 244
76 3300048929 Ga0496126_0342842 Ga0496126_0342842_166_1014 244
77 3300050516 nmdc:mga0sz30_107108_c1 nmdc:mga0sz30_107108_c1_102_950 244
78 3300053727 Ga0500611_028575 Ga0500611_028575_223_1071 244
79 3300005338 Ga0068868_100250245 Ga0068868_1002502452 245
80 3300009098 Ga0105245_10601596 Ga0105245_106015962 245
81 3300031995 Ga0307409_100653424 Ga0307409_1006534242 245
82 3300046507 Ga0495606_0023645 Ga0495606_0023645_3285_4118 245
83 3300048922 Ga0496119_0015192 Ga0496119_0015192_3862_4695 245
84 3300048925 Ga0496122_0055595 Ga0496122_0055595_1835_2668 245
85 3300048928 Ga0496125_0106619 Ga0496125_0106619_489_1322 245
86 3300050492 nmdc:mga0yw44_13281_c2 nmdc:mga0yw44_13281_c2_291_1139 245
87 3300053079 Ga0500610_0050322 Ga0500610_0050322_706_1554 245
88 3300002739 JGI25158J39367_1000094 JGI25158J39367_10000944 246
89 3300002773 JGI25152J39213_1013083 JGI25152J39213_10130831 246
90 3300002773 JGI25152J39213_1015131 JGI25152J39213_10151312 246
91 3300002773 JGI25152J39213_1016662 JGI25152J39213_10166622 246
92 3300002774 JGI25150J39212_1006873 JGI25150J39212_10068732 246
93 3300003215 JGI25153J46596_10005550 JGI25153J46596_100055505 246
94 3300003215 JGI25153J46596_10037724 JGI25153J46596_100377242 246
95 3300003215 JGI25153J46596_10037747 JGI25153J46596_100377472 246
96 3300003374 JGI25161J50226_1001989 JGI25161J50226_10019895 246
97 3300003771 Ga0055526_1017729 Ga0055526_10177291 246
98 3300003775 Ga0055524_1014578 Ga0055524_10145783 246
99 3300003790 Ga0055528_1004148 Ga0055528_10041485 246
100 3300003792 Ga0055540_1005332 Ga0055540_10053323 246
101 3300004625 Ga0055543_1000021 Ga0055543_100002157 246
102 3300005262 Ga0065165_1008941 Ga0065165_10089412 246
103 3300025208 Ga0209436_101959 Ga0209436_1019592 246
104 3300025245 Ga0207425_1008594 Ga0207425_10085942 246
105 3300025258 Ga0209129_1001521 Ga0209129_100152114 246
106 3300025258 Ga0209129_1002872 Ga0209129_10028723 246
107 3300025258 Ga0209129_1004004 Ga0209129_10040046 246
108 3300025273 Ga0209673_1002729 Ga0209673_10027299 246
109 3300025284 Ga0209130_1000001 Ga0209130_1000001213 246
110 3300025294 Ga0209025_1002519 Ga0209025_10025192 246
111 3300025295 Ga0209564_1002441 Ga0209564_10024419 246
112 3300025297 Ga0209758_1000712 Ga0209758_100071213 246
113 3300025297 Ga0209758_1002735 Ga0209758_100273517 246
114 3300025297 Ga0209758_1004308 Ga0209758_10043089 246
115 3300025299 Ga0209256_1003989 Ga0209256_10039899 246
116 3300025302 Ga0207426_1000005 Ga0207426_1000005818 246
117 3300041413 Ga0439465_0075847 Ga0439465_0075847_181_1011 246
118 3300041413 Ga0439465_0142491 Ga0439465_0142491_11_841 246
119 3300046810 Ga0495660_0051547 Ga0495660_0051547_1236_2030 246
120 3300048909 Ga0496106_0351713 Ga0496106_0351713_110_940 246
121 3300048922 Ga0496119_0011716 Ga0496119_0011716_5720_6568 246
122 3300048923 Ga0496120_0001523 Ga0496120_0001523_5790_6638 246
123 3300048926 Ga0496123_0169793 Ga0496123_0169793_258_1088 246
124 3300048927 Ga0496124_0265687 Ga0496124_0265687_207_1037 246
125 3300049459 Ga0495678_036076 Ga0495678_036076_133_927 246
126 3300053139 Ga0500568_0000109 Ga0500568_0000109_171_1001 246
127 3300053153 Ga0500616_0039388 Ga0500616_0039388_224_1018 246
128 3300060353 Ga0501082_0116708 Ga0501082_0116708_1287_2117 246
129 3300014497 Ga0182008_10100750 Ga0182008_101007501 248
130 3300026078 Ga0207702_10487839 Ga0207702_104878391 248
131 3300036401 Ga0373937_0593115 Ga0373937_0593115_171_974 248
132 3300006353 Ga0075370_10070369 Ga0075370_100703692 249
133 3300025297 Ga0209758_1005005 Ga0209758_10050058 249
134 3300025904 Ga0207647_10081824 Ga0207647_100818242 249
135 3300025907 Ga0207645_10056949 Ga0207645_100569492 249
136 3300025940 Ga0207691_10187455 Ga0207691_101874552 249
137 3300025972 Ga0207668_10510421 Ga0207668_105104211 249
138 3300026067 Ga0207678_10159191 Ga0207678_101591912 249
139 3300042012 Ga0439455_0022511 Ga0439455_0022511_318_1166 249
140 3300050494 nmdc:mga06z11_243744_c1 nmdc:mga06z11_243744_c1_32_862 249
141 3300049568 Ga0501031_0182755 Ga0501031_0182755_438_1289 250
142 3300049578 Ga0501042_0062880 Ga0501042_0062880_1188_2039 250
143 3300049591 Ga0501075_0334746 Ga0501075_0334746_175_1026 250
144 3300054114 Ga0501084_0218865 Ga0501084_0218865_179_1030 250
145 3300061734 Ga0530510_0214334 Ga0530510_0214334_189_1040 250
146 3300009174 Ga0105241_10560250 Ga0105241_105602502 251
147 3300046459 Ga0495629_0040880 Ga0495629_0040880_1223_2035 252
148 3300046475 Ga0495639_0081012 Ga0495639_0081012_437_1249 252
149 3300046536 Ga0495587_0121886 Ga0495587_0121886_192_1004 252
150 3300047319 Ga0495674_0451548 Ga0495674_0451548_13_825 252
151 iso_pu_bacteria 2508501050 2508733346 252
152 iso_pu_bacteria 2511231035 2511435636 252
153 iso_pu_bacteria 2599185156 2599334020 252
154 iso_pu_bacteria 2671180139 2671693577 252
155 iso_pu_bacteria 2773857925 2774872485 252
156 iso_pu_bacteria 2842922631 2842925700 252
157 iso_pu_bacteria 2876601092 2876604989 252
158 iso_pu_bacteria 2882456835 2882460008 252
159 iso_pu_bacteria 2894232714 2894236834 252
160 iso_pu_bacteria 2939602548 2939605381 252
161 iso_pu_bacteria 8016733728 8016738591 252
162 iso_pu_bacteria 8019499862 8019500238 252
163 3300048921 Ga0496118_0012231 Ga0496118_0012231_7399_8214 253
164 iso_pu_bacteria 2582581304 2585255305 253
165 iso_pu_bacteria 2908669403 2908673145 253
166 3300002704 JGI25155J39150_1000015 JGI25155J39150_100001545 254
167 3300002705 JGI25156J39149_1000007 JGI25156J39149_100000745 254
168 3300002737 JGI25162J39368_1000119 JGI25162J39368_100011949 254
169 3300002737 JGI25162J39368_1000489 JGI25162J39368_100048928 254
170 3300002738 JGI25154J39366_1000145 JGI25154J39366_100014545 254
171 3300002741 JGI25157J39369_1000012 JGI25157J39369_1000012156 254
172 3300002773 JGI25152J39213_1002953 JGI25152J39213_10029535 254
173 3300002774 JGI25150J39212_1000103 JGI25150J39212_100010336 254
174 3300002774 JGI25150J39212_1014069 JGI25150J39212_10140692 254
175 3300002987 JGI25159J45721_1001078 JGI25159J45721_100107810 254
176 3300003187 JGI25151J46595_10000085 JGI25151J46595_10000085111 254
177 3300003187 JGI25151J46595_10014672 JGI25151J46595_100146724 254
178 3300003214 JGI25165J46597_1000211 JGI25165J46597_100021149 254
179 3300003214 JGI25165J46597_1001070 JGI25165J46597_100107012 254
180 3300003214 JGI25165J46597_1004826 JGI25165J46597_10048261 254
181 3300003215 JGI25153J46596_10000103 JGI25153J46596_1000010345 254
182 3300003215 JGI25153J46596_10001488 JGI25153J46596_100014885 254
183 3300003215 JGI25153J46596_10009848 JGI25153J46596_100098484 254
184 3300003354 JGI25160J50197_1000023 JGI25160J50197_1000023168 254
185 3300003354 JGI25160J50197_1000033 JGI25160J50197_1000033163 254
186 3300003354 JGI25160J50197_1001657 JGI25160J50197_10016578 254
187 3300003374 JGI25161J50226_1000012 JGI25161J50226_1000012168 254
188 3300003374 JGI25161J50226_1000508 JGI25161J50226_10005085 254
189 3300003374 JGI25161J50226_1004573 JGI25161J50226_10045732 254
190 3300003578 Ga0006562J51391_1050521 Ga0006562J51391_10505212 254
191 3300003771 Ga0055526_1002294 Ga0055526_100229412 254
192 3300003771 Ga0055526_1008324 Ga0055526_10083242 254
193 3300003771 Ga0055526_1016912 Ga0055526_10169122 254
194 3300003771 Ga0055526_1028335 Ga0055526_10283352 254
195 3300003775 Ga0055524_1003993 Ga0055524_10039934 254
196 3300003775 Ga0055524_1007275 Ga0055524_10072752 254
197 3300003775 Ga0055524_1023454 Ga0055524_10234542 254
198 3300003781 Ga0055536_1012578 Ga0055536_10125783 254
199 3300003790 Ga0055528_1000519 Ga0055528_100051921 254
200 3300003790 Ga0055528_1014232 Ga0055528_10142322 254
201 3300003790 Ga0055528_1027463 Ga0055528_10274631 254
202 3300003790 Ga0055528_1031970 Ga0055528_10319702 254
203 3300003791 Ga0055530_10022847 Ga0055530_100228472 254
204 3300003792 Ga0055540_1000050 Ga0055540_1000050126 254
205 3300003792 Ga0055540_1012166 Ga0055540_10121662 254
206 3300003794 Ga0055531_10016516 Ga0055531_100165162 254
207 3300003794 Ga0055531_10017593 Ga0055531_100175931 254
208 3300003856 Ga0058692_1017728 Ga0058692_10177282 254
209 3300004625 Ga0055543_1000009 Ga0055543_1000009168 254
210 3300004625 Ga0055543_1000315 Ga0055543_100031522 254
211 3300004625 Ga0055543_1003043 Ga0055543_10030433 254
212 3300005262 Ga0065165_1000064 Ga0065165_100006429 254
213 3300005262 Ga0065165_1000513 Ga0065165_100051314 254
214 3300005262 Ga0065165_1005453 Ga0065165_10054538 254
215 3300005262 Ga0065165_1006135 Ga0065165_10061352 254
216 3300005331 Ga0070670_100000287 Ga0070670_10000028724 254
217 3300005347 Ga0070668_100127067 Ga0070668_1001270672 254
218 3300005355 Ga0070671_100380979 Ga0070671_1003809792 254
219 3300005548 Ga0070665_100105349 Ga0070665_1001053492 254
220 3300005548 Ga0070665_100177473 Ga0070665_1001774733 254
221 3300005548 Ga0070665_100263818 Ga0070665_1002638182 254
222 3300005578 Ga0068854_100067701 Ga0068854_1000677013 254
223 3300005614 Ga0068856_100022838 Ga0068856_1000228382 254
224 3300005834 Ga0068851_10135295 Ga0068851_101352952 254
225 3300005844 Ga0068862_100090252 Ga0068862_1000902523 254
226 3300006038 Ga0075365_10010840 Ga0075365_100108404 254
227 3300006038 Ga0075365_10303480 Ga0075365_103034802 254
228 3300006042 Ga0075368_10088341 Ga0075368_100883412 254
229 3300006048 Ga0075363_100272121 Ga0075363_1002721211 254
230 3300006051 Ga0075364_10013563 Ga0075364_100135633 254
231 3300006051 Ga0075364_10326887 Ga0075364_103268872 254
232 3300006178 Ga0075367_10021014 Ga0075367_100210143 254
233 3300006186 Ga0075369_10007134 Ga0075369_100071344 254
234 3300006186 Ga0075369_10035944 Ga0075369_100359442 254
235 3300006195 Ga0075366_10003448 Ga0075366_100034483 254
236 3300006353 Ga0075370_10003108 Ga0075370_100031088 254
237 3300006881 Ga0068865_100577500 Ga0068865_1005775001 254
238 3300006948 Ga0099826_10000181 Ga0099826_100001814 254
239 3300009011 Ga0105251_10055843 Ga0105251_100558432 254
240 3300009036 Ga0105244_10122047 Ga0105244_101220472 254
241 3300009093 Ga0105240_10000217 Ga0105240_1000021764 254
242 3300009093 Ga0105240_10542647 Ga0105240_105426471 254
243 3300009098 Ga0105245_10346920 Ga0105245_103469202 254
244 3300009098 Ga0105245_10933278 Ga0105245_109332781 254
245 3300009148 Ga0105243_10032808 Ga0105243_100328083 254
246 3300009148 Ga0105243_10293898 Ga0105243_102938982 254
247 3300009177 Ga0105248_10046083 Ga0105248_100460832 254
248 3300009177 Ga0105248_10736661 Ga0105248_107366612 254
249 3300009545 Ga0105237_10001458 Ga0105237_1000145828 254
250 3300009551 Ga0105238_10823791 Ga0105238_108237911 254
251 3300009553 Ga0105249_10239161 Ga0105249_102391611 254
252 3300009765 Ga0123341_1000109 Ga0123341_100010913 254
253 3300009766 Ga0123342_1014735 Ga0123342_10147353 254
254 3300010375 Ga0105239_10001164 Ga0105239_100011642 254
255 3300010375 Ga0105239_10440443 Ga0105239_104404432 254
256 3300011119 Ga0105246_10097688 Ga0105246_100976882 254
257 3300013100 Ga0157373_10030840 Ga0157373_100308403 254
258 3300013102 Ga0157371_10000002 Ga0157371_10000002606 254
259 3300013104 Ga0157370_10001439 Ga0157370_1000143931 254
260 3300013104 Ga0157370_10001923 Ga0157370_100019233 254
261 3300013105 Ga0157369_10107178 Ga0157369_101071783 254
262 3300013249 Ga0171463_1007 Ga0171463_1007285 254
263 3300015262 Ga0182007_10000324 Ga0182007_100003249 254
264 3300015265 Ga0182005_1001504 Ga0182005_10015044 254
265 3300015690 Ga0183363_1153 Ga0183363_11535 254
266 3300025206 Ga0209435_100006 Ga0209435_100006481 254
267 3300025208 Ga0209436_109923 Ga0209436_1099232 254
268 3300025233 Ga0209437_100042 Ga0209437_100042132 254
269 3300025233 Ga0209437_100062 Ga0209437_100062279 254
270 3300025245 Ga0207425_1000065 Ga0207425_1000065108 254
271 3300025245 Ga0207425_1009532 Ga0207425_10095322 254
272 3300025246 Ga0209646_1000015 Ga0209646_100001553 254
273 3300025246 Ga0209646_1003792 Ga0209646_10037922 254
274 3300025250 Ga0209026_1000046 Ga0209026_100004653 254
275 3300025253 Ga0209677_100429 Ga0209677_1004296 254
276 3300025256 Ga0209759_1000005 Ga0209759_1000005481 254
277 3300025258 Ga0209129_1000019 Ga0209129_1000019107 254
278 3300025258 Ga0209129_1000132 Ga0209129_1000132108 254
279 3300025258 Ga0209129_1006071 Ga0209129_10060713 254
280 3300025258 Ga0209129_1010911 Ga0209129_10109112 254
281 3300025261 Ga0209233_1000082 Ga0209233_1000082279 254
282 3300025261 Ga0209233_1000103 Ga0209233_1000103132 254
283 3300025261 Ga0209233_1000288 Ga0209233_100028815 254
284 3300025273 Ga0209673_1000023 Ga0209673_1000023228 254
285 3300025273 Ga0209673_1000132 Ga0209673_1000132106 254
286 3300025273 Ga0209673_1001968 Ga0209673_10019687 254
287 3300025273 Ga0209673_1002876 Ga0209673_10028763 254
288 3300025273 Ga0209673_1003829 Ga0209673_10038292 254
289 3300025284 Ga0209130_1000017 Ga0209130_100001714 254
290 3300025284 Ga0209130_1000048 Ga0209130_100004829 254
291 3300025284 Ga0209130_1015688 Ga0209130_10156882 254
292 3300025292 Ga0209676_1021257 Ga0209676_10212572 254
293 3300025294 Ga0209025_1000072 Ga0209025_100007282 254
294 3300025294 Ga0209025_1000153 Ga0209025_1000153162 254
295 3300025294 Ga0209025_1000247 Ga0209025_1000247108 254
296 3300025294 Ga0209025_1005892 Ga0209025_10058926 254
297 3300025294 Ga0209025_1019188 Ga0209025_10191882 254
298 3300025294 Ga0209025_1019195 Ga0209025_10191952 254
299 3300025294 Ga0209025_1049715 Ga0209025_10497152 254
300 3300025295 Ga0209564_1000100 Ga0209564_1000100154 254
301 3300025295 Ga0209564_1000372 Ga0209564_100037252 254
302 3300025295 Ga0209564_1001437 Ga0209564_100143711 254
303 3300025295 Ga0209564_1011402 Ga0209564_10114022 254
304 3300025295 Ga0209564_1034239 Ga0209564_10342392 254
305 3300025297 Ga0209758_1000053 Ga0209758_1000053150 254
306 3300025297 Ga0209758_1000212 Ga0209758_1000212109 254
307 3300025297 Ga0209758_1000239 Ga0209758_100023967 254
308 3300025297 Ga0209758_1014984 Ga0209758_10149843 254
309 3300025297 Ga0209758_1022928 Ga0209758_10229283 254
310 3300025297 Ga0209758_1030212 Ga0209758_10302122 254
311 3300025297 Ga0209758_1034485 Ga0209758_10344852 254
312 3300025297 Ga0209758_1049788 Ga0209758_10497882 254
313 3300025298 Ga0209050_1002669 Ga0209050_100266915 254
314 3300025298 Ga0209050_1006906 Ga0209050_10069067 254
315 3300025298 Ga0209050_1009761 Ga0209050_10097612 254
316 3300025299 Ga0209256_1000401 Ga0209256_100040122 254
317 3300025299 Ga0209256_1000458 Ga0209256_100045824 254
318 3300025299 Ga0209256_1000735 Ga0209256_100073540 254
319 3300025299 Ga0209256_1000818 Ga0209256_10008182 254
320 3300025299 Ga0209256_1002923 Ga0209256_10029235 254
321 3300025302 Ga0207426_1000006 Ga0207426_100000614 254
322 3300025302 Ga0207426_1000035 Ga0207426_1000035225 254
323 3300025302 Ga0207426_1000136 Ga0207426_100013629 254
324 3300025303 Ga0209051_1000062 Ga0209051_1000062201 254
325 3300025303 Ga0209051_1003152 Ga0209051_10031526 254
326 3300025303 Ga0209051_1005006 Ga0209051_10050063 254
327 3300025303 Ga0209051_1035479 Ga0209051_10354792 254
328 3300025304 Ga0209257_1001119 Ga0209257_10011196 254
329 3300025304 Ga0209257_1010746 Ga0209257_10107464 254
330 3300025903 Ga0207680_10246153 Ga0207680_102461531 254
331 3300025913 Ga0207695_10000613 Ga0207695_1000061349 254
332 3300025914 Ga0207671_10001160 Ga0207671_100011602 254
333 3300025925 Ga0207650_10001289 Ga0207650_1000128910 254
334 3300025928 Ga0207700_10206085 Ga0207700_102060852 254
335 3300025935 Ga0207709_10036345 Ga0207709_100363452 254
336 3300025941 Ga0207711_10334835 Ga0207711_103348351 254
337 3300025972 Ga0207668_10106081 Ga0207668_101060812 254
338 3300026075 Ga0207708_10110635 Ga0207708_101106352 254
339 3300026078 Ga0207702_10014348 Ga0207702_100143486 254
340 3300026121 Ga0207683_10198925 Ga0207683_101989251 254
341 3300027312 Ga0209371_1004328 Ga0209371_10043284 254
342 3300027666 Ga0209282_1000176 Ga0209282_100017631 254
343 3300028379 Ga0268266_10005342 Ga0268266_100053423 254
344 3300028379 Ga0268266_10198257 Ga0268266_101982572 254
345 3300028379 Ga0268266_10240919 Ga0268266_102409192 254
346 3300028379 Ga0268266_10361384 Ga0268266_103613842 254
347 3300028380 Ga0268265_10171350 Ga0268265_101713502 254
348 3300028786 Ga0307517_10207732 Ga0307517_102077322 254
349 3300028794 Ga0307515_10002150 Ga0307515_1000215040 254
350 3300028794 Ga0307515_10033865 Ga0307515_100338652 254
351 3300028794 Ga0307515_10168799 Ga0307515_101687992 254
352 3300030500 Ga0268256_1003966 Ga0268256_10039663 254
353 3300030744 Ga0316181_1067070 Ga0316181_10670702 254
354 3300031235 Ga0265330_10046801 Ga0265330_100468012 254
355 3300031456 Ga0307513_10000463 Ga0307513_1000046355 254
356 3300031456 Ga0307513_10166943 Ga0307513_101669432 254
357 3300031456 Ga0307513_10185890 Ga0307513_101858902 254
358 3300031456 Ga0307513_10355592 Ga0307513_103555922 254
359 3300031616 Ga0307508_10081823 Ga0307508_100818232 254
360 3300031711 Ga0265314_10018857 Ga0265314_100188575 254
361 3300031911 Ga0307412_10019356 Ga0307412_100193564 254
362 3300032002 Ga0307416_100202641 Ga0307416_1002026412 254
363 3300032004 Ga0307414_10365263 Ga0307414_103652632 254
364 3300037471 Ga0395905_0002837 Ga0395905_0002837_5015_5848 254
365 3300037471 Ga0395905_0003927 Ga0395905_0003927_7977_8810 254
366 3300037471 Ga0395905_0048313 Ga0395905_0048313_452_1291 254
367 3300037471 Ga0395905_0093038 Ga0395905_0093038_401_1234 254
368 3300039437 Ga0436365_0671760 Ga0436365_0671760_177_1007 254
369 3300041404 Ga0439436_0000195 Ga0439436_0000195_8664_9497 254
370 3300041492 Ga0451835_0331121 Ga0451835_0331121_236_1066 254
371 3300041496 Ga0451839_0268492 Ga0451839_0268492_554_1384 254
372 3300041501 Ga0451845_0189427 Ga0451845_0189427_430_1260 254
373 3300041503 Ga0451847_0010441 Ga0451847_0010441_280_1110 254
374 3300041509 Ga0451843_0065299 Ga0451843_0065299_137_967 254
375 3300041512 Ga0451853_2758235 Ga0451853_2758235_243_1073 254
376 3300042015 Ga0439462_0027122 Ga0439462_0027122_357_1190 254
377 3300042015 Ga0439462_0042290 Ga0439462_0042290_108_941 254
378 3300042145 Ga0450906_029307 Ga0450906_029307_30_863 254
379 3300044765 Ga0466970_0169294 Ga0466970_0169294_145_975 254
380 3300044901 Ga0466960_0168679 Ga0466960_0168679_213_1052 254
381 3300046454 Ga0495592_0075679 Ga0495592_0075679_243_1076 254
382 3300046460 Ga0495638_0123397 Ga0495638_0123397_306_1139 254
383 3300046476 Ga0495662_0007616 Ga0495662_0007616_3766_4599 254
384 3300046492 Ga0495585_0140841 Ga0495585_0140841_76_906 254
385 3300046507 Ga0495606_0001618 Ga0495606_0001618_1553_2383 254
386 3300046513 Ga0495616_0116708 Ga0495616_0116708_118_948 254
387 3300046518 Ga0495631_0077215 Ga0495631_0077215_86_916 254
388 3300046519 Ga0495632_0086599 Ga0495632_0086599_406_1236 254
389 3300046530 Ga0495654_0000694 Ga0495654_0000694_25487_26320 254
390 3300046557 Ga0495622_0023211 Ga0495622_0023211_914_1747 254
391 3300046558 Ga0495633_0005760 Ga0495633_0005760_5019_5849 254
392 3300046615 Ga0495656_0110939 Ga0495656_0110939_366_1196 254
393 3300046616 Ga0495668_0196902 Ga0495668_0196902_199_1029 254
394 3300046660 Ga0495625_0082577 Ga0495625_0082577_112_942 254
395 3300046660 Ga0495625_0110977 Ga0495625_0110977_612_1442 254
396 3300046660 Ga0495625_0371288 Ga0495625_0371288_55_888 254
397 3300046674 Ga0495588_0073614 Ga0495588_0073614_294_1127 254
398 3300046675 Ga0495657_0149954 Ga0495657_0149954_472_1305 254
399 3300047317 Ga0495604_0021553 Ga0495604_0021553_1838_2671 254
400 3300047470 Ga0495681_0002695 Ga0495681_0002695_10734_11564 254
401 3300047472 Ga0495686_0000795 Ga0495686_0000795_2807_3637 254
402 3300048090 Ga0495615_0040446 Ga0495615_0040446_133_963 254
403 3300048907 Ga0496104_0131911 Ga0496104_0131911_1129_1959 254
404 3300048919 Ga0496116_0000042 Ga0496116_0000042_122593_123423 254
405 3300048919 Ga0496116_0007217 Ga0496116_0007217_7178_8008 254
406 3300048919 Ga0496116_0019687 Ga0496116_0019687_2792_3622 254
407 3300048919 Ga0496116_0120858 Ga0496116_0120858_351_1181 254
408 3300048920 Ga0496117_0000036 Ga0496117_0000036_304278_305108 254
409 3300048920 Ga0496117_0026327 Ga0496117_0026327_3265_4095 254
410 3300048920 Ga0496117_0070372 Ga0496117_0070372_544_1374 254
411 3300048921 Ga0496118_0015347 Ga0496118_0015347_3815_4645 254
412 3300048921 Ga0496118_0041334 Ga0496118_0041334_2394_3224 254
413 3300048922 Ga0496119_0004655 Ga0496119_0004655_2863_3693 254
414 3300048922 Ga0496119_0016484 Ga0496119_0016484_3740_4573 254
415 3300048923 Ga0496120_0000777 Ga0496120_0000777_43923_44753 254
416 3300048923 Ga0496120_0001949 Ga0496120_0001949_10282_11112 254
417 3300048923 Ga0496120_0008096 Ga0496120_0008096_5793_6626 254
418 3300048924 Ga0496121_0000001 Ga0496121_0000001_103603_104436 254
419 3300048924 Ga0496121_0000239 Ga0496121_0000239_115748_116578 254
420 3300048924 Ga0496121_0002342 Ga0496121_0002342_10381_11211 254
421 3300048924 Ga0496121_0018876 Ga0496121_0018876_1062_1892 254
422 3300048925 Ga0496122_0000002 Ga0496122_0000002_576256_577086 254
423 3300048925 Ga0496122_0000072 Ga0496122_0000072_19555_20385 254
424 3300048925 Ga0496122_0022649 Ga0496122_0022649_4535_5365 254
425 3300048925 Ga0496122_0024700 Ga0496122_0024700_1598_2428 254
426 3300048925 Ga0496122_0038214 Ga0496122_0038214_2761_3591 254
427 3300048925 Ga0496122_0102534 Ga0496122_0102534_1019_1849 254
428 3300048926 Ga0496123_0000002 Ga0496123_0000002_1234597_1235427 254
429 3300048926 Ga0496123_0000002 Ga0496123_0000002_576256_577086 254
430 3300048926 Ga0496123_0000035 Ga0496123_0000035_64407_65237 254
431 3300048927 Ga0496124_0003541 Ga0496124_0003541_16004_16822 254
432 3300048927 Ga0496124_0010305 Ga0496124_0010305_7328_8158 254
433 3300048927 Ga0496124_0015678 Ga0496124_0015678_5582_6412 254
434 3300048927 Ga0496124_0018541 Ga0496124_0018541_1835_2665 254
435 3300048928 Ga0496125_0000001 Ga0496125_0000001_217058_217891 254
436 3300048928 Ga0496125_0032307 Ga0496125_0032307_2193_3023 254
437 3300048929 Ga0496126_0000053 Ga0496126_0000053_167227_168057 254
438 3300048929 Ga0496126_0050721 Ga0496126_0050721_1300_2130 254
439 3300048929 Ga0496126_0061199 Ga0496126_0061199_1397_2227 254
440 3300048929 Ga0496126_0082583 Ga0496126_0082583_1402_2235 254
441 3300048929 Ga0496126_0241908 Ga0496126_0241908_71_904 254
442 3300049569 Ga0501032_0256322 Ga0501032_0256322_29_859 254
443 3300049579 Ga0501043_0159367 Ga0501043_0159367_60_893 254
444 3300049580 Ga0501046_0129194 Ga0501046_0129194_326_1156 254
445 3300049581 Ga0501047_0015869 Ga0501047_0015869_574_1404 254
446 3300049589 Ga0501073_0001099 Ga0501073_0001099_13301_14131 254
447 3300049742 Ga0501080_0022705 Ga0501080_0022705_4280_5113 254
448 3300049742 Ga0501080_0043791 Ga0501080_0043791_2828_3658 254
449 3300049744 Ga0501083_0019699 Ga0501083_0019699_889_1719 254
450 3300049822 Ga0501035_0112926 Ga0501035_0112926_1413_2246 254
451 3300049822 Ga0501035_0448403 Ga0501035_0448403_85_918 254
452 3300049823 Ga0501044_0007436 Ga0501044_0007436_6679_7512 254
453 3300049823 Ga0501044_0017995 Ga0501044_0017995_995_1825 254
454 3300049823 Ga0501044_0063397 Ga0501044_0063397_68_898 254
455 3300050490 nmdc:mga03n38_21958_c1 nmdc:mga03n38_21958_c1_1560_2390 254
456 3300050491 nmdc:mga00v17_18899_c1 nmdc:mga00v17_18899_c1_286_1119 254
457 3300050491 nmdc:mga00v17_230_c1 nmdc:mga00v17_230_c1_1250_2080 254
458 3300050492 nmdc:mga0yw44_184551_c1 nmdc:mga0yw44_184551_c1_264_1097 254
459 3300050492 nmdc:mga0yw44_53094_c1 nmdc:mga0yw44_53094_c1_589_1419 254
460 3300050494 nmdc:mga06z11_67034_c1 nmdc:mga06z11_67034_c1_631_1461 254
461 3300050495 nmdc:mga04h51_76042_c1 nmdc:mga04h51_76042_c1_254_1084 254
462 3300050496 nmdc:mga07m45_65030_c1 nmdc:mga07m45_65030_c1_700_1530 254
463 3300050516 nmdc:mga0sz30_16417_c1 nmdc:mga0sz30_16417_c1_1922_2761 254
464 3300050516 nmdc:mga0sz30_6234_c1 nmdc:mga0sz30_6234_c1_3227_4057 254
465 3300053085 Ga0495619_0058978 Ga0495619_0058978_1408_2241 254
466 3300053086 Ga0500578_0041834 Ga0500578_0041834_152_982 254
467 3300053090 Ga0500646_0002763 Ga0500646_0002763_1136_1966 254
468 3300053105 Ga0500557_026116 Ga0500557_026116_390_1220 254
469 3300053134 Ga0500658_0001819 Ga0500658_0001819_1751_2581 254
470 3300053137 Ga0500561_0000110 Ga0500561_0000110_3107_3937 254
471 3300053140 Ga0500573_0018384 Ga0500573_0018384_2417_3250 254
472 3300053146 Ga0500588_0008069 Ga0500588_0008069_1176_2006 254
473 3300053148 Ga0500590_000792 Ga0500590_000792_9182_10015 254
474 3300053151 Ga0500604_0002453 Ga0500604_0002453_866_1696 254
475 3300053151 Ga0500604_0014031 Ga0500604_0014031_553_1383 254
476 3300053153 Ga0500616_0002733 Ga0500616_0002733_11131_11961 254
477 3300053156 Ga0500622_0002690 Ga0500622_0002690_1610_2440 254
478 3300053157 Ga0500624_000296 Ga0500624_000296_11165_11995 254
479 3300053158 Ga0500627_0098481 Ga0500627_0098481_225_1055 254
480 3300053161 Ga0500634_0000796 Ga0500634_0000796_6555_7385 254
481 3300053161 Ga0500634_0010247 Ga0500634_0010247_813_1646 254
482 3300053177 Ga0500636_0000026 Ga0500636_0000026_8773_9603 254
483 3300053177 Ga0500636_0000083 Ga0500636_0000083_14991_15821 254
484 3300060353 Ga0501082_0131532 Ga0501082_0131532_1068_1898 254
485 iso_pu_bacteria 2503198000 2503202144 254
486 iso_pu_bacteria 2508501122 2509107964 254
487 iso_pu_bacteria 2508501123 2509117071 254
488 iso_pu_bacteria 2508501127 2509141454 254
489 iso_pu_bacteria 2509276018 2509370790 254
490 iso_pu_bacteria 2509276019 2509376860 254
491 iso_pu_bacteria 2509276021 2509385493 254
492 iso_pu_bacteria 2509276022 2509396788 254
493 iso_pu_bacteria 2509276033 2509448466 254
494 iso_pu_bacteria 2510065019 2510136503 254
495 iso_pu_bacteria 2510065057 2510304151 254
496 iso_pu_bacteria 2510065059 2510317575 254
497 iso_pu_bacteria 2510461069 2510839081 254
498 iso_pu_bacteria 2510461076 2510900235 254
499 iso_pu_bacteria 2510917022 2511135646 254
500 iso_pu_bacteria 2510917028 2511184343 254
501 iso_pu_bacteria 2510917030 2511197550 254
502 iso_pu_bacteria 2511231027 2511391245 254
503 iso_pu_bacteria 2511231052 2511502588 254
504 iso_pu_bacteria 2512047086 2512533957 254
505 iso_pu_bacteria 2512875016 2512930959 254
506 iso_pu_bacteria 2512875024 2512958688 254
507 iso_pu_bacteria 2512875026 2512970284 254
508 iso_pu_bacteria 2513237084 2513569646 254
509 iso_pu_bacteria 2513237085 2513576471 254
510 iso_pu_bacteria 2513237086 2513583219 254
511 iso_pu_bacteria 2513237088 2513595060 254
512 iso_pu_bacteria 2513237089 2513601348 254
513 iso_pu_bacteria 2513237090 2513609730 254
514 iso_pu_bacteria 2513237091 2513620915 254
515 iso_pu_bacteria 2513237093 2513635126 254
516 iso_pu_bacteria 2513237103 2513709794 254
517 iso_pu_bacteria 2513237138 2513871326 254
518 iso_pu_bacteria 2513237140 2513881729 254
519 iso_pu_bacteria 2513237143 2513904873 254
520 iso_pu_bacteria 2513237144 2513911556 254
521 iso_pu_bacteria 2513237146 2513929073 254
522 iso_pu_bacteria 2513237156 2513986639 254
523 iso_pu_bacteria 2513237159 2513999225 254
524 iso_pu_bacteria 2513237160 2514003205 254
525 iso_pu_bacteria 2513237162 2514018772 254
526 iso_pu_bacteria 2513237164 2514034898 254
527 iso_pu_bacteria 2513237305 2514421914 254
528 iso_pu_bacteria 2515075009 2515115074 254
529 iso_pu_bacteria 2515154107 2515609371 254
530 iso_pu_bacteria 2515154113 2515633250 254
531 iso_pu_bacteria 2515154114 2515642476 254
532 iso_pu_bacteria 2515154116 2515658452 254
533 iso_pu_bacteria 2515154134 2515741926 254
534 iso_pu_bacteria 2516143018 2516205991 254
535 iso_pu_bacteria 2516653046 2516893964 254
536 iso_pu_bacteria 2516653077 2517041925 254
537 iso_pu_bacteria 2516653085 2517081044 254
538 iso_pu_bacteria 2517093000 2517098616 254
539 iso_pu_bacteria 2517287029 2517410836 254
540 iso_pu_bacteria 2517487022 2517570678 254
541 iso_pu_bacteria 2519899620 2520380739 254
542 iso_pu_bacteria 2523231067 2523468242 254
543 iso_pu_bacteria 2524023207 2524448216 254
544 iso_pu_bacteria 2524023209 2524457344 254
545 iso_pu_bacteria 2529292951 2530644495 254
546 iso_pu_bacteria 2534681796 2535520002 254
547 iso_pu_bacteria 2537561587 2537877750 254
548 iso_pu_bacteria 2551306084 2551675353 254
549 iso_pu_bacteria 2551306084 2551676763 254
550 iso_pu_bacteria 2551306085 2551689363 254
551 iso_pu_bacteria 2551306086 2551695507 254
552 iso_pu_bacteria 2551306087 2551700998 254
553 iso_pu_bacteria 2551306089 2551711112 254
554 iso_pu_bacteria 2551306090 2551722007 254
555 iso_pu_bacteria 2551306091 2551724378 254
556 iso_pu_bacteria 2551306092 2551736474 254
557 iso_pu_bacteria 2551306093 2551739982 254
558 iso_pu_bacteria 2554235003 2554245787 254
559 iso_pu_bacteria 2558860100 2558865782 254
560 iso_pu_bacteria 2558860242 2559296446 254
561 iso_pu_bacteria 2582581283 2585169049 254
562 iso_pu_bacteria 2582581294 2585202767 254
563 iso_pu_bacteria 2582581298 2585221616 254
564 iso_pu_bacteria 2582581299 2585233303 254
565 iso_pu_bacteria 2582581306 2585270229 254
566 iso_pu_bacteria 2582581307 2585272721 254
567 iso_pu_bacteria 2582581308 2585281237 254
568 iso_pu_bacteria 2582581315 2585327345 254
569 iso_pu_bacteria 2582581316 2585335301 254
570 iso_pu_bacteria 2582581865 2585390451 254
571 iso_pu_bacteria 2582581866 2585395812 254
572 iso_pu_bacteria 2582581867 2585401686 254
573 iso_pu_bacteria 2585427526 2585524176 254
574 iso_pu_bacteria 2585427527 2585536102 254
575 iso_pu_bacteria 2585427528 2585539212 254
576 iso_pu_bacteria 2585427529 2585544214 254
577 iso_pu_bacteria 2585427530 2585557413 254
578 iso_pu_bacteria 2585427531 2585562389 254
579 iso_pu_bacteria 2585427590 2585821381 254
580 iso_pu_bacteria 2585427593 2585837165 254
581 iso_pu_bacteria 2585427594 2585842471 254
582 iso_pu_bacteria 2585427608 2585896829 254
583 iso_pu_bacteria 2585427609 2585906444 254
584 iso_pu_bacteria 2585428125 2587981866 254
585 iso_pu_bacteria 2588253730 2588516644 254
586 iso_pu_bacteria 2597489875 2597814999 254
587 iso_pu_bacteria 2599185170 2599414714 254
588 iso_pu_bacteria 2599185210 2599603066 254
589 iso_pu_bacteria 2599185236 2599717816 254
590 iso_pu_bacteria 2599185301 2599935530 254
591 iso_pu_bacteria 2599185352 2600196889 254
592 iso_pu_bacteria 2600255279 2601610683 254
593 iso_pu_bacteria 2600255308 2601746987 254
594 iso_pu_bacteria 2615840624 2616295200 254
595 iso_pu_bacteria 2615840626 2616310961 254
596 iso_pu_bacteria 2615840698 2616551887 254
597 iso_pu_bacteria 2617270742 2617382883 254
598 iso_pu_bacteria 2643221557 2643804484 254
599 iso_pu_bacteria 2643221568 2643857039 254
600 iso_pu_bacteria 2643221582 2643922190 254
601 iso_pu_bacteria 2643221595 2643989318 254
602 iso_pu_bacteria 2643221599 2644003366 254
603 iso_pu_bacteria 2643221607 2644051210 254
604 iso_pu_bacteria 2643221610 2644065255 254
605 iso_pu_bacteria 2643221618 2644105548 254
606 iso_pu_bacteria 2643221626 2644146551 254
607 iso_pu_bacteria 2643221627 2644152890 254
608 iso_pu_bacteria 2643221634 2644194443 254
609 iso_pu_bacteria 2643221636 2644200881 254
610 iso_pu_bacteria 2643221637 2644210824 254
611 iso_pu_bacteria 2643221643 2644240821 254
612 iso_pu_bacteria 2643221655 2644308299 254
613 iso_pu_bacteria 2643221659 2644334126 254
614 iso_pu_bacteria 2643221668 2644377664 254
615 iso_pu_bacteria 2643221675 2644418139 254
616 iso_pu_bacteria 2643221680 2644451395 254
617 iso_pu_bacteria 2643221686 2644484114 254
618 iso_pu_bacteria 2643221688 2644494936 254
619 iso_pu_bacteria 2643221689 2644497933 254
620 iso_pu_bacteria 2643221693 2644520572 254
621 iso_pu_bacteria 2643221698 2644541720 254
622 iso_pu_bacteria 2643221712 2644615581 254
623 iso_pu_bacteria 2643221718 2644654358 254
624 iso_pu_bacteria 2643221723 2644672679 254
625 iso_pu_bacteria 2643221726 2644691625 254
626 iso_pu_bacteria 2667528174 2671116756 254
627 iso_pu_bacteria 2687453392 2688599505 254
628 iso_pu_bacteria 2690316117 2692315091 254
629 iso_pu_bacteria 2693429783 2694628273 254
630 iso_pu_bacteria 2693429784 2694640870 254
631 iso_pu_bacteria 2718217882 2719183761 254
632 iso_pu_bacteria 2718217927 2719388440 254
633 iso_pu_bacteria 2718217997 2719668060 254
634 iso_pu_bacteria 2718218009 2719728202 254
635 iso_pu_bacteria 2718218199 2720494823 254
636 iso_pu_bacteria 2718218232 2720611145 254
637 iso_pu_bacteria 2718218233 2720616317 254
638 iso_pu_bacteria 2718218235 2720629392 254
639 iso_pu_bacteria 2718218269 2720771963 254
640 iso_pu_bacteria 2718218363 2721145063 254
641 iso_pu_bacteria 2718218365 2721155800 254
642 iso_pu_bacteria 2718218366 2721167150 254
643 iso_pu_bacteria 2718218423 2721403063 254
644 iso_pu_bacteria 2721755514 2722838128 254
645 iso_pu_bacteria 2721755556 2723029393 254
646 iso_pu_bacteria 2721755684 2723563009 254
647 iso_pu_bacteria 2721755685 2723570990 254
648 iso_pu_bacteria 2721755686 2723572800 254
649 iso_pu_bacteria 2721755809 2724035420 254
650 iso_pu_bacteria 2721755810 2724042396 254
651 iso_pu_bacteria 2721755819 2724086783 254
652 iso_pu_bacteria 2721755822 2724106941 254
653 iso_pu_bacteria 2721755823 2724107750 254
654 iso_pu_bacteria 2724679232 2725952224 254
655 iso_pu_bacteria 2728369352 2730105707 254
656 iso_pu_bacteria 2728369365 2730161901 254
657 iso_pu_bacteria 2728369397 2730300907 254
658 iso_pu_bacteria 2738541293 2738802543 254
659 iso_pu_bacteria 2738541317 2738944977 254
660 iso_pu_bacteria 2738541333 2739033659 254
661 iso_pu_bacteria 2738543024 2739305846 254
662 iso_pu_bacteria 2751185821 2753463267 254
663 iso_pu_bacteria 2756170246 2756677219 254
664 iso_pu_bacteria 2758568016 2758640843 254
665 iso_pu_bacteria 2765235802 2765468569 254
666 iso_pu_bacteria 2765235942 2766068382 254
667 iso_pu_bacteria 2767802442 2770198940 254
668 iso_pu_bacteria 2775506902 2776272851 254
669 iso_pu_bacteria 2775506904 2776283256 254
670 iso_pu_bacteria 2775507266 2778175158 254
671 iso_pu_bacteria 2791355082 2792581604 254
672 iso_pu_bacteria 2791355091 2792620398 254
673 iso_pu_bacteria 2791355092 2792625756 254
674 iso_pu_bacteria 2791355094 2792641827 254
675 iso_pu_bacteria 2791355123 2792748622 254
676 iso_pu_bacteria 2791355253 2793281230 254
677 iso_pu_bacteria 2791355256 2793296422 254
678 iso_pu_bacteria 2791355259 2793317210 254
679 iso_pu_bacteria 2791355260 2793324054 254
680 iso_pu_bacteria 2791355261 2793325642 254
681 iso_pu_bacteria 2791355262 2793333065 254
682 iso_pu_bacteria 2791355263 2793340130 254
683 iso_pu_bacteria 2791355264 2793346237 254
684 iso_pu_bacteria 2791355265 2793355457 254
685 iso_pu_bacteria 2791355266 2793357802 254
686 iso_pu_bacteria 2791355267 2793366540 254
687 iso_pu_bacteria 2802428858 2802716641 254
688 iso_pu_bacteria 2802428859 2802725452 254
689 iso_pu_bacteria 2802428860 2802730456 254
690 iso_pu_bacteria 2802428861 2802737572 254
691 iso_pu_bacteria 2802428862 2802743038 254
692 iso_pu_bacteria 2802428863 2802750462 254
693 iso_pu_bacteria 2802429605 2805929051 254
694 iso_pu_bacteria 2802429606 2805937247 254
695 iso_pu_bacteria 2802429633 2806044842 254
696 iso_pu_bacteria 2802429634 2806053998 254
697 iso_pu_bacteria 2802429635 2806059910 254
698 iso_pu_bacteria 2802429636 2806066037 254
699 iso_pu_bacteria 2802429637 2806073381 254
700 iso_pu_bacteria 2808606387 2808990160 254
701 iso_pu_bacteria 2818991272 2819244924 254
702 iso_pu_bacteria 2818991448 2819607525 254
703 iso_pu_bacteria 2818991453 2819643922 254
704 iso_pu_bacteria 2821123053 2821126607 254
705 iso_pu_bacteria 2821443989 2821449605 254
706 iso_pu_bacteria 2838016132 2838019455 254
707 iso_pu_bacteria 2838022645 2838025081 254
708 iso_pu_bacteria 2838029111 2838032024 254
709 iso_pu_bacteria 2838035591 2838039567 254
710 iso_pu_bacteria 2838042994 2838045955 254
711 iso_pu_bacteria 2838048938 2838050561 254
712 iso_pu_bacteria 2838061910 2838062855 254
713 iso_pu_bacteria 2838068647 2838071803 254
714 iso_pu_bacteria 2838074704 2838080550 254
715 iso_pu_bacteria 2838661181 2838667956 254
716 iso_pu_bacteria 2838668709 2838671489 254
717 iso_pu_bacteria 2838675328 2838679983 254
718 iso_pu_bacteria 2838680041 2838684410 254
719 iso_pu_bacteria 2838686498 2838693562 254
720 iso_pu_bacteria 2838694306 2838699901 254
721 iso_pu_bacteria 2838701080 2838704244 254
722 iso_pu_bacteria 2838707686 2838711814 254
723 iso_pu_bacteria 2838714209 2838717398 254
724 iso_pu_bacteria 2838719591 2838721992 254
725 iso_pu_bacteria 2838724970 2838728148 254
726 iso_pu_bacteria 2838729681 2838735455 254
727 iso_pu_bacteria 2838736955 2838739989 254
728 iso_pu_bacteria 2838742623 2838748357 254
729 iso_pu_bacteria 2839993093 2839996536 254
730 iso_pu_bacteria 2840764183 2840770270 254
731 iso_pu_bacteria 2841734538 2841741108 254
732 iso_pu_bacteria 2841840854 2841843887 254
733 iso_pu_bacteria 2841846520 2841850709 254
734 iso_pu_bacteria 2841851746 2841858421 254
735 iso_pu_bacteria 2841859092 2841864183 254
736 iso_pu_bacteria 2841864319 2841869756 254
737 iso_pu_bacteria 2842077413 2842081877 254
738 iso_pu_bacteria 2842110456 2842117609 254
739 iso_pu_bacteria 2842118031 2842122453 254
740 iso_pu_bacteria 2842124991 2842129514 254
741 iso_pu_bacteria 2842130223 2842134886 254
742 iso_pu_bacteria 2842140634 2842143608 254
743 iso_pu_bacteria 2842146304 2842149138 254
744 iso_pu_bacteria 2842152218 2842156903 254
745 iso_pu_bacteria 2842156927 2842162669 254
746 iso_pu_bacteria 2842163707 2842167040 254
747 iso_pu_bacteria 2842170452 2842173081 254
748 iso_pu_bacteria 2842175837 2842180521 254
749 iso_pu_bacteria 2842180545 2842186173 254
750 iso_pu_bacteria 2842187318 2842190505 254
751 iso_pu_bacteria 2842192696 2842195256 254
752 iso_pu_bacteria 2842198810 2842203281 254
753 iso_pu_bacteria 2842205361 2842210272 254
754 iso_pu_bacteria 2842211629 2842214819 254
755 iso_pu_bacteria 2842217011 2842222260 254
756 iso_pu_bacteria 2842224351 2842227540 254
757 iso_pu_bacteria 2842229732 2842236048 254
758 iso_pu_bacteria 2842237096 2842241226 254
759 iso_pu_bacteria 2842243621 2842249979 254
760 iso_pu_bacteria 2842250916 2842253695 254
761 iso_pu_bacteria 2842257432 2842263275 254
762 iso_pu_bacteria 2842264693 2842268006 254
763 iso_pu_bacteria 2842271015 2842278031 254
764 iso_pu_bacteria 2842278818 2842283726 254
765 iso_pu_bacteria 2842285085 2842289697 254
766 iso_pu_bacteria 2842291075 2842295532 254
767 iso_pu_bacteria 2842298080 2842299100 254
768 iso_pu_bacteria 2842304105 2842310047 254
769 iso_pu_bacteria 2842311132 2842311773 254
770 iso_pu_bacteria 2842317721 2842318998 254
771 iso_pu_bacteria 2842341865 2842343994 254
772 iso_pu_bacteria 2842357229 2842358566 254
773 iso_pu_bacteria 2842363717 2842369694 254
774 iso_pu_bacteria 2842370503 2842376676 254
775 iso_pu_bacteria 2842377471 2842381692 254
776 iso_pu_bacteria 2842384541 2842389001 254
777 iso_pu_bacteria 2842395702 2842396355 254
778 iso_pu_bacteria 2842402390 2842407162 254
779 iso_pu_bacteria 2842409023 2842414054 254
780 iso_pu_bacteria 2842415677 2842420695 254
781 iso_pu_bacteria 2842422224 2842425436 254
782 iso_pu_bacteria 2842428310 2842432169 254
783 iso_pu_bacteria 2842434925 2842438281 254
784 iso_pu_bacteria 2842441272 2842443977 254
785 iso_pu_bacteria 2842447887 2842450151 254
786 iso_pu_bacteria 2842462802 2842466267 254
787 iso_pu_bacteria 2842469257 2842472749 254
788 iso_pu_bacteria 2842475841 2842478756 254
789 iso_pu_bacteria 2842482326 2842487522 254
790 iso_pu_bacteria 2842489311 2842491448 254
791 iso_pu_bacteria 2842495871 2842499516 254
792 iso_pu_bacteria 2842502639 2842505925 254
793 iso_pu_bacteria 2842509118 2842511959 254
794 iso_pu_bacteria 2842515876 2842521070 254
795 iso_pu_bacteria 2842521101 2842524972 254
796 iso_pu_bacteria 2842871566 2842875762 254
797 iso_pu_bacteria 2844002411 2844006363 254
798 iso_pu_bacteria 2844009547 2844014779 254
799 iso_pu_bacteria 2844163670 2844166464 254
800 iso_pu_bacteria 2844454524 2844461106 254
801 iso_pu_bacteria 2844533157 2844537546 254
802 iso_pu_bacteria 2847417321 2847419848 254
803 iso_pu_bacteria 2847670302 2847673130 254
804 iso_pu_bacteria 2847686936 2847689652 254
805 iso_pu_bacteria 2848992105 2848994865 254
806 iso_pu_bacteria 2850079185 2850081864 254
807 iso_pu_bacteria 2852387548 2852394991 254
808 iso_pu_bacteria 2854896431 2854899983 254
809 iso_pu_bacteria 2854911287 2854914164 254
810 iso_pu_bacteria 2854916844 2854921102 254
811 iso_pu_bacteria 2855825444 2855826685 254
812 iso_pu_bacteria 2855839649 2855842078 254
813 iso_pu_bacteria 2855872281 2855877364 254
814 iso_pu_bacteria 2856314179 2856319837 254
815 iso_pu_bacteria 2856320880 2856325775 254
816 iso_pu_bacteria 2856328259 2856329056 254
817 iso_pu_bacteria 2856334872 2856341621 254
818 iso_pu_bacteria 2856342000 2856346836 254
819 iso_pu_bacteria 2856349417 2856351571 254
820 iso_pu_bacteria 2856356410 2856360916 254
821 iso_pu_bacteria 2856364286 2856366096 254
822 iso_pu_bacteria 2857349434 2857352554 254
823 iso_pu_bacteria 2857367948 2857373068 254
824 iso_pu_bacteria 2857516855 2857519183 254
825 iso_pu_bacteria 2857531043 2857536699 254
826 iso_pu_bacteria 2858800743 2858802753 254
827 iso_pu_bacteria 2869162929 2869167452 254
828 iso_pu_bacteria 2869169390 2869175846 254
829 iso_pu_bacteria 2869234852 2869237262 254
830 iso_pu_bacteria 2869242130 2869247277 254
831 iso_pu_bacteria 2869249662 2869250990 254
832 iso_pu_bacteria 2869256925 2869260570 254
833 iso_pu_bacteria 2869264136 2869264232 254
834 iso_pu_bacteria 2869271264 2869271353 254
835 iso_pu_bacteria 2869278585 2869279393 254
836 iso_pu_bacteria 2869285874 2869291049 254
837 iso_pu_bacteria 2871429161 2871433331 254
838 iso_pu_bacteria 2871435913 2871441477 254
839 iso_pu_bacteria 2871444079 2871449730 254
840 iso_pu_bacteria 2871451962 2871453017 254
841 iso_pu_bacteria 2871459585 2871464452 254
842 iso_pu_bacteria 2871466892 2871469772 254
843 iso_pu_bacteria 2871474448 2871478495 254
844 iso_pu_bacteria 2871481445 2871488220 254
845 iso_pu_bacteria 2871488783 2871491030 254
846 iso_pu_bacteria 2871495908 2871498873 254
847 iso_pu_bacteria 2874102143 2874107880 254
848 iso_pu_bacteria 2874109183 2874109344 254
849 iso_pu_bacteria 2874116593 2874118292 254
850 iso_pu_bacteria 2874123672 2874124905 254
851 iso_pu_bacteria 2874131515 2874133410 254
852 iso_pu_bacteria 2874139085 2874145142 254
853 iso_pu_bacteria 2874146452 2874148726 254
854 iso_pu_bacteria 2874155637 2874160773 254
855 iso_pu_bacteria 2874162495 2874166728 254
856 iso_pu_bacteria 2874168670 2874176129 254
857 iso_pu_bacteria 2876363079 2876365892 254
858 iso_pu_bacteria 2876369609 2876377575 254
859 iso_pu_bacteria 2876377896 2876381931 254
860 iso_pu_bacteria 2876386047 2876391637 254
861 iso_pu_bacteria 2876392853 2876397384 254
862 iso_pu_bacteria 2876399893 2876402590 254
863 iso_pu_bacteria 2876406927 2876408260 254
864 iso_pu_bacteria 2876413966 2876418813 254
865 iso_pu_bacteria 2876420981 2876422175 254
866 iso_pu_bacteria 2878035449 2878035734 254
867 iso_pu_bacteria 2878730984 2878732984 254
868 iso_pu_bacteria 2878738818 2878743339 254
869 iso_pu_bacteria 2878745973 2878750944 254
870 iso_pu_bacteria 2878753008 2878755439 254
871 iso_pu_bacteria 2878760144 2878763086 254
872 iso_pu_bacteria 2878767105 2878770061 254
873 iso_pu_bacteria 2878774303 2878779542 254
874 iso_pu_bacteria 2878781027 2878786524 254
875 iso_pu_bacteria 2881147464 2881147855 254
876 iso_pu_bacteria 2881155292 2881158933 254
877 iso_pu_bacteria 2881161766 2881164620 254
878 iso_pu_bacteria 2881845957 2881848663 254
879 iso_pu_bacteria 2881861095 2881867316 254
880 iso_pu_bacteria 2882632389 2882634840 254
881 iso_pu_bacteria 2882912400 2882912412 254
882 iso_pu_bacteria 2885305155 2885306474 254
883 iso_pu_bacteria 2885312484 2885316413 254
884 iso_pu_bacteria 2885318864 2885318994 254
885 iso_pu_bacteria 2885326080 2885333316 254
886 iso_pu_bacteria 2885334103 2885335408 254
887 iso_pu_bacteria 2885342637 2885349103 254
888 iso_pu_bacteria 2885350715 2885351315 254
889 iso_pu_bacteria 2888337043 2888340070 254
890 iso_pu_bacteria 2888343758 2888348474 254
891 iso_pu_bacteria 2888350351 2888352737 254
892 iso_pu_bacteria 2889010040 2889014508 254
893 iso_pu_bacteria 2889016732 2889020506 254
894 iso_pu_bacteria 2889790730 2889790744 254
895 iso_pu_bacteria 2889914905 2889915128 254
896 iso_pu_bacteria 2894652903 2894656838 254
897 iso_pu_bacteria 2894817345 2894821315 254
898 iso_pu_bacteria 2896384573 2896391298 254
899 iso_pu_bacteria 2899792073 2899793443 254
900 iso_pu_bacteria 2899845264 2899847644 254
901 iso_pu_bacteria 2903448605 2903451963 254
902 iso_pu_bacteria 2903492973 2903499085 254
903 iso_pu_bacteria 2903492973 2903500236 254
904 iso_pu_bacteria 2903513507 2903520302 254
905 iso_pu_bacteria 2903521522 2903523784 254
906 iso_pu_bacteria 2903528002 2903534355 254
907 iso_pu_bacteria 2903540706 2903543672 254
908 iso_pu_bacteria 2904578770 2904582474 254
909 iso_pu_bacteria 2904659560 2904664138 254
910 iso_pu_bacteria 2906308376 2906313869 254
911 iso_pu_bacteria 2906321335 2906326578 254
912 iso_pu_bacteria 2906328253 2906334846 254
913 iso_pu_bacteria 2906354277 2906361767 254
914 iso_pu_bacteria 2906363423 2906370587 254
915 iso_pu_bacteria 2906370794 2906377254 254
916 iso_pu_bacteria 2906378014 2906378624 254
917 iso_pu_bacteria 2906393657 2906397990 254
918 iso_pu_bacteria 2906401398 2906403551 254
919 iso_pu_bacteria 2906408224 2906410357 254
920 iso_pu_bacteria 2906414383 2906420613 254
921 iso_pu_bacteria 2906427513 2906432880 254
922 iso_pu_bacteria 2909042592 2909043879 254
923 iso_pu_bacteria 2913295892 2913301710 254
924 iso_pu_bacteria 2913308742 2913309602 254
925 iso_pu_bacteria 2915650412 2915651048 254
926 iso_pu_bacteria 2915980308 2915981222 254
927 iso_pu_bacteria 2915986958 2915992233 254
928 iso_pu_bacteria 2915993759 2915998593 254
929 iso_pu_bacteria 2916000859 2916005669 254
930 iso_pu_bacteria 2916007675 2916013523 254
931 iso_pu_bacteria 2916014648 2916021438 254
932 iso_pu_bacteria 2916021584 2916026840 254
933 iso_pu_bacteria 2916028427 2916033036 254
934 iso_pu_bacteria 2916035215 2916039279 254
935 iso_pu_bacteria 2916041962 2916046500 254
936 iso_pu_bacteria 2916048683 2916050504 254
937 iso_pu_bacteria 2916055098 2916055951 254
938 iso_pu_bacteria 2916061851 2916062083 254
939 iso_pu_bacteria 2916068649 2916070755 254
940 iso_pu_bacteria 2916076590 2916082653 254
941 iso_pu_bacteria 2917554339 2917556392 254
942 iso_pu_bacteria 2919100787 2919103463 254
943 iso_pu_bacteria 2919114240 2919119151 254
944 iso_pu_bacteria 2919119836 2919123953 254
945 iso_pu_bacteria 2919166419 2919170185 254
946 iso_pu_bacteria 2919408235 2919413120 254
947 iso_pu_bacteria 2920760137 2920761099 254
948 iso_pu_bacteria 2920822456 2920825722 254
949 iso_pu_bacteria 2921201388 2921204232 254
950 iso_pu_bacteria 2921208531 2921210305 254
951 iso_pu_bacteria 2921237296 2921239341 254
952 iso_pu_bacteria 2921244191 2921249951 254
953 iso_pu_bacteria 2921250672 2921251728 254
954 iso_pu_bacteria 2921257292 2921258882 254
955 iso_pu_bacteria 2921263974 2921270254 254
956 iso_pu_bacteria 2921282425 2921287217 254
957 iso_pu_bacteria 2921289301 2921292025 254
958 iso_pu_bacteria 2921296804 2921302383 254
959 iso_pu_bacteria 2922130491 2922138307 254
960 iso_pu_bacteria 2922151315 2922153102 254
961 iso_pu_bacteria 2922158528 2922165361 254
962 iso_pu_bacteria 2922172374 2922178035 254
963 iso_pu_bacteria 2922178524 2922184152 254
964 iso_pu_bacteria 2922185730 2922194028 254
965 iso_pu_bacteria 2923556063 2923556728 254
966 iso_pu_bacteria 2924144063 2924144924 254
967 iso_pu_bacteria 2924150972 2924156115 254
968 iso_pu_bacteria 2924158325 2924159968 254
969 iso_pu_bacteria 2924165586 2924169480 254
970 iso_pu_bacteria 2924172951 2924173545 254
971 iso_pu_bacteria 2924179722 2924183367 254
972 iso_pu_bacteria 2924186466 2924193172 254
973 iso_pu_bacteria 2924193448 2924195095 254
974 iso_pu_bacteria 2924200457 2924201593 254
975 iso_pu_bacteria 2924207177 2924208206 254
976 iso_pu_bacteria 2924214083 2924216930 254
977 iso_pu_bacteria 2924221636 2924227452 254
978 iso_pu_bacteria 2924228884 2924235221 254
979 iso_pu_bacteria 2924710171 2924716816 254
980 iso_pu_bacteria 2924718760 2924726398 254
981 iso_pu_bacteria 2924726620 2924727946 254
982 iso_pu_bacteria 2924733363 2924737033 254
983 iso_pu_bacteria 2924741084 2924746336 254
984 iso_pu_bacteria 2924754689 2924756723 254
985 iso_pu_bacteria 2924762789 2924764992 254
986 iso_pu_bacteria 2924776078 2924781150 254
987 iso_pu_bacteria 2924784321 2924791589 254
988 iso_pu_bacteria 2926754445 2926759180 254
989 iso_pu_bacteria 2926760298 2926763394 254
990 iso_pu_bacteria 2928521798 2928524811 254
991 iso_pu_bacteria 2929138655 2929138670 254
992 iso_pu_bacteria 2933006813 2933010033 254
993 iso_pu_bacteria 2933011516 2933011518 254
994 iso_pu_bacteria 2933016740 2933017614 254
995 iso_pu_bacteria 2933570622 2933576488 254
996 iso_pu_bacteria 2933586486 2933591783 254
997 iso_pu_bacteria 2933594066 2933595994 254
998 iso_pu_bacteria 2933599457 2933602598 254
999 iso_pu_bacteria 2935894831 2935898250 254
1000 iso_pu_bacteria 2935901341 2935905752 254
1001 iso_pu_bacteria 2936367885 2936370190 254
1002 iso_pu_bacteria 2936375103 2936377862 254
1003 iso_pu_bacteria 2936381700 2936384150 254
1004 iso_pu_bacteria 2936996657 2937001224 254
1005 iso_pu_bacteria 2937002841 2937003934 254
1006 iso_pu_bacteria 2937009748 2937010756 254
1007 iso_pu_bacteria 2937016420 2937021795 254
1008 iso_pu_bacteria 2937023124 2937027411 254
1009 iso_pu_bacteria 2937029754 2937035710 254
1010 iso_pu_bacteria 2937036028 2937039373 254
1011 iso_pu_bacteria 2937042894 2937042930 254
1012 iso_pu_bacteria 2937049772 2937050361 254
1013 iso_pu_bacteria 2937056579 2937062850 254
1014 iso_pu_bacteria 2937063883 2937064569 254
1015 iso_pu_bacteria 2937071275 2937073262 254
1016 iso_pu_bacteria 2937078374 2937080772 254
1017 iso_pu_bacteria 2937084907 2937085374 254
1018 iso_pu_bacteria 2937091812 2937098124 254
1019 iso_pu_bacteria 2937098957 2937105570 254
1020 iso_pu_bacteria 2937106411 2937110904 254
1021 iso_pu_bacteria 2937113482 2937117604 254
1022 iso_pu_bacteria 2937119839 2937124435 254
1023 iso_pu_bacteria 2937126314 2937131493 254
1024 iso_pu_bacteria 2937813078 2937819825 254
1025 iso_pu_bacteria 2937822353 2937824323 254
1026 iso_pu_bacteria 2937836603 2937840483 254
1027 iso_pu_bacteria 2937848649 2937854941 254
1028 iso_pu_bacteria 2937861824 2937866658 254
1029 iso_pu_bacteria 2937868953 2937870345 254
1030 iso_pu_bacteria 2937877337 2937877574 254
1031 iso_pu_bacteria 2937891427 2937894248 254
1032 iso_pu_bacteria 2937972304 2937975343 254
1033 iso_pu_bacteria 2937980651 2937981607 254
1034 iso_pu_bacteria 2937994558 2937997521 254
1035 iso_pu_bacteria 2938014810 2938021671 254
1036 iso_pu_bacteria 2939669807 2939673710 254
1037 iso_pu_bacteria 2941499720 2941504507 254
1038 iso_pu_bacteria 2954011201 2954011230 254
1039 iso_pu_bacteria 2957375807 2957380615 254
1040 iso_pu_bacteria 2957382221 2957382593 254
1041 iso_pu_bacteria 2957388812 2957389429 254
1042 iso_pu_bacteria 2957395598 2957401973 254
1043 iso_pu_bacteria 2957402308 2957408395 254
1044 iso_pu_bacteria 2957408893 2957410150 254
1045 iso_pu_bacteria 2957415311 2957420039 254
1046 iso_pu_bacteria 2957422303 2957424793 254
1047 iso_pu_bacteria 2957430029 2957433654 254
1048 iso_pu_bacteria 2957437181 2957437525 254
1049 iso_pu_bacteria 2957443900 2957450647 254
1050 iso_pu_bacteria 2957450854 2957452240 254
1051 iso_pu_bacteria 2957457609 2957462656 254
1052 iso_pu_bacteria 2957464669 2957465611 254
1053 iso_pu_bacteria 2957471148 2957475715 254
1054 iso_pu_bacteria 2957478035 2957478983 254
1055 iso_pu_bacteria 2957484790 2957488882 254
1056 iso_pu_bacteria 2957491536 2957497915 254
1057 iso_pu_bacteria 2957498199 2957501767 254
1058 iso_pu_bacteria 2957505466 2957509920 254
1059 iso_pu_bacteria 2958034702 2958035533 254
1060 iso_pu_bacteria 2958041894 2958043720 254
1061 iso_pu_bacteria 2958041894 2958052539 254
1062 iso_pu_bacteria 2958064165 2958066917 254
1063 iso_pu_bacteria 2958071322 2958071392 254
1064 iso_pu_bacteria 2958084443 2958084682 254
1065 iso_pu_bacteria 2958092219 2958096630 254
1066 iso_pu_bacteria 2958100919 2958101872 254
1067 iso_pu_bacteria 2958108152 2958110322 254
1068 iso_pu_bacteria 2958115193 2958119461 254
1069 iso_pu_bacteria 2958122699 2958127135 254
1070 iso_pu_bacteria 2958130278 2958135449 254
1071 iso_pu_bacteria 2958158011 2958161333 254
1072 iso_pu_bacteria 2958165035 2958167994 254
1073 iso_pu_bacteria 2958172287 2958177415 254
1074 iso_pu_bacteria 2958179912 2958184478 254
1075 iso_pu_bacteria 2960584000 2960590583 254
1076 iso_pu_bacteria 2960591022 2960591885 254
1077 iso_pu_bacteria 2960597568 2960602031 254
1078 iso_pu_bacteria 2960603979 2960607908 254
1079 iso_pu_bacteria 2960610863 2960614790 254
1080 iso_pu_bacteria 2960617483 2960618073 254
1081 iso_pu_bacteria 2960624210 2960630024 254
1082 iso_pu_bacteria 2960631154 2960633906 254
1083 iso_pu_bacteria 2960637947 2960642603 254
1084 iso_pu_bacteria 2960645483 2960651188 254
1085 iso_pu_bacteria 2960652885 2960659469 254
1086 iso_pu_bacteria 2960660292 2960667202 254
1087 iso_pu_bacteria 2960667422 2960669932 254
1088 iso_pu_bacteria 2960674078 2960675287 254
1089 iso_pu_bacteria 2960680706 2960680729 254
1090 iso_pu_bacteria 2960687367 2960688671 254
1091 iso_pu_bacteria 2960693952 2960696512 254
1092 iso_pu_bacteria 2961077736 2961082533 254
1093 iso_pu_bacteria 2961114664 2961118722 254
1094 iso_pu_bacteria 2961127735 2961132463 254
1095 iso_pu_bacteria 2961136820 2961139302 254
1096 iso_pu_bacteria 2961163497 2961166460 254
1097 iso_pu_bacteria 2961170736 2961176618 254
1098 iso_pu_bacteria 2961183825 2961185623 254
1099 iso_pu_bacteria 2963644680 2963648267 254
1100 iso_pu_bacteria 2964607997 2964614879 254
1101 iso_pu_bacteria 2964615318 2964617099 254
1102 iso_pu_bacteria 2964621998 2964627196 254
1103 iso_pu_bacteria 2964628898 2964630389 254
1104 iso_pu_bacteria 2964636051 2964637710 254
1105 iso_pu_bacteria 2964643177 2964646325 254
1106 iso_pu_bacteria 2964649959 2964651173 254
1107 iso_pu_bacteria 2964656573 2964663289 254
1108 iso_pu_bacteria 2964663802 2964666285 254
1109 iso_pu_bacteria 2964670856 2964672664 254
1110 iso_pu_bacteria 2964678106 2964682453 254
1111 iso_pu_bacteria 2964685014 2964689375 254
1112 iso_pu_bacteria 2964691889 2964693915 254
1113 iso_pu_bacteria 2964698721 2964704777 254
1114 iso_pu_bacteria 2964705432 2964706424 254
1115 iso_pu_bacteria 2964712639 2964716461 254
1116 iso_pu_bacteria 2964719344 2964725738 254
1117 iso_pu_bacteria 2965018300 2965021280 254
1118 iso_pu_bacteria 2965025482 2965029605 254
1119 iso_pu_bacteria 2965032056 2965038414 254
1120 iso_pu_bacteria 2965040258 2965043753 254
1121 iso_pu_bacteria 2965062239 2965064279 254
1122 iso_pu_bacteria 2965089291 2965090560 254
1123 iso_pu_bacteria 2965102966 2965107386 254
1124 iso_pu_bacteria 2965119406 2965121413 254
1125 iso_pu_bacteria 2967664464 2967668423 254
1126 iso_pu_bacteria 2967671571 2967676207 254
1127 iso_pu_bacteria 2967678726 2967685898 254
1128 iso_pu_bacteria 2967686174 2967691001 254
1129 iso_pu_bacteria 2967693043 2967698984 254
1130 iso_pu_bacteria 2967699805 2967704340 254
1131 iso_pu_bacteria 2967706974 2967711601 254
1132 iso_pu_bacteria 2967714385 2967720461 254
1133 iso_pu_bacteria 2967721400 2967724396 254
1134 iso_pu_bacteria 2967728569 2967730999 254
1135 iso_pu_bacteria 2967735183 2967739938 254
1136 iso_pu_bacteria 2967742019 2967744523 254
1137 iso_pu_bacteria 2967748971 2967749382 254
1138 iso_pu_bacteria 2967755722 2967759580 254
1139 iso_pu_bacteria 2967762386 2967767208 254
1140 iso_pu_bacteria 2967769361 2967770500 254
1141 iso_pu_bacteria 2967775926 2967782433 254
1142 iso_pu_bacteria 2967996073 2968001367 254
1143 iso_pu_bacteria 2968003550 2968007420 254
1144 iso_pu_bacteria 2968016561 2968017919 254
1145 iso_pu_bacteria 2968083720 2968087663 254
1146 iso_pu_bacteria 2968091066 2968093895 254
1147 iso_pu_bacteria 2968097103 2968101374 254
1148 iso_pu_bacteria 2968110612 2968115277 254
1149 iso_pu_bacteria 2968117919 2968121897 254
1150 iso_pu_bacteria 2968128360 2968134172 254
1151 iso_pu_bacteria 2968138860 2968142729 254
1152 iso_pu_bacteria 2968171901 2968174864 254
1153 iso_pu_bacteria 2970019648 2970025757 254
1154 iso_pu_bacteria 2970026789 2970027509 254
1155 iso_pu_bacteria 2970033650 2970036058 254
1156 iso_pu_bacteria 2970040964 2970046115 254
1157 iso_pu_bacteria 2970047711 2970048396 254
1158 iso_pu_bacteria 2970054988 2970057258 254
1159 iso_pu_bacteria 2970061556 2970064734 254
1160 iso_pu_bacteria 2970068827 2970071067 254
1161 iso_pu_bacteria 2970076120 2970082493 254
1162 iso_pu_bacteria 2970082768 2970083632 254
1163 iso_pu_bacteria 2970088815 2970094197 254
1164 iso_pu_bacteria 2970095765 2970102144 254
1165 iso_pu_bacteria 2970102677 2970104445 254
1166 iso_pu_bacteria 2970109326 2970115035 254
1167 iso_pu_bacteria 2970116247 2970120633 254
1168 iso_pu_bacteria 2970122695 2970123419 254
1169 iso_pu_bacteria 2970129317 2970135925 254
1170 iso_pu_bacteria 2970136068 2970140850 254
1171 iso_pu_bacteria 2970143518 2970144806 254
1172 iso_pu_bacteria 2970149975 2970154926 254
1173 iso_pu_bacteria 2970156795 2970161342 254
1174 iso_pu_bacteria 2970164137 2970168349 254
1175 iso_pu_bacteria 2970170962 2970173880 254
1176 iso_pu_bacteria 2970177841 2970181033 254
1177 iso_pu_bacteria 2970184632 2970184972 254
1178 iso_pu_bacteria 2970191845 2970196075 254
1179 iso_pu_bacteria 2970469710 2970471906 254
1180 iso_pu_bacteria 2970489779 2970492695 254
1181 iso_pu_bacteria 2970503327 2970509289 254
1182 iso_pu_bacteria 2970510686 2970513065 254
1183 iso_pu_bacteria 2970524798 2970529723 254
1184 iso_pu_bacteria 2970540015 2970545327 254
1185 iso_pu_bacteria 2970547951 2970549392 254
1186 iso_pu_bacteria 2970554993 2970557934 254
1187 iso_pu_bacteria 2970593180 2970593989 254
1188 iso_pu_bacteria 2970619444 2970620327 254
1189 iso_pu_bacteria 2970627176 2970631339 254
1190 iso_pu_bacteria 2977516862 2977519385 254
1191 iso_pu_bacteria 2977523885 2977530476 254
1192 iso_pu_bacteria 2977530762 2977536319 254
1193 iso_pu_bacteria 2977537788 2977543263 254
1194 iso_pu_bacteria 2977544691 2977546458 254
1195 iso_pu_bacteria 2977551784 2977553099 254
1196 iso_pu_bacteria 2977558990 2977565217 254
1197 iso_pu_bacteria 2977565890 2977567022 254
1198 iso_pu_bacteria 2977572785 2977574372 254
1199 iso_pu_bacteria 2977579622 2977585872 254
1200 iso_pu_bacteria 2977821940 2977824578 254
1201 iso_pu_bacteria 2977828996 2977831351 254
1202 iso_pu_bacteria 2977843712 2977845546 254
1203 iso_pu_bacteria 2977858184 2977864694 254
1204 iso_pu_bacteria 2977864932 2977866551 254
1205 iso_pu_bacteria 2977872689 2977874770 254
1206 iso_pu_bacteria 2977907340 2977913177 254
1207 iso_pu_bacteria 2977915119 2977916355 254
1208 iso_pu_bacteria 2977922695 2977929388 254
1209 iso_pu_bacteria 2977935797 2977940154 254
1210 iso_pu_bacteria 2977942078 2977950632 254
1211 iso_pu_bacteria 2977950692 2977951457 254
1212 iso_pu_bacteria 2977957713 2977963069 254
1213 iso_pu_bacteria 2977971508 2977978364 254
1214 iso_pu_bacteria 2977986579 2977987596 254
1215 iso_pu_bacteria 2978969890 2978970187 254
1216 iso_pu_bacteria 2979089926 2979091573 254
1217 iso_pu_bacteria 2979095461 2979097094 254
1218 iso_pu_bacteria 2979710463 2979717195 254
1219 iso_pu_bacteria 2979742915 2979750779 254
1220 iso_pu_bacteria 2979764755 2979770021 254
1221 iso_pu_bacteria 2979772303 2979778464 254
1222 iso_pu_bacteria 2979779861 2979782976 254
1223 iso_pu_bacteria 2979793036 2979799555 254
1224 iso_pu_bacteria 2979808191 2979813968 254
1225 iso_pu_bacteria 2984587000 2984587214 254
1226 iso_pu_bacteria 2987636660 2987641146 254
1227 iso_pu_bacteria 2987645492 2987652061 254
1228 iso_pu_bacteria 2987652177 2987659187 254
1229 iso_pu_bacteria 2987659509 2987662470 254
1230 iso_pu_bacteria 2987666974 2987667898 254
1231 iso_pu_bacteria 2987673487 2987675014 254
1232 iso_pu_bacteria 2989349275 2989352529 254
1233 iso_pu_bacteria 2989771324 2989773983 254
1234 iso_pu_bacteria 2989776772 2989780771 254
1235 iso_pu_bacteria 2996341866 2996347779 254
1236 iso_pu_bacteria 2996348954 2996350835 254
1237 iso_pu_bacteria 2996386984 2996392996 254
1238 iso_pu_bacteria 2996887358 2996888650 254
1239 iso_pu_bacteria 2996893221 2996896961 254
1240 iso_pu_bacteria 3000135777 3000138562 254
1241 iso_pu_bacteria 3000135777 3000139733 254
1242 iso_pu_bacteria 3002141150 3002145481 254
1243 iso_pu_bacteria 3003930520 3003935539 254
1244 iso_pu_bacteria 3004167301 3004169505 254
1245 iso_pu_bacteria 3004188549 3004191520 254
1246 iso_pu_bacteria 3004195979 3004198594 254
1247 iso_pu_bacteria 3004203850 3004209959 254
1248 iso_pu_bacteria 3004211236 3004211754 254
1249 iso_pu_bacteria 3004218560 3004219001 254
1250 iso_pu_bacteria 3004232784 3004235921 254
1251 iso_pu_bacteria 3004239961 3004245669 254
1252 iso_pu_bacteria 3004248173 3004254023 254
1253 iso_pu_bacteria 3004268573 3004274658 254
1254 iso_pu_bacteria 3004275668 3004277533 254
1255 iso_pu_bacteria 3004334049 3004341093 254
1256 iso_pu_bacteria 3005409236 3005416287 254
1257 iso_pu_bacteria 3005416602 3005421943 254
1258 iso_pu_bacteria 3005445848 3005451458 254
1259 iso_pu_bacteria 3005452660 3005456761 254
1260 iso_pu_bacteria 637000159 637074002 254
1261 iso_pu_bacteria 639633055 639651715 254
1262 iso_pu_bacteria 643692032 643826744 254
1263 iso_pu_bacteria 648276728 648738782 254
1264 iso_pu_bacteria 649633066 649874008 254
1265 iso_pu_bacteria 650716007 650842843 254
1266 iso_pu_bacteria 8002285264 8002287276 254
1267 iso_pu_bacteria 8003570095 8003574443 254
1268 iso_pu_bacteria 8003992118 8003994521 254
1269 iso_pu_bacteria 8003999396 8004002216 254
1270 iso_pu_bacteria 8004300914 8004307448 254
1271 iso_pu_bacteria 8004312739 8004320804 254
1272 iso_pu_bacteria 8004361976 8004369132 254
1273 iso_pu_bacteria 8004374579 8004377018 254
1274 iso_pu_bacteria 8004387939 8004393338 254
1275 iso_pu_bacteria 8004445564 8004446339 254
1276 iso_pu_bacteria 8004633249 8004633320 254
1277 iso_pu_bacteria 8004640170 8004644320 254
1278 iso_pu_bacteria 8004695233 8004698225 254
1279 iso_pu_bacteria 8004703790 8004707045 254
1280 iso_pu_bacteria 8004714634 8004720125 254
1281 iso_pu_bacteria 8004727605 8004734272 254
1282 iso_pu_bacteria 8005246636 8005250597 254
1283 iso_pu_bacteria 8005258706 8005264418 254
1284 iso_pu_bacteria 8005275841 8005277155 254
1285 iso_pu_bacteria 8005282627 8005287841 254
1286 iso_pu_bacteria 8005289223 8005290653 254
1287 iso_pu_bacteria 8005301065 8005305025 254
1288 iso_pu_bacteria 8005307578 8005313120 254
1289 iso_pu_bacteria 8005314921 8005321225 254
1290 iso_pu_bacteria 8005321885 8005323177 254
1291 iso_pu_bacteria 8005376324 8005381871 254
1292 iso_pu_bacteria 8005382845 8005388479 254
1293 iso_pu_bacteria 8005395548 8005397645 254
1294 iso_pu_bacteria 8005430974 8005436996 254
1295 iso_pu_bacteria 8005460587 8005466801 254
1296 iso_pu_bacteria 8005484373 8005490034 254
1297 iso_pu_bacteria 8005497431 8005503072 254
1298 iso_pu_bacteria 8005542996 8005547732 254
1299 iso_pu_bacteria 8005556819 8005562113 254
1300 iso_pu_bacteria 8005563573 8005567131 254
1301 iso_pu_bacteria 8005570704 8005576298 254
1302 iso_pu_bacteria 8005619151 8005625591 254
1303 iso_pu_bacteria 8005626139 8005630614 254
1304 iso_pu_bacteria 8005645114 8005650910 254
1305 iso_pu_bacteria 8005668836 8005674990 254
1306 iso_pu_bacteria 8005682033 8005688170 254
1307 iso_pu_bacteria 8005688590 8005689431 254
1308 iso_pu_bacteria 8005695170 8005701933 254
1309 iso_pu_bacteria 8018127388 8018130455 254
1310 iso_pu_bacteria 8018163183 8018165904 254
1311 iso_pu_bacteria 8018176218 8018182230 254
1312 iso_pu_bacteria 8023680758 8023682367 254
1313 iso_pu_bacteria 8024479707 8024484155 254
1314 iso_pu_bacteria 8024486573 8024492855 254
1315 iso_pu_bacteria 8024501048 8024505581 254
1316 iso_pu_bacteria 8046767195 8046773915 254
1317 iso_pu_bacteria 8049293176 8049295688 254
1318 iso_pu_bacteria 8054558443 8054560445 254
1319 iso_pu_bacteria 8055617313 8055622683 254
1320 iso_pu_bacteria 8056375014 8056375187 254
1321 iso_pu_bacteria 8056382006 8056383516 254
1322 iso_pu_bacteria 8057575449 8057576258 254
1323 iso_pu_bacteria 8057874678 8057878337 254
1324 3300003792 Ga0055540_1022297 Ga0055540_10222972 255
1325 3300005295 Ga0065707_10026737 Ga0065707_100267371 255
1326 3300005353 Ga0070669_100010155 Ga0070669_1000101558 255
1327 3300005356 Ga0070674_100001722 Ga0070674_1000017224 255
1328 3300005459 Ga0068867_100270193 Ga0068867_1002701931 255
1329 3300005546 Ga0070696_100073348 Ga0070696_1000733482 255
1330 3300005719 Ga0068861_100327653 Ga0068861_1003276532 255
1331 3300005844 Ga0068862_100157312 Ga0068862_1001573122 255
1332 3300005981 Ga0081538_10002181 Ga0081538_1000218118 255
1333 3300005981 Ga0081538_10015390 Ga0081538_100153905 255
1334 3300005985 Ga0081539_10010083 Ga0081539_100100837 255
1335 3300006195 Ga0075366_10151175 Ga0075366_101511752 255
1336 3300009094 Ga0111539_10000123 Ga0111539_1000012352 255
1337 3300009551 Ga0105238_10377350 Ga0105238_103773502 255
1338 3300025302 Ga0207426_1028627 Ga0207426_10286272 255
1339 3300025937 Ga0207669_10006701 Ga0207669_100067012 255
1340 3300025938 Ga0207704_10346230 Ga0207704_103462301 255
1341 3300026089 Ga0207648_10236538 Ga0207648_102365382 255
1342 3300027907 Ga0207428_10000133 Ga0207428_1000013328 255
1343 3300031456 Ga0307513_10028096 Ga0307513_100280965 255
1344 3300031616 Ga0307508_10210604 Ga0307508_102106042 255
1345 3300031824 Ga0307413_10050395 Ga0307413_100503952 255
1346 3300031911 Ga0307412_10286358 Ga0307412_102863582 255
1347 3300031995 Ga0307409_100033770 Ga0307409_1000337704 255
1348 3300032005 Ga0307411_10060082 Ga0307411_100600822 255
1349 3300049574 Ga0501038_0097401 Ga0501038_0097401_870_1703 255
1350 3300049583 Ga0501067_0081931 Ga0501067_0081931_940_1773 255
1351 3300049823 Ga0501044_0019019 Ga0501044_0019019_5591_6424 255
1352 3300050496 nmdc:mga07m45_31123_c1 nmdc:mga07m45_31123_c1_1755_2588 255
1353 3300050507 nmdc:mga05p37_305941_c1 nmdc:mga05p37_305941_c1_856_1692 255
1354 3300050511 nmdc:mga08y16_44_c1 nmdc:mga08y16_44_c1_20355_21191 255
1355 3300053093 Ga0500651_0086229 Ga0500651_0086229_676_1509 255
1356 3300053096 Ga0500641_0055833 Ga0500641_0055833_12_845 255
1357 3300053103 Ga0500555_026090 Ga0500555_026090_562_1395 255
1358 3300053118 Ga0500594_0033298 Ga0500594_0033298_282_1115 255
1359 3300053119 Ga0500595_006666 Ga0500595_006666_882_1715 255
1360 3300053130 Ga0500642_0002981 Ga0500642_0002981_45_878 255
1361 3300053146 Ga0500588_0049259 Ga0500588_0049259_437_1270 255
1362 3300053146 Ga0500588_0063539 Ga0500588_0063539_330_1163 255
1363 3300053160 Ga0500633_0085069 Ga0500633_0085069_170_1003 255
1364 3300053731 Ga0500609_000048 Ga0500609_000048_11461_12294 255
1365 3300053731 Ga0500609_012055 Ga0500609_012055_159_992 255
1366 3300059421 Ga0590071_004505 Ga0590071_004505_868_1704 255
1367 3300059424 Ga0590075_002537 Ga0590075_002537_120_956 255
1368 3300059426 Ga0590077_010994 Ga0590077_010994_452_1288 255
1369 3300003856 Ga0058692_1008266 Ga0058692_10082663 256
1370 3300005293 Ga0065715_10033325 Ga0065715_100333252 256
1371 3300005367 Ga0070667_100442686 Ga0070667_1004426862 256
1372 3300005439 Ga0070711_100205272 Ga0070711_1002052722 256
1373 3300005468 Ga0070707_100007996 Ga0070707_1000079968 256
1374 3300005471 Ga0070698_100496819 Ga0070698_1004968191 256
1375 3300005518 Ga0070699_100241157 Ga0070699_1002411572 256
1376 3300005546 Ga0070696_100341458 Ga0070696_1003414581 256
1377 3300005548 Ga0070665_100483833 Ga0070665_1004838332 256
1378 3300006051 Ga0075364_10096538 Ga0075364_100965382 256
1379 3300009011 Ga0105251_10030323 Ga0105251_100303234 256
1380 3300009036 Ga0105244_10001791 Ga0105244_1000179114 256
1381 3300009036 Ga0105244_10014154 Ga0105244_100141543 256
1382 3300011119 Ga0105246_10010396 Ga0105246_100103962 256
1383 3300013100 Ga0157373_10004331 Ga0157373_1000433110 256
1384 3300013102 Ga0157371_10001454 Ga0157371_1000145428 256
1385 3300025711 Ga0207696_1000076 Ga0207696_100007698 256
1386 3300025728 Ga0207655_1014385 Ga0207655_10143857 256
1387 3300025728 Ga0207655_1071084 Ga0207655_10710842 256
1388 3300025735 Ga0207713_1038463 Ga0207713_10384632 256
1389 3300025922 Ga0207646_10047164 Ga0207646_100471642 256
1390 3300027312 Ga0209371_1004561 Ga0209371_10045613 256
1391 3300028379 Ga0268266_10190337 Ga0268266_101903372 256
1392 3300028380 Ga0268265_10392935 Ga0268265_103929352 256
1393 3300030500 Ga0268256_1015885 Ga0268256_10158853 256
1394 3300035725 Ga0373947_0133152 Ga0373947_0133152_159_995 256
1395 3300037068 Ga0373925_0060324 Ga0373925_0060324_1207_2043 256
1396 3300048904 Ga0496101_0000023 Ga0496101_0000023_85543_86367 256
1397 3300048913 Ga0496110_0283493 Ga0496110_0283493_74_919 256
1398 3300048919 Ga0496116_0009455 Ga0496116_0009455_3040_3864 256
1399 3300048920 Ga0496117_0019866 Ga0496117_0019866_2779_3603 256
1400 3300048922 Ga0496119_0028726 Ga0496119_0028726_2406_3230 256
1401 3300048923 Ga0496120_0001086 Ga0496120_0001086_6162_6986 256
1402 3300048925 Ga0496122_0006562 Ga0496122_0006562_3769_4593 256
1403 3300048926 Ga0496123_0019603 Ga0496123_0019603_1118_1942 256
1404 3300048927 Ga0496124_0034006 Ga0496124_0034006_801_1625 256
1405 3300049571 Ga0501034_0001016 Ga0501034_0001016_10922_11764 256
1406 3300050491 nmdc:mga00v17_24964_c1 nmdc:mga00v17_24964_c1_1537_2361 256
1407 3300053153 Ga0500616_0001121 Ga0500616_0001121_26491_27327 256
1408 3300002705 JGI25156J39149_1009617 JGI25156J39149_10096172 257
1409 3300002741 JGI25157J39369_1003024 JGI25157J39369_10030242 257
1410 3300003187 JGI25151J46595_10001194 JGI25151J46595_100011944 257
1411 3300003214 JGI25165J46597_1000206 JGI25165J46597_100020622 257
1412 3300003215 JGI25153J46596_10022279 JGI25153J46596_100222792 257
1413 3300003762 Ga0055542_1000947 Ga0055542_100094710 257
1414 3300003762 Ga0055542_1001298 Ga0055542_10012986 257
1415 3300003763 Ga0055529_1005284 Ga0055529_10052842 257
1416 3300005339 Ga0070660_100128224 Ga0070660_1001282242 257
1417 3300005539 Ga0068853_100357110 Ga0068853_1003571101 257
1418 3300005614 Ga0068856_100485317 Ga0068856_1004853172 257
1419 3300005616 Ga0068852_100237316 Ga0068852_1002373162 257
1420 3300005983 Ga0081540_1071406 Ga0081540_10714062 257
1421 3300006038 Ga0075365_10190182 Ga0075365_101901822 257
1422 3300006048 Ga0075363_100129012 Ga0075363_1001290121 257
1423 3300006881 Ga0068865_100362889 Ga0068865_1003628892 257
1424 3300009093 Ga0105240_10330935 Ga0105240_103309352 257
1425 3300009148 Ga0105243_10410444 Ga0105243_104104442 257
1426 3300009553 Ga0105249_10353592 Ga0105249_103535922 257
1427 3300010375 Ga0105239_10230990 Ga0105239_102309902 257
1428 3300010375 Ga0105239_10475843 Ga0105239_104758431 257
1429 3300013100 Ga0157373_10240529 Ga0157373_102405292 257
1430 3300013296 Ga0157374_10469475 Ga0157374_104694751 257
1431 3300025250 Ga0209026_1000050 Ga0209026_100005039 257
1432 3300025254 Ga0209148_1000050 Ga0209148_100005015 257
1433 3300025256 Ga0209759_1000229 Ga0209759_100022968 257
1434 3300025261 Ga0209233_1000034 Ga0209233_1000034157 257
1435 3300025261 Ga0209233_1005432 Ga0209233_10054322 257
1436 3300025272 Ga0209455_1000507 Ga0209455_100050715 257
1437 3300025294 Ga0209025_1000077 Ga0209025_1000077110 257
1438 3300025297 Ga0209758_1002011 Ga0209758_10020118 257
1439 3300025919 Ga0207657_10054577 Ga0207657_100545773 257
1440 3300025961 Ga0207712_10181007 Ga0207712_101810072 257
1441 3300026118 Ga0207675_100026208 Ga0207675_1000262087 257
1442 3300026142 Ga0207698_10084832 Ga0207698_100848322 257
1443 3300028379 Ga0268266_10127196 Ga0268266_101271963 257
1444 3300031616 Ga0307508_10335188 Ga0307508_103351882 257
1445 3300037418 Ga0395900_0018190 Ga0395900_0018190_3319_4167 257
1446 3300038443 Ga0395901_0108026 Ga0395901_0108026_1810_2658 257
1447 3300039447 Ga0436361_0034602 Ga0436361_0034602_198_1046 257
1448 3300039450 Ga0436363_0274728 Ga0436363_0274728_2235_3083 257
1449 3300044658 Ga0466972_0046222 Ga0466972_0046222_376_1224 257
1450 3300046458 Ga0495591_000803 Ga0495591_000803_17464_18291 257
1451 3300046471 Ga0495650_0000113 Ga0495650_0000113_113327_114154 257
1452 3300046474 Ga0495605_0099869 Ga0495605_0099869_130_957 257
1453 3300046491 Ga0495584_0002744 Ga0495584_0002744_7842_8669 257
1454 3300046518 Ga0495631_0036456 Ga0495631_0036456_1214_2041 257
1455 3300046523 Ga0495644_0001112 Ga0495644_0001112_7943_8770 257
1456 3300046524 Ga0495648_0018790 Ga0495648_0018790_2591_3418 257
1457 3300046530 Ga0495654_0000124 Ga0495654_0000124_3775_4602 257
1458 3300046794 Ga0495589_0039901 Ga0495589_0039901_1013_1840 257
1459 3300046810 Ga0495660_0000034 Ga0495660_0000034_54281_55108 257
1460 3300047320 Ga0495672_0000029 Ga0495672_0000029_123709_124536 257
1461 3300047469 Ga0495673_0000092 Ga0495673_0000092_171552_172379 257
1462 3300048908 Ga0496105_0294200 Ga0496105_0294200_151_999 257
1463 3300048914 Ga0496111_0123945 Ga0496111_0123945_664_1512 257
1464 3300048915 Ga0496112_0028761 Ga0496112_0028761_4246_5094 257
1465 3300048915 Ga0496112_0047536 Ga0496112_0047536_2322_3170 257
1466 3300048915 Ga0496112_0622845 Ga0496112_0622845_34_873 257
1467 3300048918 Ga0496115_0100983 Ga0496115_0100983_667_1515 257
1468 3300048919 Ga0496116_0005820 Ga0496116_0005820_4152_4979 257
1469 3300048922 Ga0496119_0010451 Ga0496119_0010451_1830_2657 257
1470 3300048922 Ga0496119_0058948 Ga0496119_0058948_415_1263 257
1471 3300048923 Ga0496120_0000032 Ga0496120_0000032_23373_24200 257
1472 3300048927 Ga0496124_0236713 Ga0496124_0236713_264_1112 257
1473 3300048929 Ga0496126_0186957 Ga0496126_0186957_452_1300 257
1474 3300049459 Ga0495678_001299 Ga0495678_001299_5627_6454 257
1475 3300049460 Ga0495682_0000003 Ga0495682_0000003_171435_172262 257
1476 3300050490 nmdc:mga03n38_92522_c1 nmdc:mga03n38_92522_c1_528_1376 257
1477 3300050491 nmdc:mga00v17_152240_c1 nmdc:mga00v17_152240_c1_344_1192 257
1478 3300050491 nmdc:mga00v17_24063_c1 nmdc:mga00v17_24063_c1_2499_3347 257
1479 3300050492 nmdc:mga0yw44_36719_c1 nmdc:mga0yw44_36719_c1_1041_1889 257
1480 3300050496 nmdc:mga07m45_50630_c1 nmdc:mga07m45_50630_c1_619_1467 257
1481 3300053126 Ga0500621_000006 Ga0500621_000006_159779_160606 257
1482 3300053139 Ga0500568_0021697 Ga0500568_0021697_243_1091 257
1483 3300053153 Ga0500616_0035927 Ga0500616_0035927_1328_2176 257
1484 3300046507 Ga0495606_0000374 Ga0495606_0000374_49552_50382 258
1485 iso_pu_bacteria 2585427591 2585829462 258
1486 iso_pu_bacteria 2585427592 2585834827 258
1487 iso_pu_bacteria 2667528173 2671109943 258
1488 iso_pu_bacteria 2904474040 2904477225 258
1489 iso_pu_bacteria 2919150387 2919153392 258
1490 iso_pu_bacteria 2927143783 2927144018 258
1491 3300039062 Ga0400483_065417 Ga0400483_065417_1739_2590 260
1492 2162886007 SwRhRL2b_contig_999527 SwRhRL2b_0261.00003920 262
1493 3300002737 JGI25162J39368_1000009 JGI25162J39368_1000009212 262
1494 3300002771 JGI25163J39215_1000765 JGI25163J39215_10007656 262
1495 3300002772 JGI25164J39214_1000002 JGI25164J39214_1000002135 262
1496 3300003751 Ga0055538_1000015 Ga0055538_1000015136 262
1497 3300003752 Ga0055539_1000009 Ga0055539_1000009227 262
1498 3300003756 Ga0055533_1000012 Ga0055533_1000012134 262
1499 3300003759 Ga0055525_1000014 Ga0055525_1000014227 262
1500 3300003841 Ga0055541_1000006 Ga0055541_1000006134 262
1501 3300005289 Ga0065704_10000959 Ga0065704_100009595 262
1502 3300009036 Ga0105244_10001340 Ga0105244_100013405 262
1503 3300009092 Ga0105250_10004385 Ga0105250_100043856 262
1504 3300025207 Ga0209760_100051 Ga0209760_10005139 262
1505 3300025224 Ga0209784_100001 Ga0209784_1000012019 262
1506 3300025225 Ga0209566_100001 Ga0209566_1000012019 262
1507 3300025226 Ga0209674_100002 Ga0209674_1000022019 262
1508 3300025230 Ga0209563_100002 Ga0209563_100002554 262
1509 3300025231 Ga0207427_100020 Ga0207427_100020222 262
1510 3300025233 Ga0209437_100001 Ga0209437_100001554 262
1511 3300025253 Ga0209677_100002 Ga0209677_100002554 262
1512 3300025711 Ga0207696_1000396 Ga0207696_100039628 262
1513 3300025728 Ga0207655_1000413 Ga0207655_100041312 262
1514 3300046471 Ga0495650_0000043 Ga0495650_0000043_245797_246639 262
1515 3300046810 Ga0495660_0000012 Ga0495660_0000012_173215_174057 262
1516 3300048919 Ga0496116_0000066 Ga0496116_0000066_172413_173255 262
1517 3300048920 Ga0496117_0013982 Ga0496117_0013982_2691_3533 262
1518 3300048921 Ga0496118_0022829 Ga0496118_0022829_3550_4392 262
1519 3300048922 Ga0496119_0045882 Ga0496119_0045882_1454_2296 262
1520 3300048923 Ga0496120_0008032 Ga0496120_0008032_2826_3668 262
1521 3300048925 Ga0496122_0000110 Ga0496122_0000110_169823_170665 262
1522 3300048926 Ga0496123_0000081 Ga0496123_0000081_19478_20320 262
1523 3300048927 Ga0496124_0000530 Ga0496124_0000530_11631_12473 262
1524 3300048928 Ga0496125_0000033 Ga0496125_0000033_97159_98001 262
1525 3300048929 Ga0496126_0001066 Ga0496126_0001066_33862_34704 262

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

102

289

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.7628 11 254
8hpr-assembly1.cif.gz_B lpqy-sugabc in state 4 0.7593 9 246
2r6g-assembly1.cif.gz_G the crystal structure of the e. coli maltose transporter 0.7348 11 262
7cad-assembly1.cif.gz_B mycobacterium smegmatis sugabc complex 0.7292 11 262
8ja7-assembly1.cif.gz_B cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.7179 11 258
ID Description Score Start End Superfamily
af_Q2G1E7_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7849 4 248 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7716 10 252 1.10.3720.10
af_P9WG01_5_265_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7637 14 252 1.10.3720.10
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7579 4 252 1.10.3720.10
2r6gG01 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7457 11 248 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7C4D325-F1-model_v4 Carbohydrate ABC transporter permease 0.8315 7 262 GO:0005886
GO:0055085
AF-A0A5Q4G8K8-F1-model_v4 Carbohydrate ABC transporter permease 0.83 16 262 GO:0005886
GO:0055085
AF-A0A316JGE5-F1-model_v4 Carbohydrate ABC transporter permease 0.8227 10 258 GO:0005886
GO:0055085
AF-A0A6B1D8H8-F1-model_v4 Carbohydrate ABC transporter permease 0.8226 1 262 GO:0005886
GO:0055085
AF-A0A6B1D8H8-F1-model_v4 Carbohydrate ABC transporter permease 0.8197 1 262 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
72.35 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map