F494565
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1525 | 1193 | 662 | 274 |
Family's Representative Sequence
| Representative Sequence | 3300026118|Ga0207675_100026208|Ga0207675_1000262087 |
| Length | 294 |
| Sequence | MTAMTMTTPPTLVTMLMTRPKRIVGTIAHRGAILLYIFFALFPLYWLLKVSVTPNDLLYSEGVRLWPSRTSIQHYLFVLEHSDFPRFFRNSVIVSGATAFIVTILASCAGYALSRFTFRGKYWIVALMLLTQMFPLVMLVAPIFKMLSPLGLTNSLTGLVIVYVAFNVPFATFLMQSFFDGIPKDLEEAAMIDGATRFRAFSQIILPLTLPGIAATLGFVFTAAWSELLFALMLISSAGASTFPVGLLSFVSKFSVDFGQMMAAGVLALIPACLFFLFIQRYLVQGLTAGAVKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 3 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 4 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 5 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 6 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 7 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 8 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 9 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 10 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 11 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 12 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 13 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 14 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 15 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 16 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 17 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 18 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 19 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 20 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 21 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 22 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 23 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 24 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 25 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 26 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 27 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 28 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 29 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 30 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 31 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 32 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 33 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 34 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 35 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 36 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 37 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 38 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 39 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 40 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 41 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 42 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 43 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 44 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 45 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 46 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 47 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 48 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 49 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 50 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 51 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 52 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 53 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 54 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 55 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 56 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 57 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 58 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 59 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 60 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 61 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 62 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 63 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 64 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 65 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 66 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 67 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 68 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 69 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 70 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 71 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 72 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 73 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 74 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 75 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 76 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 77 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 78 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 79 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 80 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 81 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 82 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 83 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 84 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 85 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 86 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 87 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 88 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 89 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 90 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 91 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 92 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 93 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 94 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 95 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 96 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 97 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 98 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 99 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 100 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 101 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 102 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 103 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 104 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 105 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 106 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 107 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 108 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 109 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 110 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 111 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 112 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 113 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 114 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 115 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 116 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 117 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 118 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 119 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 120 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 121 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 122 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 123 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 124 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 125 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 126 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 127 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 128 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 129 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 130 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 131 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 132 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 133 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 134 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 135 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 136 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 137 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 138 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 139 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 140 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 141 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 142 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 143 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 144 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 145 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 146 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 147 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 148 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 149 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 150 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 151 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 152 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 153 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 154 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 155 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 156 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 157 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 158 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 159 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 160 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 161 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 162 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 163 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 164 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 165 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 166 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 167 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 168 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 169 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 170 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 171 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 172 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 173 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 174 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 175 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 176 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 177 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 178 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 179 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 180 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 181 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 182 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 183 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 184 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 185 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 186 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 187 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 188 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 189 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 190 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 191 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 192 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 193 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 194 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 195 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 196 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 197 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 198 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 199 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 200 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 201 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 202 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 203 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 204 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 205 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 206 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 207 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 208 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 209 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 210 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 211 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 212 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 213 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 214 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 215 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 216 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 217 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 218 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 219 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 220 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 221 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 222 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 223 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 224 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 225 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 226 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 227 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 228 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 229 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 230 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 231 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 232 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 233 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 234 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 235 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 236 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 237 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 238 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 239 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 240 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 241 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 242 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 243 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 244 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 245 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 246 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 247 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 248 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 249 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 250 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 251 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 252 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 253 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 254 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 255 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 256 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 257 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 258 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 259 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 260 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 261 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 262 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 263 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 264 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 265 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 266 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 267 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 268 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 269 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 270 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 271 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 272 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 273 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 274 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 275 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 276 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 277 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 278 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 279 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 280 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 281 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 282 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 283 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 284 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 285 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 286 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 287 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 288 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 289 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 290 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 291 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 292 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 293 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 294 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 295 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 296 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 297 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 298 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 299 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 300 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 301 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 302 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 303 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 304 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 305 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 306 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 307 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 308 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 309 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 310 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 311 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 312 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 313 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 314 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 315 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 316 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 317 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 318 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 319 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 320 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 321 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 322 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 323 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 324 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 325 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 326 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 327 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 328 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 329 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 330 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 331 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 332 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 333 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 334 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 335 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 336 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 337 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 338 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 339 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 340 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 341 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 342 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 343 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 344 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 345 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 346 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 347 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 348 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 349 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 350 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 351 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 352 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 353 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 354 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 355 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 356 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 357 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 358 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 359 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 360 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 361 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 362 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 363 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 364 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 365 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 366 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 367 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 368 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 369 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 370 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 371 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 372 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 373 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 374 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 375 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 376 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 377 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 378 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 379 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 380 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 381 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 382 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 383 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 384 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 385 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 386 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 387 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 388 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 389 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 390 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 391 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 392 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 393 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 394 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 395 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 396 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 397 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 398 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 399 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 400 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 401 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 402 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 403 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 404 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 405 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 406 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 407 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 408 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 409 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 410 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 411 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 412 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 413 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 414 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 415 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 416 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 417 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 418 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 419 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 420 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 421 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 422 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 423 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 424 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 425 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 426 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 427 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 428 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 429 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 430 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 431 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 432 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 433 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 434 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 435 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 436 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 437 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 438 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 439 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 440 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 441 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 442 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 443 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 444 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 445 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 446 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 447 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 448 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 449 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 450 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 451 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 452 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 453 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 454 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 455 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 456 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 457 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 458 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 459 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 460 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 461 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 462 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 463 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 464 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 465 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 466 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 467 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 468 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 469 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 470 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 471 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 472 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 473 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 474 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 475 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 476 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 477 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 478 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 479 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 480 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 481 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 482 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 483 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 484 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 485 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 486 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 487 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 488 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 489 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 490 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 491 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 492 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 493 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 494 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 495 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 496 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 497 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 498 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 499 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 500 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 501 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 502 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 503 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 504 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 505 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 506 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 507 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 508 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 509 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 510 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 511 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 512 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 513 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 514 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 515 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 516 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 517 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 518 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 519 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 520 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 521 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 522 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 523 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 524 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 525 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 526 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 527 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 528 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 529 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 530 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 531 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 532 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 533 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 534 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 535 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 536 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 537 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 538 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 539 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 540 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 541 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 542 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 543 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 544 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 545 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 546 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 547 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 548 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 549 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 550 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 551 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 552 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 553 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 554 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 555 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 556 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 557 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 558 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 559 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 560 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 561 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 562 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 563 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 564 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 565 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 566 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 567 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 568 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 569 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 570 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 571 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 572 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 573 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 574 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 575 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 576 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 577 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 578 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 579 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 580 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 581 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 582 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 583 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 584 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 585 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 586 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 587 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 588 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 589 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 590 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 591 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 592 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 593 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 594 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 595 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 596 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 597 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 598 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 599 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 600 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 601 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 602 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 603 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 604 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 605 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 606 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 607 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 608 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 609 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 610 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 611 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 612 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 613 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 614 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 615 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 616 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 617 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 618 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 619 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 620 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 621 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 622 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 623 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 624 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 625 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 626 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 627 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 628 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 629 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 630 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 631 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 632 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 633 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 634 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 635 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 636 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 637 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 638 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 639 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 640 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 641 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 642 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 643 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 644 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 645 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 646 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 647 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 648 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 649 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 650 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 651 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 652 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 653 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 654 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 655 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 656 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 657 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 658 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 659 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 660 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 661 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 662 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 663 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 664 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 665 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 666 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 667 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 668 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 669 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 670 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 671 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 672 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 673 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 674 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 675 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 676 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 677 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 678 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 679 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 680 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 681 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 682 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 683 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 684 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 685 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 686 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 687 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 688 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 689 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 690 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 691 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 692 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 693 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 694 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 695 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 696 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 697 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 698 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 699 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 700 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 701 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 702 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 703 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 704 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 705 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 706 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 707 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 708 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 709 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 710 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 711 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 712 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 713 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 714 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 715 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 716 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 717 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 718 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 719 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 720 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 721 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 722 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 723 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 724 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 725 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 726 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 727 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 728 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 729 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 730 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 731 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 732 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 733 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 734 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 735 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 736 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 737 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 738 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 739 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 740 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 741 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 742 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 743 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 744 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 745 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 746 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 747 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 748 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 749 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 750 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 751 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 752 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 753 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 754 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 755 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 756 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 757 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 758 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 759 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 760 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 761 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 762 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 763 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 764 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 765 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 766 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 767 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 768 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 769 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 770 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 771 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 772 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 773 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 774 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 775 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 776 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 777 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 778 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 779 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 780 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 781 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 782 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 783 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 784 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 785 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 786 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 787 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 788 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 789 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 790 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 791 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 792 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 793 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 794 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 795 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 796 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 797 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 798 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 799 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 800 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 801 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 802 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 803 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 804 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 805 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 806 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 807 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 808 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 809 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 810 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 811 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 812 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 813 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 814 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 815 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 816 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 817 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 818 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 819 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 820 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 821 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 822 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 823 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 824 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 825 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 826 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 827 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 828 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 829 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 830 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 831 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 832 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 833 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 834 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 835 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 836 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 837 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 838 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 839 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 840 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 841 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 842 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 843 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 844 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 845 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 846 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 847 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 848 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 849 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 850 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 851 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 852 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 853 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 854 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 855 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 856 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 857 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 858 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 859 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 860 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 861 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 862 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 863 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 864 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 865 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 866 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 867 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 868 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 869 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 870 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 871 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 872 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 873 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 874 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 875 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 876 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 877 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 878 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 879 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 880 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 881 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 882 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 883 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 884 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 885 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 886 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 887 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 888 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 889 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 890 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 891 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 892 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 893 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 894 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 895 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 896 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 897 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 898 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 899 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 900 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 901 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 902 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 903 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 904 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 905 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 906 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 907 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 908 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 909 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 910 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 911 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 912 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 913 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 914 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 915 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 916 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 917 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 918 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 919 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 920 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 921 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 922 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 923 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 924 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 925 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 926 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 927 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 928 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 929 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 930 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 931 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 932 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 933 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 934 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 935 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 936 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 937 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 938 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 939 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 940 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 941 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 942 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 943 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 944 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 945 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 946 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 947 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 948 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 949 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 950 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 951 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 952 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 953 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 954 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 955 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 956 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 957 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 958 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 959 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 960 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 961 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 962 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 963 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 964 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 965 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 966 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 967 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 968 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 969 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 970 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 971 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 972 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 973 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 974 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 975 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 976 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 977 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 978 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 979 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 980 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 981 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 982 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 983 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 984 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 985 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 986 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 987 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 988 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 989 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 990 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 991 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 992 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 993 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 994 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 995 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 996 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 997 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 998 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 999 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 1000 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 1001 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 1002 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 1003 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 1004 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 1005 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 1006 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 1007 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 1008 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 1009 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 1010 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 1011 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 1012 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 1013 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 1014 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 1015 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 1016 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 1017 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 1018 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 1019 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 1020 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 1021 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 1022 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 1023 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 1024 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 1025 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 1026 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 1027 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 1028 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 1029 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 1030 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 1031 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 1032 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 1033 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 1034 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 1035 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 1036 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 1037 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 1038 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 1039 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 1040 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 1041 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 1042 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 1043 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 1044 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 1045 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 1046 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 1047 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 1048 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 1049 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 1050 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 1051 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 1052 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 1053 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 1054 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 1055 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 1056 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 1057 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 1058 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 1059 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 1060 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 1061 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 1062 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 1063 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 1064 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 1065 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 1066 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 1067 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 1068 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 1069 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1070 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1071 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1072 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1073 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1074 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1075 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1076 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1077 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1078 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1079 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1080 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1081 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1082 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1083 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1084 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 1085 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 1086 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 1087 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 1088 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 1089 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 1090 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 1091 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 1092 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 1093 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 1094 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 1095 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 1096 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 1097 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 1098 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 1099 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 1100 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 1101 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 1102 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 1103 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 1104 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 1105 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 1106 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 1107 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 1108 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 1109 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 1110 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 1111 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 1112 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 1113 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 1114 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 1115 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 1116 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 1117 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 1118 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 1119 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 1120 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 1121 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 1122 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1123 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 1124 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 1125 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 1126 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1127 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 1128 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 1129 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1130 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 1131 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1132 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 1133 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 1134 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 1135 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 1136 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1137 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1138 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 1139 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 1140 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 1141 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 1142 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 1143 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 1144 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 1145 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 1146 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 1147 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 1148 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 1149 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 1150 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 1151 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1152 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1153 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1154 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1155 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1156 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1157 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1158 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1159 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1160 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1161 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1162 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1163 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1164 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 1165 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1166 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 1167 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1168 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1169 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1170 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1171 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1172 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 1173 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1174 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 1175 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1176 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1177 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 1178 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1179 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1180 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1181 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 1182 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1183 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1184 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 1185 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1186 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 1187 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1188 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 1189 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 1190 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1191 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1192 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 1193 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 43.41 |
| Metatranscriptomes | 0.07 |
| Isolates | 56.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.07 |
| Bulb | 0 |
| Endosphere | 16.07 |
| Nodule | 44.52 |
| Rhizoplane | 1.38 |
| Rhizosphere | 22.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_999527 | 2162886007 | Bacteria | 5204 |
| 2 | JGI25155J39150_1000015 | 3300002704 | Bacteria | 178839 |
| 3 | JGI25156J39149_1000007 | 3300002705 | Bacteria | 252108 |
| 4 | JGI25156J39149_1009617 | 3300002705 | Bacteria | 2335 |
| 5 | JGI25162J39368_1000009 | 3300002737 | Bacteria | 389795 |
| 6 | JGI25162J39368_1000119 | 3300002737 | Bacteria | 87157 |
| 7 | JGI25162J39368_1000489 | 3300002737 | Bacteria | 30241 |
| 8 | JGI25154J39366_1000145 | 3300002738 | Bacteria | 55861 |
| 9 | JGI25158J39367_1000094 | 3300002739 | Bacteria | 20606 |
| 10 | JGI25157J39369_1000012 | 3300002741 | Bacteria | 205167 |
| 11 | JGI25157J39369_1003024 | 3300002741 | Bacteria | 3672 |
| 12 | JGI25163J39215_1000765 | 3300002771 | Bacteria | 7902 |
| 13 | JGI25164J39214_1000002 | 3300002772 | Bacteria | 406570 |
| 14 | JGI25152J39213_1002953 | 3300002773 | Bacteria | 6053 |
| 15 | JGI25152J39213_1013083 | 3300002773 | Bacteria | 1746 |
| 16 | JGI25152J39213_1015131 | 3300002773 | Bacteria | 1532 |
| 17 | JGI25152J39213_1016662 | 3300002773 | Bacteria | 1410 |
| 18 | JGI25150J39212_1000103 | 3300002774 | Bacteria | 49029 |
| 19 | JGI25150J39212_1006873 | 3300002774 | Bacteria | 2318 |
| 20 | JGI25150J39212_1014069 | 3300002774 | Bacteria | 1368 |
| 21 | JGI25159J45721_1001078 | 3300002987 | Bacteria | 11655 |
| 22 | JGI25159J45721_1003115 | 3300002987 | Bacteria | 5982 |
| 23 | JGI25151J46595_10000085 | 3300003187 | Bacteria | 127212 |
| 24 | JGI25151J46595_10001194 | 3300003187 | Bacteria | 18647 |
| 25 | JGI25151J46595_10014672 | 3300003187 | Bacteria | 3481 |
| 26 | JGI25165J46597_1000206 | 3300003214 | Bacteria | 84821 |
| 27 | JGI25165J46597_1000211 | 3300003214 | Bacteria | 82463 |
| 28 | JGI25165J46597_1001070 | 3300003214 | Bacteria | 17582 |
| 29 | JGI25165J46597_1004826 | 3300003214 | Bacteria | 2755 |
| 30 | JGI25153J46596_10000103 | 3300003215 | Bacteria | 96279 |
| 31 | JGI25153J46596_10001488 | 3300003215 | Bacteria | 13974 |
| 32 | JGI25153J46596_10005550 | 3300003215 | Bacteria | 6594 |
| 33 | JGI25153J46596_10009848 | 3300003215 | Bacteria | 4386 |
| 34 | JGI25153J46596_10022279 | 3300003215 | Bacteria | 2340 |
| 35 | JGI25153J46596_10037724 | 3300003215 | Bacteria | 1532 |
| 36 | JGI25153J46596_10037747 | 3300003215 | Bacteria | 1532 |
| 37 | JGI25160J50197_1000023 | 3300003354 | Bacteria | 200692 |
| 38 | JGI25160J50197_1000033 | 3300003354 | Bacteria | 172667 |
| 39 | JGI25160J50197_1000726 | 3300003354 | Bacteria | 18068 |
| 40 | JGI25160J50197_1001657 | 3300003354 | Bacteria | 10887 |
| 41 | JGI25161J50226_1000012 | 3300003374 | Bacteria | 200668 |
| 42 | JGI25161J50226_1000508 | 3300003374 | Bacteria | 17047 |
| 43 | JGI25161J50226_1001989 | 3300003374 | Bacteria | 5608 |
| 44 | JGI25161J50226_1004573 | 3300003374 | Bacteria | 2865 |
| 45 | Ga0006562J51391_1050521 | 3300003578 | Bacteria | 2458 |
| 46 | Ga0055538_1000015 | 3300003751 | Bacteria | 311166 |
| 47 | Ga0055539_1000009 | 3300003752 | Bacteria | 406566 |
| 48 | Ga0055533_1000012 | 3300003756 | Bacteria | 406566 |
| 49 | Ga0055525_1000014 | 3300003759 | Bacteria | 406566 |
| 50 | Ga0055542_1000947 | 3300003762 | Bacteria | 19060 |
| 51 | Ga0055542_1001298 | 3300003762 | Bacteria | 13317 |
| 52 | Ga0055529_1005284 | 3300003763 | Bacteria | 1881 |
| 53 | Ga0055526_1002294 | 3300003771 | Bacteria | 13055 |
| 54 | Ga0055526_1008324 | 3300003771 | Bacteria | 5199 |
| 55 | Ga0055526_1016818 | 3300003771 | Bacteria | 2834 |
| 56 | Ga0055526_1016912 | 3300003771 | Bacteria | 2820 |
| 57 | Ga0055526_1017729 | 3300003771 | Bacteria | 2702 |
| 58 | Ga0055526_1028335 | 3300003771 | Bacteria | 1697 |
| 59 | Ga0055524_1003993 | 3300003775 | Bacteria | 6961 |
| 60 | Ga0055524_1007275 | 3300003775 | Bacteria | 4724 |
| 61 | Ga0055524_1014578 | 3300003775 | Bacteria | 2906 |
| 62 | Ga0055524_1023454 | 3300003775 | Bacteria | 1985 |
| 63 | Ga0055536_1012578 | 3300003781 | Bacteria | 3126 |
| 64 | Ga0055528_1000519 | 3300003790 | Bacteria | 30154 |
| 65 | Ga0055528_1004148 | 3300003790 | Bacteria | 7059 |
| 66 | Ga0055528_1014232 | 3300003790 | Bacteria | 2957 |
| 67 | Ga0055528_1027463 | 3300003790 | Bacteria | 1601 |
| 68 | Ga0055528_1031970 | 3300003790 | Bacteria | 1356 |
| 69 | Ga0055530_10022847 | 3300003791 | Bacteria | 1811 |
| 70 | Ga0055540_1000050 | 3300003792 | Bacteria | 145565 |
| 71 | Ga0055540_1005332 | 3300003792 | Bacteria | 5457 |
| 72 | Ga0055540_1012166 | 3300003792 | Bacteria | 2721 |
| 73 | Ga0055540_1022297 | 3300003792 | Bacteria | 1623 |
| 74 | Ga0055531_10016516 | 3300003794 | Bacteria | 3179 |
| 75 | Ga0055531_10017593 | 3300003794 | Bacteria | 3006 |
| 76 | Ga0055541_1000006 | 3300003841 | Bacteria | 406566 |
| 77 | Ga0058692_1008266 | 3300003856 | Bacteria | 2693 |
| 78 | Ga0058692_1017728 | 3300003856 | Bacteria | 1556 |
| 79 | Ga0055543_1000009 | 3300004625 | Bacteria | 200706 |
| 80 | Ga0055543_1000021 | 3300004625 | Bacteria | 150116 |
| 81 | Ga0055543_1000315 | 3300004625 | Bacteria | 33655 |
| 82 | Ga0055543_1003043 | 3300004625 | Bacteria | 5170 |
| 83 | Ga0065165_1000064 | 3300005262 | Bacteria | 175153 |
| 84 | Ga0065165_1000513 | 3300005262 | Bacteria | 59506 |
| 85 | Ga0065165_1005453 | 3300005262 | Bacteria | 7139 |
| 86 | Ga0065165_1006135 | 3300005262 | Bacteria | 6429 |
| 87 | Ga0065165_1008941 | 3300005262 | Bacteria | 4588 |
| 88 | Ga0065165_1047904 | 3300005262 | Bacteria | 1231 |
| 89 | Ga0065704_10000959 | 3300005289 | Bacteria | 34794 |
| 90 | Ga0065715_10033325 | 3300005293 | Bacteria | 1939 |
| 91 | Ga0065707_10026737 | 3300005295 | Bacteria | 1507 |
| 92 | Ga0070670_100000287 | 3300005331 | Bacteria | 44454 |
| 93 | Ga0068868_100250245 | 3300005338 | Bacteria | 1491 |
| 94 | Ga0070660_100128224 | 3300005339 | Bacteria | 2029 |
| 95 | Ga0070668_100127067 | 3300005347 | Bacteria | 2043 |
| 96 | Ga0070669_100010155 | 3300005353 | Bacteria | 6694 |
| 97 | Ga0070671_100380979 | 3300005355 | Bacteria | 1205 |
| 98 | Ga0070674_100001722 | 3300005356 | Bacteria | 11851 |
| 99 | Ga0070667_100442686 | 3300005367 | Bacteria | 1187 |
| 100 | Ga0070711_100205272 | 3300005439 | Bacteria | 1523 |
| 101 | Ga0068867_100270193 | 3300005459 | Bacteria | 1390 |
| 102 | Ga0070707_100007996 | 3300005468 | Bacteria | 9825 |
| 103 | Ga0070698_100496819 | 3300005471 | Bacteria | 1158 |
| 104 | Ga0070699_100241157 | 3300005518 | Bacteria | 1614 |
| 105 | Ga0068853_100357110 | 3300005539 | Bacteria | 1360 |
| 106 | Ga0070696_100073348 | 3300005546 | Bacteria | 2411 |
| 107 | Ga0070696_100341458 | 3300005546 | Bacteria | 1157 |
| 108 | Ga0070665_100105349 | 3300005548 | Bacteria | 2822 |
| 109 | Ga0070665_100177473 | 3300005548 | Bacteria | 2131 |
| 110 | Ga0070665_100263818 | 3300005548 | Bacteria | 1724 |
| 111 | Ga0070665_100483833 | 3300005548 | Bacteria | 1249 |
| 112 | Ga0070665_100511960 | 3300005548 | Bacteria | 1212 |
| 113 | Ga0068857_100169903 | 3300005577 | Bacteria | 1982 |
| 114 | Ga0068854_100067701 | 3300005578 | Bacteria | 2602 |
| 115 | Ga0068856_100022838 | 3300005614 | Bacteria | 6084 |
| 116 | Ga0068856_100485317 | 3300005614 | Bacteria | 1257 |
| 117 | Ga0068852_100237316 | 3300005616 | Bacteria | 1741 |
| 118 | Ga0068861_100327653 | 3300005719 | Bacteria | 1336 |
| 119 | Ga0068851_10135295 | 3300005834 | Bacteria | 1336 |
| 120 | Ga0068862_100090252 | 3300005844 | Bacteria | 2667 |
| 121 | Ga0068862_100157312 | 3300005844 | Bacteria | 2026 |
| 122 | Ga0081455_10035366 | 3300005937 | Bacteria | 4466 |
| 123 | Ga0081455_10124862 | 3300005937 | Bacteria | 2022 |
| 124 | Ga0081538_10002181 | 3300005981 | Bacteria | 19427 |
| 125 | Ga0081538_10015390 | 3300005981 | Bacteria | 5923 |
| 126 | Ga0081540_1041947 | 3300005983 | Bacteria | 2366 |
| 127 | Ga0081540_1071406 | 3300005983 | Bacteria | 1604 |
| 128 | Ga0081539_10010083 | 3300005985 | Bacteria | 7761 |
| 129 | Ga0075365_10010840 | 3300006038 | Bacteria | 5331 |
| 130 | Ga0075365_10190182 | 3300006038 | Bacteria | 1436 |
| 131 | Ga0075365_10303480 | 3300006038 | Bacteria | 1124 |
| 132 | Ga0075368_10088341 | 3300006042 | Bacteria | 1266 |
| 133 | Ga0075363_100129012 | 3300006048 | Bacteria | 1417 |
| 134 | Ga0075363_100272121 | 3300006048 | Bacteria | 978 |
| 135 | Ga0075364_10013563 | 3300006051 | Bacteria | 5014 |
| 136 | Ga0075364_10096538 | 3300006051 | Bacteria | 1965 |
| 137 | Ga0075364_10326887 | 3300006051 | Bacteria | 1044 |
| 138 | Ga0075367_10021014 | 3300006178 | Bacteria | 3643 |
| 139 | Ga0075369_10007134 | 3300006186 | Bacteria | 4247 |
| 140 | Ga0075369_10035944 | 3300006186 | Bacteria | 2106 |
| 141 | Ga0075366_10003448 | 3300006195 | Bacteria | 8344 |
| 142 | Ga0075366_10151175 | 3300006195 | Bacteria | 1406 |
| 143 | Ga0075370_10003108 | 3300006353 | Bacteria | 7837 |
| 144 | Ga0075370_10070369 | 3300006353 | Bacteria | 2001 |
| 145 | Ga0068865_100362889 | 3300006881 | Bacteria | 1177 |
| 146 | Ga0068865_100577500 | 3300006881 | Bacteria | 947 |
| 147 | Ga0079104_1001270 | 3300006946 | Bacteria | 17502 |
| 148 | Ga0079104_1024320 | 3300006946 | Bacteria | 1596 |
| 149 | Ga0099826_10000181 | 3300006948 | Bacteria | 26466 |
| 150 | Ga0099826_10035342 | 3300006948 | Bacteria | 3556 |
| 151 | Ga0105251_10030323 | 3300009011 | Bacteria | 2717 |
| 152 | Ga0105251_10055843 | 3300009011 | Bacteria | 1871 |
| 153 | Ga0105244_10001340 | 3300009036 | Bacteria | 20097 |
| 154 | Ga0105244_10001791 | 3300009036 | Bacteria | 16834 |
| 155 | Ga0105244_10014154 | 3300009036 | Bacteria | 4625 |
| 156 | Ga0105244_10122047 | 3300009036 | Bacteria | 1261 |
| 157 | Ga0105250_10004385 | 3300009092 | Bacteria | 6501 |
| 158 | Ga0105240_10000217 | 3300009093 | Bacteria | 115649 |
| 159 | Ga0105240_10330935 | 3300009093 | Bacteria | 1733 |
| 160 | Ga0105240_10542647 | 3300009093 | Bacteria | 1287 |
| 161 | Ga0111539_10000123 | 3300009094 | Bacteria | 87000 |
| 162 | Ga0105245_10346920 | 3300009098 | Bacteria | 1470 |
| 163 | Ga0105245_10601596 | 3300009098 | Bacteria | 1126 |
| 164 | Ga0105245_10933278 | 3300009098 | Bacteria | 910 |
| 165 | Ga0105243_10032808 | 3300009148 | Bacteria | 4014 |
| 166 | Ga0105243_10293898 | 3300009148 | Bacteria | 1469 |
| 167 | Ga0105243_10410444 | 3300009148 | Bacteria | 1260 |
| 168 | Ga0105241_10032823 | 3300009174 | Bacteria | 3895 |
| 169 | Ga0105241_10560250 | 3300009174 | Bacteria | 1027 |
| 170 | Ga0105248_10046083 | 3300009177 | Bacteria | 4887 |
| 171 | Ga0105248_10736661 | 3300009177 | Bacteria | 1112 |
| 172 | Ga0105237_10001458 | 3300009545 | Bacteria | 31192 |
| 173 | Ga0105237_10023149 | 3300009545 | Bacteria | 6369 |
| 174 | Ga0105237_10283541 | 3300009545 | Bacteria | 1659 |
| 175 | Ga0105238_10014472 | 3300009551 | Bacteria | 7979 |
| 176 | Ga0105238_10377350 | 3300009551 | Bacteria | 1409 |
| 177 | Ga0105238_10823791 | 3300009551 | Bacteria | 944 |
| 178 | Ga0105249_10239161 | 3300009553 | Bacteria | 1794 |
| 179 | Ga0105249_10353592 | 3300009553 | Bacteria | 1489 |
| 180 | Ga0123341_1000109 | 3300009765 | Bacteria | 36496 |
| 181 | Ga0123342_1014735 | 3300009766 | Bacteria | 7361 |
| 182 | Ga0105239_10001164 | 3300010375 | Bacteria | 36154 |
| 183 | Ga0105239_10078102 | 3300010375 | Bacteria | 3643 |
| 184 | Ga0105239_10230990 | 3300010375 | Bacteria | 2075 |
| 185 | Ga0105239_10440443 | 3300010375 | Bacteria | 1477 |
| 186 | Ga0105239_10475843 | 3300010375 | Bacteria | 1419 |
| 187 | Ga0105246_10010396 | 3300011119 | Bacteria | 5757 |
| 188 | Ga0105246_10097688 | 3300011119 | Bacteria | 2132 |
| 189 | Ga0157373_10004331 | 3300013100 | Bacteria | 10686 |
| 190 | Ga0157373_10030840 | 3300013100 | Bacteria | 3858 |
| 191 | Ga0157373_10240529 | 3300013100 | Bacteria | 1280 |
| 192 | Ga0157371_10000002 | 3300013102 | Bacteria | 665040 |
| 193 | Ga0157371_10001454 | 3300013102 | Bacteria | 24558 |
| 194 | Ga0157370_10001439 | 3300013104 | Bacteria | 29445 |
| 195 | Ga0157370_10001923 | 3300013104 | Bacteria | 25548 |
| 196 | Ga0157369_10107178 | 3300013105 | Bacteria | 2973 |
| 197 | Ga0171463_1007 | 3300013249 | Bacteria | 301198 |
| 198 | Ga0157374_10469475 | 3300013296 | Bacteria | 1261 |
| 199 | Ga0182008_10100750 | 3300014497 | Bacteria | 1427 |
| 200 | Ga0182007_10000324 | 3300015262 | Bacteria | 30329 |
| 201 | Ga0182005_1001504 | 3300015265 | Bacteria | 9294 |
| 202 | Ga0183363_1153 | 3300015690 | Bacteria | 17205 |
| 203 | Ga0214544_1000010 | 3300021320 | Bacteria | 270164 |
| 204 | Ga0214542_1000023 | 3300021321 | Bacteria | 191557 |
| 205 | Ga0214542_1018351 | 3300021321 | Bacteria | 5949 |
| 206 | Ga0214543_1000019 | 3300021327 | Bacteria | 267908 |
| 207 | Ga0214543_1001578 | 3300021327 | Bacteria | 44277 |
| 208 | Ga0213872_10002824 | 3300021361 | Bacteria | 9940 |
| 209 | Ga0213872_10009103 | 3300021361 | Bacteria | 4773 |
| 210 | Ga0228711_1000017 | 3300022739 | Bacteria | 121084 |
| 211 | Ga0228710_1000005 | 3300022740 | Bacteria | 233531 |
| 212 | Ga0209435_100006 | 3300025206 | Bacteria | 542459 |
| 213 | Ga0209760_100051 | 3300025207 | Bacteria | 105257 |
| 214 | Ga0209436_101959 | 3300025208 | Bacteria | 6600 |
| 215 | Ga0209436_109923 | 3300025208 | Bacteria | 1775 |
| 216 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 217 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 218 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 219 | Ga0209563_100002 | 3300025230 | Bacteria | 2045675 |
| 220 | Ga0207427_100020 | 3300025231 | Bacteria | 507515 |
| 221 | Ga0209437_100001 | 3300025233 | Bacteria | 2045675 |
| 222 | Ga0209437_100042 | 3300025233 | Bacteria | 444095 |
| 223 | Ga0209437_100062 | 3300025233 | Bacteria | 336900 |
| 224 | Ga0207425_1000065 | 3300025245 | Bacteria | 127264 |
| 225 | Ga0207425_1008594 | 3300025245 | Bacteria | 2599 |
| 226 | Ga0207425_1009532 | 3300025245 | Bacteria | 2408 |
| 227 | Ga0209646_1000015 | 3300025246 | Bacteria | 542459 |
| 228 | Ga0209646_1003792 | 3300025246 | Bacteria | 2894 |
| 229 | Ga0209026_1000046 | 3300025250 | Bacteria | 262031 |
| 230 | Ga0209026_1000050 | 3300025250 | Bacteria | 254994 |
| 231 | Ga0209677_100002 | 3300025253 | Bacteria | 2045675 |
| 232 | Ga0209677_100429 | 3300025253 | Bacteria | 24814 |
| 233 | Ga0209148_1000050 | 3300025254 | Bacteria | 413178 |
| 234 | Ga0209759_1000005 | 3300025256 | Bacteria | 542459 |
| 235 | Ga0209759_1000229 | 3300025256 | Bacteria | 83575 |
| 236 | Ga0209129_1000019 | 3300025258 | Bacteria | 460802 |
| 237 | Ga0209129_1000132 | 3300025258 | Bacteria | 127262 |
| 238 | Ga0209129_1001521 | 3300025258 | Bacteria | 12809 |
| 239 | Ga0209129_1002872 | 3300025258 | Bacteria | 7945 |
| 240 | Ga0209129_1004004 | 3300025258 | Bacteria | 6048 |
| 241 | Ga0209129_1006071 | 3300025258 | Bacteria | 4038 |
| 242 | Ga0209129_1010911 | 3300025258 | Bacteria | 2218 |
| 243 | Ga0209233_1000034 | 3300025261 | Bacteria | 578898 |
| 244 | Ga0209233_1000082 | 3300025261 | Bacteria | 336320 |
| 245 | Ga0209233_1000103 | 3300025261 | Bacteria | 284123 |
| 246 | Ga0209233_1000288 | 3300025261 | Bacteria | 66882 |
| 247 | Ga0209233_1005432 | 3300025261 | Bacteria | 4229 |
| 248 | Ga0209455_1000507 | 3300025272 | Bacteria | 27901 |
| 249 | Ga0209673_1000023 | 3300025273 | Bacteria | 411385 |
| 250 | Ga0209673_1000132 | 3300025273 | Bacteria | 162349 |
| 251 | Ga0209673_1001968 | 3300025273 | Bacteria | 16055 |
| 252 | Ga0209673_1002729 | 3300025273 | Bacteria | 11649 |
| 253 | Ga0209673_1002876 | 3300025273 | Bacteria | 10948 |
| 254 | Ga0209673_1003829 | 3300025273 | Bacteria | 8509 |
| 255 | Ga0209130_1000001 | 3300025284 | Bacteria | 831557 |
| 256 | Ga0209130_1000017 | 3300025284 | Bacteria | 388431 |
| 257 | Ga0209130_1000048 | 3300025284 | Bacteria | 233357 |
| 258 | Ga0209130_1001748 | 3300025284 | Bacteria | 12937 |
| 259 | Ga0209130_1010463 | 3300025284 | Bacteria | 2552 |
| 260 | Ga0209130_1015688 | 3300025284 | Bacteria | 1857 |
| 261 | Ga0209676_1021257 | 3300025292 | Bacteria | 2183 |
| 262 | Ga0209025_1000072 | 3300025294 | Bacteria | 283452 |
| 263 | Ga0209025_1000077 | 3300025294 | Bacteria | 271958 |
| 264 | Ga0209025_1000153 | 3300025294 | Bacteria | 170548 |
| 265 | Ga0209025_1000247 | 3300025294 | Bacteria | 127264 |
| 266 | Ga0209025_1000666 | 3300025294 | Bacteria | 59408 |
| 267 | Ga0209025_1002519 | 3300025294 | Bacteria | 19180 |
| 268 | Ga0209025_1005892 | 3300025294 | Bacteria | 9796 |
| 269 | Ga0209025_1019188 | 3300025294 | Bacteria | 3817 |
| 270 | Ga0209025_1019195 | 3300025294 | Bacteria | 3816 |
| 271 | Ga0209025_1049715 | 3300025294 | Bacteria | 1683 |
| 272 | Ga0209564_1000100 | 3300025295 | Bacteria | 224016 |
| 273 | Ga0209564_1000372 | 3300025295 | Bacteria | 83053 |
| 274 | Ga0209564_1001437 | 3300025295 | Bacteria | 24420 |
| 275 | Ga0209564_1002441 | 3300025295 | Bacteria | 14707 |
| 276 | Ga0209564_1011402 | 3300025295 | Bacteria | 3987 |
| 277 | Ga0209564_1034239 | 3300025295 | Bacteria | 1493 |
| 278 | Ga0209758_1000053 | 3300025297 | Bacteria | 337751 |
| 279 | Ga0209758_1000212 | 3300025297 | Bacteria | 127597 |
| 280 | Ga0209758_1000239 | 3300025297 | Bacteria | 114761 |
| 281 | Ga0209758_1000712 | 3300025297 | Bacteria | 49095 |
| 282 | Ga0209758_1002011 | 3300025297 | Bacteria | 21870 |
| 283 | Ga0209758_1002735 | 3300025297 | Bacteria | 17345 |
| 284 | Ga0209758_1004308 | 3300025297 | Bacteria | 11994 |
| 285 | Ga0209758_1005005 | 3300025297 | Bacteria | 10575 |
| 286 | Ga0209758_1014984 | 3300025297 | Bacteria | 4056 |
| 287 | Ga0209758_1022928 | 3300025297 | Bacteria | 2841 |
| 288 | Ga0209758_1030212 | 3300025297 | Bacteria | 2249 |
| 289 | Ga0209758_1034485 | 3300025297 | Bacteria | 2011 |
| 290 | Ga0209758_1049788 | 3300025297 | Bacteria | 1475 |
| 291 | Ga0209050_1002669 | 3300025298 | Bacteria | 14559 |
| 292 | Ga0209050_1006906 | 3300025298 | Bacteria | 6569 |
| 293 | Ga0209050_1009761 | 3300025298 | Bacteria | 4848 |
| 294 | Ga0209256_1000401 | 3300025299 | Bacteria | 68618 |
| 295 | Ga0209256_1000458 | 3300025299 | Bacteria | 61611 |
| 296 | Ga0209256_1000735 | 3300025299 | Bacteria | 43205 |
| 297 | Ga0209256_1000818 | 3300025299 | Bacteria | 39749 |
| 298 | Ga0209256_1002923 | 3300025299 | Bacteria | 12843 |
| 299 | Ga0209256_1003989 | 3300025299 | Bacteria | 9683 |
| 300 | Ga0207426_1000005 | 3300025302 | Bacteria | 1037188 |
| 301 | Ga0207426_1000006 | 3300025302 | Bacteria | 1025969 |
| 302 | Ga0207426_1000035 | 3300025302 | Bacteria | 448327 |
| 303 | Ga0207426_1000136 | 3300025302 | Bacteria | 201401 |
| 304 | Ga0207426_1000141 | 3300025302 | Bacteria | 194453 |
| 305 | Ga0207426_1028627 | 3300025302 | Bacteria | 1845 |
| 306 | Ga0209051_1000062 | 3300025303 | Bacteria | 251081 |
| 307 | Ga0209051_1003152 | 3300025303 | Bacteria | 11077 |
| 308 | Ga0209051_1005006 | 3300025303 | Bacteria | 7897 |
| 309 | Ga0209051_1035479 | 3300025303 | Bacteria | 1855 |
| 310 | Ga0209257_1001119 | 3300025304 | Bacteria | 34613 |
| 311 | Ga0209257_1010746 | 3300025304 | Bacteria | 4556 |
| 312 | Ga0207696_1000076 | 3300025711 | Bacteria | 210418 |
| 313 | Ga0207696_1000396 | 3300025711 | Bacteria | 40779 |
| 314 | Ga0207655_1000413 | 3300025728 | Bacteria | 58877 |
| 315 | Ga0207655_1014385 | 3300025728 | Bacteria | 4475 |
| 316 | Ga0207655_1071084 | 3300025728 | Bacteria | 1293 |
| 317 | Ga0207713_1038463 | 3300025735 | Bacteria | 2029 |
| 318 | Ga0207680_10246153 | 3300025903 | Bacteria | 1234 |
| 319 | Ga0207647_10081824 | 3300025904 | Bacteria | 1934 |
| 320 | Ga0207645_10056949 | 3300025907 | Bacteria | 2495 |
| 321 | Ga0207695_10000613 | 3300025913 | Bacteria | 71568 |
| 322 | Ga0207695_10011879 | 3300025913 | Bacteria | 10494 |
| 323 | Ga0207671_10001160 | 3300025914 | Bacteria | 31428 |
| 324 | Ga0207671_10088960 | 3300025914 | Bacteria | 2324 |
| 325 | Ga0207657_10054577 | 3300025919 | Bacteria | 3455 |
| 326 | Ga0207646_10047164 | 3300025922 | Bacteria | 3865 |
| 327 | Ga0207694_10032771 | 3300025924 | Bacteria | 3978 |
| 328 | Ga0207650_10001289 | 3300025925 | Bacteria | 18184 |
| 329 | Ga0207700_10206085 | 3300025928 | Bacteria | 1660 |
| 330 | Ga0207709_10036345 | 3300025935 | Bacteria | 2919 |
| 331 | Ga0207669_10006701 | 3300025937 | Bacteria | 5282 |
| 332 | Ga0207704_10346230 | 3300025938 | Bacteria | 1155 |
| 333 | Ga0207691_10187455 | 3300025940 | Bacteria | 1805 |
| 334 | Ga0207711_10334835 | 3300025941 | Bacteria | 1400 |
| 335 | Ga0207712_10181007 | 3300025961 | Bacteria | 1655 |
| 336 | Ga0207668_10106081 | 3300025972 | Bacteria | 2098 |
| 337 | Ga0207668_10510421 | 3300025972 | Bacteria | 1036 |
| 338 | Ga0207678_10159191 | 3300026067 | Bacteria | 1928 |
| 339 | Ga0207708_10110635 | 3300026075 | Bacteria | 2132 |
| 340 | Ga0207702_10014348 | 3300026078 | Bacteria | 6578 |
| 341 | Ga0207702_10487839 | 3300026078 | Bacteria | 1200 |
| 342 | Ga0207648_10236538 | 3300026089 | Bacteria | 1626 |
| 343 | Ga0207648_10613942 | 3300026089 | Bacteria | 1003 |
| 344 | Ga0207674_10432554 | 3300026116 | Bacteria | 1272 |
| 345 | Ga0207675_100026208 | 3300026118 | Bacteria | 5427 |
| 346 | Ga0207675_100122019 | 3300026118 | Bacteria | 2466 |
| 347 | Ga0207683_10039107 | 3300026121 | Bacteria | 4138 |
| 348 | Ga0207683_10198925 | 3300026121 | Bacteria | 1821 |
| 349 | Ga0207698_10084832 | 3300026142 | Bacteria | 2569 |
| 350 | Ga0209281_1000082 | 3300027111 | Bacteria | 257684 |
| 351 | Ga0209281_1001229 | 3300027111 | Bacteria | 17082 |
| 352 | Ga0209371_1004328 | 3300027312 | Bacteria | 6261 |
| 353 | Ga0209371_1004561 | 3300027312 | Bacteria | 5941 |
| 354 | Ga0209371_1004841 | 3300027312 | Bacteria | 5645 |
| 355 | Ga0209282_1000006 | 3300027666 | Bacteria | 276998 |
| 356 | Ga0209282_1000176 | 3300027666 | Bacteria | 35300 |
| 357 | Ga0209282_1036197 | 3300027666 | Bacteria | 2982 |
| 358 | Ga0207428_10000133 | 3300027907 | Bacteria | 100902 |
| 359 | Ga0268266_10005342 | 3300028379 | Bacteria | 12018 |
| 360 | Ga0268266_10127196 | 3300028379 | Bacteria | 2275 |
| 361 | Ga0268266_10190337 | 3300028379 | Bacteria | 1873 |
| 362 | Ga0268266_10198257 | 3300028379 | Bacteria | 1836 |
| 363 | Ga0268266_10240919 | 3300028379 | Bacteria | 1669 |
| 364 | Ga0268266_10361384 | 3300028379 | Bacteria | 1366 |
| 365 | Ga0268265_10171350 | 3300028380 | Bacteria | 1855 |
| 366 | Ga0268265_10392935 | 3300028380 | Bacteria | 1280 |
| 367 | Ga0307517_10207732 | 3300028786 | Bacteria | 1212 |
| 368 | Ga0307515_10002150 | 3300028794 | Bacteria | 43260 |
| 369 | Ga0307515_10033865 | 3300028794 | Bacteria | 8393 |
| 370 | Ga0307515_10168799 | 3300028794 | Bacteria | 2192 |
| 371 | Ga0268256_1003641 | 3300030500 | Bacteria | 6841 |
| 372 | Ga0268256_1003966 | 3300030500 | Bacteria | 6378 |
| 373 | Ga0268256_1004619 | 3300030500 | Bacteria | 5645 |
| 374 | Ga0268256_1015885 | 3300030500 | Bacteria | 2178 |
| 375 | Ga0316181_1067070 | 3300030744 | Bacteria | 2047 |
| 376 | Ga0265330_10046801 | 3300031235 | Bacteria | 1905 |
| 377 | Ga0307513_10000463 | 3300031456 | Bacteria | 58389 |
| 378 | Ga0307513_10028096 | 3300031456 | Bacteria | 6441 |
| 379 | Ga0307513_10166943 | 3300031456 | Bacteria | 2084 |
| 380 | Ga0307513_10185890 | 3300031456 | Bacteria | 1935 |
| 381 | Ga0307513_10355592 | 3300031456 | Bacteria | 1211 |
| 382 | Ga0307508_10081823 | 3300031616 | Bacteria | 2810 |
| 383 | Ga0307508_10210604 | 3300031616 | Bacteria | 1544 |
| 384 | Ga0307508_10335188 | 3300031616 | Bacteria | 1104 |
| 385 | Ga0265314_10018857 | 3300031711 | Bacteria | 5359 |
| 386 | Ga0307413_10050395 | 3300031824 | Bacteria | 2501 |
| 387 | Ga0307410_10203197 | 3300031852 | Bacteria | 1514 |
| 388 | Ga0307412_10019356 | 3300031911 | Bacteria | 4120 |
| 389 | Ga0307412_10286358 | 3300031911 | Bacteria | 1296 |
| 390 | Ga0315914_1000003 | 3300031967 | Bacteria | 314370 |
| 391 | Ga0307409_100033770 | 3300031995 | Bacteria | 3727 |
| 392 | Ga0307409_100116671 | 3300031995 | Bacteria | 2251 |
| 393 | Ga0307409_100653424 | 3300031995 | Bacteria | 1046 |
| 394 | Ga0307416_100202641 | 3300032002 | Bacteria | 1884 |
| 395 | Ga0307414_10365263 | 3300032004 | Bacteria | 1243 |
| 396 | Ga0307411_10060082 | 3300032005 | Bacteria | 2522 |
| 397 | Ga0315913_1000001 | 3300033430 | Bacteria | 284459 |
| 398 | Ga0315915_1000008 | 3300033464 | Bacteria | 258517 |
| 399 | Ga0373927_0000266 | 3300035695 | Bacteria | 41356 |
| 400 | Ga0373947_0133152 | 3300035725 | Bacteria | 1589 |
| 401 | Ga0373937_0593115 | 3300036401 | Bacteria | 1052 |
| 402 | Ga0373925_0001672 | 3300037068 | Bacteria | 18664 |
| 403 | Ga0373925_0060324 | 3300037068 | Bacteria | 2849 |
| 404 | Ga0395900_0018190 | 3300037418 | Bacteria | 7169 |
| 405 | Ga0395905_0002837 | 3300037471 | Bacteria | 18981 |
| 406 | Ga0395905_0003927 | 3300037471 | Bacteria | 15643 |
| 407 | Ga0395905_0048313 | 3300037471 | Bacteria | 3988 |
| 408 | Ga0395905_0093038 | 3300037471 | Bacteria | 2827 |
| 409 | Ga0395905_0122973 | 3300037471 | Bacteria | 2440 |
| 410 | Ga0395901_0108026 | 3300038443 | Bacteria | 2921 |
| 411 | Ga0395901_0116451 | 3300038443 | Bacteria | 2807 |
| 412 | Ga0400483_065417 | 3300039062 | Bacteria | 3409 |
| 413 | Ga0436365_0671760 | 3300039437 | Bacteria | 1347 |
| 414 | Ga0436361_0027550 | 3300039447 | Bacteria | 11259 |
| 415 | Ga0436361_0034602 | 3300039447 | Bacteria | 1517 |
| 416 | Ga0436361_0137889 | 3300039447 | Bacteria | 2935 |
| 417 | Ga0436361_0570105 | 3300039447 | Bacteria | 9679 |
| 418 | Ga0436363_0274728 | 3300039450 | Bacteria | 6466 |
| 419 | Ga0436363_1315970 | 3300039450 | Bacteria | 3880 |
| 420 | Ga0439436_0000195 | 3300041404 | Bacteria | 14462 |
| 421 | Ga0439447_048680 | 3300041407 | Bacteria | 1017 |
| 422 | Ga0439465_0075847 | 3300041413 | Bacteria | 1133 |
| 423 | Ga0439465_0142491 | 3300041413 | Bacteria | 852 |
| 424 | Ga0451835_0331121 | 3300041492 | Bacteria | 1390 |
| 425 | Ga0451839_0268492 | 3300041496 | Bacteria | 1451 |
| 426 | Ga0451845_0189427 | 3300041501 | Bacteria | 2701 |
| 427 | Ga0451847_0010441 | 3300041503 | Bacteria | 1131 |
| 428 | Ga0451843_0065299 | 3300041509 | Bacteria | 1037 |
| 429 | Ga0451853_2758235 | 3300041512 | Bacteria | 1143 |
| 430 | Ga0439449_0017545 | 3300042007 | Bacteria | 2688 |
| 431 | Ga0439455_0022511 | 3300042012 | Bacteria | 1511 |
| 432 | Ga0439462_0027122 | 3300042015 | Bacteria | 1511 |
| 433 | Ga0439462_0042290 | 3300042015 | Bacteria | 1217 |
| 434 | Ga0450906_029307 | 3300042145 | Bacteria | 973 |
| 435 | Ga0466972_0046222 | 3300044658 | Bacteria | 2108 |
| 436 | Ga0466972_0084169 | 3300044658 | Bacteria | 1512 |
| 437 | Ga0466970_0169294 | 3300044765 | Bacteria | 1210 |
| 438 | Ga0466960_0168679 | 3300044901 | Bacteria | 1180 |
| 439 | Ga0466959_0052281 | 3300045049 | Bacteria | 2993 |
| 440 | Ga0495592_0075679 | 3300046454 | Bacteria | 2444 |
| 441 | Ga0495591_000803 | 3300046458 | Bacteria | 22249 |
| 442 | Ga0495629_0040880 | 3300046459 | Bacteria | 3262 |
| 443 | Ga0495638_0123397 | 3300046460 | Bacteria | 1528 |
| 444 | Ga0495638_0210983 | 3300046460 | Bacteria | 1091 |
| 445 | Ga0495650_0000043 | 3300046471 | Bacteria | 357197 |
| 446 | Ga0495650_0000113 | 3300046471 | Bacteria | 196536 |
| 447 | Ga0495605_0099869 | 3300046474 | Bacteria | 1335 |
| 448 | Ga0495639_0081012 | 3300046475 | Bacteria | 1512 |
| 449 | Ga0495662_0007616 | 3300046476 | Bacteria | 5343 |
| 450 | Ga0495584_0002744 | 3300046491 | Bacteria | 9858 |
| 451 | Ga0495585_0140841 | 3300046492 | Bacteria | 1263 |
| 452 | Ga0495606_0000374 | 3300046507 | Bacteria | 76132 |
| 453 | Ga0495606_0001618 | 3300046507 | Bacteria | 29389 |
| 454 | Ga0495606_0023645 | 3300046507 | Bacteria | 4446 |
| 455 | Ga0495610_0009644 | 3300046512 | Bacteria | 6081 |
| 456 | Ga0495616_0116708 | 3300046513 | Bacteria | 1235 |
| 457 | Ga0495620_0107319 | 3300046515 | Bacteria | 1109 |
| 458 | Ga0495631_0036456 | 3300046518 | Bacteria | 2196 |
| 459 | Ga0495631_0077215 | 3300046518 | Bacteria | 1437 |
| 460 | Ga0495632_0086599 | 3300046519 | Bacteria | 1490 |
| 461 | Ga0495643_0088441 | 3300046522 | Bacteria | 1601 |
| 462 | Ga0495644_0001112 | 3300046523 | Bacteria | 11067 |
| 463 | Ga0495648_0018790 | 3300046524 | Bacteria | 4878 |
| 464 | Ga0495654_0000124 | 3300046530 | Bacteria | 86154 |
| 465 | Ga0495654_0000694 | 3300046530 | Bacteria | 26403 |
| 466 | Ga0495587_0121886 | 3300046536 | Bacteria | 1493 |
| 467 | Ga0495622_0023211 | 3300046557 | Bacteria | 2892 |
| 468 | Ga0495633_0005760 | 3300046558 | Bacteria | 7486 |
| 469 | Ga0495656_0110939 | 3300046615 | Bacteria | 1283 |
| 470 | Ga0495668_0196902 | 3300046616 | Bacteria | 1103 |
| 471 | Ga0495625_0082577 | 3300046660 | Bacteria | 2234 |
| 472 | Ga0495625_0105065 | 3300046660 | Bacteria | 1935 |
| 473 | Ga0495625_0110977 | 3300046660 | Bacteria | 1874 |
| 474 | Ga0495625_0371288 | 3300046660 | Bacteria | 900 |
| 475 | Ga0495588_0073614 | 3300046674 | Bacteria | 1779 |
| 476 | Ga0495657_0149954 | 3300046675 | Bacteria | 1448 |
| 477 | Ga0495649_0158143 | 3300046694 | Bacteria | 1189 |
| 478 | Ga0495589_0039901 | 3300046794 | Bacteria | 2345 |
| 479 | Ga0495660_0000012 | 3300046810 | Bacteria | 350701 |
| 480 | Ga0495660_0000034 | 3300046810 | Bacteria | 201261 |
| 481 | Ga0495660_0051547 | 3300046810 | Bacteria | 2239 |
| 482 | Ga0495604_0021553 | 3300047317 | Bacteria | 5143 |
| 483 | Ga0495674_0451548 | 3300047319 | Bacteria | 1033 |
| 484 | Ga0495672_0000029 | 3300047320 | Bacteria | 305231 |
| 485 | Ga0495673_0000092 | 3300047469 | Bacteria | 187963 |
| 486 | Ga0495681_0002695 | 3300047470 | Bacteria | 12583 |
| 487 | Ga0495681_0061718 | 3300047470 | Bacteria | 1726 |
| 488 | Ga0495686_0000795 | 3300047472 | Bacteria | 41055 |
| 489 | Ga0495615_0040446 | 3300048090 | Bacteria | 1161 |
| 490 | Ga0496101_0000023 | 3300048904 | Bacteria | 209923 |
| 491 | Ga0496104_0131911 | 3300048907 | Bacteria | 2400 |
| 492 | Ga0496105_0294200 | 3300048908 | Bacteria | 1307 |
| 493 | Ga0496106_0351713 | 3300048909 | Bacteria | 1183 |
| 494 | Ga0496110_0283493 | 3300048913 | Bacteria | 1509 |
| 495 | Ga0496111_0123945 | 3300048914 | Bacteria | 1910 |
| 496 | Ga0496112_0028761 | 3300048915 | Bacteria | 5369 |
| 497 | Ga0496112_0047536 | 3300048915 | Bacteria | 4210 |
| 498 | Ga0496112_0622845 | 3300048915 | Bacteria | 1010 |
| 499 | Ga0496115_0100983 | 3300048918 | Bacteria | 2365 |
| 500 | Ga0496116_0000042 | 3300048919 | Bacteria | 330516 |
| 501 | Ga0496116_0000066 | 3300048919 | Bacteria | 264035 |
| 502 | Ga0496116_0005820 | 3300048919 | Bacteria | 11323 |
| 503 | Ga0496116_0007217 | 3300048919 | Bacteria | 9916 |
| 504 | Ga0496116_0009455 | 3300048919 | Bacteria | 8303 |
| 505 | Ga0496116_0019687 | 3300048919 | Bacteria | 5159 |
| 506 | Ga0496116_0120858 | 3300048919 | Bacteria | 1516 |
| 507 | Ga0496117_0000036 | 3300048920 | Bacteria | 325635 |
| 508 | Ga0496117_0013982 | 3300048920 | Bacteria | 6954 |
| 509 | Ga0496117_0019866 | 3300048920 | Bacteria | 5499 |
| 510 | Ga0496117_0026327 | 3300048920 | Bacteria | 4553 |
| 511 | Ga0496117_0070372 | 3300048920 | Bacteria | 2350 |
| 512 | Ga0496117_0160660 | 3300048920 | Bacteria | 1317 |
| 513 | Ga0496118_0012231 | 3300048921 | Bacteria | 8269 |
| 514 | Ga0496118_0015347 | 3300048921 | Bacteria | 7096 |
| 515 | Ga0496118_0022829 | 3300048921 | Bacteria | 5454 |
| 516 | Ga0496118_0041334 | 3300048921 | Bacteria | 3651 |
| 517 | Ga0496119_0004655 | 3300048922 | Bacteria | 13530 |
| 518 | Ga0496119_0010451 | 3300048922 | Bacteria | 7812 |
| 519 | Ga0496119_0011716 | 3300048922 | Bacteria | 7217 |
| 520 | Ga0496119_0015192 | 3300048922 | Bacteria | 5957 |
| 521 | Ga0496119_0016484 | 3300048922 | Bacteria | 5621 |
| 522 | Ga0496119_0028726 | 3300048922 | Bacteria | 3788 |
| 523 | Ga0496119_0045882 | 3300048922 | Bacteria | 2734 |
| 524 | Ga0496119_0058948 | 3300048922 | Bacteria | 2310 |
| 525 | Ga0496120_0000032 | 3300048923 | Bacteria | 220255 |
| 526 | Ga0496120_0000777 | 3300048923 | Bacteria | 46134 |
| 527 | Ga0496120_0001086 | 3300048923 | Bacteria | 35695 |
| 528 | Ga0496120_0001523 | 3300048923 | Bacteria | 27295 |
| 529 | Ga0496120_0001949 | 3300048923 | Bacteria | 22617 |
| 530 | Ga0496120_0008032 | 3300048923 | Bacteria | 7762 |
| 531 | Ga0496120_0008096 | 3300048923 | Bacteria | 7725 |
| 532 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 533 | Ga0496121_0000239 | 3300048924 | Bacteria | 118051 |
| 534 | Ga0496121_0002342 | 3300048924 | Bacteria | 29248 |
| 535 | Ga0496121_0018876 | 3300048924 | Bacteria | 6922 |
| 536 | Ga0496122_0000002 | 3300048925 | Bacteria | 905834 |
| 537 | Ga0496122_0000072 | 3300048925 | Bacteria | 222436 |
| 538 | Ga0496122_0000110 | 3300048925 | Bacteria | 190142 |
| 539 | Ga0496122_0006562 | 3300048925 | Bacteria | 13298 |
| 540 | Ga0496122_0022649 | 3300048925 | Bacteria | 5575 |
| 541 | Ga0496122_0024700 | 3300048925 | Bacteria | 5250 |
| 542 | Ga0496122_0038214 | 3300048925 | Bacteria | 3850 |
| 543 | Ga0496122_0055595 | 3300048925 | Bacteria | 2959 |
| 544 | Ga0496122_0102534 | 3300048925 | Bacteria | 1907 |
| 545 | Ga0496123_0000002 | 3300048926 | Bacteria | 1811682 |
| 546 | Ga0496123_0000035 | 3300048926 | Bacteria | 267288 |
| 547 | Ga0496123_0000081 | 3300048926 | Bacteria | 190142 |
| 548 | Ga0496123_0019603 | 3300048926 | Bacteria | 5327 |
| 549 | Ga0496123_0131675 | 3300048926 | Bacteria | 1384 |
| 550 | Ga0496123_0169793 | 3300048926 | Bacteria | 1152 |
| 551 | Ga0496124_0000530 | 3300048927 | Bacteria | 65033 |
| 552 | Ga0496124_0003541 | 3300048927 | Bacteria | 18992 |
| 553 | Ga0496124_0010305 | 3300048927 | Bacteria | 9485 |
| 554 | Ga0496124_0015678 | 3300048927 | Bacteria | 7249 |
| 555 | Ga0496124_0018541 | 3300048927 | Bacteria | 6514 |
| 556 | Ga0496124_0034006 | 3300048927 | Bacteria | 4479 |
| 557 | Ga0496124_0236713 | 3300048927 | Bacteria | 1361 |
| 558 | Ga0496124_0265687 | 3300048927 | Bacteria | 1260 |
| 559 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 560 | Ga0496125_0000033 | 3300048928 | Bacteria | 351850 |
| 561 | Ga0496125_0032307 | 3300048928 | Bacteria | 4650 |
| 562 | Ga0496125_0106619 | 3300048928 | Bacteria | 2044 |
| 563 | Ga0496126_0000053 | 3300048929 | Bacteria | 311989 |
| 564 | Ga0496126_0001066 | 3300048929 | Bacteria | 46225 |
| 565 | Ga0496126_0048035 | 3300048929 | Bacteria | 3905 |
| 566 | Ga0496126_0050721 | 3300048929 | Bacteria | 3781 |
| 567 | Ga0496126_0061199 | 3300048929 | Bacteria | 3382 |
| 568 | Ga0496126_0082583 | 3300048929 | Bacteria | 2838 |
| 569 | Ga0496126_0186957 | 3300048929 | Bacteria | 1756 |
| 570 | Ga0496126_0241908 | 3300048929 | Bacteria | 1507 |
| 571 | Ga0496126_0342842 | 3300048929 | Bacteria | 1224 |
| 572 | Ga0495678_001299 | 3300049459 | Bacteria | 20174 |
| 573 | Ga0495678_036076 | 3300049459 | Bacteria | 2021 |
| 574 | Ga0495682_0000003 | 3300049460 | Bacteria | 515787 |
| 575 | Ga0501031_0182755 | 3300049568 | Bacteria | 1370 |
| 576 | Ga0501032_0256322 | 3300049569 | Bacteria | 1135 |
| 577 | Ga0501034_0001016 | 3300049571 | Bacteria | 40222 |
| 578 | Ga0501038_0097401 | 3300049574 | Bacteria | 2454 |
| 579 | Ga0501042_0062880 | 3300049578 | Bacteria | 2653 |
| 580 | Ga0501043_0159367 | 3300049579 | Bacteria | 1764 |
| 581 | Ga0501046_0129194 | 3300049580 | Bacteria | 1917 |
| 582 | Ga0501047_0015869 | 3300049581 | Bacteria | 7177 |
| 583 | Ga0501067_0081931 | 3300049583 | Bacteria | 1789 |
| 584 | Ga0501073_0001099 | 3300049589 | Bacteria | 19587 |
| 585 | Ga0501075_0334746 | 3300049591 | Bacteria | 1154 |
| 586 | Ga0501080_0022705 | 3300049742 | Bacteria | 5813 |
| 587 | Ga0501080_0043791 | 3300049742 | Bacteria | 4168 |
| 588 | Ga0501083_0019699 | 3300049744 | Bacteria | 4698 |
| 589 | Ga0501035_0112926 | 3300049822 | Bacteria | 2380 |
| 590 | Ga0501035_0448403 | 3300049822 | Bacteria | 1068 |
| 591 | Ga0501044_0007436 | 3300049823 | Bacteria | 12046 |
| 592 | Ga0501044_0017995 | 3300049823 | Bacteria | 7577 |
| 593 | Ga0501044_0019019 | 3300049823 | Bacteria | 7355 |
| 594 | Ga0501044_0063397 | 3300049823 | Bacteria | 3776 |
| 595 | nmdc:mga03n38_21958_c1 | 3300050490 | Bacteria | 2576 |
| 596 | nmdc:mga03n38_92522_c1 | 3300050490 | Bacteria | 1443 |
| 597 | nmdc:mga00v17_152240_c1 | 3300050491 | Bacteria | 1486 |
| 598 | nmdc:mga00v17_18899_c1 | 3300050491 | Bacteria | 3923 |
| 599 | nmdc:mga00v17_230_c1 | 3300050491 | Bacteria | 33351 |
| 600 | nmdc:mga00v17_24063_c1 | 3300050491 | Bacteria | 3528 |
| 601 | nmdc:mga00v17_24964_c1 | 3300050491 | Bacteria | 3469 |
| 602 | nmdc:mga0yw44_13281_c2 | 3300050492 | Bacteria | 3956 |
| 603 | nmdc:mga0yw44_184551_c1 | 3300050492 | Bacteria | 1374 |
| 604 | nmdc:mga0yw44_36719_c1 | 3300050492 | Bacteria | 2889 |
| 605 | nmdc:mga0yw44_53094_c1 | 3300050492 | Bacteria | 2460 |
| 606 | nmdc:mga06z11_243744_c1 | 3300050494 | Bacteria | 1056 |
| 607 | nmdc:mga06z11_67034_c1 | 3300050494 | Bacteria | 1889 |
| 608 | nmdc:mga04h51_76042_c1 | 3300050495 | Bacteria | 1183 |
| 609 | nmdc:mga07m45_31123_c1 | 3300050496 | Bacteria | 2956 |
| 610 | nmdc:mga07m45_50630_c1 | 3300050496 | Bacteria | 2341 |
| 611 | nmdc:mga07m45_65030_c1 | 3300050496 | Bacteria | 2070 |
| 612 | nmdc:mga05p37_305941_c1 | 3300050507 | Bacteria | 1886 |
| 613 | nmdc:mga08y16_44_c1 | 3300050511 | Bacteria | 121496 |
| 614 | nmdc:mga0sz30_107108_c1 | 3300050516 | Bacteria | 1223 |
| 615 | nmdc:mga0sz30_16417_c1 | 3300050516 | Bacteria | 2940 |
| 616 | nmdc:mga0sz30_6234_c1 | 3300050516 | Bacteria | 4422 |
| 617 | Ga0500610_0050322 | 3300053079 | Bacteria | 2168 |
| 618 | Ga0495619_0058978 | 3300053085 | Bacteria | 2549 |
| 619 | Ga0500578_0041834 | 3300053086 | Bacteria | 2942 |
| 620 | Ga0500646_0002763 | 3300053090 | Bacteria | 4529 |
| 621 | Ga0500651_0086229 | 3300053093 | Bacteria | 1940 |
| 622 | Ga0500641_0055833 | 3300053096 | Bacteria | 1635 |
| 623 | Ga0500555_026090 | 3300053103 | Bacteria | 1670 |
| 624 | Ga0500557_026116 | 3300053105 | Bacteria | 1725 |
| 625 | Ga0500594_0033298 | 3300053118 | Bacteria | 1370 |
| 626 | Ga0500595_006666 | 3300053119 | Bacteria | 4871 |
| 627 | Ga0500621_000006 | 3300053126 | Bacteria | 245480 |
| 628 | Ga0500642_0002981 | 3300053130 | Bacteria | 5046 |
| 629 | Ga0500658_0001819 | 3300053134 | Bacteria | 8407 |
| 630 | Ga0500561_0000110 | 3300053137 | Bacteria | 15825 |
| 631 | Ga0500568_0000109 | 3300053139 | Bacteria | 76714 |
| 632 | Ga0500568_0021697 | 3300053139 | Bacteria | 2759 |
| 633 | Ga0500573_0018384 | 3300053140 | Bacteria | 3985 |
| 634 | Ga0500588_0008069 | 3300053146 | Bacteria | 2446 |
| 635 | Ga0500588_0049259 | 3300053146 | Bacteria | 1306 |
| 636 | Ga0500588_0063539 | 3300053146 | Bacteria | 1190 |
| 637 | Ga0500590_000792 | 3300053148 | Bacteria | 11720 |
| 638 | Ga0500604_0002453 | 3300053151 | Bacteria | 5056 |
| 639 | Ga0500604_0014031 | 3300053151 | Bacteria | 2177 |
| 640 | Ga0500616_0001121 | 3300053153 | Bacteria | 27611 |
| 641 | Ga0500616_0002733 | 3300053153 | Bacteria | 14294 |
| 642 | Ga0500616_0035927 | 3300053153 | Bacteria | 2692 |
| 643 | Ga0500616_0039388 | 3300053153 | Bacteria | 2548 |
| 644 | Ga0500620_000841 | 3300053155 | Bacteria | 5328 |
| 645 | Ga0500622_0002690 | 3300053156 | Bacteria | 12594 |
| 646 | Ga0500624_000296 | 3300053157 | Bacteria | 17030 |
| 647 | Ga0500627_0098481 | 3300053158 | Bacteria | 1312 |
| 648 | Ga0500633_0085069 | 3300053160 | Bacteria | 1149 |
| 649 | Ga0500634_0000796 | 3300053161 | Bacteria | 11018 |
| 650 | Ga0500634_0010247 | 3300053161 | Bacteria | 4780 |
| 651 | Ga0500636_0000026 | 3300053177 | Bacteria | 84046 |
| 652 | Ga0500636_0000083 | 3300053177 | Bacteria | 47142 |
| 653 | Ga0500611_028575 | 3300053727 | Bacteria | 1133 |
| 654 | Ga0500609_000048 | 3300053731 | Bacteria | 15782 |
| 655 | Ga0500609_012055 | 3300053731 | Bacteria | 1169 |
| 656 | Ga0501084_0218865 | 3300054114 | Bacteria | 1607 |
| 657 | Ga0590071_004505 | 3300059421 | Bacteria | 3380 |
| 658 | Ga0590075_002537 | 3300059424 | Bacteria | 4364 |
| 659 | Ga0590077_010994 | 3300059426 | Bacteria | 1866 |
| 660 | Ga0501082_0116708 | 3300060353 | Bacteria | 2312 |
| 661 | Ga0501082_0131532 | 3300060353 | Bacteria | 2171 |
| 662 | Ga0530510_0214334 | 3300061734 | Bacteria | 1431 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026089 | Ga0207648_10613942 | Ga0207648_106139421 | 217 |
| 2 | iso_pu_bacteria | 2977898635 | 2977904808 | 219 |
| 3 | 3300021361 | Ga0213872_10009103 | Ga0213872_100091034 | 221 |
| 4 | 3300039447 | Ga0436361_0570105 | Ga0436361_0570105_3415_4239 | 221 |
| 5 | 3300039447 | Ga0436361_0137889 | Ga0436361_0137889_555_1370 | 224 |
| 6 | 3300046512 | Ga0495610_0009644 | Ga0495610_0009644_3413_4264 | 228 |
| 7 | iso_pu_bacteria | 2965110997 | 2965113533 | 228 |
| 8 | 3300039450 | Ga0436363_1315970 | Ga0436363_1315970_2809_3657 | 229 |
| 9 | 3300002987 | JGI25159J45721_1003115 | JGI25159J45721_10031152 | 233 |
| 10 | 3300005262 | Ga0065165_1047904 | Ga0065165_10479042 | 233 |
| 11 | 3300021361 | Ga0213872_10002824 | Ga0213872_100028245 | 233 |
| 12 | 3300025284 | Ga0209130_1001748 | Ga0209130_10017484 | 233 |
| 13 | 3300025302 | Ga0207426_1000141 | Ga0207426_10001414 | 233 |
| 14 | 3300039447 | Ga0436361_0027550 | Ga0436361_0027550_8075_8893 | 233 |
| 15 | 3300041407 | Ga0439447_048680 | Ga0439447_048680_119_970 | 233 |
| 16 | iso_pu_bacteria | 2958144490 | 2958150398 | 236 |
| 17 | 3300045049 | Ga0466959_0052281 | Ga0466959_0052281_414_1238 | 237 |
| 18 | 3300053155 | Ga0500620_000841 | Ga0500620_000841_1656_2504 | 237 |
| 19 | 3300005937 | Ga0081455_10124862 | Ga0081455_101248621 | 238 |
| 20 | 3300005983 | Ga0081540_1041947 | Ga0081540_10419472 | 238 |
| 21 | 3300003354 | JGI25160J50197_1000726 | JGI25160J50197_10007262 | 239 |
| 22 | 3300003771 | Ga0055526_1016818 | Ga0055526_10168183 | 239 |
| 23 | 3300026121 | Ga0207683_10039107 | Ga0207683_100391071 | 240 |
| 24 | 3300037471 | Ga0395905_0122973 | Ga0395905_0122973_496_1344 | 241 |
| 25 | 3300005548 | Ga0070665_100511960 | Ga0070665_1005119602 | 242 |
| 26 | 3300009545 | Ga0105237_10023149 | Ga0105237_100231493 | 242 |
| 27 | 3300009545 | Ga0105237_10283541 | Ga0105237_102835412 | 242 |
| 28 | 3300009551 | Ga0105238_10014472 | Ga0105238_100144722 | 242 |
| 29 | 3300010375 | Ga0105239_10078102 | Ga0105239_100781024 | 242 |
| 30 | 3300025284 | Ga0209130_1010463 | Ga0209130_10104633 | 242 |
| 31 | 3300025914 | Ga0207671_10088960 | Ga0207671_100889602 | 242 |
| 32 | 3300025924 | Ga0207694_10032771 | Ga0207694_100327714 | 242 |
| 33 | 3300048920 | Ga0496117_0160660 | Ga0496117_0160660_436_1284 | 242 |
| 34 | 3300048929 | Ga0496126_0048035 | Ga0496126_0048035_2179_3027 | 242 |
| 35 | 3300006946 | Ga0079104_1001270 | Ga0079104_10012707 | 243 |
| 36 | 3300006946 | Ga0079104_1024320 | Ga0079104_10243201 | 243 |
| 37 | 3300006948 | Ga0099826_10035342 | Ga0099826_100353422 | 243 |
| 38 | 3300021320 | Ga0214544_1000010 | Ga0214544_1000010196 | 243 |
| 39 | 3300021321 | Ga0214542_1000023 | Ga0214542_100002355 | 243 |
| 40 | 3300021321 | Ga0214542_1018351 | Ga0214542_10183515 | 243 |
| 41 | 3300021327 | Ga0214543_1000019 | Ga0214543_1000019130 | 243 |
| 42 | 3300021327 | Ga0214543_1001578 | Ga0214543_100157839 | 243 |
| 43 | 3300022739 | Ga0228711_1000017 | Ga0228711_100001719 | 243 |
| 44 | 3300022740 | Ga0228710_1000005 | Ga0228710_1000005234 | 243 |
| 45 | 3300025294 | Ga0209025_1000666 | Ga0209025_100066651 | 243 |
| 46 | 3300027111 | Ga0209281_1000082 | Ga0209281_1000082182 | 243 |
| 47 | 3300027111 | Ga0209281_1001229 | Ga0209281_10012296 | 243 |
| 48 | 3300027312 | Ga0209371_1004841 | Ga0209371_10048413 | 243 |
| 49 | 3300027666 | Ga0209282_1000006 | Ga0209282_1000006204 | 243 |
| 50 | 3300027666 | Ga0209282_1036197 | Ga0209282_10361973 | 243 |
| 51 | 3300030500 | Ga0268256_1003641 | Ga0268256_10036414 | 243 |
| 52 | 3300030500 | Ga0268256_1004619 | Ga0268256_10046193 | 243 |
| 53 | 3300031852 | Ga0307410_10203197 | Ga0307410_102031972 | 243 |
| 54 | 3300031967 | Ga0315914_1000003 | Ga0315914_1000003259 | 243 |
| 55 | 3300031995 | Ga0307409_100116671 | Ga0307409_1001166712 | 243 |
| 56 | 3300033430 | Ga0315913_1000001 | Ga0315913_1000001210 | 243 |
| 57 | 3300033464 | Ga0315915_1000008 | Ga0315915_100000877 | 243 |
| 58 | 3300035695 | Ga0373927_0000266 | Ga0373927_0000266_995_1828 | 243 |
| 59 | 3300037068 | Ga0373925_0001672 | Ga0373925_0001672_12449_13282 | 243 |
| 60 | 3300038443 | Ga0395901_0116451 | Ga0395901_0116451_334_1182 | 243 |
| 61 | 3300042007 | Ga0439449_0017545 | Ga0439449_0017545_1795_2628 | 243 |
| 62 | 3300048926 | Ga0496123_0131675 | Ga0496123_0131675_395_1225 | 243 |
| 63 | 3300005577 | Ga0068857_100169903 | Ga0068857_1001699032 | 244 |
| 64 | 3300005937 | Ga0081455_10035366 | Ga0081455_100353663 | 244 |
| 65 | 3300009174 | Ga0105241_10032823 | Ga0105241_100328232 | 244 |
| 66 | 3300025913 | Ga0207695_10011879 | Ga0207695_100118792 | 244 |
| 67 | 3300026116 | Ga0207674_10432554 | Ga0207674_104325542 | 244 |
| 68 | 3300026118 | Ga0207675_100122019 | Ga0207675_1001220192 | 244 |
| 69 | 3300044658 | Ga0466972_0084169 | Ga0466972_0084169_345_1193 | 244 |
| 70 | 3300046460 | Ga0495638_0210983 | Ga0495638_0210983_47_895 | 244 |
| 71 | 3300046515 | Ga0495620_0107319 | Ga0495620_0107319_167_1015 | 244 |
| 72 | 3300046522 | Ga0495643_0088441 | Ga0495643_0088441_710_1558 | 244 |
| 73 | 3300046660 | Ga0495625_0105065 | Ga0495625_0105065_324_1172 | 244 |
| 74 | 3300046694 | Ga0495649_0158143 | Ga0495649_0158143_186_1034 | 244 |
| 75 | 3300047470 | Ga0495681_0061718 | Ga0495681_0061718_697_1545 | 244 |
| 76 | 3300048929 | Ga0496126_0342842 | Ga0496126_0342842_166_1014 | 244 |
| 77 | 3300050516 | nmdc:mga0sz30_107108_c1 | nmdc:mga0sz30_107108_c1_102_950 | 244 |
| 78 | 3300053727 | Ga0500611_028575 | Ga0500611_028575_223_1071 | 244 |
| 79 | 3300005338 | Ga0068868_100250245 | Ga0068868_1002502452 | 245 |
| 80 | 3300009098 | Ga0105245_10601596 | Ga0105245_106015962 | 245 |
| 81 | 3300031995 | Ga0307409_100653424 | Ga0307409_1006534242 | 245 |
| 82 | 3300046507 | Ga0495606_0023645 | Ga0495606_0023645_3285_4118 | 245 |
| 83 | 3300048922 | Ga0496119_0015192 | Ga0496119_0015192_3862_4695 | 245 |
| 84 | 3300048925 | Ga0496122_0055595 | Ga0496122_0055595_1835_2668 | 245 |
| 85 | 3300048928 | Ga0496125_0106619 | Ga0496125_0106619_489_1322 | 245 |
| 86 | 3300050492 | nmdc:mga0yw44_13281_c2 | nmdc:mga0yw44_13281_c2_291_1139 | 245 |
| 87 | 3300053079 | Ga0500610_0050322 | Ga0500610_0050322_706_1554 | 245 |
| 88 | 3300002739 | JGI25158J39367_1000094 | JGI25158J39367_10000944 | 246 |
| 89 | 3300002773 | JGI25152J39213_1013083 | JGI25152J39213_10130831 | 246 |
| 90 | 3300002773 | JGI25152J39213_1015131 | JGI25152J39213_10151312 | 246 |
| 91 | 3300002773 | JGI25152J39213_1016662 | JGI25152J39213_10166622 | 246 |
| 92 | 3300002774 | JGI25150J39212_1006873 | JGI25150J39212_10068732 | 246 |
| 93 | 3300003215 | JGI25153J46596_10005550 | JGI25153J46596_100055505 | 246 |
| 94 | 3300003215 | JGI25153J46596_10037724 | JGI25153J46596_100377242 | 246 |
| 95 | 3300003215 | JGI25153J46596_10037747 | JGI25153J46596_100377472 | 246 |
| 96 | 3300003374 | JGI25161J50226_1001989 | JGI25161J50226_10019895 | 246 |
| 97 | 3300003771 | Ga0055526_1017729 | Ga0055526_10177291 | 246 |
| 98 | 3300003775 | Ga0055524_1014578 | Ga0055524_10145783 | 246 |
| 99 | 3300003790 | Ga0055528_1004148 | Ga0055528_10041485 | 246 |
| 100 | 3300003792 | Ga0055540_1005332 | Ga0055540_10053323 | 246 |
| 101 | 3300004625 | Ga0055543_1000021 | Ga0055543_100002157 | 246 |
| 102 | 3300005262 | Ga0065165_1008941 | Ga0065165_10089412 | 246 |
| 103 | 3300025208 | Ga0209436_101959 | Ga0209436_1019592 | 246 |
| 104 | 3300025245 | Ga0207425_1008594 | Ga0207425_10085942 | 246 |
| 105 | 3300025258 | Ga0209129_1001521 | Ga0209129_100152114 | 246 |
| 106 | 3300025258 | Ga0209129_1002872 | Ga0209129_10028723 | 246 |
| 107 | 3300025258 | Ga0209129_1004004 | Ga0209129_10040046 | 246 |
| 108 | 3300025273 | Ga0209673_1002729 | Ga0209673_10027299 | 246 |
| 109 | 3300025284 | Ga0209130_1000001 | Ga0209130_1000001213 | 246 |
| 110 | 3300025294 | Ga0209025_1002519 | Ga0209025_10025192 | 246 |
| 111 | 3300025295 | Ga0209564_1002441 | Ga0209564_10024419 | 246 |
| 112 | 3300025297 | Ga0209758_1000712 | Ga0209758_100071213 | 246 |
| 113 | 3300025297 | Ga0209758_1002735 | Ga0209758_100273517 | 246 |
| 114 | 3300025297 | Ga0209758_1004308 | Ga0209758_10043089 | 246 |
| 115 | 3300025299 | Ga0209256_1003989 | Ga0209256_10039899 | 246 |
| 116 | 3300025302 | Ga0207426_1000005 | Ga0207426_1000005818 | 246 |
| 117 | 3300041413 | Ga0439465_0075847 | Ga0439465_0075847_181_1011 | 246 |
| 118 | 3300041413 | Ga0439465_0142491 | Ga0439465_0142491_11_841 | 246 |
| 119 | 3300046810 | Ga0495660_0051547 | Ga0495660_0051547_1236_2030 | 246 |
| 120 | 3300048909 | Ga0496106_0351713 | Ga0496106_0351713_110_940 | 246 |
| 121 | 3300048922 | Ga0496119_0011716 | Ga0496119_0011716_5720_6568 | 246 |
| 122 | 3300048923 | Ga0496120_0001523 | Ga0496120_0001523_5790_6638 | 246 |
| 123 | 3300048926 | Ga0496123_0169793 | Ga0496123_0169793_258_1088 | 246 |
| 124 | 3300048927 | Ga0496124_0265687 | Ga0496124_0265687_207_1037 | 246 |
| 125 | 3300049459 | Ga0495678_036076 | Ga0495678_036076_133_927 | 246 |
| 126 | 3300053139 | Ga0500568_0000109 | Ga0500568_0000109_171_1001 | 246 |
| 127 | 3300053153 | Ga0500616_0039388 | Ga0500616_0039388_224_1018 | 246 |
| 128 | 3300060353 | Ga0501082_0116708 | Ga0501082_0116708_1287_2117 | 246 |
| 129 | 3300014497 | Ga0182008_10100750 | Ga0182008_101007501 | 248 |
| 130 | 3300026078 | Ga0207702_10487839 | Ga0207702_104878391 | 248 |
| 131 | 3300036401 | Ga0373937_0593115 | Ga0373937_0593115_171_974 | 248 |
| 132 | 3300006353 | Ga0075370_10070369 | Ga0075370_100703692 | 249 |
| 133 | 3300025297 | Ga0209758_1005005 | Ga0209758_10050058 | 249 |
| 134 | 3300025904 | Ga0207647_10081824 | Ga0207647_100818242 | 249 |
| 135 | 3300025907 | Ga0207645_10056949 | Ga0207645_100569492 | 249 |
| 136 | 3300025940 | Ga0207691_10187455 | Ga0207691_101874552 | 249 |
| 137 | 3300025972 | Ga0207668_10510421 | Ga0207668_105104211 | 249 |
| 138 | 3300026067 | Ga0207678_10159191 | Ga0207678_101591912 | 249 |
| 139 | 3300042012 | Ga0439455_0022511 | Ga0439455_0022511_318_1166 | 249 |
| 140 | 3300050494 | nmdc:mga06z11_243744_c1 | nmdc:mga06z11_243744_c1_32_862 | 249 |
| 141 | 3300049568 | Ga0501031_0182755 | Ga0501031_0182755_438_1289 | 250 |
| 142 | 3300049578 | Ga0501042_0062880 | Ga0501042_0062880_1188_2039 | 250 |
| 143 | 3300049591 | Ga0501075_0334746 | Ga0501075_0334746_175_1026 | 250 |
| 144 | 3300054114 | Ga0501084_0218865 | Ga0501084_0218865_179_1030 | 250 |
| 145 | 3300061734 | Ga0530510_0214334 | Ga0530510_0214334_189_1040 | 250 |
| 146 | 3300009174 | Ga0105241_10560250 | Ga0105241_105602502 | 251 |
| 147 | 3300046459 | Ga0495629_0040880 | Ga0495629_0040880_1223_2035 | 252 |
| 148 | 3300046475 | Ga0495639_0081012 | Ga0495639_0081012_437_1249 | 252 |
| 149 | 3300046536 | Ga0495587_0121886 | Ga0495587_0121886_192_1004 | 252 |
| 150 | 3300047319 | Ga0495674_0451548 | Ga0495674_0451548_13_825 | 252 |
| 151 | iso_pu_bacteria | 2508501050 | 2508733346 | 252 |
| 152 | iso_pu_bacteria | 2511231035 | 2511435636 | 252 |
| 153 | iso_pu_bacteria | 2599185156 | 2599334020 | 252 |
| 154 | iso_pu_bacteria | 2671180139 | 2671693577 | 252 |
| 155 | iso_pu_bacteria | 2773857925 | 2774872485 | 252 |
| 156 | iso_pu_bacteria | 2842922631 | 2842925700 | 252 |
| 157 | iso_pu_bacteria | 2876601092 | 2876604989 | 252 |
| 158 | iso_pu_bacteria | 2882456835 | 2882460008 | 252 |
| 159 | iso_pu_bacteria | 2894232714 | 2894236834 | 252 |
| 160 | iso_pu_bacteria | 2939602548 | 2939605381 | 252 |
| 161 | iso_pu_bacteria | 8016733728 | 8016738591 | 252 |
| 162 | iso_pu_bacteria | 8019499862 | 8019500238 | 252 |
| 163 | 3300048921 | Ga0496118_0012231 | Ga0496118_0012231_7399_8214 | 253 |
| 164 | iso_pu_bacteria | 2582581304 | 2585255305 | 253 |
| 165 | iso_pu_bacteria | 2908669403 | 2908673145 | 253 |
| 166 | 3300002704 | JGI25155J39150_1000015 | JGI25155J39150_100001545 | 254 |
| 167 | 3300002705 | JGI25156J39149_1000007 | JGI25156J39149_100000745 | 254 |
| 168 | 3300002737 | JGI25162J39368_1000119 | JGI25162J39368_100011949 | 254 |
| 169 | 3300002737 | JGI25162J39368_1000489 | JGI25162J39368_100048928 | 254 |
| 170 | 3300002738 | JGI25154J39366_1000145 | JGI25154J39366_100014545 | 254 |
| 171 | 3300002741 | JGI25157J39369_1000012 | JGI25157J39369_1000012156 | 254 |
| 172 | 3300002773 | JGI25152J39213_1002953 | JGI25152J39213_10029535 | 254 |
| 173 | 3300002774 | JGI25150J39212_1000103 | JGI25150J39212_100010336 | 254 |
| 174 | 3300002774 | JGI25150J39212_1014069 | JGI25150J39212_10140692 | 254 |
| 175 | 3300002987 | JGI25159J45721_1001078 | JGI25159J45721_100107810 | 254 |
| 176 | 3300003187 | JGI25151J46595_10000085 | JGI25151J46595_10000085111 | 254 |
| 177 | 3300003187 | JGI25151J46595_10014672 | JGI25151J46595_100146724 | 254 |
| 178 | 3300003214 | JGI25165J46597_1000211 | JGI25165J46597_100021149 | 254 |
| 179 | 3300003214 | JGI25165J46597_1001070 | JGI25165J46597_100107012 | 254 |
| 180 | 3300003214 | JGI25165J46597_1004826 | JGI25165J46597_10048261 | 254 |
| 181 | 3300003215 | JGI25153J46596_10000103 | JGI25153J46596_1000010345 | 254 |
| 182 | 3300003215 | JGI25153J46596_10001488 | JGI25153J46596_100014885 | 254 |
| 183 | 3300003215 | JGI25153J46596_10009848 | JGI25153J46596_100098484 | 254 |
| 184 | 3300003354 | JGI25160J50197_1000023 | JGI25160J50197_1000023168 | 254 |
| 185 | 3300003354 | JGI25160J50197_1000033 | JGI25160J50197_1000033163 | 254 |
| 186 | 3300003354 | JGI25160J50197_1001657 | JGI25160J50197_10016578 | 254 |
| 187 | 3300003374 | JGI25161J50226_1000012 | JGI25161J50226_1000012168 | 254 |
| 188 | 3300003374 | JGI25161J50226_1000508 | JGI25161J50226_10005085 | 254 |
| 189 | 3300003374 | JGI25161J50226_1004573 | JGI25161J50226_10045732 | 254 |
| 190 | 3300003578 | Ga0006562J51391_1050521 | Ga0006562J51391_10505212 | 254 |
| 191 | 3300003771 | Ga0055526_1002294 | Ga0055526_100229412 | 254 |
| 192 | 3300003771 | Ga0055526_1008324 | Ga0055526_10083242 | 254 |
| 193 | 3300003771 | Ga0055526_1016912 | Ga0055526_10169122 | 254 |
| 194 | 3300003771 | Ga0055526_1028335 | Ga0055526_10283352 | 254 |
| 195 | 3300003775 | Ga0055524_1003993 | Ga0055524_10039934 | 254 |
| 196 | 3300003775 | Ga0055524_1007275 | Ga0055524_10072752 | 254 |
| 197 | 3300003775 | Ga0055524_1023454 | Ga0055524_10234542 | 254 |
| 198 | 3300003781 | Ga0055536_1012578 | Ga0055536_10125783 | 254 |
| 199 | 3300003790 | Ga0055528_1000519 | Ga0055528_100051921 | 254 |
| 200 | 3300003790 | Ga0055528_1014232 | Ga0055528_10142322 | 254 |
| 201 | 3300003790 | Ga0055528_1027463 | Ga0055528_10274631 | 254 |
| 202 | 3300003790 | Ga0055528_1031970 | Ga0055528_10319702 | 254 |
| 203 | 3300003791 | Ga0055530_10022847 | Ga0055530_100228472 | 254 |
| 204 | 3300003792 | Ga0055540_1000050 | Ga0055540_1000050126 | 254 |
| 205 | 3300003792 | Ga0055540_1012166 | Ga0055540_10121662 | 254 |
| 206 | 3300003794 | Ga0055531_10016516 | Ga0055531_100165162 | 254 |
| 207 | 3300003794 | Ga0055531_10017593 | Ga0055531_100175931 | 254 |
| 208 | 3300003856 | Ga0058692_1017728 | Ga0058692_10177282 | 254 |
| 209 | 3300004625 | Ga0055543_1000009 | Ga0055543_1000009168 | 254 |
| 210 | 3300004625 | Ga0055543_1000315 | Ga0055543_100031522 | 254 |
| 211 | 3300004625 | Ga0055543_1003043 | Ga0055543_10030433 | 254 |
| 212 | 3300005262 | Ga0065165_1000064 | Ga0065165_100006429 | 254 |
| 213 | 3300005262 | Ga0065165_1000513 | Ga0065165_100051314 | 254 |
| 214 | 3300005262 | Ga0065165_1005453 | Ga0065165_10054538 | 254 |
| 215 | 3300005262 | Ga0065165_1006135 | Ga0065165_10061352 | 254 |
| 216 | 3300005331 | Ga0070670_100000287 | Ga0070670_10000028724 | 254 |
| 217 | 3300005347 | Ga0070668_100127067 | Ga0070668_1001270672 | 254 |
| 218 | 3300005355 | Ga0070671_100380979 | Ga0070671_1003809792 | 254 |
| 219 | 3300005548 | Ga0070665_100105349 | Ga0070665_1001053492 | 254 |
| 220 | 3300005548 | Ga0070665_100177473 | Ga0070665_1001774733 | 254 |
| 221 | 3300005548 | Ga0070665_100263818 | Ga0070665_1002638182 | 254 |
| 222 | 3300005578 | Ga0068854_100067701 | Ga0068854_1000677013 | 254 |
| 223 | 3300005614 | Ga0068856_100022838 | Ga0068856_1000228382 | 254 |
| 224 | 3300005834 | Ga0068851_10135295 | Ga0068851_101352952 | 254 |
| 225 | 3300005844 | Ga0068862_100090252 | Ga0068862_1000902523 | 254 |
| 226 | 3300006038 | Ga0075365_10010840 | Ga0075365_100108404 | 254 |
| 227 | 3300006038 | Ga0075365_10303480 | Ga0075365_103034802 | 254 |
| 228 | 3300006042 | Ga0075368_10088341 | Ga0075368_100883412 | 254 |
| 229 | 3300006048 | Ga0075363_100272121 | Ga0075363_1002721211 | 254 |
| 230 | 3300006051 | Ga0075364_10013563 | Ga0075364_100135633 | 254 |
| 231 | 3300006051 | Ga0075364_10326887 | Ga0075364_103268872 | 254 |
| 232 | 3300006178 | Ga0075367_10021014 | Ga0075367_100210143 | 254 |
| 233 | 3300006186 | Ga0075369_10007134 | Ga0075369_100071344 | 254 |
| 234 | 3300006186 | Ga0075369_10035944 | Ga0075369_100359442 | 254 |
| 235 | 3300006195 | Ga0075366_10003448 | Ga0075366_100034483 | 254 |
| 236 | 3300006353 | Ga0075370_10003108 | Ga0075370_100031088 | 254 |
| 237 | 3300006881 | Ga0068865_100577500 | Ga0068865_1005775001 | 254 |
| 238 | 3300006948 | Ga0099826_10000181 | Ga0099826_100001814 | 254 |
| 239 | 3300009011 | Ga0105251_10055843 | Ga0105251_100558432 | 254 |
| 240 | 3300009036 | Ga0105244_10122047 | Ga0105244_101220472 | 254 |
| 241 | 3300009093 | Ga0105240_10000217 | Ga0105240_1000021764 | 254 |
| 242 | 3300009093 | Ga0105240_10542647 | Ga0105240_105426471 | 254 |
| 243 | 3300009098 | Ga0105245_10346920 | Ga0105245_103469202 | 254 |
| 244 | 3300009098 | Ga0105245_10933278 | Ga0105245_109332781 | 254 |
| 245 | 3300009148 | Ga0105243_10032808 | Ga0105243_100328083 | 254 |
| 246 | 3300009148 | Ga0105243_10293898 | Ga0105243_102938982 | 254 |
| 247 | 3300009177 | Ga0105248_10046083 | Ga0105248_100460832 | 254 |
| 248 | 3300009177 | Ga0105248_10736661 | Ga0105248_107366612 | 254 |
| 249 | 3300009545 | Ga0105237_10001458 | Ga0105237_1000145828 | 254 |
| 250 | 3300009551 | Ga0105238_10823791 | Ga0105238_108237911 | 254 |
| 251 | 3300009553 | Ga0105249_10239161 | Ga0105249_102391611 | 254 |
| 252 | 3300009765 | Ga0123341_1000109 | Ga0123341_100010913 | 254 |
| 253 | 3300009766 | Ga0123342_1014735 | Ga0123342_10147353 | 254 |
| 254 | 3300010375 | Ga0105239_10001164 | Ga0105239_100011642 | 254 |
| 255 | 3300010375 | Ga0105239_10440443 | Ga0105239_104404432 | 254 |
| 256 | 3300011119 | Ga0105246_10097688 | Ga0105246_100976882 | 254 |
| 257 | 3300013100 | Ga0157373_10030840 | Ga0157373_100308403 | 254 |
| 258 | 3300013102 | Ga0157371_10000002 | Ga0157371_10000002606 | 254 |
| 259 | 3300013104 | Ga0157370_10001439 | Ga0157370_1000143931 | 254 |
| 260 | 3300013104 | Ga0157370_10001923 | Ga0157370_100019233 | 254 |
| 261 | 3300013105 | Ga0157369_10107178 | Ga0157369_101071783 | 254 |
| 262 | 3300013249 | Ga0171463_1007 | Ga0171463_1007285 | 254 |
| 263 | 3300015262 | Ga0182007_10000324 | Ga0182007_100003249 | 254 |
| 264 | 3300015265 | Ga0182005_1001504 | Ga0182005_10015044 | 254 |
| 265 | 3300015690 | Ga0183363_1153 | Ga0183363_11535 | 254 |
| 266 | 3300025206 | Ga0209435_100006 | Ga0209435_100006481 | 254 |
| 267 | 3300025208 | Ga0209436_109923 | Ga0209436_1099232 | 254 |
| 268 | 3300025233 | Ga0209437_100042 | Ga0209437_100042132 | 254 |
| 269 | 3300025233 | Ga0209437_100062 | Ga0209437_100062279 | 254 |
| 270 | 3300025245 | Ga0207425_1000065 | Ga0207425_1000065108 | 254 |
| 271 | 3300025245 | Ga0207425_1009532 | Ga0207425_10095322 | 254 |
| 272 | 3300025246 | Ga0209646_1000015 | Ga0209646_100001553 | 254 |
| 273 | 3300025246 | Ga0209646_1003792 | Ga0209646_10037922 | 254 |
| 274 | 3300025250 | Ga0209026_1000046 | Ga0209026_100004653 | 254 |
| 275 | 3300025253 | Ga0209677_100429 | Ga0209677_1004296 | 254 |
| 276 | 3300025256 | Ga0209759_1000005 | Ga0209759_1000005481 | 254 |
| 277 | 3300025258 | Ga0209129_1000019 | Ga0209129_1000019107 | 254 |
| 278 | 3300025258 | Ga0209129_1000132 | Ga0209129_1000132108 | 254 |
| 279 | 3300025258 | Ga0209129_1006071 | Ga0209129_10060713 | 254 |
| 280 | 3300025258 | Ga0209129_1010911 | Ga0209129_10109112 | 254 |
| 281 | 3300025261 | Ga0209233_1000082 | Ga0209233_1000082279 | 254 |
| 282 | 3300025261 | Ga0209233_1000103 | Ga0209233_1000103132 | 254 |
| 283 | 3300025261 | Ga0209233_1000288 | Ga0209233_100028815 | 254 |
| 284 | 3300025273 | Ga0209673_1000023 | Ga0209673_1000023228 | 254 |
| 285 | 3300025273 | Ga0209673_1000132 | Ga0209673_1000132106 | 254 |
| 286 | 3300025273 | Ga0209673_1001968 | Ga0209673_10019687 | 254 |
| 287 | 3300025273 | Ga0209673_1002876 | Ga0209673_10028763 | 254 |
| 288 | 3300025273 | Ga0209673_1003829 | Ga0209673_10038292 | 254 |
| 289 | 3300025284 | Ga0209130_1000017 | Ga0209130_100001714 | 254 |
| 290 | 3300025284 | Ga0209130_1000048 | Ga0209130_100004829 | 254 |
| 291 | 3300025284 | Ga0209130_1015688 | Ga0209130_10156882 | 254 |
| 292 | 3300025292 | Ga0209676_1021257 | Ga0209676_10212572 | 254 |
| 293 | 3300025294 | Ga0209025_1000072 | Ga0209025_100007282 | 254 |
| 294 | 3300025294 | Ga0209025_1000153 | Ga0209025_1000153162 | 254 |
| 295 | 3300025294 | Ga0209025_1000247 | Ga0209025_1000247108 | 254 |
| 296 | 3300025294 | Ga0209025_1005892 | Ga0209025_10058926 | 254 |
| 297 | 3300025294 | Ga0209025_1019188 | Ga0209025_10191882 | 254 |
| 298 | 3300025294 | Ga0209025_1019195 | Ga0209025_10191952 | 254 |
| 299 | 3300025294 | Ga0209025_1049715 | Ga0209025_10497152 | 254 |
| 300 | 3300025295 | Ga0209564_1000100 | Ga0209564_1000100154 | 254 |
| 301 | 3300025295 | Ga0209564_1000372 | Ga0209564_100037252 | 254 |
| 302 | 3300025295 | Ga0209564_1001437 | Ga0209564_100143711 | 254 |
| 303 | 3300025295 | Ga0209564_1011402 | Ga0209564_10114022 | 254 |
| 304 | 3300025295 | Ga0209564_1034239 | Ga0209564_10342392 | 254 |
| 305 | 3300025297 | Ga0209758_1000053 | Ga0209758_1000053150 | 254 |
| 306 | 3300025297 | Ga0209758_1000212 | Ga0209758_1000212109 | 254 |
| 307 | 3300025297 | Ga0209758_1000239 | Ga0209758_100023967 | 254 |
| 308 | 3300025297 | Ga0209758_1014984 | Ga0209758_10149843 | 254 |
| 309 | 3300025297 | Ga0209758_1022928 | Ga0209758_10229283 | 254 |
| 310 | 3300025297 | Ga0209758_1030212 | Ga0209758_10302122 | 254 |
| 311 | 3300025297 | Ga0209758_1034485 | Ga0209758_10344852 | 254 |
| 312 | 3300025297 | Ga0209758_1049788 | Ga0209758_10497882 | 254 |
| 313 | 3300025298 | Ga0209050_1002669 | Ga0209050_100266915 | 254 |
| 314 | 3300025298 | Ga0209050_1006906 | Ga0209050_10069067 | 254 |
| 315 | 3300025298 | Ga0209050_1009761 | Ga0209050_10097612 | 254 |
| 316 | 3300025299 | Ga0209256_1000401 | Ga0209256_100040122 | 254 |
| 317 | 3300025299 | Ga0209256_1000458 | Ga0209256_100045824 | 254 |
| 318 | 3300025299 | Ga0209256_1000735 | Ga0209256_100073540 | 254 |
| 319 | 3300025299 | Ga0209256_1000818 | Ga0209256_10008182 | 254 |
| 320 | 3300025299 | Ga0209256_1002923 | Ga0209256_10029235 | 254 |
| 321 | 3300025302 | Ga0207426_1000006 | Ga0207426_100000614 | 254 |
| 322 | 3300025302 | Ga0207426_1000035 | Ga0207426_1000035225 | 254 |
| 323 | 3300025302 | Ga0207426_1000136 | Ga0207426_100013629 | 254 |
| 324 | 3300025303 | Ga0209051_1000062 | Ga0209051_1000062201 | 254 |
| 325 | 3300025303 | Ga0209051_1003152 | Ga0209051_10031526 | 254 |
| 326 | 3300025303 | Ga0209051_1005006 | Ga0209051_10050063 | 254 |
| 327 | 3300025303 | Ga0209051_1035479 | Ga0209051_10354792 | 254 |
| 328 | 3300025304 | Ga0209257_1001119 | Ga0209257_10011196 | 254 |
| 329 | 3300025304 | Ga0209257_1010746 | Ga0209257_10107464 | 254 |
| 330 | 3300025903 | Ga0207680_10246153 | Ga0207680_102461531 | 254 |
| 331 | 3300025913 | Ga0207695_10000613 | Ga0207695_1000061349 | 254 |
| 332 | 3300025914 | Ga0207671_10001160 | Ga0207671_100011602 | 254 |
| 333 | 3300025925 | Ga0207650_10001289 | Ga0207650_1000128910 | 254 |
| 334 | 3300025928 | Ga0207700_10206085 | Ga0207700_102060852 | 254 |
| 335 | 3300025935 | Ga0207709_10036345 | Ga0207709_100363452 | 254 |
| 336 | 3300025941 | Ga0207711_10334835 | Ga0207711_103348351 | 254 |
| 337 | 3300025972 | Ga0207668_10106081 | Ga0207668_101060812 | 254 |
| 338 | 3300026075 | Ga0207708_10110635 | Ga0207708_101106352 | 254 |
| 339 | 3300026078 | Ga0207702_10014348 | Ga0207702_100143486 | 254 |
| 340 | 3300026121 | Ga0207683_10198925 | Ga0207683_101989251 | 254 |
| 341 | 3300027312 | Ga0209371_1004328 | Ga0209371_10043284 | 254 |
| 342 | 3300027666 | Ga0209282_1000176 | Ga0209282_100017631 | 254 |
| 343 | 3300028379 | Ga0268266_10005342 | Ga0268266_100053423 | 254 |
| 344 | 3300028379 | Ga0268266_10198257 | Ga0268266_101982572 | 254 |
| 345 | 3300028379 | Ga0268266_10240919 | Ga0268266_102409192 | 254 |
| 346 | 3300028379 | Ga0268266_10361384 | Ga0268266_103613842 | 254 |
| 347 | 3300028380 | Ga0268265_10171350 | Ga0268265_101713502 | 254 |
| 348 | 3300028786 | Ga0307517_10207732 | Ga0307517_102077322 | 254 |
| 349 | 3300028794 | Ga0307515_10002150 | Ga0307515_1000215040 | 254 |
| 350 | 3300028794 | Ga0307515_10033865 | Ga0307515_100338652 | 254 |
| 351 | 3300028794 | Ga0307515_10168799 | Ga0307515_101687992 | 254 |
| 352 | 3300030500 | Ga0268256_1003966 | Ga0268256_10039663 | 254 |
| 353 | 3300030744 | Ga0316181_1067070 | Ga0316181_10670702 | 254 |
| 354 | 3300031235 | Ga0265330_10046801 | Ga0265330_100468012 | 254 |
| 355 | 3300031456 | Ga0307513_10000463 | Ga0307513_1000046355 | 254 |
| 356 | 3300031456 | Ga0307513_10166943 | Ga0307513_101669432 | 254 |
| 357 | 3300031456 | Ga0307513_10185890 | Ga0307513_101858902 | 254 |
| 358 | 3300031456 | Ga0307513_10355592 | Ga0307513_103555922 | 254 |
| 359 | 3300031616 | Ga0307508_10081823 | Ga0307508_100818232 | 254 |
| 360 | 3300031711 | Ga0265314_10018857 | Ga0265314_100188575 | 254 |
| 361 | 3300031911 | Ga0307412_10019356 | Ga0307412_100193564 | 254 |
| 362 | 3300032002 | Ga0307416_100202641 | Ga0307416_1002026412 | 254 |
| 363 | 3300032004 | Ga0307414_10365263 | Ga0307414_103652632 | 254 |
| 364 | 3300037471 | Ga0395905_0002837 | Ga0395905_0002837_5015_5848 | 254 |
| 365 | 3300037471 | Ga0395905_0003927 | Ga0395905_0003927_7977_8810 | 254 |
| 366 | 3300037471 | Ga0395905_0048313 | Ga0395905_0048313_452_1291 | 254 |
| 367 | 3300037471 | Ga0395905_0093038 | Ga0395905_0093038_401_1234 | 254 |
| 368 | 3300039437 | Ga0436365_0671760 | Ga0436365_0671760_177_1007 | 254 |
| 369 | 3300041404 | Ga0439436_0000195 | Ga0439436_0000195_8664_9497 | 254 |
| 370 | 3300041492 | Ga0451835_0331121 | Ga0451835_0331121_236_1066 | 254 |
| 371 | 3300041496 | Ga0451839_0268492 | Ga0451839_0268492_554_1384 | 254 |
| 372 | 3300041501 | Ga0451845_0189427 | Ga0451845_0189427_430_1260 | 254 |
| 373 | 3300041503 | Ga0451847_0010441 | Ga0451847_0010441_280_1110 | 254 |
| 374 | 3300041509 | Ga0451843_0065299 | Ga0451843_0065299_137_967 | 254 |
| 375 | 3300041512 | Ga0451853_2758235 | Ga0451853_2758235_243_1073 | 254 |
| 376 | 3300042015 | Ga0439462_0027122 | Ga0439462_0027122_357_1190 | 254 |
| 377 | 3300042015 | Ga0439462_0042290 | Ga0439462_0042290_108_941 | 254 |
| 378 | 3300042145 | Ga0450906_029307 | Ga0450906_029307_30_863 | 254 |
| 379 | 3300044765 | Ga0466970_0169294 | Ga0466970_0169294_145_975 | 254 |
| 380 | 3300044901 | Ga0466960_0168679 | Ga0466960_0168679_213_1052 | 254 |
| 381 | 3300046454 | Ga0495592_0075679 | Ga0495592_0075679_243_1076 | 254 |
| 382 | 3300046460 | Ga0495638_0123397 | Ga0495638_0123397_306_1139 | 254 |
| 383 | 3300046476 | Ga0495662_0007616 | Ga0495662_0007616_3766_4599 | 254 |
| 384 | 3300046492 | Ga0495585_0140841 | Ga0495585_0140841_76_906 | 254 |
| 385 | 3300046507 | Ga0495606_0001618 | Ga0495606_0001618_1553_2383 | 254 |
| 386 | 3300046513 | Ga0495616_0116708 | Ga0495616_0116708_118_948 | 254 |
| 387 | 3300046518 | Ga0495631_0077215 | Ga0495631_0077215_86_916 | 254 |
| 388 | 3300046519 | Ga0495632_0086599 | Ga0495632_0086599_406_1236 | 254 |
| 389 | 3300046530 | Ga0495654_0000694 | Ga0495654_0000694_25487_26320 | 254 |
| 390 | 3300046557 | Ga0495622_0023211 | Ga0495622_0023211_914_1747 | 254 |
| 391 | 3300046558 | Ga0495633_0005760 | Ga0495633_0005760_5019_5849 | 254 |
| 392 | 3300046615 | Ga0495656_0110939 | Ga0495656_0110939_366_1196 | 254 |
| 393 | 3300046616 | Ga0495668_0196902 | Ga0495668_0196902_199_1029 | 254 |
| 394 | 3300046660 | Ga0495625_0082577 | Ga0495625_0082577_112_942 | 254 |
| 395 | 3300046660 | Ga0495625_0110977 | Ga0495625_0110977_612_1442 | 254 |
| 396 | 3300046660 | Ga0495625_0371288 | Ga0495625_0371288_55_888 | 254 |
| 397 | 3300046674 | Ga0495588_0073614 | Ga0495588_0073614_294_1127 | 254 |
| 398 | 3300046675 | Ga0495657_0149954 | Ga0495657_0149954_472_1305 | 254 |
| 399 | 3300047317 | Ga0495604_0021553 | Ga0495604_0021553_1838_2671 | 254 |
| 400 | 3300047470 | Ga0495681_0002695 | Ga0495681_0002695_10734_11564 | 254 |
| 401 | 3300047472 | Ga0495686_0000795 | Ga0495686_0000795_2807_3637 | 254 |
| 402 | 3300048090 | Ga0495615_0040446 | Ga0495615_0040446_133_963 | 254 |
| 403 | 3300048907 | Ga0496104_0131911 | Ga0496104_0131911_1129_1959 | 254 |
| 404 | 3300048919 | Ga0496116_0000042 | Ga0496116_0000042_122593_123423 | 254 |
| 405 | 3300048919 | Ga0496116_0007217 | Ga0496116_0007217_7178_8008 | 254 |
| 406 | 3300048919 | Ga0496116_0019687 | Ga0496116_0019687_2792_3622 | 254 |
| 407 | 3300048919 | Ga0496116_0120858 | Ga0496116_0120858_351_1181 | 254 |
| 408 | 3300048920 | Ga0496117_0000036 | Ga0496117_0000036_304278_305108 | 254 |
| 409 | 3300048920 | Ga0496117_0026327 | Ga0496117_0026327_3265_4095 | 254 |
| 410 | 3300048920 | Ga0496117_0070372 | Ga0496117_0070372_544_1374 | 254 |
| 411 | 3300048921 | Ga0496118_0015347 | Ga0496118_0015347_3815_4645 | 254 |
| 412 | 3300048921 | Ga0496118_0041334 | Ga0496118_0041334_2394_3224 | 254 |
| 413 | 3300048922 | Ga0496119_0004655 | Ga0496119_0004655_2863_3693 | 254 |
| 414 | 3300048922 | Ga0496119_0016484 | Ga0496119_0016484_3740_4573 | 254 |
| 415 | 3300048923 | Ga0496120_0000777 | Ga0496120_0000777_43923_44753 | 254 |
| 416 | 3300048923 | Ga0496120_0001949 | Ga0496120_0001949_10282_11112 | 254 |
| 417 | 3300048923 | Ga0496120_0008096 | Ga0496120_0008096_5793_6626 | 254 |
| 418 | 3300048924 | Ga0496121_0000001 | Ga0496121_0000001_103603_104436 | 254 |
| 419 | 3300048924 | Ga0496121_0000239 | Ga0496121_0000239_115748_116578 | 254 |
| 420 | 3300048924 | Ga0496121_0002342 | Ga0496121_0002342_10381_11211 | 254 |
| 421 | 3300048924 | Ga0496121_0018876 | Ga0496121_0018876_1062_1892 | 254 |
| 422 | 3300048925 | Ga0496122_0000002 | Ga0496122_0000002_576256_577086 | 254 |
| 423 | 3300048925 | Ga0496122_0000072 | Ga0496122_0000072_19555_20385 | 254 |
| 424 | 3300048925 | Ga0496122_0022649 | Ga0496122_0022649_4535_5365 | 254 |
| 425 | 3300048925 | Ga0496122_0024700 | Ga0496122_0024700_1598_2428 | 254 |
| 426 | 3300048925 | Ga0496122_0038214 | Ga0496122_0038214_2761_3591 | 254 |
| 427 | 3300048925 | Ga0496122_0102534 | Ga0496122_0102534_1019_1849 | 254 |
| 428 | 3300048926 | Ga0496123_0000002 | Ga0496123_0000002_1234597_1235427 | 254 |
| 429 | 3300048926 | Ga0496123_0000002 | Ga0496123_0000002_576256_577086 | 254 |
| 430 | 3300048926 | Ga0496123_0000035 | Ga0496123_0000035_64407_65237 | 254 |
| 431 | 3300048927 | Ga0496124_0003541 | Ga0496124_0003541_16004_16822 | 254 |
| 432 | 3300048927 | Ga0496124_0010305 | Ga0496124_0010305_7328_8158 | 254 |
| 433 | 3300048927 | Ga0496124_0015678 | Ga0496124_0015678_5582_6412 | 254 |
| 434 | 3300048927 | Ga0496124_0018541 | Ga0496124_0018541_1835_2665 | 254 |
| 435 | 3300048928 | Ga0496125_0000001 | Ga0496125_0000001_217058_217891 | 254 |
| 436 | 3300048928 | Ga0496125_0032307 | Ga0496125_0032307_2193_3023 | 254 |
| 437 | 3300048929 | Ga0496126_0000053 | Ga0496126_0000053_167227_168057 | 254 |
| 438 | 3300048929 | Ga0496126_0050721 | Ga0496126_0050721_1300_2130 | 254 |
| 439 | 3300048929 | Ga0496126_0061199 | Ga0496126_0061199_1397_2227 | 254 |
| 440 | 3300048929 | Ga0496126_0082583 | Ga0496126_0082583_1402_2235 | 254 |
| 441 | 3300048929 | Ga0496126_0241908 | Ga0496126_0241908_71_904 | 254 |
| 442 | 3300049569 | Ga0501032_0256322 | Ga0501032_0256322_29_859 | 254 |
| 443 | 3300049579 | Ga0501043_0159367 | Ga0501043_0159367_60_893 | 254 |
| 444 | 3300049580 | Ga0501046_0129194 | Ga0501046_0129194_326_1156 | 254 |
| 445 | 3300049581 | Ga0501047_0015869 | Ga0501047_0015869_574_1404 | 254 |
| 446 | 3300049589 | Ga0501073_0001099 | Ga0501073_0001099_13301_14131 | 254 |
| 447 | 3300049742 | Ga0501080_0022705 | Ga0501080_0022705_4280_5113 | 254 |
| 448 | 3300049742 | Ga0501080_0043791 | Ga0501080_0043791_2828_3658 | 254 |
| 449 | 3300049744 | Ga0501083_0019699 | Ga0501083_0019699_889_1719 | 254 |
| 450 | 3300049822 | Ga0501035_0112926 | Ga0501035_0112926_1413_2246 | 254 |
| 451 | 3300049822 | Ga0501035_0448403 | Ga0501035_0448403_85_918 | 254 |
| 452 | 3300049823 | Ga0501044_0007436 | Ga0501044_0007436_6679_7512 | 254 |
| 453 | 3300049823 | Ga0501044_0017995 | Ga0501044_0017995_995_1825 | 254 |
| 454 | 3300049823 | Ga0501044_0063397 | Ga0501044_0063397_68_898 | 254 |
| 455 | 3300050490 | nmdc:mga03n38_21958_c1 | nmdc:mga03n38_21958_c1_1560_2390 | 254 |
| 456 | 3300050491 | nmdc:mga00v17_18899_c1 | nmdc:mga00v17_18899_c1_286_1119 | 254 |
| 457 | 3300050491 | nmdc:mga00v17_230_c1 | nmdc:mga00v17_230_c1_1250_2080 | 254 |
| 458 | 3300050492 | nmdc:mga0yw44_184551_c1 | nmdc:mga0yw44_184551_c1_264_1097 | 254 |
| 459 | 3300050492 | nmdc:mga0yw44_53094_c1 | nmdc:mga0yw44_53094_c1_589_1419 | 254 |
| 460 | 3300050494 | nmdc:mga06z11_67034_c1 | nmdc:mga06z11_67034_c1_631_1461 | 254 |
| 461 | 3300050495 | nmdc:mga04h51_76042_c1 | nmdc:mga04h51_76042_c1_254_1084 | 254 |
| 462 | 3300050496 | nmdc:mga07m45_65030_c1 | nmdc:mga07m45_65030_c1_700_1530 | 254 |
| 463 | 3300050516 | nmdc:mga0sz30_16417_c1 | nmdc:mga0sz30_16417_c1_1922_2761 | 254 |
| 464 | 3300050516 | nmdc:mga0sz30_6234_c1 | nmdc:mga0sz30_6234_c1_3227_4057 | 254 |
| 465 | 3300053085 | Ga0495619_0058978 | Ga0495619_0058978_1408_2241 | 254 |
| 466 | 3300053086 | Ga0500578_0041834 | Ga0500578_0041834_152_982 | 254 |
| 467 | 3300053090 | Ga0500646_0002763 | Ga0500646_0002763_1136_1966 | 254 |
| 468 | 3300053105 | Ga0500557_026116 | Ga0500557_026116_390_1220 | 254 |
| 469 | 3300053134 | Ga0500658_0001819 | Ga0500658_0001819_1751_2581 | 254 |
| 470 | 3300053137 | Ga0500561_0000110 | Ga0500561_0000110_3107_3937 | 254 |
| 471 | 3300053140 | Ga0500573_0018384 | Ga0500573_0018384_2417_3250 | 254 |
| 472 | 3300053146 | Ga0500588_0008069 | Ga0500588_0008069_1176_2006 | 254 |
| 473 | 3300053148 | Ga0500590_000792 | Ga0500590_000792_9182_10015 | 254 |
| 474 | 3300053151 | Ga0500604_0002453 | Ga0500604_0002453_866_1696 | 254 |
| 475 | 3300053151 | Ga0500604_0014031 | Ga0500604_0014031_553_1383 | 254 |
| 476 | 3300053153 | Ga0500616_0002733 | Ga0500616_0002733_11131_11961 | 254 |
| 477 | 3300053156 | Ga0500622_0002690 | Ga0500622_0002690_1610_2440 | 254 |
| 478 | 3300053157 | Ga0500624_000296 | Ga0500624_000296_11165_11995 | 254 |
| 479 | 3300053158 | Ga0500627_0098481 | Ga0500627_0098481_225_1055 | 254 |
| 480 | 3300053161 | Ga0500634_0000796 | Ga0500634_0000796_6555_7385 | 254 |
| 481 | 3300053161 | Ga0500634_0010247 | Ga0500634_0010247_813_1646 | 254 |
| 482 | 3300053177 | Ga0500636_0000026 | Ga0500636_0000026_8773_9603 | 254 |
| 483 | 3300053177 | Ga0500636_0000083 | Ga0500636_0000083_14991_15821 | 254 |
| 484 | 3300060353 | Ga0501082_0131532 | Ga0501082_0131532_1068_1898 | 254 |
| 485 | iso_pu_bacteria | 2503198000 | 2503202144 | 254 |
| 486 | iso_pu_bacteria | 2508501122 | 2509107964 | 254 |
| 487 | iso_pu_bacteria | 2508501123 | 2509117071 | 254 |
| 488 | iso_pu_bacteria | 2508501127 | 2509141454 | 254 |
| 489 | iso_pu_bacteria | 2509276018 | 2509370790 | 254 |
| 490 | iso_pu_bacteria | 2509276019 | 2509376860 | 254 |
| 491 | iso_pu_bacteria | 2509276021 | 2509385493 | 254 |
| 492 | iso_pu_bacteria | 2509276022 | 2509396788 | 254 |
| 493 | iso_pu_bacteria | 2509276033 | 2509448466 | 254 |
| 494 | iso_pu_bacteria | 2510065019 | 2510136503 | 254 |
| 495 | iso_pu_bacteria | 2510065057 | 2510304151 | 254 |
| 496 | iso_pu_bacteria | 2510065059 | 2510317575 | 254 |
| 497 | iso_pu_bacteria | 2510461069 | 2510839081 | 254 |
| 498 | iso_pu_bacteria | 2510461076 | 2510900235 | 254 |
| 499 | iso_pu_bacteria | 2510917022 | 2511135646 | 254 |
| 500 | iso_pu_bacteria | 2510917028 | 2511184343 | 254 |
| 501 | iso_pu_bacteria | 2510917030 | 2511197550 | 254 |
| 502 | iso_pu_bacteria | 2511231027 | 2511391245 | 254 |
| 503 | iso_pu_bacteria | 2511231052 | 2511502588 | 254 |
| 504 | iso_pu_bacteria | 2512047086 | 2512533957 | 254 |
| 505 | iso_pu_bacteria | 2512875016 | 2512930959 | 254 |
| 506 | iso_pu_bacteria | 2512875024 | 2512958688 | 254 |
| 507 | iso_pu_bacteria | 2512875026 | 2512970284 | 254 |
| 508 | iso_pu_bacteria | 2513237084 | 2513569646 | 254 |
| 509 | iso_pu_bacteria | 2513237085 | 2513576471 | 254 |
| 510 | iso_pu_bacteria | 2513237086 | 2513583219 | 254 |
| 511 | iso_pu_bacteria | 2513237088 | 2513595060 | 254 |
| 512 | iso_pu_bacteria | 2513237089 | 2513601348 | 254 |
| 513 | iso_pu_bacteria | 2513237090 | 2513609730 | 254 |
| 514 | iso_pu_bacteria | 2513237091 | 2513620915 | 254 |
| 515 | iso_pu_bacteria | 2513237093 | 2513635126 | 254 |
| 516 | iso_pu_bacteria | 2513237103 | 2513709794 | 254 |
| 517 | iso_pu_bacteria | 2513237138 | 2513871326 | 254 |
| 518 | iso_pu_bacteria | 2513237140 | 2513881729 | 254 |
| 519 | iso_pu_bacteria | 2513237143 | 2513904873 | 254 |
| 520 | iso_pu_bacteria | 2513237144 | 2513911556 | 254 |
| 521 | iso_pu_bacteria | 2513237146 | 2513929073 | 254 |
| 522 | iso_pu_bacteria | 2513237156 | 2513986639 | 254 |
| 523 | iso_pu_bacteria | 2513237159 | 2513999225 | 254 |
| 524 | iso_pu_bacteria | 2513237160 | 2514003205 | 254 |
| 525 | iso_pu_bacteria | 2513237162 | 2514018772 | 254 |
| 526 | iso_pu_bacteria | 2513237164 | 2514034898 | 254 |
| 527 | iso_pu_bacteria | 2513237305 | 2514421914 | 254 |
| 528 | iso_pu_bacteria | 2515075009 | 2515115074 | 254 |
| 529 | iso_pu_bacteria | 2515154107 | 2515609371 | 254 |
| 530 | iso_pu_bacteria | 2515154113 | 2515633250 | 254 |
| 531 | iso_pu_bacteria | 2515154114 | 2515642476 | 254 |
| 532 | iso_pu_bacteria | 2515154116 | 2515658452 | 254 |
| 533 | iso_pu_bacteria | 2515154134 | 2515741926 | 254 |
| 534 | iso_pu_bacteria | 2516143018 | 2516205991 | 254 |
| 535 | iso_pu_bacteria | 2516653046 | 2516893964 | 254 |
| 536 | iso_pu_bacteria | 2516653077 | 2517041925 | 254 |
| 537 | iso_pu_bacteria | 2516653085 | 2517081044 | 254 |
| 538 | iso_pu_bacteria | 2517093000 | 2517098616 | 254 |
| 539 | iso_pu_bacteria | 2517287029 | 2517410836 | 254 |
| 540 | iso_pu_bacteria | 2517487022 | 2517570678 | 254 |
| 541 | iso_pu_bacteria | 2519899620 | 2520380739 | 254 |
| 542 | iso_pu_bacteria | 2523231067 | 2523468242 | 254 |
| 543 | iso_pu_bacteria | 2524023207 | 2524448216 | 254 |
| 544 | iso_pu_bacteria | 2524023209 | 2524457344 | 254 |
| 545 | iso_pu_bacteria | 2529292951 | 2530644495 | 254 |
| 546 | iso_pu_bacteria | 2534681796 | 2535520002 | 254 |
| 547 | iso_pu_bacteria | 2537561587 | 2537877750 | 254 |
| 548 | iso_pu_bacteria | 2551306084 | 2551675353 | 254 |
| 549 | iso_pu_bacteria | 2551306084 | 2551676763 | 254 |
| 550 | iso_pu_bacteria | 2551306085 | 2551689363 | 254 |
| 551 | iso_pu_bacteria | 2551306086 | 2551695507 | 254 |
| 552 | iso_pu_bacteria | 2551306087 | 2551700998 | 254 |
| 553 | iso_pu_bacteria | 2551306089 | 2551711112 | 254 |
| 554 | iso_pu_bacteria | 2551306090 | 2551722007 | 254 |
| 555 | iso_pu_bacteria | 2551306091 | 2551724378 | 254 |
| 556 | iso_pu_bacteria | 2551306092 | 2551736474 | 254 |
| 557 | iso_pu_bacteria | 2551306093 | 2551739982 | 254 |
| 558 | iso_pu_bacteria | 2554235003 | 2554245787 | 254 |
| 559 | iso_pu_bacteria | 2558860100 | 2558865782 | 254 |
| 560 | iso_pu_bacteria | 2558860242 | 2559296446 | 254 |
| 561 | iso_pu_bacteria | 2582581283 | 2585169049 | 254 |
| 562 | iso_pu_bacteria | 2582581294 | 2585202767 | 254 |
| 563 | iso_pu_bacteria | 2582581298 | 2585221616 | 254 |
| 564 | iso_pu_bacteria | 2582581299 | 2585233303 | 254 |
| 565 | iso_pu_bacteria | 2582581306 | 2585270229 | 254 |
| 566 | iso_pu_bacteria | 2582581307 | 2585272721 | 254 |
| 567 | iso_pu_bacteria | 2582581308 | 2585281237 | 254 |
| 568 | iso_pu_bacteria | 2582581315 | 2585327345 | 254 |
| 569 | iso_pu_bacteria | 2582581316 | 2585335301 | 254 |
| 570 | iso_pu_bacteria | 2582581865 | 2585390451 | 254 |
| 571 | iso_pu_bacteria | 2582581866 | 2585395812 | 254 |
| 572 | iso_pu_bacteria | 2582581867 | 2585401686 | 254 |
| 573 | iso_pu_bacteria | 2585427526 | 2585524176 | 254 |
| 574 | iso_pu_bacteria | 2585427527 | 2585536102 | 254 |
| 575 | iso_pu_bacteria | 2585427528 | 2585539212 | 254 |
| 576 | iso_pu_bacteria | 2585427529 | 2585544214 | 254 |
| 577 | iso_pu_bacteria | 2585427530 | 2585557413 | 254 |
| 578 | iso_pu_bacteria | 2585427531 | 2585562389 | 254 |
| 579 | iso_pu_bacteria | 2585427590 | 2585821381 | 254 |
| 580 | iso_pu_bacteria | 2585427593 | 2585837165 | 254 |
| 581 | iso_pu_bacteria | 2585427594 | 2585842471 | 254 |
| 582 | iso_pu_bacteria | 2585427608 | 2585896829 | 254 |
| 583 | iso_pu_bacteria | 2585427609 | 2585906444 | 254 |
| 584 | iso_pu_bacteria | 2585428125 | 2587981866 | 254 |
| 585 | iso_pu_bacteria | 2588253730 | 2588516644 | 254 |
| 586 | iso_pu_bacteria | 2597489875 | 2597814999 | 254 |
| 587 | iso_pu_bacteria | 2599185170 | 2599414714 | 254 |
| 588 | iso_pu_bacteria | 2599185210 | 2599603066 | 254 |
| 589 | iso_pu_bacteria | 2599185236 | 2599717816 | 254 |
| 590 | iso_pu_bacteria | 2599185301 | 2599935530 | 254 |
| 591 | iso_pu_bacteria | 2599185352 | 2600196889 | 254 |
| 592 | iso_pu_bacteria | 2600255279 | 2601610683 | 254 |
| 593 | iso_pu_bacteria | 2600255308 | 2601746987 | 254 |
| 594 | iso_pu_bacteria | 2615840624 | 2616295200 | 254 |
| 595 | iso_pu_bacteria | 2615840626 | 2616310961 | 254 |
| 596 | iso_pu_bacteria | 2615840698 | 2616551887 | 254 |
| 597 | iso_pu_bacteria | 2617270742 | 2617382883 | 254 |
| 598 | iso_pu_bacteria | 2643221557 | 2643804484 | 254 |
| 599 | iso_pu_bacteria | 2643221568 | 2643857039 | 254 |
| 600 | iso_pu_bacteria | 2643221582 | 2643922190 | 254 |
| 601 | iso_pu_bacteria | 2643221595 | 2643989318 | 254 |
| 602 | iso_pu_bacteria | 2643221599 | 2644003366 | 254 |
| 603 | iso_pu_bacteria | 2643221607 | 2644051210 | 254 |
| 604 | iso_pu_bacteria | 2643221610 | 2644065255 | 254 |
| 605 | iso_pu_bacteria | 2643221618 | 2644105548 | 254 |
| 606 | iso_pu_bacteria | 2643221626 | 2644146551 | 254 |
| 607 | iso_pu_bacteria | 2643221627 | 2644152890 | 254 |
| 608 | iso_pu_bacteria | 2643221634 | 2644194443 | 254 |
| 609 | iso_pu_bacteria | 2643221636 | 2644200881 | 254 |
| 610 | iso_pu_bacteria | 2643221637 | 2644210824 | 254 |
| 611 | iso_pu_bacteria | 2643221643 | 2644240821 | 254 |
| 612 | iso_pu_bacteria | 2643221655 | 2644308299 | 254 |
| 613 | iso_pu_bacteria | 2643221659 | 2644334126 | 254 |
| 614 | iso_pu_bacteria | 2643221668 | 2644377664 | 254 |
| 615 | iso_pu_bacteria | 2643221675 | 2644418139 | 254 |
| 616 | iso_pu_bacteria | 2643221680 | 2644451395 | 254 |
| 617 | iso_pu_bacteria | 2643221686 | 2644484114 | 254 |
| 618 | iso_pu_bacteria | 2643221688 | 2644494936 | 254 |
| 619 | iso_pu_bacteria | 2643221689 | 2644497933 | 254 |
| 620 | iso_pu_bacteria | 2643221693 | 2644520572 | 254 |
| 621 | iso_pu_bacteria | 2643221698 | 2644541720 | 254 |
| 622 | iso_pu_bacteria | 2643221712 | 2644615581 | 254 |
| 623 | iso_pu_bacteria | 2643221718 | 2644654358 | 254 |
| 624 | iso_pu_bacteria | 2643221723 | 2644672679 | 254 |
| 625 | iso_pu_bacteria | 2643221726 | 2644691625 | 254 |
| 626 | iso_pu_bacteria | 2667528174 | 2671116756 | 254 |
| 627 | iso_pu_bacteria | 2687453392 | 2688599505 | 254 |
| 628 | iso_pu_bacteria | 2690316117 | 2692315091 | 254 |
| 629 | iso_pu_bacteria | 2693429783 | 2694628273 | 254 |
| 630 | iso_pu_bacteria | 2693429784 | 2694640870 | 254 |
| 631 | iso_pu_bacteria | 2718217882 | 2719183761 | 254 |
| 632 | iso_pu_bacteria | 2718217927 | 2719388440 | 254 |
| 633 | iso_pu_bacteria | 2718217997 | 2719668060 | 254 |
| 634 | iso_pu_bacteria | 2718218009 | 2719728202 | 254 |
| 635 | iso_pu_bacteria | 2718218199 | 2720494823 | 254 |
| 636 | iso_pu_bacteria | 2718218232 | 2720611145 | 254 |
| 637 | iso_pu_bacteria | 2718218233 | 2720616317 | 254 |
| 638 | iso_pu_bacteria | 2718218235 | 2720629392 | 254 |
| 639 | iso_pu_bacteria | 2718218269 | 2720771963 | 254 |
| 640 | iso_pu_bacteria | 2718218363 | 2721145063 | 254 |
| 641 | iso_pu_bacteria | 2718218365 | 2721155800 | 254 |
| 642 | iso_pu_bacteria | 2718218366 | 2721167150 | 254 |
| 643 | iso_pu_bacteria | 2718218423 | 2721403063 | 254 |
| 644 | iso_pu_bacteria | 2721755514 | 2722838128 | 254 |
| 645 | iso_pu_bacteria | 2721755556 | 2723029393 | 254 |
| 646 | iso_pu_bacteria | 2721755684 | 2723563009 | 254 |
| 647 | iso_pu_bacteria | 2721755685 | 2723570990 | 254 |
| 648 | iso_pu_bacteria | 2721755686 | 2723572800 | 254 |
| 649 | iso_pu_bacteria | 2721755809 | 2724035420 | 254 |
| 650 | iso_pu_bacteria | 2721755810 | 2724042396 | 254 |
| 651 | iso_pu_bacteria | 2721755819 | 2724086783 | 254 |
| 652 | iso_pu_bacteria | 2721755822 | 2724106941 | 254 |
| 653 | iso_pu_bacteria | 2721755823 | 2724107750 | 254 |
| 654 | iso_pu_bacteria | 2724679232 | 2725952224 | 254 |
| 655 | iso_pu_bacteria | 2728369352 | 2730105707 | 254 |
| 656 | iso_pu_bacteria | 2728369365 | 2730161901 | 254 |
| 657 | iso_pu_bacteria | 2728369397 | 2730300907 | 254 |
| 658 | iso_pu_bacteria | 2738541293 | 2738802543 | 254 |
| 659 | iso_pu_bacteria | 2738541317 | 2738944977 | 254 |
| 660 | iso_pu_bacteria | 2738541333 | 2739033659 | 254 |
| 661 | iso_pu_bacteria | 2738543024 | 2739305846 | 254 |
| 662 | iso_pu_bacteria | 2751185821 | 2753463267 | 254 |
| 663 | iso_pu_bacteria | 2756170246 | 2756677219 | 254 |
| 664 | iso_pu_bacteria | 2758568016 | 2758640843 | 254 |
| 665 | iso_pu_bacteria | 2765235802 | 2765468569 | 254 |
| 666 | iso_pu_bacteria | 2765235942 | 2766068382 | 254 |
| 667 | iso_pu_bacteria | 2767802442 | 2770198940 | 254 |
| 668 | iso_pu_bacteria | 2775506902 | 2776272851 | 254 |
| 669 | iso_pu_bacteria | 2775506904 | 2776283256 | 254 |
| 670 | iso_pu_bacteria | 2775507266 | 2778175158 | 254 |
| 671 | iso_pu_bacteria | 2791355082 | 2792581604 | 254 |
| 672 | iso_pu_bacteria | 2791355091 | 2792620398 | 254 |
| 673 | iso_pu_bacteria | 2791355092 | 2792625756 | 254 |
| 674 | iso_pu_bacteria | 2791355094 | 2792641827 | 254 |
| 675 | iso_pu_bacteria | 2791355123 | 2792748622 | 254 |
| 676 | iso_pu_bacteria | 2791355253 | 2793281230 | 254 |
| 677 | iso_pu_bacteria | 2791355256 | 2793296422 | 254 |
| 678 | iso_pu_bacteria | 2791355259 | 2793317210 | 254 |
| 679 | iso_pu_bacteria | 2791355260 | 2793324054 | 254 |
| 680 | iso_pu_bacteria | 2791355261 | 2793325642 | 254 |
| 681 | iso_pu_bacteria | 2791355262 | 2793333065 | 254 |
| 682 | iso_pu_bacteria | 2791355263 | 2793340130 | 254 |
| 683 | iso_pu_bacteria | 2791355264 | 2793346237 | 254 |
| 684 | iso_pu_bacteria | 2791355265 | 2793355457 | 254 |
| 685 | iso_pu_bacteria | 2791355266 | 2793357802 | 254 |
| 686 | iso_pu_bacteria | 2791355267 | 2793366540 | 254 |
| 687 | iso_pu_bacteria | 2802428858 | 2802716641 | 254 |
| 688 | iso_pu_bacteria | 2802428859 | 2802725452 | 254 |
| 689 | iso_pu_bacteria | 2802428860 | 2802730456 | 254 |
| 690 | iso_pu_bacteria | 2802428861 | 2802737572 | 254 |
| 691 | iso_pu_bacteria | 2802428862 | 2802743038 | 254 |
| 692 | iso_pu_bacteria | 2802428863 | 2802750462 | 254 |
| 693 | iso_pu_bacteria | 2802429605 | 2805929051 | 254 |
| 694 | iso_pu_bacteria | 2802429606 | 2805937247 | 254 |
| 695 | iso_pu_bacteria | 2802429633 | 2806044842 | 254 |
| 696 | iso_pu_bacteria | 2802429634 | 2806053998 | 254 |
| 697 | iso_pu_bacteria | 2802429635 | 2806059910 | 254 |
| 698 | iso_pu_bacteria | 2802429636 | 2806066037 | 254 |
| 699 | iso_pu_bacteria | 2802429637 | 2806073381 | 254 |
| 700 | iso_pu_bacteria | 2808606387 | 2808990160 | 254 |
| 701 | iso_pu_bacteria | 2818991272 | 2819244924 | 254 |
| 702 | iso_pu_bacteria | 2818991448 | 2819607525 | 254 |
| 703 | iso_pu_bacteria | 2818991453 | 2819643922 | 254 |
| 704 | iso_pu_bacteria | 2821123053 | 2821126607 | 254 |
| 705 | iso_pu_bacteria | 2821443989 | 2821449605 | 254 |
| 706 | iso_pu_bacteria | 2838016132 | 2838019455 | 254 |
| 707 | iso_pu_bacteria | 2838022645 | 2838025081 | 254 |
| 708 | iso_pu_bacteria | 2838029111 | 2838032024 | 254 |
| 709 | iso_pu_bacteria | 2838035591 | 2838039567 | 254 |
| 710 | iso_pu_bacteria | 2838042994 | 2838045955 | 254 |
| 711 | iso_pu_bacteria | 2838048938 | 2838050561 | 254 |
| 712 | iso_pu_bacteria | 2838061910 | 2838062855 | 254 |
| 713 | iso_pu_bacteria | 2838068647 | 2838071803 | 254 |
| 714 | iso_pu_bacteria | 2838074704 | 2838080550 | 254 |
| 715 | iso_pu_bacteria | 2838661181 | 2838667956 | 254 |
| 716 | iso_pu_bacteria | 2838668709 | 2838671489 | 254 |
| 717 | iso_pu_bacteria | 2838675328 | 2838679983 | 254 |
| 718 | iso_pu_bacteria | 2838680041 | 2838684410 | 254 |
| 719 | iso_pu_bacteria | 2838686498 | 2838693562 | 254 |
| 720 | iso_pu_bacteria | 2838694306 | 2838699901 | 254 |
| 721 | iso_pu_bacteria | 2838701080 | 2838704244 | 254 |
| 722 | iso_pu_bacteria | 2838707686 | 2838711814 | 254 |
| 723 | iso_pu_bacteria | 2838714209 | 2838717398 | 254 |
| 724 | iso_pu_bacteria | 2838719591 | 2838721992 | 254 |
| 725 | iso_pu_bacteria | 2838724970 | 2838728148 | 254 |
| 726 | iso_pu_bacteria | 2838729681 | 2838735455 | 254 |
| 727 | iso_pu_bacteria | 2838736955 | 2838739989 | 254 |
| 728 | iso_pu_bacteria | 2838742623 | 2838748357 | 254 |
| 729 | iso_pu_bacteria | 2839993093 | 2839996536 | 254 |
| 730 | iso_pu_bacteria | 2840764183 | 2840770270 | 254 |
| 731 | iso_pu_bacteria | 2841734538 | 2841741108 | 254 |
| 732 | iso_pu_bacteria | 2841840854 | 2841843887 | 254 |
| 733 | iso_pu_bacteria | 2841846520 | 2841850709 | 254 |
| 734 | iso_pu_bacteria | 2841851746 | 2841858421 | 254 |
| 735 | iso_pu_bacteria | 2841859092 | 2841864183 | 254 |
| 736 | iso_pu_bacteria | 2841864319 | 2841869756 | 254 |
| 737 | iso_pu_bacteria | 2842077413 | 2842081877 | 254 |
| 738 | iso_pu_bacteria | 2842110456 | 2842117609 | 254 |
| 739 | iso_pu_bacteria | 2842118031 | 2842122453 | 254 |
| 740 | iso_pu_bacteria | 2842124991 | 2842129514 | 254 |
| 741 | iso_pu_bacteria | 2842130223 | 2842134886 | 254 |
| 742 | iso_pu_bacteria | 2842140634 | 2842143608 | 254 |
| 743 | iso_pu_bacteria | 2842146304 | 2842149138 | 254 |
| 744 | iso_pu_bacteria | 2842152218 | 2842156903 | 254 |
| 745 | iso_pu_bacteria | 2842156927 | 2842162669 | 254 |
| 746 | iso_pu_bacteria | 2842163707 | 2842167040 | 254 |
| 747 | iso_pu_bacteria | 2842170452 | 2842173081 | 254 |
| 748 | iso_pu_bacteria | 2842175837 | 2842180521 | 254 |
| 749 | iso_pu_bacteria | 2842180545 | 2842186173 | 254 |
| 750 | iso_pu_bacteria | 2842187318 | 2842190505 | 254 |
| 751 | iso_pu_bacteria | 2842192696 | 2842195256 | 254 |
| 752 | iso_pu_bacteria | 2842198810 | 2842203281 | 254 |
| 753 | iso_pu_bacteria | 2842205361 | 2842210272 | 254 |
| 754 | iso_pu_bacteria | 2842211629 | 2842214819 | 254 |
| 755 | iso_pu_bacteria | 2842217011 | 2842222260 | 254 |
| 756 | iso_pu_bacteria | 2842224351 | 2842227540 | 254 |
| 757 | iso_pu_bacteria | 2842229732 | 2842236048 | 254 |
| 758 | iso_pu_bacteria | 2842237096 | 2842241226 | 254 |
| 759 | iso_pu_bacteria | 2842243621 | 2842249979 | 254 |
| 760 | iso_pu_bacteria | 2842250916 | 2842253695 | 254 |
| 761 | iso_pu_bacteria | 2842257432 | 2842263275 | 254 |
| 762 | iso_pu_bacteria | 2842264693 | 2842268006 | 254 |
| 763 | iso_pu_bacteria | 2842271015 | 2842278031 | 254 |
| 764 | iso_pu_bacteria | 2842278818 | 2842283726 | 254 |
| 765 | iso_pu_bacteria | 2842285085 | 2842289697 | 254 |
| 766 | iso_pu_bacteria | 2842291075 | 2842295532 | 254 |
| 767 | iso_pu_bacteria | 2842298080 | 2842299100 | 254 |
| 768 | iso_pu_bacteria | 2842304105 | 2842310047 | 254 |
| 769 | iso_pu_bacteria | 2842311132 | 2842311773 | 254 |
| 770 | iso_pu_bacteria | 2842317721 | 2842318998 | 254 |
| 771 | iso_pu_bacteria | 2842341865 | 2842343994 | 254 |
| 772 | iso_pu_bacteria | 2842357229 | 2842358566 | 254 |
| 773 | iso_pu_bacteria | 2842363717 | 2842369694 | 254 |
| 774 | iso_pu_bacteria | 2842370503 | 2842376676 | 254 |
| 775 | iso_pu_bacteria | 2842377471 | 2842381692 | 254 |
| 776 | iso_pu_bacteria | 2842384541 | 2842389001 | 254 |
| 777 | iso_pu_bacteria | 2842395702 | 2842396355 | 254 |
| 778 | iso_pu_bacteria | 2842402390 | 2842407162 | 254 |
| 779 | iso_pu_bacteria | 2842409023 | 2842414054 | 254 |
| 780 | iso_pu_bacteria | 2842415677 | 2842420695 | 254 |
| 781 | iso_pu_bacteria | 2842422224 | 2842425436 | 254 |
| 782 | iso_pu_bacteria | 2842428310 | 2842432169 | 254 |
| 783 | iso_pu_bacteria | 2842434925 | 2842438281 | 254 |
| 784 | iso_pu_bacteria | 2842441272 | 2842443977 | 254 |
| 785 | iso_pu_bacteria | 2842447887 | 2842450151 | 254 |
| 786 | iso_pu_bacteria | 2842462802 | 2842466267 | 254 |
| 787 | iso_pu_bacteria | 2842469257 | 2842472749 | 254 |
| 788 | iso_pu_bacteria | 2842475841 | 2842478756 | 254 |
| 789 | iso_pu_bacteria | 2842482326 | 2842487522 | 254 |
| 790 | iso_pu_bacteria | 2842489311 | 2842491448 | 254 |
| 791 | iso_pu_bacteria | 2842495871 | 2842499516 | 254 |
| 792 | iso_pu_bacteria | 2842502639 | 2842505925 | 254 |
| 793 | iso_pu_bacteria | 2842509118 | 2842511959 | 254 |
| 794 | iso_pu_bacteria | 2842515876 | 2842521070 | 254 |
| 795 | iso_pu_bacteria | 2842521101 | 2842524972 | 254 |
| 796 | iso_pu_bacteria | 2842871566 | 2842875762 | 254 |
| 797 | iso_pu_bacteria | 2844002411 | 2844006363 | 254 |
| 798 | iso_pu_bacteria | 2844009547 | 2844014779 | 254 |
| 799 | iso_pu_bacteria | 2844163670 | 2844166464 | 254 |
| 800 | iso_pu_bacteria | 2844454524 | 2844461106 | 254 |
| 801 | iso_pu_bacteria | 2844533157 | 2844537546 | 254 |
| 802 | iso_pu_bacteria | 2847417321 | 2847419848 | 254 |
| 803 | iso_pu_bacteria | 2847670302 | 2847673130 | 254 |
| 804 | iso_pu_bacteria | 2847686936 | 2847689652 | 254 |
| 805 | iso_pu_bacteria | 2848992105 | 2848994865 | 254 |
| 806 | iso_pu_bacteria | 2850079185 | 2850081864 | 254 |
| 807 | iso_pu_bacteria | 2852387548 | 2852394991 | 254 |
| 808 | iso_pu_bacteria | 2854896431 | 2854899983 | 254 |
| 809 | iso_pu_bacteria | 2854911287 | 2854914164 | 254 |
| 810 | iso_pu_bacteria | 2854916844 | 2854921102 | 254 |
| 811 | iso_pu_bacteria | 2855825444 | 2855826685 | 254 |
| 812 | iso_pu_bacteria | 2855839649 | 2855842078 | 254 |
| 813 | iso_pu_bacteria | 2855872281 | 2855877364 | 254 |
| 814 | iso_pu_bacteria | 2856314179 | 2856319837 | 254 |
| 815 | iso_pu_bacteria | 2856320880 | 2856325775 | 254 |
| 816 | iso_pu_bacteria | 2856328259 | 2856329056 | 254 |
| 817 | iso_pu_bacteria | 2856334872 | 2856341621 | 254 |
| 818 | iso_pu_bacteria | 2856342000 | 2856346836 | 254 |
| 819 | iso_pu_bacteria | 2856349417 | 2856351571 | 254 |
| 820 | iso_pu_bacteria | 2856356410 | 2856360916 | 254 |
| 821 | iso_pu_bacteria | 2856364286 | 2856366096 | 254 |
| 822 | iso_pu_bacteria | 2857349434 | 2857352554 | 254 |
| 823 | iso_pu_bacteria | 2857367948 | 2857373068 | 254 |
| 824 | iso_pu_bacteria | 2857516855 | 2857519183 | 254 |
| 825 | iso_pu_bacteria | 2857531043 | 2857536699 | 254 |
| 826 | iso_pu_bacteria | 2858800743 | 2858802753 | 254 |
| 827 | iso_pu_bacteria | 2869162929 | 2869167452 | 254 |
| 828 | iso_pu_bacteria | 2869169390 | 2869175846 | 254 |
| 829 | iso_pu_bacteria | 2869234852 | 2869237262 | 254 |
| 830 | iso_pu_bacteria | 2869242130 | 2869247277 | 254 |
| 831 | iso_pu_bacteria | 2869249662 | 2869250990 | 254 |
| 832 | iso_pu_bacteria | 2869256925 | 2869260570 | 254 |
| 833 | iso_pu_bacteria | 2869264136 | 2869264232 | 254 |
| 834 | iso_pu_bacteria | 2869271264 | 2869271353 | 254 |
| 835 | iso_pu_bacteria | 2869278585 | 2869279393 | 254 |
| 836 | iso_pu_bacteria | 2869285874 | 2869291049 | 254 |
| 837 | iso_pu_bacteria | 2871429161 | 2871433331 | 254 |
| 838 | iso_pu_bacteria | 2871435913 | 2871441477 | 254 |
| 839 | iso_pu_bacteria | 2871444079 | 2871449730 | 254 |
| 840 | iso_pu_bacteria | 2871451962 | 2871453017 | 254 |
| 841 | iso_pu_bacteria | 2871459585 | 2871464452 | 254 |
| 842 | iso_pu_bacteria | 2871466892 | 2871469772 | 254 |
| 843 | iso_pu_bacteria | 2871474448 | 2871478495 | 254 |
| 844 | iso_pu_bacteria | 2871481445 | 2871488220 | 254 |
| 845 | iso_pu_bacteria | 2871488783 | 2871491030 | 254 |
| 846 | iso_pu_bacteria | 2871495908 | 2871498873 | 254 |
| 847 | iso_pu_bacteria | 2874102143 | 2874107880 | 254 |
| 848 | iso_pu_bacteria | 2874109183 | 2874109344 | 254 |
| 849 | iso_pu_bacteria | 2874116593 | 2874118292 | 254 |
| 850 | iso_pu_bacteria | 2874123672 | 2874124905 | 254 |
| 851 | iso_pu_bacteria | 2874131515 | 2874133410 | 254 |
| 852 | iso_pu_bacteria | 2874139085 | 2874145142 | 254 |
| 853 | iso_pu_bacteria | 2874146452 | 2874148726 | 254 |
| 854 | iso_pu_bacteria | 2874155637 | 2874160773 | 254 |
| 855 | iso_pu_bacteria | 2874162495 | 2874166728 | 254 |
| 856 | iso_pu_bacteria | 2874168670 | 2874176129 | 254 |
| 857 | iso_pu_bacteria | 2876363079 | 2876365892 | 254 |
| 858 | iso_pu_bacteria | 2876369609 | 2876377575 | 254 |
| 859 | iso_pu_bacteria | 2876377896 | 2876381931 | 254 |
| 860 | iso_pu_bacteria | 2876386047 | 2876391637 | 254 |
| 861 | iso_pu_bacteria | 2876392853 | 2876397384 | 254 |
| 862 | iso_pu_bacteria | 2876399893 | 2876402590 | 254 |
| 863 | iso_pu_bacteria | 2876406927 | 2876408260 | 254 |
| 864 | iso_pu_bacteria | 2876413966 | 2876418813 | 254 |
| 865 | iso_pu_bacteria | 2876420981 | 2876422175 | 254 |
| 866 | iso_pu_bacteria | 2878035449 | 2878035734 | 254 |
| 867 | iso_pu_bacteria | 2878730984 | 2878732984 | 254 |
| 868 | iso_pu_bacteria | 2878738818 | 2878743339 | 254 |
| 869 | iso_pu_bacteria | 2878745973 | 2878750944 | 254 |
| 870 | iso_pu_bacteria | 2878753008 | 2878755439 | 254 |
| 871 | iso_pu_bacteria | 2878760144 | 2878763086 | 254 |
| 872 | iso_pu_bacteria | 2878767105 | 2878770061 | 254 |
| 873 | iso_pu_bacteria | 2878774303 | 2878779542 | 254 |
| 874 | iso_pu_bacteria | 2878781027 | 2878786524 | 254 |
| 875 | iso_pu_bacteria | 2881147464 | 2881147855 | 254 |
| 876 | iso_pu_bacteria | 2881155292 | 2881158933 | 254 |
| 877 | iso_pu_bacteria | 2881161766 | 2881164620 | 254 |
| 878 | iso_pu_bacteria | 2881845957 | 2881848663 | 254 |
| 879 | iso_pu_bacteria | 2881861095 | 2881867316 | 254 |
| 880 | iso_pu_bacteria | 2882632389 | 2882634840 | 254 |
| 881 | iso_pu_bacteria | 2882912400 | 2882912412 | 254 |
| 882 | iso_pu_bacteria | 2885305155 | 2885306474 | 254 |
| 883 | iso_pu_bacteria | 2885312484 | 2885316413 | 254 |
| 884 | iso_pu_bacteria | 2885318864 | 2885318994 | 254 |
| 885 | iso_pu_bacteria | 2885326080 | 2885333316 | 254 |
| 886 | iso_pu_bacteria | 2885334103 | 2885335408 | 254 |
| 887 | iso_pu_bacteria | 2885342637 | 2885349103 | 254 |
| 888 | iso_pu_bacteria | 2885350715 | 2885351315 | 254 |
| 889 | iso_pu_bacteria | 2888337043 | 2888340070 | 254 |
| 890 | iso_pu_bacteria | 2888343758 | 2888348474 | 254 |
| 891 | iso_pu_bacteria | 2888350351 | 2888352737 | 254 |
| 892 | iso_pu_bacteria | 2889010040 | 2889014508 | 254 |
| 893 | iso_pu_bacteria | 2889016732 | 2889020506 | 254 |
| 894 | iso_pu_bacteria | 2889790730 | 2889790744 | 254 |
| 895 | iso_pu_bacteria | 2889914905 | 2889915128 | 254 |
| 896 | iso_pu_bacteria | 2894652903 | 2894656838 | 254 |
| 897 | iso_pu_bacteria | 2894817345 | 2894821315 | 254 |
| 898 | iso_pu_bacteria | 2896384573 | 2896391298 | 254 |
| 899 | iso_pu_bacteria | 2899792073 | 2899793443 | 254 |
| 900 | iso_pu_bacteria | 2899845264 | 2899847644 | 254 |
| 901 | iso_pu_bacteria | 2903448605 | 2903451963 | 254 |
| 902 | iso_pu_bacteria | 2903492973 | 2903499085 | 254 |
| 903 | iso_pu_bacteria | 2903492973 | 2903500236 | 254 |
| 904 | iso_pu_bacteria | 2903513507 | 2903520302 | 254 |
| 905 | iso_pu_bacteria | 2903521522 | 2903523784 | 254 |
| 906 | iso_pu_bacteria | 2903528002 | 2903534355 | 254 |
| 907 | iso_pu_bacteria | 2903540706 | 2903543672 | 254 |
| 908 | iso_pu_bacteria | 2904578770 | 2904582474 | 254 |
| 909 | iso_pu_bacteria | 2904659560 | 2904664138 | 254 |
| 910 | iso_pu_bacteria | 2906308376 | 2906313869 | 254 |
| 911 | iso_pu_bacteria | 2906321335 | 2906326578 | 254 |
| 912 | iso_pu_bacteria | 2906328253 | 2906334846 | 254 |
| 913 | iso_pu_bacteria | 2906354277 | 2906361767 | 254 |
| 914 | iso_pu_bacteria | 2906363423 | 2906370587 | 254 |
| 915 | iso_pu_bacteria | 2906370794 | 2906377254 | 254 |
| 916 | iso_pu_bacteria | 2906378014 | 2906378624 | 254 |
| 917 | iso_pu_bacteria | 2906393657 | 2906397990 | 254 |
| 918 | iso_pu_bacteria | 2906401398 | 2906403551 | 254 |
| 919 | iso_pu_bacteria | 2906408224 | 2906410357 | 254 |
| 920 | iso_pu_bacteria | 2906414383 | 2906420613 | 254 |
| 921 | iso_pu_bacteria | 2906427513 | 2906432880 | 254 |
| 922 | iso_pu_bacteria | 2909042592 | 2909043879 | 254 |
| 923 | iso_pu_bacteria | 2913295892 | 2913301710 | 254 |
| 924 | iso_pu_bacteria | 2913308742 | 2913309602 | 254 |
| 925 | iso_pu_bacteria | 2915650412 | 2915651048 | 254 |
| 926 | iso_pu_bacteria | 2915980308 | 2915981222 | 254 |
| 927 | iso_pu_bacteria | 2915986958 | 2915992233 | 254 |
| 928 | iso_pu_bacteria | 2915993759 | 2915998593 | 254 |
| 929 | iso_pu_bacteria | 2916000859 | 2916005669 | 254 |
| 930 | iso_pu_bacteria | 2916007675 | 2916013523 | 254 |
| 931 | iso_pu_bacteria | 2916014648 | 2916021438 | 254 |
| 932 | iso_pu_bacteria | 2916021584 | 2916026840 | 254 |
| 933 | iso_pu_bacteria | 2916028427 | 2916033036 | 254 |
| 934 | iso_pu_bacteria | 2916035215 | 2916039279 | 254 |
| 935 | iso_pu_bacteria | 2916041962 | 2916046500 | 254 |
| 936 | iso_pu_bacteria | 2916048683 | 2916050504 | 254 |
| 937 | iso_pu_bacteria | 2916055098 | 2916055951 | 254 |
| 938 | iso_pu_bacteria | 2916061851 | 2916062083 | 254 |
| 939 | iso_pu_bacteria | 2916068649 | 2916070755 | 254 |
| 940 | iso_pu_bacteria | 2916076590 | 2916082653 | 254 |
| 941 | iso_pu_bacteria | 2917554339 | 2917556392 | 254 |
| 942 | iso_pu_bacteria | 2919100787 | 2919103463 | 254 |
| 943 | iso_pu_bacteria | 2919114240 | 2919119151 | 254 |
| 944 | iso_pu_bacteria | 2919119836 | 2919123953 | 254 |
| 945 | iso_pu_bacteria | 2919166419 | 2919170185 | 254 |
| 946 | iso_pu_bacteria | 2919408235 | 2919413120 | 254 |
| 947 | iso_pu_bacteria | 2920760137 | 2920761099 | 254 |
| 948 | iso_pu_bacteria | 2920822456 | 2920825722 | 254 |
| 949 | iso_pu_bacteria | 2921201388 | 2921204232 | 254 |
| 950 | iso_pu_bacteria | 2921208531 | 2921210305 | 254 |
| 951 | iso_pu_bacteria | 2921237296 | 2921239341 | 254 |
| 952 | iso_pu_bacteria | 2921244191 | 2921249951 | 254 |
| 953 | iso_pu_bacteria | 2921250672 | 2921251728 | 254 |
| 954 | iso_pu_bacteria | 2921257292 | 2921258882 | 254 |
| 955 | iso_pu_bacteria | 2921263974 | 2921270254 | 254 |
| 956 | iso_pu_bacteria | 2921282425 | 2921287217 | 254 |
| 957 | iso_pu_bacteria | 2921289301 | 2921292025 | 254 |
| 958 | iso_pu_bacteria | 2921296804 | 2921302383 | 254 |
| 959 | iso_pu_bacteria | 2922130491 | 2922138307 | 254 |
| 960 | iso_pu_bacteria | 2922151315 | 2922153102 | 254 |
| 961 | iso_pu_bacteria | 2922158528 | 2922165361 | 254 |
| 962 | iso_pu_bacteria | 2922172374 | 2922178035 | 254 |
| 963 | iso_pu_bacteria | 2922178524 | 2922184152 | 254 |
| 964 | iso_pu_bacteria | 2922185730 | 2922194028 | 254 |
| 965 | iso_pu_bacteria | 2923556063 | 2923556728 | 254 |
| 966 | iso_pu_bacteria | 2924144063 | 2924144924 | 254 |
| 967 | iso_pu_bacteria | 2924150972 | 2924156115 | 254 |
| 968 | iso_pu_bacteria | 2924158325 | 2924159968 | 254 |
| 969 | iso_pu_bacteria | 2924165586 | 2924169480 | 254 |
| 970 | iso_pu_bacteria | 2924172951 | 2924173545 | 254 |
| 971 | iso_pu_bacteria | 2924179722 | 2924183367 | 254 |
| 972 | iso_pu_bacteria | 2924186466 | 2924193172 | 254 |
| 973 | iso_pu_bacteria | 2924193448 | 2924195095 | 254 |
| 974 | iso_pu_bacteria | 2924200457 | 2924201593 | 254 |
| 975 | iso_pu_bacteria | 2924207177 | 2924208206 | 254 |
| 976 | iso_pu_bacteria | 2924214083 | 2924216930 | 254 |
| 977 | iso_pu_bacteria | 2924221636 | 2924227452 | 254 |
| 978 | iso_pu_bacteria | 2924228884 | 2924235221 | 254 |
| 979 | iso_pu_bacteria | 2924710171 | 2924716816 | 254 |
| 980 | iso_pu_bacteria | 2924718760 | 2924726398 | 254 |
| 981 | iso_pu_bacteria | 2924726620 | 2924727946 | 254 |
| 982 | iso_pu_bacteria | 2924733363 | 2924737033 | 254 |
| 983 | iso_pu_bacteria | 2924741084 | 2924746336 | 254 |
| 984 | iso_pu_bacteria | 2924754689 | 2924756723 | 254 |
| 985 | iso_pu_bacteria | 2924762789 | 2924764992 | 254 |
| 986 | iso_pu_bacteria | 2924776078 | 2924781150 | 254 |
| 987 | iso_pu_bacteria | 2924784321 | 2924791589 | 254 |
| 988 | iso_pu_bacteria | 2926754445 | 2926759180 | 254 |
| 989 | iso_pu_bacteria | 2926760298 | 2926763394 | 254 |
| 990 | iso_pu_bacteria | 2928521798 | 2928524811 | 254 |
| 991 | iso_pu_bacteria | 2929138655 | 2929138670 | 254 |
| 992 | iso_pu_bacteria | 2933006813 | 2933010033 | 254 |
| 993 | iso_pu_bacteria | 2933011516 | 2933011518 | 254 |
| 994 | iso_pu_bacteria | 2933016740 | 2933017614 | 254 |
| 995 | iso_pu_bacteria | 2933570622 | 2933576488 | 254 |
| 996 | iso_pu_bacteria | 2933586486 | 2933591783 | 254 |
| 997 | iso_pu_bacteria | 2933594066 | 2933595994 | 254 |
| 998 | iso_pu_bacteria | 2933599457 | 2933602598 | 254 |
| 999 | iso_pu_bacteria | 2935894831 | 2935898250 | 254 |
| 1000 | iso_pu_bacteria | 2935901341 | 2935905752 | 254 |
| 1001 | iso_pu_bacteria | 2936367885 | 2936370190 | 254 |
| 1002 | iso_pu_bacteria | 2936375103 | 2936377862 | 254 |
| 1003 | iso_pu_bacteria | 2936381700 | 2936384150 | 254 |
| 1004 | iso_pu_bacteria | 2936996657 | 2937001224 | 254 |
| 1005 | iso_pu_bacteria | 2937002841 | 2937003934 | 254 |
| 1006 | iso_pu_bacteria | 2937009748 | 2937010756 | 254 |
| 1007 | iso_pu_bacteria | 2937016420 | 2937021795 | 254 |
| 1008 | iso_pu_bacteria | 2937023124 | 2937027411 | 254 |
| 1009 | iso_pu_bacteria | 2937029754 | 2937035710 | 254 |
| 1010 | iso_pu_bacteria | 2937036028 | 2937039373 | 254 |
| 1011 | iso_pu_bacteria | 2937042894 | 2937042930 | 254 |
| 1012 | iso_pu_bacteria | 2937049772 | 2937050361 | 254 |
| 1013 | iso_pu_bacteria | 2937056579 | 2937062850 | 254 |
| 1014 | iso_pu_bacteria | 2937063883 | 2937064569 | 254 |
| 1015 | iso_pu_bacteria | 2937071275 | 2937073262 | 254 |
| 1016 | iso_pu_bacteria | 2937078374 | 2937080772 | 254 |
| 1017 | iso_pu_bacteria | 2937084907 | 2937085374 | 254 |
| 1018 | iso_pu_bacteria | 2937091812 | 2937098124 | 254 |
| 1019 | iso_pu_bacteria | 2937098957 | 2937105570 | 254 |
| 1020 | iso_pu_bacteria | 2937106411 | 2937110904 | 254 |
| 1021 | iso_pu_bacteria | 2937113482 | 2937117604 | 254 |
| 1022 | iso_pu_bacteria | 2937119839 | 2937124435 | 254 |
| 1023 | iso_pu_bacteria | 2937126314 | 2937131493 | 254 |
| 1024 | iso_pu_bacteria | 2937813078 | 2937819825 | 254 |
| 1025 | iso_pu_bacteria | 2937822353 | 2937824323 | 254 |
| 1026 | iso_pu_bacteria | 2937836603 | 2937840483 | 254 |
| 1027 | iso_pu_bacteria | 2937848649 | 2937854941 | 254 |
| 1028 | iso_pu_bacteria | 2937861824 | 2937866658 | 254 |
| 1029 | iso_pu_bacteria | 2937868953 | 2937870345 | 254 |
| 1030 | iso_pu_bacteria | 2937877337 | 2937877574 | 254 |
| 1031 | iso_pu_bacteria | 2937891427 | 2937894248 | 254 |
| 1032 | iso_pu_bacteria | 2937972304 | 2937975343 | 254 |
| 1033 | iso_pu_bacteria | 2937980651 | 2937981607 | 254 |
| 1034 | iso_pu_bacteria | 2937994558 | 2937997521 | 254 |
| 1035 | iso_pu_bacteria | 2938014810 | 2938021671 | 254 |
| 1036 | iso_pu_bacteria | 2939669807 | 2939673710 | 254 |
| 1037 | iso_pu_bacteria | 2941499720 | 2941504507 | 254 |
| 1038 | iso_pu_bacteria | 2954011201 | 2954011230 | 254 |
| 1039 | iso_pu_bacteria | 2957375807 | 2957380615 | 254 |
| 1040 | iso_pu_bacteria | 2957382221 | 2957382593 | 254 |
| 1041 | iso_pu_bacteria | 2957388812 | 2957389429 | 254 |
| 1042 | iso_pu_bacteria | 2957395598 | 2957401973 | 254 |
| 1043 | iso_pu_bacteria | 2957402308 | 2957408395 | 254 |
| 1044 | iso_pu_bacteria | 2957408893 | 2957410150 | 254 |
| 1045 | iso_pu_bacteria | 2957415311 | 2957420039 | 254 |
| 1046 | iso_pu_bacteria | 2957422303 | 2957424793 | 254 |
| 1047 | iso_pu_bacteria | 2957430029 | 2957433654 | 254 |
| 1048 | iso_pu_bacteria | 2957437181 | 2957437525 | 254 |
| 1049 | iso_pu_bacteria | 2957443900 | 2957450647 | 254 |
| 1050 | iso_pu_bacteria | 2957450854 | 2957452240 | 254 |
| 1051 | iso_pu_bacteria | 2957457609 | 2957462656 | 254 |
| 1052 | iso_pu_bacteria | 2957464669 | 2957465611 | 254 |
| 1053 | iso_pu_bacteria | 2957471148 | 2957475715 | 254 |
| 1054 | iso_pu_bacteria | 2957478035 | 2957478983 | 254 |
| 1055 | iso_pu_bacteria | 2957484790 | 2957488882 | 254 |
| 1056 | iso_pu_bacteria | 2957491536 | 2957497915 | 254 |
| 1057 | iso_pu_bacteria | 2957498199 | 2957501767 | 254 |
| 1058 | iso_pu_bacteria | 2957505466 | 2957509920 | 254 |
| 1059 | iso_pu_bacteria | 2958034702 | 2958035533 | 254 |
| 1060 | iso_pu_bacteria | 2958041894 | 2958043720 | 254 |
| 1061 | iso_pu_bacteria | 2958041894 | 2958052539 | 254 |
| 1062 | iso_pu_bacteria | 2958064165 | 2958066917 | 254 |
| 1063 | iso_pu_bacteria | 2958071322 | 2958071392 | 254 |
| 1064 | iso_pu_bacteria | 2958084443 | 2958084682 | 254 |
| 1065 | iso_pu_bacteria | 2958092219 | 2958096630 | 254 |
| 1066 | iso_pu_bacteria | 2958100919 | 2958101872 | 254 |
| 1067 | iso_pu_bacteria | 2958108152 | 2958110322 | 254 |
| 1068 | iso_pu_bacteria | 2958115193 | 2958119461 | 254 |
| 1069 | iso_pu_bacteria | 2958122699 | 2958127135 | 254 |
| 1070 | iso_pu_bacteria | 2958130278 | 2958135449 | 254 |
| 1071 | iso_pu_bacteria | 2958158011 | 2958161333 | 254 |
| 1072 | iso_pu_bacteria | 2958165035 | 2958167994 | 254 |
| 1073 | iso_pu_bacteria | 2958172287 | 2958177415 | 254 |
| 1074 | iso_pu_bacteria | 2958179912 | 2958184478 | 254 |
| 1075 | iso_pu_bacteria | 2960584000 | 2960590583 | 254 |
| 1076 | iso_pu_bacteria | 2960591022 | 2960591885 | 254 |
| 1077 | iso_pu_bacteria | 2960597568 | 2960602031 | 254 |
| 1078 | iso_pu_bacteria | 2960603979 | 2960607908 | 254 |
| 1079 | iso_pu_bacteria | 2960610863 | 2960614790 | 254 |
| 1080 | iso_pu_bacteria | 2960617483 | 2960618073 | 254 |
| 1081 | iso_pu_bacteria | 2960624210 | 2960630024 | 254 |
| 1082 | iso_pu_bacteria | 2960631154 | 2960633906 | 254 |
| 1083 | iso_pu_bacteria | 2960637947 | 2960642603 | 254 |
| 1084 | iso_pu_bacteria | 2960645483 | 2960651188 | 254 |
| 1085 | iso_pu_bacteria | 2960652885 | 2960659469 | 254 |
| 1086 | iso_pu_bacteria | 2960660292 | 2960667202 | 254 |
| 1087 | iso_pu_bacteria | 2960667422 | 2960669932 | 254 |
| 1088 | iso_pu_bacteria | 2960674078 | 2960675287 | 254 |
| 1089 | iso_pu_bacteria | 2960680706 | 2960680729 | 254 |
| 1090 | iso_pu_bacteria | 2960687367 | 2960688671 | 254 |
| 1091 | iso_pu_bacteria | 2960693952 | 2960696512 | 254 |
| 1092 | iso_pu_bacteria | 2961077736 | 2961082533 | 254 |
| 1093 | iso_pu_bacteria | 2961114664 | 2961118722 | 254 |
| 1094 | iso_pu_bacteria | 2961127735 | 2961132463 | 254 |
| 1095 | iso_pu_bacteria | 2961136820 | 2961139302 | 254 |
| 1096 | iso_pu_bacteria | 2961163497 | 2961166460 | 254 |
| 1097 | iso_pu_bacteria | 2961170736 | 2961176618 | 254 |
| 1098 | iso_pu_bacteria | 2961183825 | 2961185623 | 254 |
| 1099 | iso_pu_bacteria | 2963644680 | 2963648267 | 254 |
| 1100 | iso_pu_bacteria | 2964607997 | 2964614879 | 254 |
| 1101 | iso_pu_bacteria | 2964615318 | 2964617099 | 254 |
| 1102 | iso_pu_bacteria | 2964621998 | 2964627196 | 254 |
| 1103 | iso_pu_bacteria | 2964628898 | 2964630389 | 254 |
| 1104 | iso_pu_bacteria | 2964636051 | 2964637710 | 254 |
| 1105 | iso_pu_bacteria | 2964643177 | 2964646325 | 254 |
| 1106 | iso_pu_bacteria | 2964649959 | 2964651173 | 254 |
| 1107 | iso_pu_bacteria | 2964656573 | 2964663289 | 254 |
| 1108 | iso_pu_bacteria | 2964663802 | 2964666285 | 254 |
| 1109 | iso_pu_bacteria | 2964670856 | 2964672664 | 254 |
| 1110 | iso_pu_bacteria | 2964678106 | 2964682453 | 254 |
| 1111 | iso_pu_bacteria | 2964685014 | 2964689375 | 254 |
| 1112 | iso_pu_bacteria | 2964691889 | 2964693915 | 254 |
| 1113 | iso_pu_bacteria | 2964698721 | 2964704777 | 254 |
| 1114 | iso_pu_bacteria | 2964705432 | 2964706424 | 254 |
| 1115 | iso_pu_bacteria | 2964712639 | 2964716461 | 254 |
| 1116 | iso_pu_bacteria | 2964719344 | 2964725738 | 254 |
| 1117 | iso_pu_bacteria | 2965018300 | 2965021280 | 254 |
| 1118 | iso_pu_bacteria | 2965025482 | 2965029605 | 254 |
| 1119 | iso_pu_bacteria | 2965032056 | 2965038414 | 254 |
| 1120 | iso_pu_bacteria | 2965040258 | 2965043753 | 254 |
| 1121 | iso_pu_bacteria | 2965062239 | 2965064279 | 254 |
| 1122 | iso_pu_bacteria | 2965089291 | 2965090560 | 254 |
| 1123 | iso_pu_bacteria | 2965102966 | 2965107386 | 254 |
| 1124 | iso_pu_bacteria | 2965119406 | 2965121413 | 254 |
| 1125 | iso_pu_bacteria | 2967664464 | 2967668423 | 254 |
| 1126 | iso_pu_bacteria | 2967671571 | 2967676207 | 254 |
| 1127 | iso_pu_bacteria | 2967678726 | 2967685898 | 254 |
| 1128 | iso_pu_bacteria | 2967686174 | 2967691001 | 254 |
| 1129 | iso_pu_bacteria | 2967693043 | 2967698984 | 254 |
| 1130 | iso_pu_bacteria | 2967699805 | 2967704340 | 254 |
| 1131 | iso_pu_bacteria | 2967706974 | 2967711601 | 254 |
| 1132 | iso_pu_bacteria | 2967714385 | 2967720461 | 254 |
| 1133 | iso_pu_bacteria | 2967721400 | 2967724396 | 254 |
| 1134 | iso_pu_bacteria | 2967728569 | 2967730999 | 254 |
| 1135 | iso_pu_bacteria | 2967735183 | 2967739938 | 254 |
| 1136 | iso_pu_bacteria | 2967742019 | 2967744523 | 254 |
| 1137 | iso_pu_bacteria | 2967748971 | 2967749382 | 254 |
| 1138 | iso_pu_bacteria | 2967755722 | 2967759580 | 254 |
| 1139 | iso_pu_bacteria | 2967762386 | 2967767208 | 254 |
| 1140 | iso_pu_bacteria | 2967769361 | 2967770500 | 254 |
| 1141 | iso_pu_bacteria | 2967775926 | 2967782433 | 254 |
| 1142 | iso_pu_bacteria | 2967996073 | 2968001367 | 254 |
| 1143 | iso_pu_bacteria | 2968003550 | 2968007420 | 254 |
| 1144 | iso_pu_bacteria | 2968016561 | 2968017919 | 254 |
| 1145 | iso_pu_bacteria | 2968083720 | 2968087663 | 254 |
| 1146 | iso_pu_bacteria | 2968091066 | 2968093895 | 254 |
| 1147 | iso_pu_bacteria | 2968097103 | 2968101374 | 254 |
| 1148 | iso_pu_bacteria | 2968110612 | 2968115277 | 254 |
| 1149 | iso_pu_bacteria | 2968117919 | 2968121897 | 254 |
| 1150 | iso_pu_bacteria | 2968128360 | 2968134172 | 254 |
| 1151 | iso_pu_bacteria | 2968138860 | 2968142729 | 254 |
| 1152 | iso_pu_bacteria | 2968171901 | 2968174864 | 254 |
| 1153 | iso_pu_bacteria | 2970019648 | 2970025757 | 254 |
| 1154 | iso_pu_bacteria | 2970026789 | 2970027509 | 254 |
| 1155 | iso_pu_bacteria | 2970033650 | 2970036058 | 254 |
| 1156 | iso_pu_bacteria | 2970040964 | 2970046115 | 254 |
| 1157 | iso_pu_bacteria | 2970047711 | 2970048396 | 254 |
| 1158 | iso_pu_bacteria | 2970054988 | 2970057258 | 254 |
| 1159 | iso_pu_bacteria | 2970061556 | 2970064734 | 254 |
| 1160 | iso_pu_bacteria | 2970068827 | 2970071067 | 254 |
| 1161 | iso_pu_bacteria | 2970076120 | 2970082493 | 254 |
| 1162 | iso_pu_bacteria | 2970082768 | 2970083632 | 254 |
| 1163 | iso_pu_bacteria | 2970088815 | 2970094197 | 254 |
| 1164 | iso_pu_bacteria | 2970095765 | 2970102144 | 254 |
| 1165 | iso_pu_bacteria | 2970102677 | 2970104445 | 254 |
| 1166 | iso_pu_bacteria | 2970109326 | 2970115035 | 254 |
| 1167 | iso_pu_bacteria | 2970116247 | 2970120633 | 254 |
| 1168 | iso_pu_bacteria | 2970122695 | 2970123419 | 254 |
| 1169 | iso_pu_bacteria | 2970129317 | 2970135925 | 254 |
| 1170 | iso_pu_bacteria | 2970136068 | 2970140850 | 254 |
| 1171 | iso_pu_bacteria | 2970143518 | 2970144806 | 254 |
| 1172 | iso_pu_bacteria | 2970149975 | 2970154926 | 254 |
| 1173 | iso_pu_bacteria | 2970156795 | 2970161342 | 254 |
| 1174 | iso_pu_bacteria | 2970164137 | 2970168349 | 254 |
| 1175 | iso_pu_bacteria | 2970170962 | 2970173880 | 254 |
| 1176 | iso_pu_bacteria | 2970177841 | 2970181033 | 254 |
| 1177 | iso_pu_bacteria | 2970184632 | 2970184972 | 254 |
| 1178 | iso_pu_bacteria | 2970191845 | 2970196075 | 254 |
| 1179 | iso_pu_bacteria | 2970469710 | 2970471906 | 254 |
| 1180 | iso_pu_bacteria | 2970489779 | 2970492695 | 254 |
| 1181 | iso_pu_bacteria | 2970503327 | 2970509289 | 254 |
| 1182 | iso_pu_bacteria | 2970510686 | 2970513065 | 254 |
| 1183 | iso_pu_bacteria | 2970524798 | 2970529723 | 254 |
| 1184 | iso_pu_bacteria | 2970540015 | 2970545327 | 254 |
| 1185 | iso_pu_bacteria | 2970547951 | 2970549392 | 254 |
| 1186 | iso_pu_bacteria | 2970554993 | 2970557934 | 254 |
| 1187 | iso_pu_bacteria | 2970593180 | 2970593989 | 254 |
| 1188 | iso_pu_bacteria | 2970619444 | 2970620327 | 254 |
| 1189 | iso_pu_bacteria | 2970627176 | 2970631339 | 254 |
| 1190 | iso_pu_bacteria | 2977516862 | 2977519385 | 254 |
| 1191 | iso_pu_bacteria | 2977523885 | 2977530476 | 254 |
| 1192 | iso_pu_bacteria | 2977530762 | 2977536319 | 254 |
| 1193 | iso_pu_bacteria | 2977537788 | 2977543263 | 254 |
| 1194 | iso_pu_bacteria | 2977544691 | 2977546458 | 254 |
| 1195 | iso_pu_bacteria | 2977551784 | 2977553099 | 254 |
| 1196 | iso_pu_bacteria | 2977558990 | 2977565217 | 254 |
| 1197 | iso_pu_bacteria | 2977565890 | 2977567022 | 254 |
| 1198 | iso_pu_bacteria | 2977572785 | 2977574372 | 254 |
| 1199 | iso_pu_bacteria | 2977579622 | 2977585872 | 254 |
| 1200 | iso_pu_bacteria | 2977821940 | 2977824578 | 254 |
| 1201 | iso_pu_bacteria | 2977828996 | 2977831351 | 254 |
| 1202 | iso_pu_bacteria | 2977843712 | 2977845546 | 254 |
| 1203 | iso_pu_bacteria | 2977858184 | 2977864694 | 254 |
| 1204 | iso_pu_bacteria | 2977864932 | 2977866551 | 254 |
| 1205 | iso_pu_bacteria | 2977872689 | 2977874770 | 254 |
| 1206 | iso_pu_bacteria | 2977907340 | 2977913177 | 254 |
| 1207 | iso_pu_bacteria | 2977915119 | 2977916355 | 254 |
| 1208 | iso_pu_bacteria | 2977922695 | 2977929388 | 254 |
| 1209 | iso_pu_bacteria | 2977935797 | 2977940154 | 254 |
| 1210 | iso_pu_bacteria | 2977942078 | 2977950632 | 254 |
| 1211 | iso_pu_bacteria | 2977950692 | 2977951457 | 254 |
| 1212 | iso_pu_bacteria | 2977957713 | 2977963069 | 254 |
| 1213 | iso_pu_bacteria | 2977971508 | 2977978364 | 254 |
| 1214 | iso_pu_bacteria | 2977986579 | 2977987596 | 254 |
| 1215 | iso_pu_bacteria | 2978969890 | 2978970187 | 254 |
| 1216 | iso_pu_bacteria | 2979089926 | 2979091573 | 254 |
| 1217 | iso_pu_bacteria | 2979095461 | 2979097094 | 254 |
| 1218 | iso_pu_bacteria | 2979710463 | 2979717195 | 254 |
| 1219 | iso_pu_bacteria | 2979742915 | 2979750779 | 254 |
| 1220 | iso_pu_bacteria | 2979764755 | 2979770021 | 254 |
| 1221 | iso_pu_bacteria | 2979772303 | 2979778464 | 254 |
| 1222 | iso_pu_bacteria | 2979779861 | 2979782976 | 254 |
| 1223 | iso_pu_bacteria | 2979793036 | 2979799555 | 254 |
| 1224 | iso_pu_bacteria | 2979808191 | 2979813968 | 254 |
| 1225 | iso_pu_bacteria | 2984587000 | 2984587214 | 254 |
| 1226 | iso_pu_bacteria | 2987636660 | 2987641146 | 254 |
| 1227 | iso_pu_bacteria | 2987645492 | 2987652061 | 254 |
| 1228 | iso_pu_bacteria | 2987652177 | 2987659187 | 254 |
| 1229 | iso_pu_bacteria | 2987659509 | 2987662470 | 254 |
| 1230 | iso_pu_bacteria | 2987666974 | 2987667898 | 254 |
| 1231 | iso_pu_bacteria | 2987673487 | 2987675014 | 254 |
| 1232 | iso_pu_bacteria | 2989349275 | 2989352529 | 254 |
| 1233 | iso_pu_bacteria | 2989771324 | 2989773983 | 254 |
| 1234 | iso_pu_bacteria | 2989776772 | 2989780771 | 254 |
| 1235 | iso_pu_bacteria | 2996341866 | 2996347779 | 254 |
| 1236 | iso_pu_bacteria | 2996348954 | 2996350835 | 254 |
| 1237 | iso_pu_bacteria | 2996386984 | 2996392996 | 254 |
| 1238 | iso_pu_bacteria | 2996887358 | 2996888650 | 254 |
| 1239 | iso_pu_bacteria | 2996893221 | 2996896961 | 254 |
| 1240 | iso_pu_bacteria | 3000135777 | 3000138562 | 254 |
| 1241 | iso_pu_bacteria | 3000135777 | 3000139733 | 254 |
| 1242 | iso_pu_bacteria | 3002141150 | 3002145481 | 254 |
| 1243 | iso_pu_bacteria | 3003930520 | 3003935539 | 254 |
| 1244 | iso_pu_bacteria | 3004167301 | 3004169505 | 254 |
| 1245 | iso_pu_bacteria | 3004188549 | 3004191520 | 254 |
| 1246 | iso_pu_bacteria | 3004195979 | 3004198594 | 254 |
| 1247 | iso_pu_bacteria | 3004203850 | 3004209959 | 254 |
| 1248 | iso_pu_bacteria | 3004211236 | 3004211754 | 254 |
| 1249 | iso_pu_bacteria | 3004218560 | 3004219001 | 254 |
| 1250 | iso_pu_bacteria | 3004232784 | 3004235921 | 254 |
| 1251 | iso_pu_bacteria | 3004239961 | 3004245669 | 254 |
| 1252 | iso_pu_bacteria | 3004248173 | 3004254023 | 254 |
| 1253 | iso_pu_bacteria | 3004268573 | 3004274658 | 254 |
| 1254 | iso_pu_bacteria | 3004275668 | 3004277533 | 254 |
| 1255 | iso_pu_bacteria | 3004334049 | 3004341093 | 254 |
| 1256 | iso_pu_bacteria | 3005409236 | 3005416287 | 254 |
| 1257 | iso_pu_bacteria | 3005416602 | 3005421943 | 254 |
| 1258 | iso_pu_bacteria | 3005445848 | 3005451458 | 254 |
| 1259 | iso_pu_bacteria | 3005452660 | 3005456761 | 254 |
| 1260 | iso_pu_bacteria | 637000159 | 637074002 | 254 |
| 1261 | iso_pu_bacteria | 639633055 | 639651715 | 254 |
| 1262 | iso_pu_bacteria | 643692032 | 643826744 | 254 |
| 1263 | iso_pu_bacteria | 648276728 | 648738782 | 254 |
| 1264 | iso_pu_bacteria | 649633066 | 649874008 | 254 |
| 1265 | iso_pu_bacteria | 650716007 | 650842843 | 254 |
| 1266 | iso_pu_bacteria | 8002285264 | 8002287276 | 254 |
| 1267 | iso_pu_bacteria | 8003570095 | 8003574443 | 254 |
| 1268 | iso_pu_bacteria | 8003992118 | 8003994521 | 254 |
| 1269 | iso_pu_bacteria | 8003999396 | 8004002216 | 254 |
| 1270 | iso_pu_bacteria | 8004300914 | 8004307448 | 254 |
| 1271 | iso_pu_bacteria | 8004312739 | 8004320804 | 254 |
| 1272 | iso_pu_bacteria | 8004361976 | 8004369132 | 254 |
| 1273 | iso_pu_bacteria | 8004374579 | 8004377018 | 254 |
| 1274 | iso_pu_bacteria | 8004387939 | 8004393338 | 254 |
| 1275 | iso_pu_bacteria | 8004445564 | 8004446339 | 254 |
| 1276 | iso_pu_bacteria | 8004633249 | 8004633320 | 254 |
| 1277 | iso_pu_bacteria | 8004640170 | 8004644320 | 254 |
| 1278 | iso_pu_bacteria | 8004695233 | 8004698225 | 254 |
| 1279 | iso_pu_bacteria | 8004703790 | 8004707045 | 254 |
| 1280 | iso_pu_bacteria | 8004714634 | 8004720125 | 254 |
| 1281 | iso_pu_bacteria | 8004727605 | 8004734272 | 254 |
| 1282 | iso_pu_bacteria | 8005246636 | 8005250597 | 254 |
| 1283 | iso_pu_bacteria | 8005258706 | 8005264418 | 254 |
| 1284 | iso_pu_bacteria | 8005275841 | 8005277155 | 254 |
| 1285 | iso_pu_bacteria | 8005282627 | 8005287841 | 254 |
| 1286 | iso_pu_bacteria | 8005289223 | 8005290653 | 254 |
| 1287 | iso_pu_bacteria | 8005301065 | 8005305025 | 254 |
| 1288 | iso_pu_bacteria | 8005307578 | 8005313120 | 254 |
| 1289 | iso_pu_bacteria | 8005314921 | 8005321225 | 254 |
| 1290 | iso_pu_bacteria | 8005321885 | 8005323177 | 254 |
| 1291 | iso_pu_bacteria | 8005376324 | 8005381871 | 254 |
| 1292 | iso_pu_bacteria | 8005382845 | 8005388479 | 254 |
| 1293 | iso_pu_bacteria | 8005395548 | 8005397645 | 254 |
| 1294 | iso_pu_bacteria | 8005430974 | 8005436996 | 254 |
| 1295 | iso_pu_bacteria | 8005460587 | 8005466801 | 254 |
| 1296 | iso_pu_bacteria | 8005484373 | 8005490034 | 254 |
| 1297 | iso_pu_bacteria | 8005497431 | 8005503072 | 254 |
| 1298 | iso_pu_bacteria | 8005542996 | 8005547732 | 254 |
| 1299 | iso_pu_bacteria | 8005556819 | 8005562113 | 254 |
| 1300 | iso_pu_bacteria | 8005563573 | 8005567131 | 254 |
| 1301 | iso_pu_bacteria | 8005570704 | 8005576298 | 254 |
| 1302 | iso_pu_bacteria | 8005619151 | 8005625591 | 254 |
| 1303 | iso_pu_bacteria | 8005626139 | 8005630614 | 254 |
| 1304 | iso_pu_bacteria | 8005645114 | 8005650910 | 254 |
| 1305 | iso_pu_bacteria | 8005668836 | 8005674990 | 254 |
| 1306 | iso_pu_bacteria | 8005682033 | 8005688170 | 254 |
| 1307 | iso_pu_bacteria | 8005688590 | 8005689431 | 254 |
| 1308 | iso_pu_bacteria | 8005695170 | 8005701933 | 254 |
| 1309 | iso_pu_bacteria | 8018127388 | 8018130455 | 254 |
| 1310 | iso_pu_bacteria | 8018163183 | 8018165904 | 254 |
| 1311 | iso_pu_bacteria | 8018176218 | 8018182230 | 254 |
| 1312 | iso_pu_bacteria | 8023680758 | 8023682367 | 254 |
| 1313 | iso_pu_bacteria | 8024479707 | 8024484155 | 254 |
| 1314 | iso_pu_bacteria | 8024486573 | 8024492855 | 254 |
| 1315 | iso_pu_bacteria | 8024501048 | 8024505581 | 254 |
| 1316 | iso_pu_bacteria | 8046767195 | 8046773915 | 254 |
| 1317 | iso_pu_bacteria | 8049293176 | 8049295688 | 254 |
| 1318 | iso_pu_bacteria | 8054558443 | 8054560445 | 254 |
| 1319 | iso_pu_bacteria | 8055617313 | 8055622683 | 254 |
| 1320 | iso_pu_bacteria | 8056375014 | 8056375187 | 254 |
| 1321 | iso_pu_bacteria | 8056382006 | 8056383516 | 254 |
| 1322 | iso_pu_bacteria | 8057575449 | 8057576258 | 254 |
| 1323 | iso_pu_bacteria | 8057874678 | 8057878337 | 254 |
| 1324 | 3300003792 | Ga0055540_1022297 | Ga0055540_10222972 | 255 |
| 1325 | 3300005295 | Ga0065707_10026737 | Ga0065707_100267371 | 255 |
| 1326 | 3300005353 | Ga0070669_100010155 | Ga0070669_1000101558 | 255 |
| 1327 | 3300005356 | Ga0070674_100001722 | Ga0070674_1000017224 | 255 |
| 1328 | 3300005459 | Ga0068867_100270193 | Ga0068867_1002701931 | 255 |
| 1329 | 3300005546 | Ga0070696_100073348 | Ga0070696_1000733482 | 255 |
| 1330 | 3300005719 | Ga0068861_100327653 | Ga0068861_1003276532 | 255 |
| 1331 | 3300005844 | Ga0068862_100157312 | Ga0068862_1001573122 | 255 |
| 1332 | 3300005981 | Ga0081538_10002181 | Ga0081538_1000218118 | 255 |
| 1333 | 3300005981 | Ga0081538_10015390 | Ga0081538_100153905 | 255 |
| 1334 | 3300005985 | Ga0081539_10010083 | Ga0081539_100100837 | 255 |
| 1335 | 3300006195 | Ga0075366_10151175 | Ga0075366_101511752 | 255 |
| 1336 | 3300009094 | Ga0111539_10000123 | Ga0111539_1000012352 | 255 |
| 1337 | 3300009551 | Ga0105238_10377350 | Ga0105238_103773502 | 255 |
| 1338 | 3300025302 | Ga0207426_1028627 | Ga0207426_10286272 | 255 |
| 1339 | 3300025937 | Ga0207669_10006701 | Ga0207669_100067012 | 255 |
| 1340 | 3300025938 | Ga0207704_10346230 | Ga0207704_103462301 | 255 |
| 1341 | 3300026089 | Ga0207648_10236538 | Ga0207648_102365382 | 255 |
| 1342 | 3300027907 | Ga0207428_10000133 | Ga0207428_1000013328 | 255 |
| 1343 | 3300031456 | Ga0307513_10028096 | Ga0307513_100280965 | 255 |
| 1344 | 3300031616 | Ga0307508_10210604 | Ga0307508_102106042 | 255 |
| 1345 | 3300031824 | Ga0307413_10050395 | Ga0307413_100503952 | 255 |
| 1346 | 3300031911 | Ga0307412_10286358 | Ga0307412_102863582 | 255 |
| 1347 | 3300031995 | Ga0307409_100033770 | Ga0307409_1000337704 | 255 |
| 1348 | 3300032005 | Ga0307411_10060082 | Ga0307411_100600822 | 255 |
| 1349 | 3300049574 | Ga0501038_0097401 | Ga0501038_0097401_870_1703 | 255 |
| 1350 | 3300049583 | Ga0501067_0081931 | Ga0501067_0081931_940_1773 | 255 |
| 1351 | 3300049823 | Ga0501044_0019019 | Ga0501044_0019019_5591_6424 | 255 |
| 1352 | 3300050496 | nmdc:mga07m45_31123_c1 | nmdc:mga07m45_31123_c1_1755_2588 | 255 |
| 1353 | 3300050507 | nmdc:mga05p37_305941_c1 | nmdc:mga05p37_305941_c1_856_1692 | 255 |
| 1354 | 3300050511 | nmdc:mga08y16_44_c1 | nmdc:mga08y16_44_c1_20355_21191 | 255 |
| 1355 | 3300053093 | Ga0500651_0086229 | Ga0500651_0086229_676_1509 | 255 |
| 1356 | 3300053096 | Ga0500641_0055833 | Ga0500641_0055833_12_845 | 255 |
| 1357 | 3300053103 | Ga0500555_026090 | Ga0500555_026090_562_1395 | 255 |
| 1358 | 3300053118 | Ga0500594_0033298 | Ga0500594_0033298_282_1115 | 255 |
| 1359 | 3300053119 | Ga0500595_006666 | Ga0500595_006666_882_1715 | 255 |
| 1360 | 3300053130 | Ga0500642_0002981 | Ga0500642_0002981_45_878 | 255 |
| 1361 | 3300053146 | Ga0500588_0049259 | Ga0500588_0049259_437_1270 | 255 |
| 1362 | 3300053146 | Ga0500588_0063539 | Ga0500588_0063539_330_1163 | 255 |
| 1363 | 3300053160 | Ga0500633_0085069 | Ga0500633_0085069_170_1003 | 255 |
| 1364 | 3300053731 | Ga0500609_000048 | Ga0500609_000048_11461_12294 | 255 |
| 1365 | 3300053731 | Ga0500609_012055 | Ga0500609_012055_159_992 | 255 |
| 1366 | 3300059421 | Ga0590071_004505 | Ga0590071_004505_868_1704 | 255 |
| 1367 | 3300059424 | Ga0590075_002537 | Ga0590075_002537_120_956 | 255 |
| 1368 | 3300059426 | Ga0590077_010994 | Ga0590077_010994_452_1288 | 255 |
| 1369 | 3300003856 | Ga0058692_1008266 | Ga0058692_10082663 | 256 |
| 1370 | 3300005293 | Ga0065715_10033325 | Ga0065715_100333252 | 256 |
| 1371 | 3300005367 | Ga0070667_100442686 | Ga0070667_1004426862 | 256 |
| 1372 | 3300005439 | Ga0070711_100205272 | Ga0070711_1002052722 | 256 |
| 1373 | 3300005468 | Ga0070707_100007996 | Ga0070707_1000079968 | 256 |
| 1374 | 3300005471 | Ga0070698_100496819 | Ga0070698_1004968191 | 256 |
| 1375 | 3300005518 | Ga0070699_100241157 | Ga0070699_1002411572 | 256 |
| 1376 | 3300005546 | Ga0070696_100341458 | Ga0070696_1003414581 | 256 |
| 1377 | 3300005548 | Ga0070665_100483833 | Ga0070665_1004838332 | 256 |
| 1378 | 3300006051 | Ga0075364_10096538 | Ga0075364_100965382 | 256 |
| 1379 | 3300009011 | Ga0105251_10030323 | Ga0105251_100303234 | 256 |
| 1380 | 3300009036 | Ga0105244_10001791 | Ga0105244_1000179114 | 256 |
| 1381 | 3300009036 | Ga0105244_10014154 | Ga0105244_100141543 | 256 |
| 1382 | 3300011119 | Ga0105246_10010396 | Ga0105246_100103962 | 256 |
| 1383 | 3300013100 | Ga0157373_10004331 | Ga0157373_1000433110 | 256 |
| 1384 | 3300013102 | Ga0157371_10001454 | Ga0157371_1000145428 | 256 |
| 1385 | 3300025711 | Ga0207696_1000076 | Ga0207696_100007698 | 256 |
| 1386 | 3300025728 | Ga0207655_1014385 | Ga0207655_10143857 | 256 |
| 1387 | 3300025728 | Ga0207655_1071084 | Ga0207655_10710842 | 256 |
| 1388 | 3300025735 | Ga0207713_1038463 | Ga0207713_10384632 | 256 |
| 1389 | 3300025922 | Ga0207646_10047164 | Ga0207646_100471642 | 256 |
| 1390 | 3300027312 | Ga0209371_1004561 | Ga0209371_10045613 | 256 |
| 1391 | 3300028379 | Ga0268266_10190337 | Ga0268266_101903372 | 256 |
| 1392 | 3300028380 | Ga0268265_10392935 | Ga0268265_103929352 | 256 |
| 1393 | 3300030500 | Ga0268256_1015885 | Ga0268256_10158853 | 256 |
| 1394 | 3300035725 | Ga0373947_0133152 | Ga0373947_0133152_159_995 | 256 |
| 1395 | 3300037068 | Ga0373925_0060324 | Ga0373925_0060324_1207_2043 | 256 |
| 1396 | 3300048904 | Ga0496101_0000023 | Ga0496101_0000023_85543_86367 | 256 |
| 1397 | 3300048913 | Ga0496110_0283493 | Ga0496110_0283493_74_919 | 256 |
| 1398 | 3300048919 | Ga0496116_0009455 | Ga0496116_0009455_3040_3864 | 256 |
| 1399 | 3300048920 | Ga0496117_0019866 | Ga0496117_0019866_2779_3603 | 256 |
| 1400 | 3300048922 | Ga0496119_0028726 | Ga0496119_0028726_2406_3230 | 256 |
| 1401 | 3300048923 | Ga0496120_0001086 | Ga0496120_0001086_6162_6986 | 256 |
| 1402 | 3300048925 | Ga0496122_0006562 | Ga0496122_0006562_3769_4593 | 256 |
| 1403 | 3300048926 | Ga0496123_0019603 | Ga0496123_0019603_1118_1942 | 256 |
| 1404 | 3300048927 | Ga0496124_0034006 | Ga0496124_0034006_801_1625 | 256 |
| 1405 | 3300049571 | Ga0501034_0001016 | Ga0501034_0001016_10922_11764 | 256 |
| 1406 | 3300050491 | nmdc:mga00v17_24964_c1 | nmdc:mga00v17_24964_c1_1537_2361 | 256 |
| 1407 | 3300053153 | Ga0500616_0001121 | Ga0500616_0001121_26491_27327 | 256 |
| 1408 | 3300002705 | JGI25156J39149_1009617 | JGI25156J39149_10096172 | 257 |
| 1409 | 3300002741 | JGI25157J39369_1003024 | JGI25157J39369_10030242 | 257 |
| 1410 | 3300003187 | JGI25151J46595_10001194 | JGI25151J46595_100011944 | 257 |
| 1411 | 3300003214 | JGI25165J46597_1000206 | JGI25165J46597_100020622 | 257 |
| 1412 | 3300003215 | JGI25153J46596_10022279 | JGI25153J46596_100222792 | 257 |
| 1413 | 3300003762 | Ga0055542_1000947 | Ga0055542_100094710 | 257 |
| 1414 | 3300003762 | Ga0055542_1001298 | Ga0055542_10012986 | 257 |
| 1415 | 3300003763 | Ga0055529_1005284 | Ga0055529_10052842 | 257 |
| 1416 | 3300005339 | Ga0070660_100128224 | Ga0070660_1001282242 | 257 |
| 1417 | 3300005539 | Ga0068853_100357110 | Ga0068853_1003571101 | 257 |
| 1418 | 3300005614 | Ga0068856_100485317 | Ga0068856_1004853172 | 257 |
| 1419 | 3300005616 | Ga0068852_100237316 | Ga0068852_1002373162 | 257 |
| 1420 | 3300005983 | Ga0081540_1071406 | Ga0081540_10714062 | 257 |
| 1421 | 3300006038 | Ga0075365_10190182 | Ga0075365_101901822 | 257 |
| 1422 | 3300006048 | Ga0075363_100129012 | Ga0075363_1001290121 | 257 |
| 1423 | 3300006881 | Ga0068865_100362889 | Ga0068865_1003628892 | 257 |
| 1424 | 3300009093 | Ga0105240_10330935 | Ga0105240_103309352 | 257 |
| 1425 | 3300009148 | Ga0105243_10410444 | Ga0105243_104104442 | 257 |
| 1426 | 3300009553 | Ga0105249_10353592 | Ga0105249_103535922 | 257 |
| 1427 | 3300010375 | Ga0105239_10230990 | Ga0105239_102309902 | 257 |
| 1428 | 3300010375 | Ga0105239_10475843 | Ga0105239_104758431 | 257 |
| 1429 | 3300013100 | Ga0157373_10240529 | Ga0157373_102405292 | 257 |
| 1430 | 3300013296 | Ga0157374_10469475 | Ga0157374_104694751 | 257 |
| 1431 | 3300025250 | Ga0209026_1000050 | Ga0209026_100005039 | 257 |
| 1432 | 3300025254 | Ga0209148_1000050 | Ga0209148_100005015 | 257 |
| 1433 | 3300025256 | Ga0209759_1000229 | Ga0209759_100022968 | 257 |
| 1434 | 3300025261 | Ga0209233_1000034 | Ga0209233_1000034157 | 257 |
| 1435 | 3300025261 | Ga0209233_1005432 | Ga0209233_10054322 | 257 |
| 1436 | 3300025272 | Ga0209455_1000507 | Ga0209455_100050715 | 257 |
| 1437 | 3300025294 | Ga0209025_1000077 | Ga0209025_1000077110 | 257 |
| 1438 | 3300025297 | Ga0209758_1002011 | Ga0209758_10020118 | 257 |
| 1439 | 3300025919 | Ga0207657_10054577 | Ga0207657_100545773 | 257 |
| 1440 | 3300025961 | Ga0207712_10181007 | Ga0207712_101810072 | 257 |
| 1441 | 3300026118 | Ga0207675_100026208 | Ga0207675_1000262087 | 257 |
| 1442 | 3300026142 | Ga0207698_10084832 | Ga0207698_100848322 | 257 |
| 1443 | 3300028379 | Ga0268266_10127196 | Ga0268266_101271963 | 257 |
| 1444 | 3300031616 | Ga0307508_10335188 | Ga0307508_103351882 | 257 |
| 1445 | 3300037418 | Ga0395900_0018190 | Ga0395900_0018190_3319_4167 | 257 |
| 1446 | 3300038443 | Ga0395901_0108026 | Ga0395901_0108026_1810_2658 | 257 |
| 1447 | 3300039447 | Ga0436361_0034602 | Ga0436361_0034602_198_1046 | 257 |
| 1448 | 3300039450 | Ga0436363_0274728 | Ga0436363_0274728_2235_3083 | 257 |
| 1449 | 3300044658 | Ga0466972_0046222 | Ga0466972_0046222_376_1224 | 257 |
| 1450 | 3300046458 | Ga0495591_000803 | Ga0495591_000803_17464_18291 | 257 |
| 1451 | 3300046471 | Ga0495650_0000113 | Ga0495650_0000113_113327_114154 | 257 |
| 1452 | 3300046474 | Ga0495605_0099869 | Ga0495605_0099869_130_957 | 257 |
| 1453 | 3300046491 | Ga0495584_0002744 | Ga0495584_0002744_7842_8669 | 257 |
| 1454 | 3300046518 | Ga0495631_0036456 | Ga0495631_0036456_1214_2041 | 257 |
| 1455 | 3300046523 | Ga0495644_0001112 | Ga0495644_0001112_7943_8770 | 257 |
| 1456 | 3300046524 | Ga0495648_0018790 | Ga0495648_0018790_2591_3418 | 257 |
| 1457 | 3300046530 | Ga0495654_0000124 | Ga0495654_0000124_3775_4602 | 257 |
| 1458 | 3300046794 | Ga0495589_0039901 | Ga0495589_0039901_1013_1840 | 257 |
| 1459 | 3300046810 | Ga0495660_0000034 | Ga0495660_0000034_54281_55108 | 257 |
| 1460 | 3300047320 | Ga0495672_0000029 | Ga0495672_0000029_123709_124536 | 257 |
| 1461 | 3300047469 | Ga0495673_0000092 | Ga0495673_0000092_171552_172379 | 257 |
| 1462 | 3300048908 | Ga0496105_0294200 | Ga0496105_0294200_151_999 | 257 |
| 1463 | 3300048914 | Ga0496111_0123945 | Ga0496111_0123945_664_1512 | 257 |
| 1464 | 3300048915 | Ga0496112_0028761 | Ga0496112_0028761_4246_5094 | 257 |
| 1465 | 3300048915 | Ga0496112_0047536 | Ga0496112_0047536_2322_3170 | 257 |
| 1466 | 3300048915 | Ga0496112_0622845 | Ga0496112_0622845_34_873 | 257 |
| 1467 | 3300048918 | Ga0496115_0100983 | Ga0496115_0100983_667_1515 | 257 |
| 1468 | 3300048919 | Ga0496116_0005820 | Ga0496116_0005820_4152_4979 | 257 |
| 1469 | 3300048922 | Ga0496119_0010451 | Ga0496119_0010451_1830_2657 | 257 |
| 1470 | 3300048922 | Ga0496119_0058948 | Ga0496119_0058948_415_1263 | 257 |
| 1471 | 3300048923 | Ga0496120_0000032 | Ga0496120_0000032_23373_24200 | 257 |
| 1472 | 3300048927 | Ga0496124_0236713 | Ga0496124_0236713_264_1112 | 257 |
| 1473 | 3300048929 | Ga0496126_0186957 | Ga0496126_0186957_452_1300 | 257 |
| 1474 | 3300049459 | Ga0495678_001299 | Ga0495678_001299_5627_6454 | 257 |
| 1475 | 3300049460 | Ga0495682_0000003 | Ga0495682_0000003_171435_172262 | 257 |
| 1476 | 3300050490 | nmdc:mga03n38_92522_c1 | nmdc:mga03n38_92522_c1_528_1376 | 257 |
| 1477 | 3300050491 | nmdc:mga00v17_152240_c1 | nmdc:mga00v17_152240_c1_344_1192 | 257 |
| 1478 | 3300050491 | nmdc:mga00v17_24063_c1 | nmdc:mga00v17_24063_c1_2499_3347 | 257 |
| 1479 | 3300050492 | nmdc:mga0yw44_36719_c1 | nmdc:mga0yw44_36719_c1_1041_1889 | 257 |
| 1480 | 3300050496 | nmdc:mga07m45_50630_c1 | nmdc:mga07m45_50630_c1_619_1467 | 257 |
| 1481 | 3300053126 | Ga0500621_000006 | Ga0500621_000006_159779_160606 | 257 |
| 1482 | 3300053139 | Ga0500568_0021697 | Ga0500568_0021697_243_1091 | 257 |
| 1483 | 3300053153 | Ga0500616_0035927 | Ga0500616_0035927_1328_2176 | 257 |
| 1484 | 3300046507 | Ga0495606_0000374 | Ga0495606_0000374_49552_50382 | 258 |
| 1485 | iso_pu_bacteria | 2585427591 | 2585829462 | 258 |
| 1486 | iso_pu_bacteria | 2585427592 | 2585834827 | 258 |
| 1487 | iso_pu_bacteria | 2667528173 | 2671109943 | 258 |
| 1488 | iso_pu_bacteria | 2904474040 | 2904477225 | 258 |
| 1489 | iso_pu_bacteria | 2919150387 | 2919153392 | 258 |
| 1490 | iso_pu_bacteria | 2927143783 | 2927144018 | 258 |
| 1491 | 3300039062 | Ga0400483_065417 | Ga0400483_065417_1739_2590 | 260 |
| 1492 | 2162886007 | SwRhRL2b_contig_999527 | SwRhRL2b_0261.00003920 | 262 |
| 1493 | 3300002737 | JGI25162J39368_1000009 | JGI25162J39368_1000009212 | 262 |
| 1494 | 3300002771 | JGI25163J39215_1000765 | JGI25163J39215_10007656 | 262 |
| 1495 | 3300002772 | JGI25164J39214_1000002 | JGI25164J39214_1000002135 | 262 |
| 1496 | 3300003751 | Ga0055538_1000015 | Ga0055538_1000015136 | 262 |
| 1497 | 3300003752 | Ga0055539_1000009 | Ga0055539_1000009227 | 262 |
| 1498 | 3300003756 | Ga0055533_1000012 | Ga0055533_1000012134 | 262 |
| 1499 | 3300003759 | Ga0055525_1000014 | Ga0055525_1000014227 | 262 |
| 1500 | 3300003841 | Ga0055541_1000006 | Ga0055541_1000006134 | 262 |
| 1501 | 3300005289 | Ga0065704_10000959 | Ga0065704_100009595 | 262 |
| 1502 | 3300009036 | Ga0105244_10001340 | Ga0105244_100013405 | 262 |
| 1503 | 3300009092 | Ga0105250_10004385 | Ga0105250_100043856 | 262 |
| 1504 | 3300025207 | Ga0209760_100051 | Ga0209760_10005139 | 262 |
| 1505 | 3300025224 | Ga0209784_100001 | Ga0209784_1000012019 | 262 |
| 1506 | 3300025225 | Ga0209566_100001 | Ga0209566_1000012019 | 262 |
| 1507 | 3300025226 | Ga0209674_100002 | Ga0209674_1000022019 | 262 |
| 1508 | 3300025230 | Ga0209563_100002 | Ga0209563_100002554 | 262 |
| 1509 | 3300025231 | Ga0207427_100020 | Ga0207427_100020222 | 262 |
| 1510 | 3300025233 | Ga0209437_100001 | Ga0209437_100001554 | 262 |
| 1511 | 3300025253 | Ga0209677_100002 | Ga0209677_100002554 | 262 |
| 1512 | 3300025711 | Ga0207696_1000396 | Ga0207696_100039628 | 262 |
| 1513 | 3300025728 | Ga0207655_1000413 | Ga0207655_100041312 | 262 |
| 1514 | 3300046471 | Ga0495650_0000043 | Ga0495650_0000043_245797_246639 | 262 |
| 1515 | 3300046810 | Ga0495660_0000012 | Ga0495660_0000012_173215_174057 | 262 |
| 1516 | 3300048919 | Ga0496116_0000066 | Ga0496116_0000066_172413_173255 | 262 |
| 1517 | 3300048920 | Ga0496117_0013982 | Ga0496117_0013982_2691_3533 | 262 |
| 1518 | 3300048921 | Ga0496118_0022829 | Ga0496118_0022829_3550_4392 | 262 |
| 1519 | 3300048922 | Ga0496119_0045882 | Ga0496119_0045882_1454_2296 | 262 |
| 1520 | 3300048923 | Ga0496120_0008032 | Ga0496120_0008032_2826_3668 | 262 |
| 1521 | 3300048925 | Ga0496122_0000110 | Ga0496122_0000110_169823_170665 | 262 |
| 1522 | 3300048926 | Ga0496123_0000081 | Ga0496123_0000081_19478_20320 | 262 |
| 1523 | 3300048927 | Ga0496124_0000530 | Ga0496124_0000530_11631_12473 | 262 |
| 1524 | 3300048928 | Ga0496125_0000033 | Ga0496125_0000033_97159_98001 | 262 |
| 1525 | 3300048929 | Ga0496126_0001066 | Ga0496126_0001066_33862_34704 | 262 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
102
289
0.9
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hpn-assembly1.cif.gz_B | lpqy-sugabc in state 3 | 0.7628 | 11 | 254 |
| 8hpr-assembly1.cif.gz_B | lpqy-sugabc in state 4 | 0.7593 | 9 | 246 |
| 2r6g-assembly1.cif.gz_G | the crystal structure of the e. coli maltose transporter | 0.7348 | 11 | 262 |
| 7cad-assembly1.cif.gz_B | mycobacterium smegmatis sugabc complex | 0.7292 | 11 | 262 |
| 8ja7-assembly1.cif.gz_B | cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose | 0.7179 | 11 | 258 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1E7_1_266_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7849 | 4 | 248 | 1.10.3720.10 |
| af_I6Y1U3_2_266_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7716 | 10 | 252 | 1.10.3720.10 |
| af_P9WG01_5_265_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7637 | 14 | 252 | 1.10.3720.10 |
| af_O53483_6_271_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7579 | 4 | 252 | 1.10.3720.10 |
| 2r6gG01 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7457 | 11 | 248 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C4D325-F1-model_v4 | Carbohydrate ABC transporter permease | 0.8315 | 7 | 262 |
GO:0005886
GO:0055085 |
| AF-A0A5Q4G8K8-F1-model_v4 | Carbohydrate ABC transporter permease | 0.83 | 16 | 262 |
GO:0005886
GO:0055085 |
| AF-A0A316JGE5-F1-model_v4 | Carbohydrate ABC transporter permease | 0.8227 | 10 | 258 |
GO:0005886
GO:0055085 |
| AF-A0A6B1D8H8-F1-model_v4 | Carbohydrate ABC transporter permease | 0.8226 | 1 | 262 |
GO:0005886
GO:0055085 |
| AF-A0A6B1D8H8-F1-model_v4 | Carbohydrate ABC transporter permease | 0.8197 | 1 | 262 |
GO:0005886
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar