F494542
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1522 | 601 | 3044 | 103 |
Family's Representative Sequence
| Representative Sequence | 3300025290|Ga0207673_1069421|Ga0207673_10694212 |
| Length | 107 |
| Sequence | MASSIRVRATTSGETTEVQALIQHPMDSGFVKDAKGEIIPAHFIQQLTFEYDGKNVFTADWGGGVSKDPYVKFAFKGGKKGDELKISWVDNKGAAFEQTAQIAFSTT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 10 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 14 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 85 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 91 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 93 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 94 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 96 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 97 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 98 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 99 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 100 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 104 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 105 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 106 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 107 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 109 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 110 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 111 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 112 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 113 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 114 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 115 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 117 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 118 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 119 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 120 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 121 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 122 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 137 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 140 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 141 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 142 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 143 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 155 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 159 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 161 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 162 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 163 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 164 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 238 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 239 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 240 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 241 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 242 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 246 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 247 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 248 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 249 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 250 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 251 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 252 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 253 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 254 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 255 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 256 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 257 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 258 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 259 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 260 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 261 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 262 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 263 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 264 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 265 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 266 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 267 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 268 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 269 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 270 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 271 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 272 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 273 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 275 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 276 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 277 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 278 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 279 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 280 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 281 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 282 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 283 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 284 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 285 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 286 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 287 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 288 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 289 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 291 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 292 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 293 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 294 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 295 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 296 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 297 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 298 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 299 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 300 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 301 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 302 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 303 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 304 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 305 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 306 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 307 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 308 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 309 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 310 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 311 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 312 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 313 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 314 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 315 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 316 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 317 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 318 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 319 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 320 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 321 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 322 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 323 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 324 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 325 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 326 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 416 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 417 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 418 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 419 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 420 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 421 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 422 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 423 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 424 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 425 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 426 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 427 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 428 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 429 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 430 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 431 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 432 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 433 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 434 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 435 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 436 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 437 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 438 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 439 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 440 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 462 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 463 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 464 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 465 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 466 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 467 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 468 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 469 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 477 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 480 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 481 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 485 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 486 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 487 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 488 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 489 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 490 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 491 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 492 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 493 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 494 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 495 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 496 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 497 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 498 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 499 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 500 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 501 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 502 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 503 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 504 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 505 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 506 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 507 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 508 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 509 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 510 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 511 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 512 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 513 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 514 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 515 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 516 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 517 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 518 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 519 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 520 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 521 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 522 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 523 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 524 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 525 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 526 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 527 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 528 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 529 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 530 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 531 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 532 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 533 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 534 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 535 | 2791355199 | |||
| 536 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 537 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 538 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 539 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 540 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 541 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 542 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 543 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 544 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 545 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 546 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 547 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 548 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 549 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 550 | 2904699407 | |||
| 551 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 552 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 553 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 554 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 555 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 556 | 2922368715 | |||
| 557 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 558 | 2922425934 | |||
| 559 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 560 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 561 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 562 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 563 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 564 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 565 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 566 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 567 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 568 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 569 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 570 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 571 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 572 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 573 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 574 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 575 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 576 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 577 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 578 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 579 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 580 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 581 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 582 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 583 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 584 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 585 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 586 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 587 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 588 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 589 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 590 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 591 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 592 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 593 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 594 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 595 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 596 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 597 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 598 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 599 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 600 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 601 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.8 |
| Metatranscriptomes | 0.07 |
| Isolates | 5.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.41 |
| Nodule | 4.86 |
| Rhizoplane | 7.75 |
| Rhizosphere | 73.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207673_1069421 | 3300025290 | Bacteria | 502 |
| 2 | JGI24752J21851_1044791 | 3300001976 | Bacteria | 596 |
| 3 | JGI24740J21852_10195787 | 3300001979 | Bacteria | 501 |
| 4 | JGI24739J22299_10021915 | 3300001989 | Bacteria | 2270 |
| 5 | JGI24737J22298_10057219 | 3300001990 | Bacteria | 1177 |
| 6 | JGI24737J22298_10252199 | 3300001990 | Bacteria | 521 |
| 7 | JGI24743J22301_10134990 | 3300001991 | Bacteria | 547 |
| 8 | JGI24738J21930_10022662 | 3300002075 | Bacteria | 1297 |
| 9 | JGI24744J21845_10004758 | 3300002077 | Bacteria | 2806 |
| 10 | JGI24034J26672_10102219 | 3300002239 | Bacteria | 541 |
| 11 | JGI24034J26672_10124046 | 3300002239 | Bacteria | 502 |
| 12 | JGI24742J22300_10125870 | 3300002244 | Bacteria | 508 |
| 13 | JGI25165J46597_1030557 | 3300003214 | Bacteria | 695 |
| 14 | JGI25153J46596_10024263 | 3300003215 | Bacteria | 2189 |
| 15 | JGI25153J46596_10112511 | 3300003215 | Bacteria | 623 |
| 16 | JGI25404J52841_10077790 | 3300003659 | Bacteria | 693 |
| 17 | Ga0055525_1006276 | 3300003759 | Bacteria | 1007 |
| 18 | JGI25405J52794_10015161 | 3300003911 | Bacteria | 1511 |
| 19 | Ga0065712_10514385 | 3300005290 | Bacteria | 640 |
| 20 | Ga0065715_10137956 | 3300005293 | Bacteria | 1899 |
| 21 | Ga0065715_10405338 | 3300005293 | Bacteria | 876 |
| 22 | Ga0070658_10503964 | 3300005327 | Bacteria | 1046 |
| 23 | Ga0070676_10120315 | 3300005328 | Bacteria | 1647 |
| 24 | Ga0070676_10976317 | 3300005328 | Bacteria | 635 |
| 25 | Ga0070683_100574077 | 3300005329 | Bacteria | 1079 |
| 26 | Ga0070683_101598612 | 3300005329 | Bacteria | 627 |
| 27 | Ga0070690_100655805 | 3300005330 | Bacteria | 802 |
| 28 | Ga0070670_100097588 | 3300005331 | Bacteria | 2528 |
| 29 | Ga0070670_100210948 | 3300005331 | Bacteria | 1689 |
| 30 | Ga0070670_100395926 | 3300005331 | Bacteria | 1219 |
| 31 | Ga0070670_100462141 | 3300005331 | Bacteria | 1126 |
| 32 | Ga0070670_100535041 | 3300005331 | Bacteria | 1044 |
| 33 | Ga0070670_102011878 | 3300005331 | Bacteria | 532 |
| 34 | Ga0070677_10279218 | 3300005333 | Bacteria | 841 |
| 35 | Ga0068869_100062357 | 3300005334 | Bacteria | 2736 |
| 36 | Ga0068869_100188818 | 3300005334 | Bacteria | 1619 |
| 37 | Ga0068869_100319154 | 3300005334 | Bacteria | 1259 |
| 38 | Ga0068869_100478502 | 3300005334 | Bacteria | 1036 |
| 39 | Ga0068869_100735749 | 3300005334 | Bacteria | 843 |
| 40 | Ga0070666_10329846 | 3300005335 | Bacteria | 1089 |
| 41 | Ga0070666_10508400 | 3300005335 | Bacteria | 874 |
| 42 | Ga0070680_100023524 | 3300005336 | Bacteria | 4914 |
| 43 | Ga0070682_100807615 | 3300005337 | Bacteria | 763 |
| 44 | Ga0070682_100904053 | 3300005337 | Bacteria | 726 |
| 45 | Ga0070682_102067858 | 3300005337 | Bacteria | 502 |
| 46 | Ga0068868_100146708 | 3300005338 | Bacteria | 1941 |
| 47 | Ga0068868_100170158 | 3300005338 | Bacteria | 1803 |
| 48 | Ga0068868_100204587 | 3300005338 | Bacteria | 1647 |
| 49 | Ga0068868_100464905 | 3300005338 | Bacteria | 1102 |
| 50 | Ga0068868_100683894 | 3300005338 | Bacteria | 916 |
| 51 | Ga0068868_101333190 | 3300005338 | Bacteria | 667 |
| 52 | Ga0068868_102431287 | 3300005338 | Bacteria | 501 |
| 53 | Ga0070660_100466445 | 3300005339 | Bacteria | 1049 |
| 54 | Ga0070689_100710968 | 3300005340 | Bacteria | 878 |
| 55 | Ga0070689_101583565 | 3300005340 | Bacteria | 595 |
| 56 | Ga0070691_10063088 | 3300005341 | Bacteria | 1786 |
| 57 | Ga0070661_100082222 | 3300005344 | Bacteria | 2378 |
| 58 | Ga0070661_100501402 | 3300005344 | Bacteria | 972 |
| 59 | Ga0070661_101019303 | 3300005344 | Unclassified | 687 |
| 60 | Ga0070692_10450460 | 3300005345 | Bacteria | 824 |
| 61 | Ga0070692_10934402 | 3300005345 | Bacteria | 602 |
| 62 | Ga0070668_100020513 | 3300005347 | Bacteria | 4988 |
| 63 | Ga0070668_100095069 | 3300005347 | Bacteria | 2353 |
| 64 | Ga0070668_100105741 | 3300005347 | Bacteria | 2235 |
| 65 | Ga0070668_100112658 | 3300005347 | Bacteria | 2166 |
| 66 | Ga0070668_100161650 | 3300005347 | Bacteria | 1817 |
| 67 | Ga0070668_100344680 | 3300005347 | Bacteria | 1259 |
| 68 | Ga0070668_100591650 | 3300005347 | Bacteria | 970 |
| 69 | Ga0070668_100875740 | 3300005347 | Bacteria | 801 |
| 70 | Ga0070668_100894163 | 3300005347 | Bacteria | 793 |
| 71 | Ga0070669_100067918 | 3300005353 | Bacteria | 2631 |
| 72 | Ga0070669_100265816 | 3300005353 | Bacteria | 1370 |
| 73 | Ga0070669_101020846 | 3300005353 | Bacteria | 710 |
| 74 | Ga0070669_101321167 | 3300005353 | Bacteria | 625 |
| 75 | Ga0070675_100031306 | 3300005354 | Bacteria | 4300 |
| 76 | Ga0070675_100410615 | 3300005354 | Bacteria | 1209 |
| 77 | Ga0070675_100558513 | 3300005354 | Bacteria | 1036 |
| 78 | Ga0070675_100719807 | 3300005354 | Bacteria | 910 |
| 79 | Ga0070671_100001877 | 3300005355 | Bacteria | 16060 |
| 80 | Ga0070671_100057317 | 3300005355 | Bacteria | 3241 |
| 81 | Ga0070671_100079034 | 3300005355 | Bacteria | 2749 |
| 82 | Ga0070671_100092874 | 3300005355 | Bacteria | 2529 |
| 83 | Ga0070671_100535097 | 3300005355 | Bacteria | 1010 |
| 84 | Ga0070674_100041817 | 3300005356 | Bacteria | 3109 |
| 85 | Ga0070674_100122561 | 3300005356 | Bacteria | 1927 |
| 86 | Ga0070674_100167870 | 3300005356 | Bacteria | 1671 |
| 87 | Ga0070674_100799887 | 3300005356 | Bacteria | 814 |
| 88 | Ga0070674_101128780 | 3300005356 | Bacteria | 693 |
| 89 | Ga0070674_101639773 | 3300005356 | Bacteria | 581 |
| 90 | Ga0070673_100064549 | 3300005364 | Bacteria | 2918 |
| 91 | Ga0070673_100090954 | 3300005364 | Bacteria | 2494 |
| 92 | Ga0070673_100403484 | 3300005364 | Bacteria | 1223 |
| 93 | Ga0070688_100119237 | 3300005365 | Bacteria | 1765 |
| 94 | Ga0070688_100705644 | 3300005365 | Bacteria | 782 |
| 95 | Ga0070688_101785130 | 3300005365 | Bacteria | 505 |
| 96 | Ga0070659_100173077 | 3300005366 | Bacteria | 1769 |
| 97 | Ga0070659_100617798 | 3300005366 | Bacteria | 932 |
| 98 | Ga0070667_100193565 | 3300005367 | Bacteria | 1802 |
| 99 | Ga0070667_100214817 | 3300005367 | Bacteria | 1710 |
| 100 | Ga0070667_100275175 | 3300005367 | Bacteria | 1510 |
| 101 | Ga0070667_100535062 | 3300005367 | Bacteria | 1076 |
| 102 | Ga0070667_100636867 | 3300005367 | Unclassified | 984 |
| 103 | Ga0070709_10708744 | 3300005434 | Bacteria | 784 |
| 104 | Ga0070714_100419921 | 3300005435 | Bacteria | 1267 |
| 105 | Ga0070714_100465866 | 3300005435 | Bacteria | 1202 |
| 106 | Ga0070714_102494168 | 3300005435 | Bacteria | 502 |
| 107 | Ga0070713_101049574 | 3300005436 | Bacteria | 787 |
| 108 | Ga0070710_11411803 | 3300005437 | Bacteria | 521 |
| 109 | Ga0070701_10676541 | 3300005438 | Bacteria | 692 |
| 110 | Ga0070711_101339397 | 3300005439 | Bacteria | 622 |
| 111 | Ga0070705_100291635 | 3300005440 | Bacteria | 1165 |
| 112 | Ga0070700_100950241 | 3300005441 | Unclassified | 703 |
| 113 | Ga0070700_101336461 | 3300005441 | Bacteria | 603 |
| 114 | Ga0070700_101883965 | 3300005441 | Bacteria | 517 |
| 115 | Ga0070694_100702185 | 3300005444 | Bacteria | 822 |
| 116 | Ga0070694_100850500 | 3300005444 | Bacteria | 751 |
| 117 | Ga0070694_101191001 | 3300005444 | Bacteria | 638 |
| 118 | Ga0070663_100005344 | 3300005455 | Bacteria | 7623 |
| 119 | Ga0070663_100029905 | 3300005455 | Bacteria | 3727 |
| 120 | Ga0070663_100066818 | 3300005455 | Bacteria | 2606 |
| 121 | Ga0070663_100068130 | 3300005455 | Bacteria | 2583 |
| 122 | Ga0070663_100092861 | 3300005455 | Bacteria | 2238 |
| 123 | Ga0070663_100116537 | 3300005455 | Bacteria | 2013 |
| 124 | Ga0070663_100158224 | 3300005455 | Bacteria | 1742 |
| 125 | Ga0070663_100217826 | 3300005455 | Bacteria | 1497 |
| 126 | Ga0070663_100515882 | 3300005455 | Bacteria | 994 |
| 127 | Ga0070663_100870154 | 3300005455 | Bacteria | 777 |
| 128 | Ga0070663_101607202 | 3300005455 | Bacteria | 580 |
| 129 | Ga0070678_100060739 | 3300005456 | Bacteria | 2783 |
| 130 | Ga0070678_100159057 | 3300005456 | Bacteria | 1828 |
| 131 | Ga0070678_100201609 | 3300005456 | Bacteria | 1642 |
| 132 | Ga0070678_100238721 | 3300005456 | Bacteria | 1519 |
| 133 | Ga0070678_100635020 | 3300005456 | Bacteria | 956 |
| 134 | Ga0070678_100858280 | 3300005456 | Bacteria | 828 |
| 135 | Ga0070678_101015869 | 3300005456 | Bacteria | 763 |
| 136 | Ga0070678_101513040 | 3300005456 | Bacteria | 629 |
| 137 | Ga0070662_100069945 | 3300005457 | Bacteria | 2585 |
| 138 | Ga0070662_100113397 | 3300005457 | Bacteria | 2068 |
| 139 | Ga0070662_100129713 | 3300005457 | Bacteria | 1942 |
| 140 | Ga0070662_100387962 | 3300005457 | Bacteria | 1151 |
| 141 | Ga0070662_100691538 | 3300005457 | Unclassified | 862 |
| 142 | Ga0070662_100846803 | 3300005457 | Bacteria | 779 |
| 143 | Ga0070662_101549466 | 3300005457 | Bacteria | 572 |
| 144 | Ga0070681_10017850 | 3300005458 | Bacteria | 7091 |
| 145 | Ga0070681_10075708 | 3300005458 | Bacteria | 3325 |
| 146 | Ga0070681_11985184 | 3300005458 | Bacteria | 510 |
| 147 | Ga0068867_100040545 | 3300005459 | Bacteria | 3399 |
| 148 | Ga0068867_100395975 | 3300005459 | Bacteria | 1164 |
| 149 | Ga0068867_100783106 | 3300005459 | Bacteria | 849 |
| 150 | Ga0068867_100827894 | 3300005459 | Bacteria | 828 |
| 151 | Ga0068867_101422410 | 3300005459 | Bacteria | 644 |
| 152 | Ga0070685_11030807 | 3300005466 | Bacteria | 619 |
| 153 | Ga0070706_101116188 | 3300005467 | Bacteria | 726 |
| 154 | Ga0070707_100417084 | 3300005468 | Bacteria | 1303 |
| 155 | Ga0070707_102055847 | 3300005468 | Bacteria | 539 |
| 156 | Ga0070698_100717158 | 3300005471 | Bacteria | 942 |
| 157 | Ga0070699_100076497 | 3300005518 | Bacteria | 2913 |
| 158 | Ga0070679_100016197 | 3300005530 | Bacteria | 7181 |
| 159 | Ga0070684_100486351 | 3300005535 | Bacteria | 1143 |
| 160 | Ga0070684_101137982 | 3300005535 | Bacteria | 734 |
| 161 | Ga0070697_100004451 | 3300005536 | Bacteria | 10767 |
| 162 | Ga0070697_100135729 | 3300005536 | Bacteria | 2066 |
| 163 | Ga0068853_100161116 | 3300005539 | Bacteria | 2025 |
| 164 | Ga0068853_100465173 | 3300005539 | Bacteria | 1191 |
| 165 | Ga0068853_100559794 | 3300005539 | Bacteria | 1084 |
| 166 | Ga0068853_100614682 | 3300005539 | Bacteria | 1033 |
| 167 | Ga0068853_100972901 | 3300005539 | Bacteria | 816 |
| 168 | Ga0070672_100066208 | 3300005543 | Bacteria | 2860 |
| 169 | Ga0070672_100071717 | 3300005543 | Bacteria | 2756 |
| 170 | Ga0070672_100155105 | 3300005543 | Bacteria | 1896 |
| 171 | Ga0070672_100441775 | 3300005543 | Bacteria | 1120 |
| 172 | Ga0070672_100479031 | 3300005543 | Bacteria | 1074 |
| 173 | Ga0070686_100168236 | 3300005544 | Bacteria | 1548 |
| 174 | Ga0070686_100493701 | 3300005544 | Bacteria | 949 |
| 175 | Ga0070686_101258045 | 3300005544 | Bacteria | 617 |
| 176 | Ga0070695_100600882 | 3300005545 | Bacteria | 864 |
| 177 | Ga0070696_100004044 | 3300005546 | Bacteria | 9779 |
| 178 | Ga0070693_101366634 | 3300005547 | Bacteria | 550 |
| 179 | Ga0070665_100073912 | 3300005548 | Bacteria | 3415 |
| 180 | Ga0070665_100077066 | 3300005548 | Bacteria | 3340 |
| 181 | Ga0070665_100119741 | 3300005548 | Bacteria | 2634 |
| 182 | Ga0070665_100157407 | 3300005548 | Bacteria | 2273 |
| 183 | Ga0070665_100163266 | 3300005548 | Bacteria | 2230 |
| 184 | Ga0070665_100179577 | 3300005548 | Bacteria | 2117 |
| 185 | Ga0070665_100248456 | 3300005548 | Bacteria | 1779 |
| 186 | Ga0070665_100329487 | 3300005548 | Bacteria | 1531 |
| 187 | Ga0070665_100507035 | 3300005548 | Unclassified | 1218 |
| 188 | Ga0070665_100811717 | 3300005548 | Bacteria | 948 |
| 189 | Ga0070665_100862365 | 3300005548 | Bacteria | 918 |
| 190 | Ga0070665_101590078 | 3300005548 | Bacteria | 662 |
| 191 | Ga0070665_102220081 | 3300005548 | Bacteria | 553 |
| 192 | Ga0070665_102539250 | 3300005548 | Bacteria | 514 |
| 193 | Ga0070704_100166364 | 3300005549 | Bacteria | 1749 |
| 194 | Ga0070704_100500104 | 3300005549 | Bacteria | 1055 |
| 195 | Ga0068855_100024487 | 3300005563 | Bacteria | 7221 |
| 196 | Ga0068855_100056894 | 3300005563 | Bacteria | 4585 |
| 197 | Ga0068855_100391792 | 3300005563 | Bacteria | 1524 |
| 198 | Ga0068855_100631088 | 3300005563 | Bacteria | 1153 |
| 199 | Ga0070664_100211131 | 3300005564 | Bacteria | 1735 |
| 200 | Ga0070664_100238206 | 3300005564 | Bacteria | 1633 |
| 201 | Ga0070664_100295224 | 3300005564 | Bacteria | 1463 |
| 202 | Ga0070664_101035900 | 3300005564 | Bacteria | 772 |
| 203 | Ga0068857_100090741 | 3300005577 | Bacteria | 2734 |
| 204 | Ga0068854_100481961 | 3300005578 | Bacteria | 1041 |
| 205 | Ga0068854_100845743 | 3300005578 | Bacteria | 801 |
| 206 | Ga0068854_101019839 | 3300005578 | Bacteria | 734 |
| 207 | Ga0068854_101600086 | 3300005578 | Bacteria | 594 |
| 208 | Ga0068856_100056023 | 3300005614 | Bacteria | 3890 |
| 209 | Ga0068856_100179411 | 3300005614 | Bacteria | 2130 |
| 210 | Ga0068856_100227402 | 3300005614 | Bacteria | 1881 |
| 211 | Ga0068856_100421406 | 3300005614 | Bacteria | 1355 |
| 212 | Ga0068856_101375046 | 3300005614 | Bacteria | 721 |
| 213 | Ga0068856_101604781 | 3300005614 | Bacteria | 664 |
| 214 | Ga0070702_100355009 | 3300005615 | Bacteria | 1034 |
| 215 | Ga0070702_100494706 | 3300005615 | Bacteria | 897 |
| 216 | Ga0070702_100973243 | 3300005615 | Bacteria | 670 |
| 217 | Ga0070702_101126228 | 3300005615 | Bacteria | 629 |
| 218 | Ga0068852_100089252 | 3300005616 | Bacteria | 2755 |
| 219 | Ga0068852_101875406 | 3300005616 | Bacteria | 622 |
| 220 | Ga0068852_101986698 | 3300005616 | Bacteria | 604 |
| 221 | Ga0068852_102610686 | 3300005616 | Bacteria | 525 |
| 222 | Ga0068859_100047364 | 3300005617 | Bacteria | 4319 |
| 223 | Ga0068859_100488623 | 3300005617 | Bacteria | 1326 |
| 224 | Ga0068859_100610383 | 3300005617 | Bacteria | 1184 |
| 225 | Ga0068859_101281148 | 3300005617 | Bacteria | 808 |
| 226 | Ga0068864_100083102 | 3300005618 | Bacteria | 2812 |
| 227 | Ga0068864_100105122 | 3300005618 | Bacteria | 2509 |
| 228 | Ga0068864_100132872 | 3300005618 | Bacteria | 2238 |
| 229 | Ga0068864_100612450 | 3300005618 | Bacteria | 1058 |
| 230 | Ga0068864_102142255 | 3300005618 | Bacteria | 566 |
| 231 | Ga0068866_10013320 | 3300005718 | Bacteria | 3605 |
| 232 | Ga0068866_10303705 | 3300005718 | Bacteria | 998 |
| 233 | Ga0068866_11138574 | 3300005718 | Bacteria | 561 |
| 234 | Ga0068861_100078768 | 3300005719 | Bacteria | 2574 |
| 235 | Ga0068861_100349039 | 3300005719 | Unclassified | 1297 |
| 236 | Ga0068861_100812324 | 3300005719 | Bacteria | 878 |
| 237 | Ga0068861_102011202 | 3300005719 | Bacteria | 576 |
| 238 | Ga0068861_102502096 | 3300005719 | Bacteria | 520 |
| 239 | Ga0068851_10320260 | 3300005834 | Bacteria | 896 |
| 240 | Ga0068870_10024241 | 3300005840 | Bacteria | 3000 |
| 241 | Ga0068870_10099778 | 3300005840 | Bacteria | 1639 |
| 242 | Ga0068870_10541088 | 3300005840 | Bacteria | 783 |
| 243 | Ga0068863_100391681 | 3300005841 | Bacteria | 1358 |
| 244 | Ga0068863_100437199 | 3300005841 | Bacteria | 1283 |
| 245 | Ga0068863_100579479 | 3300005841 | Bacteria | 1109 |
| 246 | Ga0068863_102174242 | 3300005841 | Bacteria | 565 |
| 247 | Ga0068863_102429550 | 3300005841 | Bacteria | 533 |
| 248 | Ga0068858_100170116 | 3300005842 | Bacteria | 2054 |
| 249 | Ga0068858_100498234 | 3300005842 | Bacteria | 1177 |
| 250 | Ga0068858_100795333 | 3300005842 | Bacteria | 923 |
| 251 | Ga0068858_100845982 | 3300005842 | Bacteria | 893 |
| 252 | Ga0068858_101018503 | 3300005842 | Bacteria | 812 |
| 253 | Ga0068860_100048315 | 3300005843 | Bacteria | 4055 |
| 254 | Ga0068860_100184421 | 3300005843 | Bacteria | 2017 |
| 255 | Ga0068860_100192407 | 3300005843 | Bacteria | 1974 |
| 256 | Ga0068860_100725409 | 3300005843 | Bacteria | 1004 |
| 257 | Ga0068860_100764295 | 3300005843 | Bacteria | 978 |
| 258 | Ga0068860_100807953 | 3300005843 | Bacteria | 951 |
| 259 | Ga0068860_102236253 | 3300005843 | Bacteria | 568 |
| 260 | Ga0068862_100072737 | 3300005844 | Bacteria | 2970 |
| 261 | Ga0068862_100443256 | 3300005844 | Bacteria | 1223 |
| 262 | Ga0068862_100583737 | 3300005844 | Bacteria | 1071 |
| 263 | Ga0068862_100847633 | 3300005844 | Bacteria | 895 |
| 264 | Ga0068862_101112348 | 3300005844 | Bacteria | 785 |
| 265 | Ga0081455_10006300 | 3300005937 | Bacteria | 12756 |
| 266 | Ga0081455_10006921 | 3300005937 | Bacteria | 12061 |
| 267 | Ga0081455_10023250 | 3300005937 | Bacteria | 5773 |
| 268 | Ga0081455_10031610 | 3300005937 | Bacteria | 4785 |
| 269 | Ga0081455_10065139 | 3300005937 | Bacteria | 3049 |
| 270 | Ga0081455_10132001 | 3300005937 | Bacteria | 1952 |
| 271 | Ga0081455_11040593 | 3300005937 | Bacteria | 506 |
| 272 | Ga0081538_10032860 | 3300005981 | Bacteria | 3465 |
| 273 | Ga0081540_1002991 | 3300005983 | Bacteria | 13549 |
| 274 | Ga0081540_1003839 | 3300005983 | Bacteria | 11755 |
| 275 | Ga0081540_1005442 | 3300005983 | Bacteria | 9502 |
| 276 | Ga0081540_1005804 | 3300005983 | Bacteria | 9136 |
| 277 | Ga0081540_1016025 | 3300005983 | Bacteria | 4718 |
| 278 | Ga0081540_1020260 | 3300005983 | Bacteria | 4009 |
| 279 | Ga0081540_1084572 | 3300005983 | Bacteria | 1416 |
| 280 | Ga0081540_1113094 | 3300005983 | Bacteria | 1143 |
| 281 | Ga0081540_1130387 | 3300005983 | Bacteria | 1028 |
| 282 | Ga0081539_10000048 | 3300005985 | Bacteria | 272906 |
| 283 | Ga0081539_10000530 | 3300005985 | Bacteria | 79454 |
| 284 | Ga0081539_10050176 | 3300005985 | Bacteria | 2363 |
| 285 | Ga0081539_10051204 | 3300005985 | Bacteria | 2330 |
| 286 | Ga0081539_10244445 | 3300005985 | Bacteria | 801 |
| 287 | Ga0070717_10910367 | 3300006028 | Bacteria | 801 |
| 288 | Ga0075365_10017775 | 3300006038 | Bacteria | 4359 |
| 289 | Ga0075365_10060788 | 3300006038 | Bacteria | 2521 |
| 290 | Ga0075365_10155141 | 3300006038 | Bacteria | 1594 |
| 291 | Ga0075365_10299015 | 3300006038 | Bacteria | 1133 |
| 292 | Ga0075365_10580751 | 3300006038 | Bacteria | 793 |
| 293 | Ga0075365_10631181 | 3300006038 | Bacteria | 757 |
| 294 | Ga0075368_10007497 | 3300006042 | Bacteria | 3848 |
| 295 | Ga0075368_10022410 | 3300006042 | Bacteria | 2405 |
| 296 | Ga0075368_10088178 | 3300006042 | Bacteria | 1267 |
| 297 | Ga0075368_10206187 | 3300006042 | Bacteria | 833 |
| 298 | Ga0075368_10221025 | 3300006042 | Bacteria | 805 |
| 299 | Ga0075363_100038051 | 3300006048 | Bacteria | 2528 |
| 300 | Ga0075363_100042275 | 3300006048 | Bacteria | 2407 |
| 301 | Ga0075363_100057153 | 3300006048 | Bacteria | 2093 |
| 302 | Ga0075363_100492048 | 3300006048 | Bacteria | 727 |
| 303 | Ga0075363_100568309 | 3300006048 | Bacteria | 677 |
| 304 | Ga0075364_10044838 | 3300006051 | Bacteria | 2877 |
| 305 | Ga0075364_10124008 | 3300006051 | Bacteria | 1730 |
| 306 | Ga0075364_11156462 | 3300006051 | Bacteria | 525 |
| 307 | Ga0075432_10504298 | 3300006058 | Bacteria | 540 |
| 308 | Ga0070715_10353674 | 3300006163 | Bacteria | 803 |
| 309 | Ga0070716_100153248 | 3300006173 | Bacteria | 1485 |
| 310 | Ga0070716_100482051 | 3300006173 | Bacteria | 911 |
| 311 | Ga0070712_100020761 | 3300006175 | Bacteria | 4302 |
| 312 | Ga0075362_10101204 | 3300006177 | Bacteria | 1347 |
| 313 | Ga0075362_10108671 | 3300006177 | Bacteria | 1304 |
| 314 | Ga0075367_10036197 | 3300006178 | Bacteria | 2861 |
| 315 | Ga0075367_10124896 | 3300006178 | Bacteria | 1587 |
| 316 | Ga0075367_10142643 | 3300006178 | Bacteria | 1484 |
| 317 | Ga0075367_10158624 | 3300006178 | Bacteria | 1406 |
| 318 | Ga0075367_10189044 | 3300006178 | Bacteria | 1285 |
| 319 | Ga0075367_10440437 | 3300006178 | Bacteria | 825 |
| 320 | Ga0075369_10018011 | 3300006186 | Bacteria | 2871 |
| 321 | Ga0075369_10027822 | 3300006186 | Bacteria | 2365 |
| 322 | Ga0075369_10208213 | 3300006186 | Bacteria | 903 |
| 323 | Ga0075369_10265837 | 3300006186 | Bacteria | 798 |
| 324 | Ga0075366_10294510 | 3300006195 | Bacteria | 992 |
| 325 | Ga0075366_10840185 | 3300006195 | Bacteria | 571 |
| 326 | Ga0097621_100083441 | 3300006237 | Bacteria | 2663 |
| 327 | Ga0097621_100183983 | 3300006237 | Bacteria | 1806 |
| 328 | Ga0097621_100658663 | 3300006237 | Unclassified | 961 |
| 329 | Ga0097621_101584182 | 3300006237 | Bacteria | 622 |
| 330 | Ga0097621_101917153 | 3300006237 | Bacteria | 566 |
| 331 | Ga0097621_102435346 | 3300006237 | Bacteria | 501 |
| 332 | Ga0075370_10112237 | 3300006353 | Bacteria | 1583 |
| 333 | Ga0075370_10174721 | 3300006353 | Bacteria | 1263 |
| 334 | Ga0075370_10204812 | 3300006353 | Bacteria | 1164 |
| 335 | Ga0075370_10392905 | 3300006353 | Bacteria | 832 |
| 336 | Ga0075370_10627614 | 3300006353 | Bacteria | 652 |
| 337 | Ga0068871_100054328 | 3300006358 | Bacteria | 3249 |
| 338 | Ga0068871_100167157 | 3300006358 | Bacteria | 1884 |
| 339 | Ga0068871_100202872 | 3300006358 | Bacteria | 1712 |
| 340 | Ga0068871_100632250 | 3300006358 | Bacteria | 976 |
| 341 | Ga0068871_100724482 | 3300006358 | Bacteria | 913 |
| 342 | Ga0075428_100251556 | 3300006844 | Bacteria | 1905 |
| 343 | Ga0075428_100524829 | 3300006844 | Bacteria | 1266 |
| 344 | Ga0075433_10021008 | 3300006852 | Bacteria | 5469 |
| 345 | Ga0075433_11418037 | 3300006852 | Bacteria | 601 |
| 346 | Ga0075434_100105793 | 3300006871 | Bacteria | 2823 |
| 347 | Ga0075434_100138919 | 3300006871 | Bacteria | 2449 |
| 348 | Ga0075434_100194275 | 3300006871 | Unclassified | 2050 |
| 349 | Ga0075429_100242711 | 3300006880 | Bacteria | 1578 |
| 350 | Ga0068865_100107324 | 3300006881 | Bacteria | 2053 |
| 351 | Ga0068865_100154792 | 3300006881 | Unclassified | 1742 |
| 352 | Ga0068865_100231300 | 3300006881 | Bacteria | 1450 |
| 353 | Ga0068865_100885254 | 3300006881 | Bacteria | 775 |
| 354 | Ga0068865_101529252 | 3300006881 | Bacteria | 599 |
| 355 | Ga0097620_100047363 | 3300006931 | Bacteria | 4319 |
| 356 | Ga0097620_100488647 | 3300006931 | Bacteria | 1326 |
| 357 | Ga0097620_100610405 | 3300006931 | Bacteria | 1184 |
| 358 | Ga0097620_101281217 | 3300006931 | Bacteria | 808 |
| 359 | Ga0099825_1039829 | 3300006941 | Bacteria | 1423 |
| 360 | Ga0099824_1001145 | 3300006942 | Bacteria | 36195 |
| 361 | Ga0099822_1000135 | 3300006943 | Bacteria | 49135 |
| 362 | Ga0075435_100427104 | 3300007076 | Bacteria | 1142 |
| 363 | Ga0075435_100619687 | 3300007076 | Unclassified | 939 |
| 364 | Ga0099794_10024170 | 3300007265 | Bacteria | 2787 |
| 365 | Ga0099795_10085987 | 3300007788 | Bacteria | 1211 |
| 366 | Ga0099795_10231433 | 3300007788 | Bacteria | 790 |
| 367 | Ga0105251_10081797 | 3300009011 | Bacteria | 1492 |
| 368 | Ga0105250_10169871 | 3300009092 | Bacteria | 913 |
| 369 | Ga0105250_10327001 | 3300009092 | Bacteria | 667 |
| 370 | Ga0105240_10029904 | 3300009093 | Bacteria | 7089 |
| 371 | Ga0105240_10129948 | 3300009093 | Bacteria | 3022 |
| 372 | Ga0105240_10982937 | 3300009093 | Bacteria | 904 |
| 373 | Ga0105240_11913295 | 3300009093 | Bacteria | 617 |
| 374 | Ga0111539_10152799 | 3300009094 | Bacteria | 2702 |
| 375 | Ga0111539_10177955 | 3300009094 | Bacteria | 2485 |
| 376 | Ga0105245_10074427 | 3300009098 | Bacteria | 3091 |
| 377 | Ga0105245_10179241 | 3300009098 | Bacteria | 2023 |
| 378 | Ga0105245_10373307 | 3300009098 | Bacteria | 1418 |
| 379 | Ga0105245_10413188 | 3300009098 | Bacteria | 1351 |
| 380 | Ga0105245_11045782 | 3300009098 | Bacteria | 862 |
| 381 | Ga0105245_12046499 | 3300009098 | Bacteria | 626 |
| 382 | Ga0105245_12364707 | 3300009098 | Bacteria | 585 |
| 383 | Ga0105247_10154366 | 3300009101 | Bacteria | 1515 |
| 384 | Ga0105247_10405991 | 3300009101 | Bacteria | 972 |
| 385 | Ga0105247_10476365 | 3300009101 | Bacteria | 905 |
| 386 | Ga0105247_10641782 | 3300009101 | Bacteria | 792 |
| 387 | Ga0105247_10767735 | 3300009101 | Bacteria | 732 |
| 388 | Ga0114129_10078294 | 3300009147 | Bacteria | 4598 |
| 389 | Ga0114129_10210804 | 3300009147 | Bacteria | 2626 |
| 390 | Ga0105243_10047809 | 3300009148 | Bacteria | 3370 |
| 391 | Ga0105243_10187241 | 3300009148 | Bacteria | 1805 |
| 392 | Ga0105243_10225060 | 3300009148 | Bacteria | 1660 |
| 393 | Ga0105243_11326545 | 3300009148 | Bacteria | 738 |
| 394 | Ga0105243_12502863 | 3300009148 | Bacteria | 555 |
| 395 | Ga0105241_10261336 | 3300009174 | Bacteria | 1471 |
| 396 | Ga0105241_10560585 | 3300009174 | Bacteria | 1027 |
| 397 | Ga0105242_10064098 | 3300009176 | Bacteria | 3028 |
| 398 | Ga0105242_10297075 | 3300009176 | Bacteria | 1473 |
| 399 | Ga0105242_10356703 | 3300009176 | Bacteria | 1352 |
| 400 | Ga0105242_10810605 | 3300009176 | Bacteria | 928 |
| 401 | Ga0105242_10863828 | 3300009176 | Bacteria | 901 |
| 402 | Ga0105242_12011807 | 3300009176 | Bacteria | 620 |
| 403 | Ga0105242_13294974 | 3300009176 | Bacteria | 502 |
| 404 | Ga0105248_10018433 | 3300009177 | Bacteria | 7714 |
| 405 | Ga0105248_10050589 | 3300009177 | Bacteria | 4661 |
| 406 | Ga0105248_10055840 | 3300009177 | Bacteria | 4430 |
| 407 | Ga0105248_10069718 | 3300009177 | Bacteria | 3948 |
| 408 | Ga0105248_10240916 | 3300009177 | Unclassified | 2036 |
| 409 | Ga0105248_10343953 | 3300009177 | Bacteria | 1679 |
| 410 | Ga0105248_10675268 | 3300009177 | Bacteria | 1165 |
| 411 | Ga0105237_10039147 | 3300009545 | Bacteria | 4786 |
| 412 | Ga0105237_10061747 | 3300009545 | Bacteria | 3746 |
| 413 | Ga0105237_10118985 | 3300009545 | Bacteria | 2635 |
| 414 | Ga0105237_10435460 | 3300009545 | Bacteria | 1317 |
| 415 | Ga0105237_10760708 | 3300009545 | Bacteria | 975 |
| 416 | Ga0105238_10022088 | 3300009551 | Bacteria | 6488 |
| 417 | Ga0105238_10563999 | 3300009551 | Bacteria | 1144 |
| 418 | Ga0105238_10665053 | 3300009551 | Bacteria | 1052 |
| 419 | Ga0105238_10926026 | 3300009551 | Bacteria | 890 |
| 420 | Ga0105238_11194397 | 3300009551 | Bacteria | 785 |
| 421 | Ga0105238_12362616 | 3300009551 | Bacteria | 567 |
| 422 | Ga0105249_10038388 | 3300009553 | Bacteria | 4346 |
| 423 | Ga0105249_10678818 | 3300009553 | Bacteria | 1089 |
| 424 | Ga0105249_11040082 | 3300009553 | Bacteria | 888 |
| 425 | Ga0105249_11117026 | 3300009553 | Bacteria | 858 |
| 426 | Ga0105249_12710184 | 3300009553 | Bacteria | 568 |
| 427 | Ga0099796_10133782 | 3300010159 | Bacteria | 964 |
| 428 | Ga0099796_10286595 | 3300010159 | Bacteria | 694 |
| 429 | Ga0099796_10498084 | 3300010159 | Bacteria | 545 |
| 430 | Ga0105239_10034475 | 3300010375 | Bacteria | 5558 |
| 431 | Ga0105239_10059090 | 3300010375 | Bacteria | 4208 |
| 432 | Ga0105239_10094281 | 3300010375 | Bacteria | 3306 |
| 433 | Ga0105239_10130316 | 3300010375 | Bacteria | 2797 |
| 434 | Ga0105239_10178549 | 3300010375 | Bacteria | 2375 |
| 435 | Ga0105239_10586875 | 3300010375 | Bacteria | 1270 |
| 436 | Ga0105239_10709642 | 3300010375 | Bacteria | 1150 |
| 437 | Ga0105239_11663433 | 3300010375 | Bacteria | 739 |
| 438 | Ga0105239_11732962 | 3300010375 | Bacteria | 723 |
| 439 | Ga0105239_13304635 | 3300010375 | Bacteria | 525 |
| 440 | Ga0105239_13529616 | 3300010375 | Bacteria | 508 |
| 441 | Ga0105246_10032650 | 3300011119 | Bacteria | 3453 |
| 442 | Ga0105246_10344074 | 3300011119 | Bacteria | 1220 |
| 443 | Ga0105246_10621992 | 3300011119 | Bacteria | 936 |
| 444 | Ga0105246_10699414 | 3300011119 | Bacteria | 888 |
| 445 | Ga0105246_11051449 | 3300011119 | Bacteria | 740 |
| 446 | Ga0105246_11645602 | 3300011119 | Bacteria | 608 |
| 447 | Ga0105246_12547576 | 3300011119 | Bacteria | 504 |
| 448 | Ga0157336_1025455 | 3300012477 | Bacteria | 563 |
| 449 | Ga0157318_1013438 | 3300012482 | Bacteria | 646 |
| 450 | Ga0157322_1008862 | 3300012490 | Bacteria | 779 |
| 451 | Ga0157347_1072336 | 3300012502 | Bacteria | 511 |
| 452 | Ga0157373_10825973 | 3300013100 | Bacteria | 684 |
| 453 | Ga0157371_10635123 | 3300013102 | Bacteria | 796 |
| 454 | Ga0157370_10035427 | 3300013104 | Bacteria | 4851 |
| 455 | Ga0157369_10797574 | 3300013105 | Bacteria | 970 |
| 456 | Ga0157374_10182677 | 3300013296 | Bacteria | 2049 |
| 457 | Ga0157374_10198384 | 3300013296 | Bacteria | 1965 |
| 458 | Ga0157374_10242882 | 3300013296 | Bacteria | 1771 |
| 459 | Ga0157374_10393576 | 3300013296 | Bacteria | 1381 |
| 460 | Ga0157374_10928569 | 3300013296 | Bacteria | 888 |
| 461 | Ga0157374_10929831 | 3300013296 | Bacteria | 888 |
| 462 | Ga0157374_11532103 | 3300013296 | Bacteria | 690 |
| 463 | Ga0157378_10136259 | 3300013297 | Bacteria | 2277 |
| 464 | Ga0157378_10230435 | 3300013297 | Bacteria | 1765 |
| 465 | Ga0157378_10273127 | 3300013297 | Bacteria | 1626 |
| 466 | Ga0157378_10668202 | 3300013297 | Bacteria | 1056 |
| 467 | Ga0157378_10935240 | 3300013297 | Bacteria | 899 |
| 468 | Ga0163162_10148514 | 3300013306 | Bacteria | 2461 |
| 469 | Ga0163162_10196777 | 3300013306 | Bacteria | 2144 |
| 470 | Ga0163162_10512542 | 3300013306 | Bacteria | 1329 |
| 471 | Ga0163162_10534083 | 3300013306 | Bacteria | 1302 |
| 472 | Ga0163162_10718107 | 3300013306 | Bacteria | 1120 |
| 473 | Ga0163162_11299147 | 3300013306 | Bacteria | 827 |
| 474 | Ga0163162_12267132 | 3300013306 | Bacteria | 624 |
| 475 | Ga0163162_12317854 | 3300013306 | Bacteria | 617 |
| 476 | Ga0157372_11257864 | 3300013307 | Bacteria | 854 |
| 477 | Ga0157372_11286481 | 3300013307 | Bacteria | 844 |
| 478 | Ga0157375_10136682 | 3300013308 | Bacteria | 2575 |
| 479 | Ga0157375_10223750 | 3300013308 | Bacteria | 2041 |
| 480 | Ga0157375_10381915 | 3300013308 | Bacteria | 1575 |
| 481 | Ga0157375_10617134 | 3300013308 | Bacteria | 1243 |
| 482 | Ga0157375_10947418 | 3300013308 | Bacteria | 1003 |
| 483 | Ga0157375_11747371 | 3300013308 | Bacteria | 737 |
| 484 | Ga0157375_11907399 | 3300013308 | Bacteria | 705 |
| 485 | Ga0157375_12457879 | 3300013308 | Bacteria | 622 |
| 486 | Ga0157375_12947295 | 3300013308 | Bacteria | 568 |
| 487 | Ga0163163_10009917 | 3300014325 | Bacteria | 8540 |
| 488 | Ga0163163_10130136 | 3300014325 | Bacteria | 2557 |
| 489 | Ga0163163_10245979 | 3300014325 | Bacteria | 1839 |
| 490 | Ga0163163_10296258 | 3300014325 | Bacteria | 1670 |
| 491 | Ga0163163_10450840 | 3300014325 | Bacteria | 1347 |
| 492 | Ga0163163_10542988 | 3300014325 | Bacteria | 1225 |
| 493 | Ga0163163_11092056 | 3300014325 | Bacteria | 861 |
| 494 | Ga0157380_10181827 | 3300014326 | Bacteria | 1848 |
| 495 | Ga0157380_10241111 | 3300014326 | Bacteria | 1630 |
| 496 | Ga0157380_10436182 | 3300014326 | Bacteria | 1254 |
| 497 | Ga0157380_10712153 | 3300014326 | Bacteria | 1010 |
| 498 | Ga0157380_10835300 | 3300014326 | Bacteria | 941 |
| 499 | Ga0157380_12823328 | 3300014326 | Bacteria | 552 |
| 500 | Ga0182008_10187574 | 3300014497 | Bacteria | 1048 |
| 501 | Ga0182008_10319645 | 3300014497 | Bacteria | 816 |
| 502 | Ga0182008_10590922 | 3300014497 | Bacteria | 622 |
| 503 | Ga0157377_10491109 | 3300014745 | Bacteria | 856 |
| 504 | Ga0157377_10499532 | 3300014745 | Bacteria | 850 |
| 505 | Ga0157377_10553221 | 3300014745 | Bacteria | 813 |
| 506 | Ga0157377_10689290 | 3300014745 | Bacteria | 740 |
| 507 | Ga0157377_11167244 | 3300014745 | Bacteria | 594 |
| 508 | Ga0157377_11565427 | 3300014745 | Bacteria | 527 |
| 509 | Ga0157379_10054384 | 3300014968 | Bacteria | 3577 |
| 510 | Ga0157379_10059691 | 3300014968 | Bacteria | 3410 |
| 511 | Ga0157379_10070735 | 3300014968 | Bacteria | 3122 |
| 512 | Ga0157379_10883340 | 3300014968 | Bacteria | 847 |
| 513 | Ga0157379_10968395 | 3300014968 | Bacteria | 810 |
| 514 | Ga0157379_11213729 | 3300014968 | Bacteria | 726 |
| 515 | Ga0157376_10098051 | 3300014969 | Bacteria | 2554 |
| 516 | Ga0157376_10300126 | 3300014969 | Bacteria | 1520 |
| 517 | Ga0157376_10606722 | 3300014969 | Bacteria | 1090 |
| 518 | Ga0157376_11272773 | 3300014969 | Bacteria | 765 |
| 519 | Ga0182006_1085697 | 3300015261 | Bacteria | 1142 |
| 520 | Ga0182006_1287445 | 3300015261 | Bacteria | 539 |
| 521 | Ga0163161_10078523 | 3300017792 | Bacteria | 2426 |
| 522 | Ga0163161_10485769 | 3300017792 | Bacteria | 1003 |
| 523 | Ga0163161_11649508 | 3300017792 | Bacteria | 567 |
| 524 | Ga0213873_10003627 | 3300021358 | Bacteria | 2801 |
| 525 | Ga0213874_10018962 | 3300021377 | Bacteria | 1867 |
| 526 | Ga0213876_10009766 | 3300021384 | Bacteria | 5163 |
| 527 | Ga0213875_10015369 | 3300021388 | Bacteria | 3725 |
| 528 | Ga0213875_10145474 | 3300021388 | Bacteria | 1110 |
| 529 | Ga0213875_10489006 | 3300021388 | Bacteria | 591 |
| 530 | Ga0209563_102525 | 3300025230 | Bacteria | 4109 |
| 531 | Ga0209677_105322 | 3300025253 | Bacteria | 3394 |
| 532 | Ga0209233_1001483 | 3300025261 | Bacteria | 9243 |
| 533 | Ga0207666_1040651 | 3300025271 | Bacteria | 727 |
| 534 | Ga0209758_1010323 | 3300025297 | Bacteria | 5608 |
| 535 | Ga0209758_1012517 | 3300025297 | Bacteria | 4738 |
| 536 | Ga0209758_1018538 | 3300025297 | Bacteria | 3403 |
| 537 | Ga0209257_1007532 | 3300025304 | Bacteria | 6541 |
| 538 | Ga0207697_10165591 | 3300025315 | Bacteria | 966 |
| 539 | Ga0207697_10267198 | 3300025315 | Bacteria | 758 |
| 540 | Ga0207656_10208906 | 3300025321 | Bacteria | 945 |
| 541 | Ga0207656_10466409 | 3300025321 | Bacteria | 639 |
| 542 | Ga0207653_10012944 | 3300025885 | Bacteria | 2608 |
| 543 | Ga0207682_10040789 | 3300025893 | Bacteria | 1893 |
| 544 | Ga0207692_10178730 | 3300025898 | Bacteria | 1235 |
| 545 | Ga0207692_10769265 | 3300025898 | Bacteria | 628 |
| 546 | Ga0207642_10695640 | 3300025899 | Bacteria | 640 |
| 547 | Ga0207642_10879672 | 3300025899 | Bacteria | 573 |
| 548 | Ga0207710_10078255 | 3300025900 | Bacteria | 1529 |
| 549 | Ga0207710_10129615 | 3300025900 | Bacteria | 1211 |
| 550 | Ga0207688_10015995 | 3300025901 | Bacteria | 4067 |
| 551 | Ga0207688_10098145 | 3300025901 | Bacteria | 1688 |
| 552 | Ga0207688_10195032 | 3300025901 | Bacteria | 1213 |
| 553 | Ga0207688_10238307 | 3300025901 | Bacteria | 1100 |
| 554 | Ga0207680_10057219 | 3300025903 | Bacteria | 2359 |
| 555 | Ga0207680_10140792 | 3300025903 | Bacteria | 1599 |
| 556 | Ga0207680_10425691 | 3300025903 | Bacteria | 940 |
| 557 | Ga0207647_10016721 | 3300025904 | Bacteria | 4999 |
| 558 | Ga0207647_10418201 | 3300025904 | Bacteria | 754 |
| 559 | Ga0207685_10380636 | 3300025905 | Bacteria | 719 |
| 560 | Ga0207699_10128655 | 3300025906 | Bacteria | 1648 |
| 561 | Ga0207699_10441168 | 3300025906 | Bacteria | 932 |
| 562 | Ga0207699_10875859 | 3300025906 | Bacteria | 662 |
| 563 | Ga0207645_10268380 | 3300025907 | Bacteria | 1131 |
| 564 | Ga0207645_10569798 | 3300025907 | Bacteria | 768 |
| 565 | Ga0207643_10064992 | 3300025908 | Bacteria | 2089 |
| 566 | Ga0207643_10542204 | 3300025908 | Bacteria | 746 |
| 567 | Ga0207705_10110790 | 3300025909 | Bacteria | 2028 |
| 568 | Ga0207705_10636402 | 3300025909 | Bacteria | 829 |
| 569 | Ga0207684_10976327 | 3300025910 | Bacteria | 710 |
| 570 | Ga0207654_10065446 | 3300025911 | Bacteria | 2140 |
| 571 | Ga0207707_10020967 | 3300025912 | Bacteria | 5709 |
| 572 | Ga0207707_10094717 | 3300025912 | Bacteria | 2609 |
| 573 | Ga0207695_10042176 | 3300025913 | Bacteria | 4878 |
| 574 | Ga0207671_10023286 | 3300025914 | Bacteria | 4671 |
| 575 | Ga0207671_10047312 | 3300025914 | Bacteria | 3184 |
| 576 | Ga0207671_10651752 | 3300025914 | Bacteria | 838 |
| 577 | Ga0207671_10777036 | 3300025914 | Bacteria | 760 |
| 578 | Ga0207671_10985916 | 3300025914 | Bacteria | 664 |
| 579 | Ga0207693_10001776 | 3300025915 | Bacteria | 18911 |
| 580 | Ga0207693_10043158 | 3300025915 | Bacteria | 3550 |
| 581 | Ga0207663_10191210 | 3300025916 | Bacteria | 1470 |
| 582 | Ga0207663_11000225 | 3300025916 | Bacteria | 671 |
| 583 | Ga0207660_10077105 | 3300025917 | Bacteria | 2439 |
| 584 | Ga0207660_10382402 | 3300025917 | Bacteria | 1132 |
| 585 | Ga0207657_10120290 | 3300025919 | Bacteria | 2161 |
| 586 | Ga0207657_11029008 | 3300025919 | Bacteria | 631 |
| 587 | Ga0207657_11173886 | 3300025919 | Bacteria | 584 |
| 588 | Ga0207649_10433121 | 3300025920 | Bacteria | 989 |
| 589 | Ga0207649_10506765 | 3300025920 | Unclassified | 918 |
| 590 | Ga0207649_10716218 | 3300025920 | Bacteria | 777 |
| 591 | Ga0207649_11208549 | 3300025920 | Unclassified | 597 |
| 592 | Ga0207652_10025043 | 3300025921 | Bacteria | 4957 |
| 593 | Ga0207646_11061347 | 3300025922 | Bacteria | 714 |
| 594 | Ga0207681_10112595 | 3300025923 | Bacteria | 1982 |
| 595 | Ga0207681_10605775 | 3300025923 | Bacteria | 905 |
| 596 | Ga0207681_10916060 | 3300025923 | Bacteria | 734 |
| 597 | Ga0207681_11236804 | 3300025923 | Bacteria | 627 |
| 598 | Ga0207694_10097619 | 3300025924 | Bacteria | 2325 |
| 599 | Ga0207694_10405315 | 3300025924 | Bacteria | 1134 |
| 600 | Ga0207694_10757634 | 3300025924 | Bacteria | 820 |
| 601 | Ga0207694_10867228 | 3300025924 | Bacteria | 763 |
| 602 | Ga0207694_11006221 | 3300025924 | Bacteria | 705 |
| 603 | Ga0207650_10363570 | 3300025925 | Bacteria | 1192 |
| 604 | Ga0207650_10804729 | 3300025925 | Bacteria | 797 |
| 605 | Ga0207659_10122990 | 3300025926 | Bacteria | 1991 |
| 606 | Ga0207659_10216009 | 3300025926 | Bacteria | 1539 |
| 607 | Ga0207659_10346958 | 3300025926 | Bacteria | 1231 |
| 608 | Ga0207659_10676858 | 3300025926 | Bacteria | 883 |
| 609 | Ga0207659_11582218 | 3300025926 | Unclassified | 560 |
| 610 | Ga0207687_10040881 | 3300025927 | Bacteria | 3181 |
| 611 | Ga0207687_10109880 | 3300025927 | Bacteria | 2043 |
| 612 | Ga0207687_10184149 | 3300025927 | Bacteria | 1620 |
| 613 | Ga0207687_10412033 | 3300025927 | Bacteria | 1114 |
| 614 | Ga0207687_10671536 | 3300025927 | Bacteria | 878 |
| 615 | Ga0207700_11000318 | 3300025928 | Bacteria | 748 |
| 616 | Ga0207664_10127444 | 3300025929 | Bacteria | 2138 |
| 617 | Ga0207664_10195831 | 3300025929 | Bacteria | 1742 |
| 618 | Ga0207664_10594727 | 3300025929 | Bacteria | 993 |
| 619 | Ga0207664_11331170 | 3300025929 | Bacteria | 638 |
| 620 | Ga0207664_11902336 | 3300025929 | Bacteria | 518 |
| 621 | Ga0207644_10017213 | 3300025931 | Bacteria | 4876 |
| 622 | Ga0207644_10084165 | 3300025931 | Bacteria | 2357 |
| 623 | Ga0207644_10243620 | 3300025931 | Bacteria | 1432 |
| 624 | Ga0207644_10748431 | 3300025931 | Bacteria | 816 |
| 625 | Ga0207690_10265452 | 3300025932 | Bacteria | 1331 |
| 626 | Ga0207690_10934542 | 3300025932 | Bacteria | 720 |
| 627 | Ga0207706_10061004 | 3300025933 | Bacteria | 3321 |
| 628 | Ga0207706_10192068 | 3300025933 | Bacteria | 1792 |
| 629 | Ga0207706_10294633 | 3300025933 | Bacteria | 1414 |
| 630 | Ga0207706_10519880 | 3300025933 | Bacteria | 1026 |
| 631 | Ga0207706_10673373 | 3300025933 | Bacteria | 885 |
| 632 | Ga0207706_11383529 | 3300025933 | Unclassified | 578 |
| 633 | Ga0207706_11393112 | 3300025933 | Unclassified | 576 |
| 634 | Ga0207686_10122395 | 3300025934 | Bacteria | 1772 |
| 635 | Ga0207686_10213285 | 3300025934 | Bacteria | 1389 |
| 636 | Ga0207709_10007124 | 3300025935 | Bacteria | 6242 |
| 637 | Ga0207709_10035091 | 3300025935 | Bacteria | 2962 |
| 638 | Ga0207709_10058680 | 3300025935 | Bacteria | 2392 |
| 639 | Ga0207709_10227821 | 3300025935 | Bacteria | 1348 |
| 640 | Ga0207709_10396848 | 3300025935 | Bacteria | 1053 |
| 641 | Ga0207709_10927707 | 3300025935 | Bacteria | 709 |
| 642 | Ga0207709_10939777 | 3300025935 | Bacteria | 704 |
| 643 | Ga0207670_10227617 | 3300025936 | Bacteria | 1430 |
| 644 | Ga0207670_10439585 | 3300025936 | Bacteria | 1050 |
| 645 | Ga0207669_10004832 | 3300025937 | Bacteria | 5983 |
| 646 | Ga0207669_10940992 | 3300025937 | Bacteria | 724 |
| 647 | Ga0207669_10973255 | 3300025937 | Bacteria | 712 |
| 648 | Ga0207669_11371487 | 3300025937 | Bacteria | 601 |
| 649 | Ga0207704_10082769 | 3300025938 | Bacteria | 2080 |
| 650 | Ga0207704_10105331 | 3300025938 | Bacteria | 1891 |
| 651 | Ga0207665_10072206 | 3300025939 | Bacteria | 2357 |
| 652 | Ga0207665_10590193 | 3300025939 | Bacteria | 867 |
| 653 | Ga0207691_10035507 | 3300025940 | Bacteria | 4625 |
| 654 | Ga0207691_10043336 | 3300025940 | Bacteria | 4148 |
| 655 | Ga0207691_10225732 | 3300025940 | Bacteria | 1623 |
| 656 | Ga0207691_10515468 | 3300025940 | Bacteria | 1015 |
| 657 | Ga0207691_10644201 | 3300025940 | Unclassified | 896 |
| 658 | Ga0207691_11310226 | 3300025940 | Bacteria | 598 |
| 659 | Ga0207691_11662397 | 3300025940 | Bacteria | 518 |
| 660 | Ga0207711_10025676 | 3300025941 | Bacteria | 4941 |
| 661 | Ga0207711_10051529 | 3300025941 | Bacteria | 3525 |
| 662 | Ga0207711_10257779 | 3300025941 | Bacteria | 1602 |
| 663 | Ga0207711_10342670 | 3300025941 | Bacteria | 1383 |
| 664 | Ga0207689_10071969 | 3300025942 | Bacteria | 2840 |
| 665 | Ga0207689_10131217 | 3300025942 | Bacteria | 2062 |
| 666 | Ga0207689_10136896 | 3300025942 | Bacteria | 2017 |
| 667 | Ga0207689_10797887 | 3300025942 | Bacteria | 797 |
| 668 | Ga0207661_10129788 | 3300025944 | Bacteria | 2157 |
| 669 | Ga0207661_10331027 | 3300025944 | Bacteria | 1371 |
| 670 | Ga0207661_11544333 | 3300025944 | Bacteria | 608 |
| 671 | Ga0207679_10162166 | 3300025945 | Bacteria | 1831 |
| 672 | Ga0207679_10654536 | 3300025945 | Bacteria | 950 |
| 673 | Ga0207679_11186901 | 3300025945 | Bacteria | 700 |
| 674 | Ga0207667_10022929 | 3300025949 | Bacteria | 6882 |
| 675 | Ga0207667_10243413 | 3300025949 | Bacteria | 1840 |
| 676 | Ga0207667_10328905 | 3300025949 | Bacteria | 1560 |
| 677 | Ga0207651_10071181 | 3300025960 | Bacteria | 2464 |
| 678 | Ga0207651_10129964 | 3300025960 | Unclassified | 1926 |
| 679 | Ga0207651_10165791 | 3300025960 | Bacteria | 1737 |
| 680 | Ga0207651_10297411 | 3300025960 | Bacteria | 1341 |
| 681 | Ga0207651_12018466 | 3300025960 | Bacteria | 518 |
| 682 | Ga0207712_10031864 | 3300025961 | Bacteria | 3554 |
| 683 | Ga0207712_10242489 | 3300025961 | Bacteria | 1452 |
| 684 | Ga0207712_10242517 | 3300025961 | Bacteria | 1452 |
| 685 | Ga0207712_10310442 | 3300025961 | Bacteria | 1298 |
| 686 | Ga0207712_11011028 | 3300025961 | Bacteria | 738 |
| 687 | Ga0207712_11203079 | 3300025961 | Bacteria | 676 |
| 688 | Ga0207712_11340674 | 3300025961 | Bacteria | 640 |
| 689 | Ga0207668_10005400 | 3300025972 | Bacteria | 7526 |
| 690 | Ga0207668_10010669 | 3300025972 | Bacteria | 5559 |
| 691 | Ga0207668_10031458 | 3300025972 | Bacteria | 3495 |
| 692 | Ga0207668_10105758 | 3300025972 | Bacteria | 2101 |
| 693 | Ga0207668_10158155 | 3300025972 | Bacteria | 1762 |
| 694 | Ga0207668_10240804 | 3300025972 | Bacteria | 1463 |
| 695 | Ga0207668_10285085 | 3300025972 | Bacteria | 1356 |
| 696 | Ga0207668_10497087 | 3300025972 | Bacteria | 1048 |
| 697 | Ga0207668_11150898 | 3300025972 | Bacteria | 696 |
| 698 | Ga0207668_11226283 | 3300025972 | Bacteria | 674 |
| 699 | Ga0207640_10715238 | 3300025981 | Bacteria | 860 |
| 700 | Ga0207640_10908234 | 3300025981 | Bacteria | 770 |
| 701 | Ga0207658_10647843 | 3300025986 | Bacteria | 952 |
| 702 | Ga0207658_11188627 | 3300025986 | Bacteria | 697 |
| 703 | Ga0207658_11218586 | 3300025986 | Bacteria | 688 |
| 704 | Ga0207677_10036816 | 3300026023 | Bacteria | 3193 |
| 705 | Ga0207677_10099950 | 3300026023 | Bacteria | 2132 |
| 706 | Ga0207703_10100551 | 3300026035 | Bacteria | 2450 |
| 707 | Ga0207703_10269514 | 3300026035 | Bacteria | 1542 |
| 708 | Ga0207703_10482868 | 3300026035 | Bacteria | 1161 |
| 709 | Ga0207703_10959799 | 3300026035 | Bacteria | 820 |
| 710 | Ga0207703_11031463 | 3300026035 | Bacteria | 789 |
| 711 | Ga0207703_11529223 | 3300026035 | Bacteria | 642 |
| 712 | Ga0207639_10043497 | 3300026041 | Bacteria | 3372 |
| 713 | Ga0207639_10183014 | 3300026041 | Bacteria | 1784 |
| 714 | Ga0207639_10379349 | 3300026041 | Bacteria | 1269 |
| 715 | Ga0207639_10568724 | 3300026041 | Bacteria | 1042 |
| 716 | Ga0207678_10011493 | 3300026067 | Bacteria | 7776 |
| 717 | Ga0207678_10023466 | 3300026067 | Bacteria | 5395 |
| 718 | Ga0207678_10060221 | 3300026067 | Bacteria | 3265 |
| 719 | Ga0207678_10128588 | 3300026067 | Bacteria | 2160 |
| 720 | Ga0207678_10151873 | 3300026067 | Bacteria | 1978 |
| 721 | Ga0207678_10217522 | 3300026067 | Bacteria | 1635 |
| 722 | Ga0207678_10568720 | 3300026067 | Bacteria | 992 |
| 723 | Ga0207678_11582308 | 3300026067 | Bacteria | 577 |
| 724 | Ga0207708_10034273 | 3300026075 | Bacteria | 3862 |
| 725 | Ga0207708_10093420 | 3300026075 | Bacteria | 2322 |
| 726 | Ga0207708_10424969 | 3300026075 | Bacteria | 1102 |
| 727 | Ga0207708_10568406 | 3300026075 | Bacteria | 958 |
| 728 | Ga0207702_10186015 | 3300026078 | Bacteria | 1916 |
| 729 | Ga0207702_10192543 | 3300026078 | Bacteria | 1885 |
| 730 | Ga0207702_10597653 | 3300026078 | Bacteria | 1082 |
| 731 | Ga0207702_10684208 | 3300026078 | Bacteria | 1010 |
| 732 | Ga0207702_11529657 | 3300026078 | Bacteria | 661 |
| 733 | Ga0207641_10072841 | 3300026088 | Bacteria | 2959 |
| 734 | Ga0207641_10318080 | 3300026088 | Bacteria | 1475 |
| 735 | Ga0207641_10344419 | 3300026088 | Bacteria | 1419 |
| 736 | Ga0207641_10418815 | 3300026088 | Bacteria | 1289 |
| 737 | Ga0207641_10472200 | 3300026088 | Bacteria | 1215 |
| 738 | Ga0207641_10762942 | 3300026088 | Bacteria | 955 |
| 739 | Ga0207641_11358420 | 3300026088 | Bacteria | 711 |
| 740 | Ga0207641_11977484 | 3300026088 | Bacteria | 584 |
| 741 | Ga0207641_12531698 | 3300026088 | Bacteria | 511 |
| 742 | Ga0207648_10040868 | 3300026089 | Bacteria | 4073 |
| 743 | Ga0207648_10220075 | 3300026089 | Bacteria | 1687 |
| 744 | Ga0207648_11096314 | 3300026089 | Bacteria | 747 |
| 745 | Ga0207648_11974125 | 3300026089 | Bacteria | 545 |
| 746 | Ga0207676_10024271 | 3300026095 | Bacteria | 4485 |
| 747 | Ga0207676_10255635 | 3300026095 | Bacteria | 1579 |
| 748 | Ga0207676_10373689 | 3300026095 | Bacteria | 1325 |
| 749 | Ga0207676_10388364 | 3300026095 | Bacteria | 1301 |
| 750 | Ga0207676_10786552 | 3300026095 | Bacteria | 927 |
| 751 | Ga0207674_10098670 | 3300026116 | Bacteria | 2904 |
| 752 | Ga0207674_10230355 | 3300026116 | Bacteria | 1800 |
| 753 | Ga0207674_11257747 | 3300026116 | Bacteria | 710 |
| 754 | Ga0207674_11445702 | 3300026116 | Bacteria | 657 |
| 755 | Ga0207675_100029414 | 3300026118 | Bacteria | 5119 |
| 756 | Ga0207675_100105861 | 3300026118 | Bacteria | 2651 |
| 757 | Ga0207675_100290042 | 3300026118 | Bacteria | 1592 |
| 758 | Ga0207675_100684804 | 3300026118 | Bacteria | 1033 |
| 759 | Ga0207675_100714122 | 3300026118 | Bacteria | 1012 |
| 760 | Ga0207675_101450526 | 3300026118 | Unclassified | 707 |
| 761 | Ga0207675_101875778 | 3300026118 | Bacteria | 618 |
| 762 | Ga0207683_10074092 | 3300026121 | Bacteria | 3012 |
| 763 | Ga0207683_10113783 | 3300026121 | Bacteria | 2424 |
| 764 | Ga0207683_10425324 | 3300026121 | Bacteria | 1223 |
| 765 | Ga0207683_10439288 | 3300026121 | Bacteria | 1203 |
| 766 | Ga0207683_10564592 | 3300026121 | Bacteria | 1052 |
| 767 | Ga0207683_10691493 | 3300026121 | Bacteria | 945 |
| 768 | Ga0207683_10694099 | 3300026121 | Bacteria | 944 |
| 769 | Ga0207683_11036331 | 3300026121 | Bacteria | 761 |
| 770 | Ga0207683_11039015 | 3300026121 | Bacteria | 760 |
| 771 | Ga0207698_10795968 | 3300026142 | Bacteria | 947 |
| 772 | Ga0207698_11061216 | 3300026142 | Bacteria | 822 |
| 773 | Ga0207698_11882704 | 3300026142 | Bacteria | 613 |
| 774 | Ga0207698_12406598 | 3300026142 | Bacteria | 538 |
| 775 | Ga0209589_1000017 | 3300027357 | Bacteria | 215546 |
| 776 | Ga0209489_100018 | 3300027361 | Bacteria | 215546 |
| 777 | Ga0209700_100028 | 3300027363 | Bacteria | 215546 |
| 778 | Ga0209813_10025407 | 3300027866 | Bacteria | 1703 |
| 779 | Ga0209813_10057796 | 3300027866 | Bacteria | 1231 |
| 780 | Ga0209813_10129722 | 3300027866 | Bacteria | 886 |
| 781 | Ga0207428_10748512 | 3300027907 | Bacteria | 697 |
| 782 | Ga0268266_10009701 | 3300028379 | Bacteria | 8460 |
| 783 | Ga0268266_10056273 | 3300028379 | Bacteria | 3383 |
| 784 | Ga0268266_10168478 | 3300028379 | Bacteria | 1986 |
| 785 | Ga0268266_10210870 | 3300028379 | Bacteria | 1781 |
| 786 | Ga0268266_10328791 | 3300028379 | Bacteria | 1432 |
| 787 | Ga0268266_10366984 | 3300028379 | Bacteria | 1355 |
| 788 | Ga0268266_10368279 | 3300028379 | Bacteria | 1353 |
| 789 | Ga0268266_10372858 | 3300028379 | Bacteria | 1344 |
| 790 | Ga0268266_10391936 | 3300028379 | Bacteria | 1312 |
| 791 | Ga0268266_10429327 | 3300028379 | Bacteria | 1253 |
| 792 | Ga0268266_10764883 | 3300028379 | Bacteria | 932 |
| 793 | Ga0268266_10780968 | 3300028379 | Bacteria | 922 |
| 794 | Ga0268266_11080855 | 3300028379 | Bacteria | 776 |
| 795 | Ga0268266_11287307 | 3300028379 | Bacteria | 706 |
| 796 | Ga0268266_11974106 | 3300028379 | Bacteria | 557 |
| 797 | Ga0268266_12057335 | 3300028379 | Bacteria | 544 |
| 798 | Ga0268265_10024844 | 3300028380 | Bacteria | 4245 |
| 799 | Ga0268265_10361800 | 3300028380 | Bacteria | 1328 |
| 800 | Ga0268265_10363542 | 3300028380 | Bacteria | 1325 |
| 801 | Ga0268265_10575173 | 3300028380 | Bacteria | 1073 |
| 802 | Ga0268265_10754730 | 3300028380 | Bacteria | 944 |
| 803 | Ga0268265_11505685 | 3300028380 | Bacteria | 676 |
| 804 | Ga0268265_12193264 | 3300028380 | Bacteria | 559 |
| 805 | Ga0268264_10140404 | 3300028381 | Bacteria | 2154 |
| 806 | Ga0268264_11053984 | 3300028381 | Bacteria | 821 |
| 807 | Ga0268264_12074797 | 3300028381 | Bacteria | 577 |
| 808 | Ga0307517_10000766 | 3300028786 | Bacteria | 55210 |
| 809 | Ga0307517_10437143 | 3300028786 | Bacteria | 682 |
| 810 | Ga0307515_10400275 | 3300028794 | Bacteria | 999 |
| 811 | Ga0307515_10433670 | 3300028794 | Bacteria | 932 |
| 812 | Ga0307515_10581065 | 3300028794 | Bacteria | 730 |
| 813 | Ga0307512_10102275 | 3300030522 | Bacteria | 1934 |
| 814 | Ga0265339_10007291 | 3300031249 | Bacteria | 7166 |
| 815 | Ga0265339_10056423 | 3300031249 | Bacteria | 2127 |
| 816 | Ga0265316_10576294 | 3300031344 | Bacteria | 799 |
| 817 | Ga0307513_10117890 | 3300031456 | Bacteria | 2631 |
| 818 | Ga0307513_10119162 | 3300031456 | Bacteria | 2612 |
| 819 | Ga0307513_10719587 | 3300031456 | Bacteria | 704 |
| 820 | Ga0307509_10138101 | 3300031507 | Bacteria | 2379 |
| 821 | Ga0307509_10736302 | 3300031507 | Bacteria | 652 |
| 822 | Ga0307509_10790459 | 3300031507 | Bacteria | 614 |
| 823 | Ga0307508_10011825 | 3300031616 | Bacteria | 7979 |
| 824 | Ga0307508_10307473 | 3300031616 | Bacteria | 1178 |
| 825 | Ga0307508_10693637 | 3300031616 | Bacteria | 627 |
| 826 | Ga0265314_10198417 | 3300031711 | Bacteria | 1188 |
| 827 | Ga0265342_10058172 | 3300031712 | Bacteria | 2285 |
| 828 | Ga0307516_10007966 | 3300031730 | Bacteria | 12059 |
| 829 | Ga0307516_10029291 | 3300031730 | Bacteria | 5567 |
| 830 | Ga0307516_10145252 | 3300031730 | Bacteria | 2138 |
| 831 | Ga0307516_10716711 | 3300031730 | Bacteria | 658 |
| 832 | Ga0307405_10792261 | 3300031731 | Unclassified | 793 |
| 833 | Ga0307413_10291406 | 3300031824 | Bacteria | 1233 |
| 834 | Ga0307410_10053396 | 3300031852 | Bacteria | 2735 |
| 835 | Ga0307410_10356697 | 3300031852 | Bacteria | 1170 |
| 836 | Ga0307410_10658659 | 3300031852 | Bacteria | 879 |
| 837 | Ga0326468_10046356 | 3300031889 | Bacteria | 642 |
| 838 | Ga0307406_10301156 | 3300031901 | Bacteria | 1232 |
| 839 | Ga0307406_10482928 | 3300031901 | Bacteria | 1001 |
| 840 | Ga0307406_10860173 | 3300031901 | Bacteria | 769 |
| 841 | Ga0307407_11618952 | 3300031903 | Bacteria | 514 |
| 842 | Ga0307412_10525785 | 3300031911 | Bacteria | 989 |
| 843 | Ga0307412_11496999 | 3300031911 | Bacteria | 613 |
| 844 | Ga0307409_101384233 | 3300031995 | Unclassified | 730 |
| 845 | Ga0307409_102712910 | 3300031995 | Bacteria | 523 |
| 846 | Ga0307416_100246326 | 3300032002 | Bacteria | 1736 |
| 847 | Ga0307416_100494514 | 3300032002 | Bacteria | 1286 |
| 848 | Ga0307416_101035278 | 3300032002 | Bacteria | 925 |
| 849 | Ga0307416_103244268 | 3300032002 | Bacteria | 544 |
| 850 | Ga0307414_10457183 | 3300032004 | Unclassified | 1121 |
| 851 | Ga0307411_10487557 | 3300032005 | Bacteria | 1039 |
| 852 | Ga0307411_10787610 | 3300032005 | Bacteria | 836 |
| 853 | Ga0307415_100627497 | 3300032126 | Unclassified | 960 |
| 854 | Ga0307415_100731665 | 3300032126 | Bacteria | 896 |
| 855 | Ga0307415_100852391 | 3300032126 | Bacteria | 836 |
| 856 | Ga0307415_101014639 | 3300032126 | Bacteria | 772 |
| 857 | Ga0307510_10001273 | 3300033180 | Bacteria | 27490 |
| 858 | Ga0307510_10069809 | 3300033180 | Bacteria | 3515 |
| 859 | Ga0315911_1000033 | 3300033442 | Bacteria | 67159 |
| 860 | Ga0373928_0192895 | 3300035084 | Bacteria | 584 |
| 861 | Ga0373949_0044980 | 3300035090 | Bacteria | 1097 |
| 862 | Ga0373923_0249718 | 3300035111 | Bacteria | 830 |
| 863 | Ga0373932_0255812 | 3300035112 | Bacteria | 640 |
| 864 | Ga0373936_0254779 | 3300035113 | Bacteria | 785 |
| 865 | Ga0373936_0332662 | 3300035113 | Bacteria | 689 |
| 866 | Ga0373953_0015608 | 3300035117 | Bacteria | 2757 |
| 867 | Ga0373954_0179742 | 3300035118 | Bacteria | 1037 |
| 868 | Ga0373954_0531412 | 3300035118 | Bacteria | 583 |
| 869 | Ga0373956_0287764 | 3300035119 | Bacteria | 782 |
| 870 | Ga0373957_0074306 | 3300035120 | Bacteria | 1334 |
| 871 | Ga0373960_0142049 | 3300035121 | Bacteria | 814 |
| 872 | Ga0373943_0266814 | 3300035170 | Bacteria | 965 |
| 873 | Ga0373943_0633392 | 3300035170 | Bacteria | 631 |
| 874 | Ga0373946_0142566 | 3300035171 | Bacteria | 1112 |
| 875 | Ga0373955_0024853 | 3300035172 | Bacteria | 3068 |
| 876 | Ga0373955_0110252 | 3300035172 | Bacteria | 1591 |
| 877 | Ga0373924_0126971 | 3300035410 | Bacteria | 1109 |
| 878 | Ga0373931_0189843 | 3300035691 | Bacteria | 1222 |
| 879 | Ga0373931_0421876 | 3300035691 | Bacteria | 848 |
| 880 | Ga0373935_0314935 | 3300035692 | Bacteria | 1109 |
| 881 | Ga0373927_0038587 | 3300035695 | Bacteria | 3101 |
| 882 | Ga0373927_0167722 | 3300035695 | Bacteria | 1439 |
| 883 | Ga0373927_0251276 | 3300035695 | Bacteria | 1162 |
| 884 | Ga0373933_0110446 | 3300035724 | Bacteria | 1715 |
| 885 | Ga0373947_0036019 | 3300035725 | Bacteria | 2932 |
| 886 | Ga0373947_0145981 | 3300035725 | Bacteria | 1521 |
| 887 | Ga0373947_0174409 | 3300035725 | Bacteria | 1397 |
| 888 | Ga0373925_0035939 | 3300037068 | Bacteria | 3657 |
| 889 | Ga0373925_0195438 | 3300037068 | Bacteria | 1607 |
| 890 | Ga0373925_1655806 | 3300037068 | Bacteria | 523 |
| 891 | Ga0395900_0005520 | 3300037418 | Bacteria | 13242 |
| 892 | Ga0395900_0276293 | 3300037418 | Bacteria | 1673 |
| 893 | Ga0395898_0037127 | 3300037466 | Bacteria | 4835 |
| 894 | Ga0395898_0138371 | 3300037466 | Bacteria | 2331 |
| 895 | Ga0395905_1838390 | 3300037471 | Bacteria | 512 |
| 896 | Ga0436364_0851724 | 3300037853 | Bacteria | 979 |
| 897 | Ga0436364_1384846 | 3300037853 | Bacteria | 1309 |
| 898 | Ga0436364_1525576 | 3300037853 | Bacteria | 3914 |
| 899 | Ga0395901_0139896 | 3300038443 | Bacteria | 2544 |
| 900 | Ga0395901_0386542 | 3300038443 | Bacteria | 1440 |
| 901 | Ga0395901_0955999 | 3300038443 | Bacteria | 835 |
| 902 | Ga0436365_0650112 | 3300039437 | Bacteria | 58550 |
| 903 | Ga0436365_0762255 | 3300039437 | Bacteria | 811 |
| 904 | Ga0436365_1011842 | 3300039437 | Bacteria | 1571 |
| 905 | Ga0436365_1020322 | 3300039437 | Bacteria | 547 |
| 906 | Ga0436365_1439408 | 3300039437 | Bacteria | 1349 |
| 907 | Ga0436365_1490043 | 3300039437 | Bacteria | 1261 |
| 908 | Ga0436360_0774184 | 3300039438 | Bacteria | 700 |
| 909 | Ga0436363_0280053 | 3300039450 | Bacteria | 1814 |
| 910 | Ga0436363_1091320 | 3300039450 | Bacteria | 1142 |
| 911 | Ga0436362_0326822 | 3300039453 | Bacteria | 947 |
| 912 | Ga0436362_0465319 | 3300039453 | Bacteria | 2858 |
| 913 | Ga0439439_0243865 | 3300041406 | Unclassified | 531 |
| 914 | Ga0439461_0109522 | 3300041410 | Bacteria | 680 |
| 915 | Ga0439465_0097054 | 3300041413 | Bacteria | 1014 |
| 916 | Ga0439465_0236761 | 3300041413 | Bacteria | 672 |
| 917 | Ga0451791_0351032 | 3300041451 | Bacteria | 552 |
| 918 | Ga0451791_0779637 | 3300041451 | Bacteria | 1131 |
| 919 | Ga0451793_1056007 | 3300041452 | Bacteria | 619 |
| 920 | Ga0451795_1447378 | 3300041456 | Bacteria | 817 |
| 921 | Ga0451798_0116531 | 3300041458 | Bacteria | 596 |
| 922 | Ga0451802_1480618 | 3300041460 | Bacteria | 676 |
| 923 | Ga0451802_1993911 | 3300041460 | Bacteria | 880 |
| 924 | Ga0451802_2170941 | 3300041460 | Bacteria | 596 |
| 925 | Ga0451804_0756001 | 3300041463 | Bacteria | 1026 |
| 926 | Ga0451807_1552806 | 3300041486 | Bacteria | 591 |
| 927 | Ga0451807_1643728 | 3300041486 | Bacteria | 781 |
| 928 | Ga0451807_2306262 | 3300041486 | Bacteria | 509 |
| 929 | Ga0451837_1520441 | 3300041494 | Bacteria | 586 |
| 930 | Ga0451841_0434281 | 3300041498 | Bacteria | 732 |
| 931 | Ga0451843_0781848 | 3300041509 | Bacteria | 664 |
| 932 | Ga0451843_1073320 | 3300041509 | Bacteria | 811 |
| 933 | Ga0451855_0748553 | 3300041511 | Bacteria | 586 |
| 934 | Ga0451853_0022904 | 3300041512 | Bacteria | 924 |
| 935 | Ga0451853_1309630 | 3300041512 | Bacteria | 740 |
| 936 | Ga0439431_0164142 | 3300041997 | Bacteria | 636 |
| 937 | Ga0439434_0042721 | 3300042435 | Bacteria | 1394 |
| 938 | Ga0439459_0032648 | 3300042438 | Bacteria | 1068 |
| 939 | Ga0439464_0319996 | 3300042439 | Bacteria | 509 |
| 940 | Ga0439460_0164675 | 3300042461 | Bacteria | 745 |
| 941 | Ga0466972_0000103 | 3300044658 | Bacteria | 75095 |
| 942 | Ga0466963_0504605 | 3300044694 | Bacteria | 854 |
| 943 | Ga0466964_0114755 | 3300044706 | Bacteria | 1206 |
| 944 | Ga0466964_0422816 | 3300044706 | Bacteria | 701 |
| 945 | Ga0466968_0057719 | 3300044735 | Bacteria | 1669 |
| 946 | Ga0466968_0141319 | 3300044735 | Bacteria | 1101 |
| 947 | Ga0466957_0352469 | 3300044842 | Bacteria | 999 |
| 948 | Ga0466960_0538011 | 3300044901 | Bacteria | 688 |
| 949 | Ga0466967_0054063 | 3300045976 | Bacteria | 3532 |
| 950 | Ga0466967_0315072 | 3300045976 | Bacteria | 1508 |
| 951 | Ga0466967_0482997 | 3300045976 | Bacteria | 1214 |
| 952 | Ga0495617_027265 | 3300046452 | Bacteria | 1922 |
| 953 | Ga0495617_033846 | 3300046452 | Bacteria | 1715 |
| 954 | Ga0495617_151985 | 3300046452 | Bacteria | 736 |
| 955 | Ga0495592_0006419 | 3300046454 | Bacteria | 8753 |
| 956 | Ga0495603_0004004 | 3300046455 | Bacteria | 8770 |
| 957 | Ga0495603_0040916 | 3300046455 | Bacteria | 2772 |
| 958 | Ga0495603_0199878 | 3300046455 | Bacteria | 1155 |
| 959 | Ga0495603_0213819 | 3300046455 | Bacteria | 1113 |
| 960 | Ga0495603_0235945 | 3300046455 | Bacteria | 1054 |
| 961 | Ga0495603_0286982 | 3300046455 | Bacteria | 946 |
| 962 | Ga0495603_0509490 | 3300046455 | Bacteria | 689 |
| 963 | Ga0495603_0706715 | 3300046455 | Bacteria | 576 |
| 964 | Ga0495590_0071553 | 3300046457 | Bacteria | 1217 |
| 965 | Ga0495590_0196845 | 3300046457 | Bacteria | 740 |
| 966 | Ga0495590_0259714 | 3300046457 | Bacteria | 647 |
| 967 | Ga0495590_0267416 | 3300046457 | Bacteria | 638 |
| 968 | Ga0495629_0048237 | 3300046459 | Bacteria | 2986 |
| 969 | Ga0495629_0522075 | 3300046459 | Bacteria | 799 |
| 970 | Ga0495629_0921208 | 3300046459 | Bacteria | 572 |
| 971 | Ga0495638_0007023 | 3300046460 | Bacteria | 8121 |
| 972 | Ga0495638_0333428 | 3300046460 | Bacteria | 806 |
| 973 | Ga0495638_0589454 | 3300046460 | Bacteria | 547 |
| 974 | Ga0495641_0160039 | 3300046461 | Bacteria | 1007 |
| 975 | Ga0495641_0195243 | 3300046461 | Bacteria | 907 |
| 976 | Ga0495651_0104835 | 3300046462 | Bacteria | 2098 |
| 977 | Ga0495651_0957228 | 3300046462 | Bacteria | 521 |
| 978 | Ga0495653_0256417 | 3300046463 | Bacteria | 1158 |
| 979 | Ga0495650_0062372 | 3300046471 | Bacteria | 1490 |
| 980 | Ga0495650_0114779 | 3300046471 | Bacteria | 996 |
| 981 | Ga0495580_0062442 | 3300046472 | Bacteria | 2614 |
| 982 | Ga0495582_0140032 | 3300046473 | Bacteria | 1370 |
| 983 | Ga0495605_0074591 | 3300046474 | Bacteria | 1596 |
| 984 | Ga0495605_0159424 | 3300046474 | Bacteria | 1002 |
| 985 | Ga0495605_0169003 | 3300046474 | Bacteria | 967 |
| 986 | Ga0495605_0196321 | 3300046474 | Bacteria | 881 |
| 987 | Ga0495605_0479851 | 3300046474 | Bacteria | 510 |
| 988 | Ga0495639_0097098 | 3300046475 | Bacteria | 1388 |
| 989 | Ga0495662_0102808 | 3300046476 | Bacteria | 1398 |
| 990 | Ga0495662_0367183 | 3300046476 | Bacteria | 707 |
| 991 | Ga0495664_0039454 | 3300046477 | Bacteria | 2790 |
| 992 | Ga0495664_0341228 | 3300046477 | Bacteria | 903 |
| 993 | Ga0495585_0118621 | 3300046492 | Bacteria | 1401 |
| 994 | Ga0495585_0232256 | 3300046492 | Bacteria | 926 |
| 995 | Ga0495585_0245502 | 3300046492 | Bacteria | 895 |
| 996 | Ga0495585_0550741 | 3300046492 | Bacteria | 545 |
| 997 | Ga0495585_0575128 | 3300046492 | Bacteria | 531 |
| 998 | Ga0495594_0015597 | 3300046499 | Bacteria | 3994 |
| 999 | Ga0495594_0325893 | 3300046499 | Bacteria | 875 |
| 1000 | Ga0495594_0348650 | 3300046499 | Bacteria | 843 |
| 1001 | Ga0495596_0168844 | 3300046500 | Bacteria | 850 |
| 1002 | Ga0495607_0070719 | 3300046501 | Bacteria | 1949 |
| 1003 | Ga0495607_0211818 | 3300046501 | Bacteria | 953 |
| 1004 | Ga0495607_0525195 | 3300046501 | Bacteria | 522 |
| 1005 | Ga0495583_0155558 | 3300046506 | Bacteria | 946 |
| 1006 | Ga0495583_0348019 | 3300046506 | Bacteria | 585 |
| 1007 | Ga0495583_0374122 | 3300046506 | Bacteria | 561 |
| 1008 | Ga0495606_0259403 | 3300046507 | Bacteria | 960 |
| 1009 | Ga0495608_0146937 | 3300046511 | Bacteria | 1503 |
| 1010 | Ga0495608_0408249 | 3300046511 | Bacteria | 830 |
| 1011 | Ga0495610_0101402 | 3300046512 | Bacteria | 1289 |
| 1012 | Ga0495616_0036522 | 3300046513 | Bacteria | 2535 |
| 1013 | Ga0495616_0220123 | 3300046513 | Bacteria | 827 |
| 1014 | Ga0495618_0103673 | 3300046514 | Bacteria | 1821 |
| 1015 | Ga0495620_0144181 | 3300046515 | Bacteria | 930 |
| 1016 | Ga0495620_0263225 | 3300046515 | Bacteria | 657 |
| 1017 | Ga0495628_0046957 | 3300046516 | Bacteria | 3428 |
| 1018 | Ga0495628_0781912 | 3300046516 | Bacteria | 669 |
| 1019 | Ga0495630_0160306 | 3300046517 | Bacteria | 1713 |
| 1020 | Ga0495630_1470468 | 3300046517 | Bacteria | 512 |
| 1021 | Ga0495631_0104132 | 3300046518 | Bacteria | 1221 |
| 1022 | Ga0495631_0136765 | 3300046518 | Bacteria | 1052 |
| 1023 | Ga0495631_0140579 | 3300046518 | Bacteria | 1037 |
| 1024 | Ga0495632_0019670 | 3300046519 | Bacteria | 3673 |
| 1025 | Ga0495632_0045655 | 3300046519 | Bacteria | 2181 |
| 1026 | Ga0495632_0426113 | 3300046519 | Bacteria | 577 |
| 1027 | Ga0495632_0438840 | 3300046519 | Bacteria | 567 |
| 1028 | Ga0495632_0462512 | 3300046519 | Bacteria | 549 |
| 1029 | Ga0495643_0018978 | 3300046522 | Bacteria | 3982 |
| 1030 | Ga0495643_0372475 | 3300046522 | Bacteria | 635 |
| 1031 | Ga0495643_0534198 | 3300046522 | Bacteria | 501 |
| 1032 | Ga0495644_0125630 | 3300046523 | Bacteria | 977 |
| 1033 | Ga0495648_0204062 | 3300046524 | Bacteria | 987 |
| 1034 | Ga0495648_0353047 | 3300046524 | Bacteria | 671 |
| 1035 | Ga0495663_0023116 | 3300046525 | Bacteria | 1799 |
| 1036 | Ga0495663_0163643 | 3300046525 | Bacteria | 764 |
| 1037 | Ga0495666_0022400 | 3300046526 | Bacteria | 3129 |
| 1038 | Ga0495642_0449519 | 3300046528 | Bacteria | 569 |
| 1039 | Ga0495652_0125924 | 3300046529 | Bacteria | 2035 |
| 1040 | Ga0495652_0423941 | 3300046529 | Bacteria | 937 |
| 1041 | Ga0495665_0400678 | 3300046531 | Bacteria | 696 |
| 1042 | Ga0495586_0450721 | 3300046535 | Bacteria | 742 |
| 1043 | Ga0495587_0045966 | 3300046536 | Bacteria | 2593 |
| 1044 | Ga0495587_0263905 | 3300046536 | Bacteria | 967 |
| 1045 | Ga0495598_0006848 | 3300046537 | Bacteria | 2588 |
| 1046 | Ga0495598_0086324 | 3300046537 | Bacteria | 1015 |
| 1047 | Ga0495598_0293577 | 3300046537 | Bacteria | 613 |
| 1048 | Ga0495598_0328446 | 3300046537 | Bacteria | 584 |
| 1049 | Ga0495609_0169740 | 3300046538 | Bacteria | 922 |
| 1050 | Ga0495609_0170849 | 3300046538 | Bacteria | 918 |
| 1051 | Ga0495621_0060031 | 3300046539 | Bacteria | 1378 |
| 1052 | Ga0495621_0439845 | 3300046539 | Bacteria | 557 |
| 1053 | Ga0495597_0016739 | 3300046542 | Bacteria | 3461 |
| 1054 | Ga0495597_0161475 | 3300046542 | Bacteria | 914 |
| 1055 | Ga0495597_0189414 | 3300046542 | Bacteria | 828 |
| 1056 | Ga0495645_0059254 | 3300046543 | Bacteria | 2777 |
| 1057 | Ga0495622_0043255 | 3300046557 | Bacteria | 2094 |
| 1058 | Ga0495622_0248839 | 3300046557 | Bacteria | 782 |
| 1059 | Ga0495622_0316789 | 3300046557 | Bacteria | 678 |
| 1060 | Ga0495633_0090948 | 3300046558 | Bacteria | 1419 |
| 1061 | Ga0495633_0103185 | 3300046558 | Bacteria | 1323 |
| 1062 | Ga0495633_0487312 | 3300046558 | Bacteria | 556 |
| 1063 | Ga0495667_0093822 | 3300046559 | Bacteria | 1943 |
| 1064 | Ga0495667_0294854 | 3300046559 | Bacteria | 1028 |
| 1065 | Ga0495656_0014489 | 3300046615 | Bacteria | 2957 |
| 1066 | Ga0495656_0025167 | 3300046615 | Bacteria | 2357 |
| 1067 | Ga0495656_0380705 | 3300046615 | Bacteria | 735 |
| 1068 | Ga0495656_0398765 | 3300046615 | Bacteria | 719 |
| 1069 | Ga0495656_0412102 | 3300046615 | Bacteria | 708 |
| 1070 | Ga0495656_0487813 | 3300046615 | Bacteria | 652 |
| 1071 | Ga0495668_0036843 | 3300046616 | Bacteria | 2739 |
| 1072 | Ga0495668_0074226 | 3300046616 | Bacteria | 1868 |
| 1073 | Ga0495668_0107302 | 3300046616 | Bacteria | 1527 |
| 1074 | Ga0495668_0139602 | 3300046616 | Bacteria | 1326 |
| 1075 | Ga0495668_0177552 | 3300046616 | Bacteria | 1167 |
| 1076 | Ga0495668_0178521 | 3300046616 | Bacteria | 1163 |
| 1077 | Ga0495668_0279679 | 3300046616 | Bacteria | 914 |
| 1078 | Ga0495668_0372247 | 3300046616 | Bacteria | 784 |
| 1079 | Ga0495634_0212718 | 3300046642 | Bacteria | 1196 |
| 1080 | Ga0495634_0292385 | 3300046642 | Bacteria | 987 |
| 1081 | Ga0495611_0153435 | 3300046648 | Bacteria | 1075 |
| 1082 | Ga0495611_0360463 | 3300046648 | Bacteria | 667 |
| 1083 | Ga0495625_0295045 | 3300046660 | Bacteria | 1039 |
| 1084 | Ga0495625_0327765 | 3300046660 | Bacteria | 973 |
| 1085 | Ga0495625_0333958 | 3300046660 | Bacteria | 962 |
| 1086 | Ga0495625_0379973 | 3300046660 | Bacteria | 886 |
| 1087 | Ga0495625_0401986 | 3300046660 | Bacteria | 855 |
| 1088 | Ga0495625_0593625 | 3300046660 | Bacteria | 666 |
| 1089 | Ga0495635_0148174 | 3300046663 | Bacteria | 1598 |
| 1090 | Ga0495635_0398418 | 3300046663 | Bacteria | 914 |
| 1091 | Ga0495659_0022069 | 3300046664 | Bacteria | 2149 |
| 1092 | Ga0495659_0153402 | 3300046664 | Bacteria | 926 |
| 1093 | Ga0495659_0369175 | 3300046664 | Bacteria | 615 |
| 1094 | Ga0495661_0233281 | 3300046665 | Bacteria | 948 |
| 1095 | Ga0495661_0282504 | 3300046665 | Bacteria | 836 |
| 1096 | Ga0495588_0013335 | 3300046674 | Bacteria | 3914 |
| 1097 | Ga0495588_0404279 | 3300046674 | Bacteria | 717 |
| 1098 | Ga0495657_0045052 | 3300046675 | Bacteria | 2995 |
| 1099 | Ga0495657_0191237 | 3300046675 | Bacteria | 1251 |
| 1100 | Ga0495623_0246181 | 3300046679 | Bacteria | 1007 |
| 1101 | Ga0495623_0727030 | 3300046679 | Bacteria | 507 |
| 1102 | Ga0495646_0277428 | 3300046680 | Bacteria | 891 |
| 1103 | Ga0495647_0143356 | 3300046681 | Bacteria | 1020 |
| 1104 | Ga0495647_0161801 | 3300046681 | Bacteria | 965 |
| 1105 | Ga0495647_0606606 | 3300046681 | Bacteria | 514 |
| 1106 | Ga0495658_0047124 | 3300046683 | Bacteria | 2426 |
| 1107 | Ga0495658_0229965 | 3300046683 | Bacteria | 1163 |
| 1108 | Ga0495669_0009770 | 3300046684 | Bacteria | 4050 |
| 1109 | Ga0495669_0178578 | 3300046684 | Bacteria | 1011 |
| 1110 | Ga0495669_0371833 | 3300046684 | Bacteria | 692 |
| 1111 | Ga0495669_0395627 | 3300046684 | Bacteria | 669 |
| 1112 | Ga0495613_0215885 | 3300046689 | Bacteria | 1348 |
| 1113 | Ga0495624_0166371 | 3300046690 | Bacteria | 1346 |
| 1114 | Ga0495624_0184441 | 3300046690 | Bacteria | 1271 |
| 1115 | Ga0495624_0492823 | 3300046690 | Bacteria | 733 |
| 1116 | Ga0495670_0063192 | 3300046691 | Bacteria | 1864 |
| 1117 | Ga0495670_0151618 | 3300046691 | Bacteria | 1216 |
| 1118 | Ga0495670_0170032 | 3300046691 | Bacteria | 1147 |
| 1119 | Ga0495670_0178012 | 3300046691 | Bacteria | 1122 |
| 1120 | Ga0495670_0305677 | 3300046691 | Bacteria | 853 |
| 1121 | Ga0495670_0493325 | 3300046691 | Bacteria | 665 |
| 1122 | Ga0495670_0751582 | 3300046691 | Bacteria | 532 |
| 1123 | Ga0495671_0032886 | 3300046692 | Bacteria | 2645 |
| 1124 | Ga0495671_0375221 | 3300046692 | Bacteria | 682 |
| 1125 | Ga0495671_0464718 | 3300046692 | Bacteria | 604 |
| 1126 | Ga0495671_0594957 | 3300046692 | Bacteria | 526 |
| 1127 | Ga0495649_0128503 | 3300046694 | Bacteria | 1338 |
| 1128 | Ga0495649_0287481 | 3300046694 | Bacteria | 839 |
| 1129 | Ga0495649_0555943 | 3300046694 | Bacteria | 568 |
| 1130 | Ga0495589_0110014 | 3300046794 | Bacteria | 1330 |
| 1131 | Ga0495589_0465141 | 3300046794 | Bacteria | 578 |
| 1132 | Ga0495589_0538120 | 3300046794 | Bacteria | 533 |
| 1133 | Ga0495589_0575384 | 3300046794 | Bacteria | 513 |
| 1134 | Ga0495600_0163840 | 3300046809 | Bacteria | 1436 |
| 1135 | Ga0495600_0267556 | 3300046809 | Bacteria | 1085 |
| 1136 | Ga0495660_0333527 | 3300046810 | Bacteria | 678 |
| 1137 | Ga0495581_0162232 | 3300047315 | Bacteria | 1307 |
| 1138 | Ga0495581_0171175 | 3300047315 | Bacteria | 1270 |
| 1139 | Ga0495581_0411880 | 3300047315 | Bacteria | 788 |
| 1140 | Ga0495604_0946401 | 3300047317 | Bacteria | 536 |
| 1141 | Ga0495674_0118456 | 3300047319 | Bacteria | 2239 |
| 1142 | Ga0495674_0529027 | 3300047319 | Bacteria | 940 |
| 1143 | Ga0495674_0697183 | 3300047319 | Bacteria | 797 |
| 1144 | Ga0495674_0951857 | 3300047319 | Bacteria | 660 |
| 1145 | Ga0495674_1130939 | 3300047319 | Bacteria | 595 |
| 1146 | Ga0495672_0312047 | 3300047320 | Bacteria | 741 |
| 1147 | Ga0495676_0068390 | 3300047321 | Bacteria | 2744 |
| 1148 | Ga0495676_0080875 | 3300047321 | Bacteria | 2465 |
| 1149 | Ga0495676_0847075 | 3300047321 | Bacteria | 587 |
| 1150 | Ga0495680_0121242 | 3300047322 | Bacteria | 1930 |
| 1151 | Ga0495680_0513413 | 3300047322 | Bacteria | 812 |
| 1152 | Ga0495683_0070352 | 3300047323 | Bacteria | 1718 |
| 1153 | Ga0495683_0169811 | 3300047323 | Bacteria | 1003 |
| 1154 | Ga0495683_0373852 | 3300047323 | Bacteria | 597 |
| 1155 | Ga0495687_026059 | 3300047443 | Bacteria | 2756 |
| 1156 | Ga0495675_0061810 | 3300047444 | Bacteria | 2372 |
| 1157 | Ga0495677_0142896 | 3300047445 | Bacteria | 919 |
| 1158 | Ga0495677_0322087 | 3300047445 | Bacteria | 609 |
| 1159 | Ga0495685_148898 | 3300047447 | Bacteria | 761 |
| 1160 | Ga0495673_0240891 | 3300047469 | Bacteria | 663 |
| 1161 | Ga0495686_0220865 | 3300047472 | Bacteria | 1078 |
| 1162 | Ga0495686_0325015 | 3300047472 | Bacteria | 842 |
| 1163 | Ga0495686_0338735 | 3300047472 | Bacteria | 820 |
| 1164 | Ga0495686_0458610 | 3300047472 | Bacteria | 676 |
| 1165 | Ga0495593_0718801 | 3300047673 | Bacteria | 502 |
| 1166 | Ga0495602_0251574 | 3300048088 | Bacteria | 1316 |
| 1167 | Ga0495602_0617432 | 3300048088 | Bacteria | 744 |
| 1168 | Ga0495615_0046998 | 3300048090 | Bacteria | 1099 |
| 1169 | Ga0495626_0062379 | 3300048091 | Bacteria | 1693 |
| 1170 | Ga0496100_0036087 | 3300048903 | Bacteria | 3115 |
| 1171 | Ga0496100_0257733 | 3300048903 | Bacteria | 1292 |
| 1172 | Ga0496100_0279430 | 3300048903 | Bacteria | 1244 |
| 1173 | Ga0496100_1532967 | 3300048903 | Bacteria | 526 |
| 1174 | Ga0496101_0119028 | 3300048904 | Bacteria | 1995 |
| 1175 | Ga0496101_0181314 | 3300048904 | Bacteria | 1622 |
| 1176 | Ga0496101_0314994 | 3300048904 | Bacteria | 1227 |
| 1177 | Ga0496101_0338786 | 3300048904 | Bacteria | 1181 |
| 1178 | Ga0496101_0374878 | 3300048904 | Bacteria | 1119 |
| 1179 | Ga0496101_0855810 | 3300048904 | Bacteria | 716 |
| 1180 | Ga0496101_1029200 | 3300048904 | Bacteria | 647 |
| 1181 | Ga0496102_0020395 | 3300048905 | Bacteria | 5858 |
| 1182 | Ga0496102_0063796 | 3300048905 | Bacteria | 3373 |
| 1183 | Ga0496102_0169871 | 3300048905 | Bacteria | 2053 |
| 1184 | Ga0496102_0413866 | 3300048905 | Bacteria | 1266 |
| 1185 | Ga0496102_0815625 | 3300048905 | Bacteria | 855 |
| 1186 | Ga0496102_0840779 | 3300048905 | Bacteria | 840 |
| 1187 | Ga0496103_0012448 | 3300048906 | Bacteria | 5046 |
| 1188 | Ga0496103_0168383 | 3300048906 | Bacteria | 1406 |
| 1189 | Ga0496103_0248696 | 3300048906 | Bacteria | 1144 |
| 1190 | Ga0496103_0457552 | 3300048906 | Bacteria | 818 |
| 1191 | Ga0496103_0569827 | 3300048906 | Bacteria | 722 |
| 1192 | Ga0496104_0005304 | 3300048907 | Bacteria | 11278 |
| 1193 | Ga0496104_0028812 | 3300048907 | Bacteria | 5147 |
| 1194 | Ga0496104_0032218 | 3300048907 | Bacteria | 4877 |
| 1195 | Ga0496104_0160497 | 3300048907 | Bacteria | 2156 |
| 1196 | Ga0496104_0164757 | 3300048907 | Bacteria | 2125 |
| 1197 | Ga0496104_0237782 | 3300048907 | Bacteria | 1733 |
| 1198 | Ga0496104_0528289 | 3300048907 | Bacteria | 1091 |
| 1199 | Ga0496104_0804067 | 3300048907 | Bacteria | 846 |
| 1200 | Ga0496104_0887891 | 3300048907 | Bacteria | 797 |
| 1201 | Ga0496104_1397581 | 3300048907 | Bacteria | 603 |
| 1202 | Ga0496104_1818190 | 3300048907 | Bacteria | 511 |
| 1203 | Ga0496105_0031279 | 3300048908 | Bacteria | 4364 |
| 1204 | Ga0496105_0134113 | 3300048908 | Bacteria | 2040 |
| 1205 | Ga0496105_0137428 | 3300048908 | Bacteria | 2013 |
| 1206 | Ga0496105_0253075 | 3300048908 | Bacteria | 1426 |
| 1207 | Ga0496105_0327141 | 3300048908 | Bacteria | 1227 |
| 1208 | Ga0496106_0121425 | 3300048909 | Bacteria | 2042 |
| 1209 | Ga0496106_0286971 | 3300048909 | Bacteria | 1319 |
| 1210 | Ga0496106_0649612 | 3300048909 | Bacteria | 843 |
| 1211 | Ga0496106_0834071 | 3300048909 | Bacteria | 730 |
| 1212 | Ga0496107_0003794 | 3300048910 | Bacteria | 10148 |
| 1213 | Ga0496107_0040653 | 3300048910 | Bacteria | 3338 |
| 1214 | Ga0496107_0362702 | 3300048910 | Bacteria | 1078 |
| 1215 | Ga0496107_0375479 | 3300048910 | Bacteria | 1057 |
| 1216 | Ga0496107_0465183 | 3300048910 | Bacteria | 939 |
| 1217 | Ga0496107_0509951 | 3300048910 | Bacteria | 892 |
| 1218 | Ga0496107_0841801 | 3300048910 | Bacteria | 670 |
| 1219 | Ga0496108_0058299 | 3300048911 | Bacteria | 3245 |
| 1220 | Ga0496108_0099447 | 3300048911 | Bacteria | 2479 |
| 1221 | Ga0496108_0416753 | 3300048911 | Bacteria | 1173 |
| 1222 | Ga0496108_0833165 | 3300048911 | Bacteria | 794 |
| 1223 | Ga0496108_0887637 | 3300048911 | Bacteria | 766 |
| 1224 | Ga0496108_1108332 | 3300048911 | Bacteria | 672 |
| 1225 | Ga0496108_1535273 | 3300048911 | Bacteria | 553 |
| 1226 | Ga0496109_0025525 | 3300048912 | Bacteria | 5267 |
| 1227 | Ga0496109_0159771 | 3300048912 | Bacteria | 2111 |
| 1228 | Ga0496109_0162816 | 3300048912 | Bacteria | 2090 |
| 1229 | Ga0496109_0212245 | 3300048912 | Bacteria | 1820 |
| 1230 | Ga0496109_0281849 | 3300048912 | Bacteria | 1566 |
| 1231 | Ga0496109_1101649 | 3300048912 | Bacteria | 731 |
| 1232 | Ga0496110_0011045 | 3300048913 | Bacteria | 7372 |
| 1233 | Ga0496110_0031931 | 3300048913 | Bacteria | 4545 |
| 1234 | Ga0496110_0140768 | 3300048913 | Bacteria | 2181 |
| 1235 | Ga0496110_0166098 | 3300048913 | Bacteria | 2001 |
| 1236 | Ga0496110_0246615 | 3300048913 | Bacteria | 1625 |
| 1237 | Ga0496110_0460076 | 3300048913 | Bacteria | 1159 |
| 1238 | Ga0496110_0569665 | 3300048913 | Bacteria | 1028 |
| 1239 | Ga0496110_1413380 | 3300048913 | Bacteria | 605 |
| 1240 | Ga0496110_1678913 | 3300048913 | Bacteria | 545 |
| 1241 | Ga0496111_0193593 | 3300048914 | Bacteria | 1512 |
| 1242 | Ga0496111_0279829 | 3300048914 | Bacteria | 1237 |
| 1243 | Ga0496111_0285505 | 3300048914 | Bacteria | 1224 |
| 1244 | Ga0496111_0294227 | 3300048914 | Bacteria | 1204 |
| 1245 | Ga0496112_0002348 | 3300048915 | Bacteria | 15192 |
| 1246 | Ga0496112_0024571 | 3300048915 | Bacteria | 5773 |
| 1247 | Ga0496112_0032266 | 3300048915 | Bacteria | 5084 |
| 1248 | Ga0496112_0161748 | 3300048915 | Bacteria | 2205 |
| 1249 | Ga0496112_0264925 | 3300048915 | Bacteria | 1667 |
| 1250 | Ga0496112_0641936 | 3300048915 | Bacteria | 992 |
| 1251 | Ga0496112_0847424 | 3300048915 | Bacteria | 837 |
| 1252 | Ga0496112_0922201 | 3300048915 | Bacteria | 795 |
| 1253 | Ga0496112_1104583 | 3300048915 | Unclassified | 711 |
| 1254 | Ga0496113_0010309 | 3300048916 | Bacteria | 6174 |
| 1255 | Ga0496113_0077551 | 3300048916 | Bacteria | 2541 |
| 1256 | Ga0496113_0106478 | 3300048916 | Bacteria | 2178 |
| 1257 | Ga0496113_0210828 | 3300048916 | Bacteria | 1546 |
| 1258 | Ga0496113_0607093 | 3300048916 | Bacteria | 876 |
| 1259 | Ga0496113_0810652 | 3300048916 | Bacteria | 743 |
| 1260 | Ga0496114_0127199 | 3300048917 | Bacteria | 2197 |
| 1261 | Ga0496114_0176754 | 3300048917 | Bacteria | 1863 |
| 1262 | Ga0496114_0695250 | 3300048917 | Bacteria | 892 |
| 1263 | Ga0496114_0977498 | 3300048917 | Unclassified | 729 |
| 1264 | Ga0496114_1043281 | 3300048917 | Bacteria | 701 |
| 1265 | Ga0496114_1084395 | 3300048917 | Bacteria | 685 |
| 1266 | Ga0496114_1287531 | 3300048917 | Unclassified | 618 |
| 1267 | Ga0496114_1437162 | 3300048917 | Bacteria | 577 |
| 1268 | Ga0496114_1793286 | 3300048917 | Bacteria | 502 |
| 1269 | Ga0496115_0031637 | 3300048918 | Bacteria | 4169 |
| 1270 | Ga0496115_0082169 | 3300048918 | Bacteria | 2624 |
| 1271 | Ga0496115_0137195 | 3300048918 | Bacteria | 2017 |
| 1272 | Ga0496115_0165538 | 3300048918 | Bacteria | 1829 |
| 1273 | Ga0496115_0349061 | 3300048918 | Bacteria | 1207 |
| 1274 | Ga0496115_0361198 | 3300048918 | Bacteria | 1183 |
| 1275 | Ga0496115_1415319 | 3300048918 | Bacteria | 513 |
| 1276 | Ga0496116_0215047 | 3300048919 | Bacteria | 992 |
| 1277 | Ga0496117_0135251 | 3300048920 | Bacteria | 1486 |
| 1278 | Ga0496117_0608482 | 3300048920 | Bacteria | 510 |
| 1279 | Ga0496118_0060394 | 3300048921 | Bacteria | 2815 |
| 1280 | Ga0496118_0232542 | 3300048921 | Bacteria | 1062 |
| 1281 | Ga0496118_0243162 | 3300048921 | Bacteria | 1029 |
| 1282 | Ga0496118_0268683 | 3300048921 | Bacteria | 957 |
| 1283 | Ga0496118_0630617 | 3300048921 | Bacteria | 507 |
| 1284 | Ga0496119_0499896 | 3300048922 | Bacteria | 566 |
| 1285 | Ga0496120_0458354 | 3300048923 | Bacteria | 554 |
| 1286 | Ga0496121_0040767 | 3300048924 | Bacteria | 4068 |
| 1287 | Ga0496121_0124235 | 3300048924 | Bacteria | 1943 |
| 1288 | Ga0496121_0147495 | 3300048924 | Bacteria | 1736 |
| 1289 | Ga0496121_0320748 | 3300048924 | Bacteria | 1043 |
| 1290 | Ga0496121_0383791 | 3300048924 | Bacteria | 925 |
| 1291 | Ga0496121_0397045 | 3300048924 | Bacteria | 904 |
| 1292 | Ga0496121_0432689 | 3300048924 | Bacteria | 853 |
| 1293 | Ga0496121_0474454 | 3300048924 | Bacteria | 800 |
| 1294 | Ga0496124_0042163 | 3300048927 | Bacteria | 3932 |
| 1295 | Ga0496124_0092171 | 3300048927 | Bacteria | 2468 |
| 1296 | Ga0496124_0456445 | 3300048927 | Bacteria | 870 |
| 1297 | Ga0496125_0064993 | 3300048928 | Bacteria | 2894 |
| 1298 | Ga0496125_0184109 | 3300048928 | Bacteria | 1387 |
| 1299 | Ga0496125_0541521 | 3300048928 | Bacteria | 647 |
| 1300 | Ga0496125_0605295 | 3300048928 | Bacteria | 598 |
| 1301 | Ga0496125_0717242 | 3300048928 | Bacteria | 528 |
| 1302 | Ga0496126_0076414 | 3300048929 | Bacteria | 2971 |
| 1303 | Ga0496126_0109357 | 3300048929 | Bacteria | 2409 |
| 1304 | Ga0496126_0183915 | 3300048929 | Bacteria | 1773 |
| 1305 | Ga0496126_0371718 | 3300048929 | Bacteria | 1165 |
| 1306 | Ga0495678_268874 | 3300049459 | Bacteria | 502 |
| 1307 | Ga0495682_0068866 | 3300049460 | Bacteria | 1274 |
| 1308 | Ga0495682_0190605 | 3300049460 | Bacteria | 728 |
| 1309 | Ga0501032_0023304 | 3300049569 | Bacteria | 4281 |
| 1310 | Ga0501034_0435990 | 3300049571 | Bacteria | 1229 |
| 1311 | Ga0501036_0078202 | 3300049572 | Bacteria | 2798 |
| 1312 | Ga0501036_0127553 | 3300049572 | Bacteria | 2148 |
| 1313 | Ga0501036_1476751 | 3300049572 | Bacteria | 550 |
| 1314 | Ga0501037_0019267 | 3300049573 | Bacteria | 5031 |
| 1315 | Ga0501037_0214971 | 3300049573 | Bacteria | 1354 |
| 1316 | Ga0501038_0006071 | 3300049574 | Bacteria | 11176 |
| 1317 | Ga0501039_0532010 | 3300049575 | Bacteria | 922 |
| 1318 | Ga0501042_0857248 | 3300049578 | Bacteria | 661 |
| 1319 | Ga0501047_0040644 | 3300049581 | Bacteria | 4497 |
| 1320 | Ga0501067_0025603 | 3300049583 | Bacteria | 3270 |
| 1321 | Ga0501067_0089839 | 3300049583 | Bacteria | 1705 |
| 1322 | Ga0501070_0204410 | 3300049586 | Bacteria | 1622 |
| 1323 | Ga0501071_0491521 | 3300049587 | Bacteria | 941 |
| 1324 | Ga0501071_0559757 | 3300049587 | Bacteria | 878 |
| 1325 | Ga0501072_0752131 | 3300049588 | Bacteria | 765 |
| 1326 | Ga0501073_0228990 | 3300049589 | Bacteria | 1284 |
| 1327 | Ga0501073_0271726 | 3300049589 | Bacteria | 1170 |
| 1328 | Ga0501074_1299807 | 3300049590 | Bacteria | 510 |
| 1329 | Ga0501075_0597190 | 3300049591 | Bacteria | 842 |
| 1330 | Ga0501079_0441549 | 3300049741 | Bacteria | 1022 |
| 1331 | Ga0501079_0762325 | 3300049741 | Bacteria | 762 |
| 1332 | Ga0501081_0678878 | 3300049743 | Bacteria | 773 |
| 1333 | Ga0501081_0879323 | 3300049743 | Bacteria | 675 |
| 1334 | Ga0501035_0036749 | 3300049822 | Bacteria | 4438 |
| 1335 | Ga0501035_0914083 | 3300049822 | Bacteria | 694 |
| 1336 | Ga0501044_0048353 | 3300049823 | Bacteria | 4394 |
| 1337 | nmdc:mga03683_32653_c1 | 3300050489 | Bacteria | 2095 |
| 1338 | nmdc:mga03683_427858_c1 | 3300050489 | Bacteria | 635 |
| 1339 | nmdc:mga03n38_66284_c1 | 3300050490 | Bacteria | 1658 |
| 1340 | nmdc:mga03n38_750_c1 | 3300050490 | Bacteria | 8581 |
| 1341 | nmdc:mga00v17_145356_c2 | 3300050491 | Bacteria | 1013 |
| 1342 | nmdc:mga00v17_89925_c1 | 3300050491 | Bacteria | 1927 |
| 1343 | nmdc:mga0yw44_110342_c2 | 3300050492 | Bacteria | 860 |
| 1344 | nmdc:mga0yw44_134708_c1 | 3300050492 | Bacteria | 1602 |
| 1345 | nmdc:mga0yw44_194989_c1 | 3300050492 | Bacteria | 1337 |
| 1346 | nmdc:mga0yw44_460391_c1 | 3300050492 | Bacteria | 862 |
| 1347 | nmdc:mga0yw44_71352_c1 | 3300050492 | Bacteria | 2156 |
| 1348 | nmdc:mga0k408_218592_c1 | 3300050493 | Bacteria | 1138 |
| 1349 | nmdc:mga0k408_383205_c1 | 3300050493 | Bacteria | 837 |
| 1350 | nmdc:mga06z11_115086_c1 | 3300050494 | Bacteria | 1494 |
| 1351 | nmdc:mga06z11_406481_c1 | 3300050494 | Bacteria | 820 |
| 1352 | nmdc:mga06z11_57843_c1 | 3300050494 | Bacteria | 2010 |
| 1353 | nmdc:mga06z11_718052_c1 | 3300050494 | Bacteria | 609 |
| 1354 | nmdc:mga06z11_805031_c1 | 3300050494 | Bacteria | 573 |
| 1355 | nmdc:mga06z11_902165_c1 | 3300050494 | Bacteria | 539 |
| 1356 | nmdc:mga06z11_96061_c1 | 3300050494 | Bacteria | 1618 |
| 1357 | nmdc:mga04h51_162340_c1 | 3300050495 | Bacteria | 861 |
| 1358 | nmdc:mga04h51_28282_c1 | 3300050495 | Bacteria | 1748 |
| 1359 | nmdc:mga04h51_436293_c1 | 3300050495 | Bacteria | 553 |
| 1360 | nmdc:mga04h51_76018_c1 | 3300050495 | Bacteria | 1183 |
| 1361 | nmdc:mga07m45_152413_c1 | 3300050496 | Bacteria | 1341 |
| 1362 | nmdc:mga07m45_18580_c1 | 3300050496 | Bacteria | 3756 |
| 1363 | nmdc:mga07m45_742882_c1 | 3300050496 | Bacteria | 563 |
| 1364 | nmdc:mga07m45_846283_c1 | 3300050496 | Bacteria | 524 |
| 1365 | nmdc:mga05p37_178885_c1 | 3300050507 | Bacteria | 2582 |
| 1366 | nmdc:mga05p37_847321_c1 | 3300050507 | Unclassified | 993 |
| 1367 | nmdc:mga09592_167996_c1 | 3300050508 | Bacteria | 1896 |
| 1368 | nmdc:mga08y16_1042042_c1 | 3300050511 | Bacteria | 796 |
| 1369 | nmdc:mga08y16_728993_c1 | 3300050511 | Bacteria | 989 |
| 1370 | nmdc:mga08y16_88998_c1 | 3300050511 | Bacteria | 3217 |
| 1371 | nmdc:mga0n895_393875_c1 | 3300050512 | Bacteria | 1401 |
| 1372 | nmdc:mga0n895_477290_c1 | 3300050512 | Bacteria | 1258 |
| 1373 | nmdc:mga0n895_689952_c1 | 3300050512 | Bacteria | 1018 |
| 1374 | nmdc:mga0n895_98616_c1 | 3300050512 | Bacteria | 2929 |
| 1375 | nmdc:mga0rr50_1261245_c1 | 3300050513 | Bacteria | 627 |
| 1376 | nmdc:mga0rr50_248225_c1 | 3300050513 | Bacteria | 1477 |
| 1377 | nmdc:mga0rr50_673997_c1 | 3300050513 | Bacteria | 882 |
| 1378 | nmdc:mga08x19_337831_c1 | 3300050514 | Bacteria | 1050 |
| 1379 | nmdc:mga0a205_19766_c1 | 3300050515 | Bacteria | 6356 |
| 1380 | nmdc:mga0sz30_12546_c1 | 3300050516 | Bacteria | 3300 |
| 1381 | nmdc:mga0sz30_260904_c1 | 3300050516 | Bacteria | 771 |
| 1382 | nmdc:mga0sz30_278376_c1 | 3300050516 | Bacteria | 745 |
| 1383 | Ga0495601_0057492 | 3300053077 | Bacteria | 2464 |
| 1384 | Ga0495612_0171066 | 3300053078 | Bacteria | 951 |
| 1385 | Ga0495612_0469031 | 3300053078 | Bacteria | 576 |
| 1386 | Ga0500610_0144165 | 3300053079 | Bacteria | 1200 |
| 1387 | Ga0500635_0003021 | 3300053080 | Bacteria | 4194 |
| 1388 | Ga0495655_0024332 | 3300053083 | Bacteria | 1406 |
| 1389 | Ga0495655_0226456 | 3300053083 | Bacteria | 621 |
| 1390 | Ga0495655_0228803 | 3300053083 | Bacteria | 618 |
| 1391 | Ga0495655_0300812 | 3300053083 | Bacteria | 551 |
| 1392 | Ga0495595_0164547 | 3300053084 | Bacteria | 1096 |
| 1393 | Ga0495619_0269980 | 3300053085 | Bacteria | 1179 |
| 1394 | Ga0495619_0591042 | 3300053085 | Bacteria | 760 |
| 1395 | Ga0500578_0554088 | 3300053086 | Bacteria | 639 |
| 1396 | Ga0500643_038351 | 3300053087 | Bacteria | 1421 |
| 1397 | Ga0500647_0212298 | 3300053091 | Bacteria | 871 |
| 1398 | Ga0500583_0515884 | 3300053092 | Bacteria | 559 |
| 1399 | Ga0500566_0000896 | 3300053094 | Bacteria | 17020 |
| 1400 | Ga0500566_0002969 | 3300053094 | Bacteria | 10127 |
| 1401 | Ga0500640_280486 | 3300053095 | Bacteria | 511 |
| 1402 | Ga0500641_0001155 | 3300053096 | Bacteria | 9396 |
| 1403 | Ga0500641_0209835 | 3300053096 | Bacteria | 829 |
| 1404 | Ga0500554_040612 | 3300053102 | Bacteria | 1426 |
| 1405 | Ga0500569_127264 | 3300053109 | Bacteria | 851 |
| 1406 | Ga0500572_010166 | 3300053111 | Bacteria | 2242 |
| 1407 | Ga0500595_000253 | 3300053119 | Bacteria | 35306 |
| 1408 | Ga0500595_012401 | 3300053119 | Bacteria | 3298 |
| 1409 | Ga0500608_118739 | 3300053122 | Bacteria | 1202 |
| 1410 | Ga0500614_036518 | 3300053123 | Bacteria | 1230 |
| 1411 | Ga0500628_098555 | 3300053129 | Bacteria | 771 |
| 1412 | Ga0500655_012023 | 3300053133 | Bacteria | 1573 |
| 1413 | Ga0500658_0318055 | 3300053134 | Bacteria | 715 |
| 1414 | Ga0500559_0027725 | 3300053136 | Bacteria | 2417 |
| 1415 | Ga0500561_0174895 | 3300053137 | Bacteria | 674 |
| 1416 | Ga0500564_305873 | 3300053138 | Bacteria | 608 |
| 1417 | Ga0500568_0065287 | 3300053139 | Bacteria | 1402 |
| 1418 | Ga0500568_0396271 | 3300053139 | Bacteria | 500 |
| 1419 | Ga0500577_0018436 | 3300053142 | Bacteria | 2244 |
| 1420 | Ga0500589_267915 | 3300053147 | Bacteria | 619 |
| 1421 | Ga0500603_015135 | 3300053150 | Bacteria | 1811 |
| 1422 | Ga0500603_108860 | 3300053150 | Bacteria | 830 |
| 1423 | Ga0500604_0221342 | 3300053151 | Bacteria | 653 |
| 1424 | Ga0500604_0265456 | 3300053151 | Bacteria | 595 |
| 1425 | Ga0500630_031989 | 3300053159 | Bacteria | 2583 |
| 1426 | Ga0500638_059966 | 3300053162 | Bacteria | 1829 |
| 1427 | Ga0500638_140278 | 3300053162 | Bacteria | 1086 |
| 1428 | Ga0500639_004728 | 3300053163 | Bacteria | 6929 |
| 1429 | Ga0500639_212850 | 3300053163 | Bacteria | 816 |
| 1430 | Ga0500636_0211929 | 3300053177 | Bacteria | 1016 |
| 1431 | Ga0500637_0002240 | 3300053178 | Bacteria | 8531 |
| 1432 | Ga0500637_0030173 | 3300053178 | Bacteria | 3014 |
| 1433 | Ga0500576_233524 | 3300053725 | Bacteria | 590 |
| 1434 | Ga0500611_037453 | 3300053727 | Bacteria | 1045 |
| 1435 | Ga0500609_053211 | 3300053731 | Bacteria | 563 |
| 1436 | Ga0501084_0281801 | 3300054114 | Bacteria | 1404 |
| 1437 | Ga0500661_011310 | 3300055283 | Bacteria | 1614 |
| 1438 | Ga0500661_036659 | 3300055283 | Bacteria | 868 |
| 1439 | Ga0587072_166359 | 3300059643 | Bacteria | 542 |
| 1440 | Ga0530510_1345142 | 3300061734 | Bacteria | 548 |
| 1441 | 2509149797 | 2508501128 | Bacteria | 8613869 |
| 1442 | 2513647963 | 2513237095 | Bacteria | 8976980 |
| 1443 | 2513658233 | 2513237096 | Bacteria | 8722461 |
| 1444 | 2513694927 | 2513237101 | Bacteria | 7952346 |
| 1445 | 2513862937 | 2513237137 | Bacteria | 9558895 |
| 1446 | 2513889781 | 2513237141 | Bacteria | 8496279 |
| 1447 | 2513920275 | 2513237145 | Bacteria | 8979722 |
| 1448 | 2517102387 | 2517093001 | Bacteria | 9002274 |
| 1449 | 2517889305 | 2517572143 | Bacteria | 9484767 |
| 1450 | 2523105219 | 2522572158 | Bacteria | 6514390 |
| 1451 | 2524540350 | 2524023228 | Bacteria | 10118060 |
| 1452 | 2528855139 | 2528768022 | Bacteria | 10457665 |
| 1453 | 2723842026 | 2721755755 | Bacteria | 8322773 |
| 1454 | 2728755361 | 2728368998 | Bacteria | 8720350 |
| 1455 | 2793070962 | 2791355197 | Bacteria | 8420563 |
| 1456 | 2793077425 | |||
| 1457 | 2818237279 | 2816332527 | Bacteria | 8933356 |
| 1458 | 2824664728 | 2824661429 | Bacteria | 9877870 |
| 1459 | 2841964614 | 2841957949 | Bacteria | 8652217 |
| 1460 | 2849082674 | 2849076700 | Bacteria | 7039503 |
| 1461 | 2874610362 | 2874604998 | Bacteria | 7834745 |
| 1462 | 2874617920 | 2874612657 | Bacteria | 8252029 |
| 1463 | 2876812841 | 2876808645 | Bacteria | 8824342 |
| 1464 | 2879111681 | 2879110137 | Bacteria | 8907982 |
| 1465 | 2885377733 | 2885374607 | Bacteria | 8927485 |
| 1466 | 2888379964 | 2888378607 | Bacteria | 9652610 |
| 1467 | 2888391042 | 2888388044 | Bacteria | 7304136 |
| 1468 | 2889035074 | 2889033259 | Bacteria | 9099371 |
| 1469 | 2903749922 | 2903748898 | Bacteria | 9972761 |
| 1470 | 2904692504 | 2904690495 | Bacteria | 9412302 |
| 1471 | 2904709175 | |||
| 1472 | 2906635490 | 2906635258 | Bacteria | 8601019 |
| 1473 | 2906668621 | 2906660503 | Bacteria | 8595048 |
| 1474 | 2908747905 | 2908739725 | Bacteria | 8628932 |
| 1475 | 2908756772 | 2908756301 | Bacteria | 8864324 |
| 1476 | 2922363333 | 2922361189 | Bacteria | 7436256 |
| 1477 | 2922378350 | |||
| 1478 | 2922388612 | 2922386360 | Bacteria | 7017218 |
| 1479 | 2922433716 | |||
| 1480 | 2929622549 | 2929615660 | Bacteria | 9193770 |
| 1481 | 2929631233 | 2929624759 | Bacteria | 9339455 |
| 1482 | 2932786345 | 2932784394 | Bacteria | 9704911 |
| 1483 | 2932829583 | 2932828146 | Bacteria | 9745859 |
| 1484 | 2933584372 | 2933577622 | Bacteria | 9116884 |
| 1485 | 2935618101 | 2935616580 | Bacteria | 9032984 |
| 1486 | 2935634762 | 2935630451 | Bacteria | 8169952 |
| 1487 | 2935641501 | 2935638405 | Bacteria | 10015038 |
| 1488 | 2935669441 | 2935665750 | Bacteria | 9571747 |
| 1489 | 2935677961 | 2935675223 | Bacteria | 9928132 |
| 1490 | 2935701801 | 2935694250 | Bacteria | 9291695 |
| 1491 | 2935707266 | 2935703347 | Bacteria | 10242284 |
| 1492 | 2935804355 | 2935801545 | Bacteria | 9301974 |
| 1493 | 2935817216 | 2935810662 | Bacteria | 9401221 |
| 1494 | 2935831232 | 2935827899 | Bacteria | 10038562 |
| 1495 | 2935841841 | 2935837841 | Bacteria | 9454360 |
| 1496 | 2935856400 | 2935855204 | Bacteria | 9035059 |
| 1497 | 2935871077 | 2935864058 | Bacteria | 9784707 |
| 1498 | 2935874574 | 2935873716 | Bacteria | 9632195 |
| 1499 | 2935964145 | 2935959822 | Bacteria | 7869783 |
| 1500 | 2935994035 | 2935992306 | Bacteria | 9802711 |
| 1501 | 2936004954 | 2936002035 | Bacteria | 9362176 |
| 1502 | 2936044012 | 2936037263 | Bacteria | 9446081 |
| 1503 | 2941511908 | 2941507105 | Bacteria | 8166816 |
| 1504 | 2941519610 | 2941515067 | Bacteria | 8166720 |
| 1505 | 2941527698 | 2941523033 | Bacteria | 8169134 |
| 1506 | 2941543914 | 2941538514 | Bacteria | 9402094 |
| 1507 | 3005475545 | 3005474847 | Bacteria | 9259049 |
| 1508 | 8006935753 | 8006933436 | Bacteria | 10410654 |
| 1509 | 8006968313 | 8006964411 | Bacteria | 8966052 |
| 1510 | 8006975672 | 8006973647 | Bacteria | 10679141 |
| 1511 | 8006985952 | 8006984368 | Bacteria | 9651211 |
| 1512 | 8007000244 | 8006994254 | Bacteria | 8309700 |
| 1513 | 8016518627 | 8016511872 | Bacteria | 9921665 |
| 1514 | 8017058043 | 8017057580 | Bacteria | 10023680 |
| 1515 | 8019563039 | 8019555841 | Bacteria | 9642137 |
| 1516 | 8019573120 | 8019565922 | Bacteria | 9639779 |
| 1517 | 8019577691 | 8019576017 | Bacteria | 10049540 |
| 1518 | 8019595790 | 8019586578 | Bacteria | 10212056 |
| 1519 | 8019612562 | 8019608314 | Bacteria | 10042931 |
| 1520 | 8055751000 | 8055742211 | Bacteria | 9226248 |
| 1521 | 8056677726 | 8056673599 | Bacteria | 7871253 |
| 1522 | 8056694112 | 8056689827 | Bacteria | 6712655 |
| 1523 | Ga0207673_1069421 | |||
| 1524 | JGI24752J21851_1044791 | |||
| 1525 | JGI24740J21852_10195787 | |||
| 1526 | JGI24739J22299_10021915 | |||
| 1527 | JGI24737J22298_10057219 | |||
| 1528 | JGI24737J22298_10252199 | |||
| 1529 | JGI24743J22301_10134990 | |||
| 1530 | JGI24738J21930_10022662 | |||
| 1531 | JGI24744J21845_10004758 | |||
| 1532 | JGI24034J26672_10102219 | |||
| 1533 | JGI24034J26672_10124046 | |||
| 1534 | JGI24742J22300_10125870 | |||
| 1535 | JGI25165J46597_1030557 | |||
| 1536 | JGI25153J46596_10024263 | |||
| 1537 | JGI25153J46596_10112511 | |||
| 1538 | JGI25404J52841_10077790 | |||
| 1539 | Ga0055525_1006276 | |||
| 1540 | JGI25405J52794_10015161 | |||
| 1541 | Ga0065712_10514385 | |||
| 1542 | Ga0065715_10137956 | |||
| 1543 | Ga0065715_10405338 | |||
| 1544 | Ga0070658_10503964 | |||
| 1545 | Ga0070676_10120315 | |||
| 1546 | Ga0070676_10976317 | |||
| 1547 | Ga0070683_100574077 | |||
| 1548 | Ga0070683_101598612 | |||
| 1549 | Ga0070690_100655805 | |||
| 1550 | Ga0070670_100097588 | |||
| 1551 | Ga0070670_100210948 | |||
| 1552 | Ga0070670_100395926 | |||
| 1553 | Ga0070670_100462141 | |||
| 1554 | Ga0070670_100535041 | |||
| 1555 | Ga0070670_102011878 | |||
| 1556 | Ga0070677_10279218 | |||
| 1557 | Ga0068869_100062357 | |||
| 1558 | Ga0068869_100188818 | |||
| 1559 | Ga0068869_100319154 | |||
| 1560 | Ga0068869_100478502 | |||
| 1561 | Ga0068869_100735749 | |||
| 1562 | Ga0070666_10329846 | |||
| 1563 | Ga0070666_10508400 | |||
| 1564 | Ga0070680_100023524 | |||
| 1565 | Ga0070682_100807615 | |||
| 1566 | Ga0070682_100904053 | |||
| 1567 | Ga0070682_102067858 | |||
| 1568 | Ga0068868_100146708 | |||
| 1569 | Ga0068868_100170158 | |||
| 1570 | Ga0068868_100204587 | |||
| 1571 | Ga0068868_100464905 | |||
| 1572 | Ga0068868_100683894 | |||
| 1573 | Ga0068868_101333190 | |||
| 1574 | Ga0068868_102431287 | |||
| 1575 | Ga0070660_100466445 | |||
| 1576 | Ga0070689_100710968 | |||
| 1577 | Ga0070689_101583565 | |||
| 1578 | Ga0070691_10063088 | |||
| 1579 | Ga0070661_100082222 | |||
| 1580 | Ga0070661_100501402 | |||
| 1581 | Ga0070661_101019303 | |||
| 1582 | Ga0070692_10450460 | |||
| 1583 | Ga0070692_10934402 | |||
| 1584 | Ga0070668_100020513 | |||
| 1585 | Ga0070668_100095069 | |||
| 1586 | Ga0070668_100105741 | |||
| 1587 | Ga0070668_100112658 | |||
| 1588 | Ga0070668_100161650 | |||
| 1589 | Ga0070668_100344680 | |||
| 1590 | Ga0070668_100591650 | |||
| 1591 | Ga0070668_100875740 | |||
| 1592 | Ga0070668_100894163 | |||
| 1593 | Ga0070669_100067918 | |||
| 1594 | Ga0070669_100265816 | |||
| 1595 | Ga0070669_101020846 | |||
| 1596 | Ga0070669_101321167 | |||
| 1597 | Ga0070675_100031306 | |||
| 1598 | Ga0070675_100410615 | |||
| 1599 | Ga0070675_100558513 | |||
| 1600 | Ga0070675_100719807 | |||
| 1601 | Ga0070671_100001877 | |||
| 1602 | Ga0070671_100057317 | |||
| 1603 | Ga0070671_100079034 | |||
| 1604 | Ga0070671_100092874 | |||
| 1605 | Ga0070671_100535097 | |||
| 1606 | Ga0070674_100041817 | |||
| 1607 | Ga0070674_100122561 | |||
| 1608 | Ga0070674_100167870 | |||
| 1609 | Ga0070674_100799887 | |||
| 1610 | Ga0070674_101128780 | |||
| 1611 | Ga0070674_101639773 | |||
| 1612 | Ga0070673_100064549 | |||
| 1613 | Ga0070673_100090954 | |||
| 1614 | Ga0070673_100403484 | |||
| 1615 | Ga0070688_100119237 | |||
| 1616 | Ga0070688_100705644 | |||
| 1617 | Ga0070688_101785130 | |||
| 1618 | Ga0070659_100173077 | |||
| 1619 | Ga0070659_100617798 | |||
| 1620 | Ga0070667_100193565 | |||
| 1621 | Ga0070667_100214817 | |||
| 1622 | Ga0070667_100275175 | |||
| 1623 | Ga0070667_100535062 | |||
| 1624 | Ga0070667_100636867 | |||
| 1625 | Ga0070709_10708744 | |||
| 1626 | Ga0070714_100419921 | |||
| 1627 | Ga0070714_100465866 | |||
| 1628 | Ga0070714_102494168 | |||
| 1629 | Ga0070713_101049574 | |||
| 1630 | Ga0070710_11411803 | |||
| 1631 | Ga0070701_10676541 | |||
| 1632 | Ga0070711_101339397 | |||
| 1633 | Ga0070705_100291635 | |||
| 1634 | Ga0070700_100950241 | |||
| 1635 | Ga0070700_101336461 | |||
| 1636 | Ga0070700_101883965 | |||
| 1637 | Ga0070694_100702185 | |||
| 1638 | Ga0070694_100850500 | |||
| 1639 | Ga0070694_101191001 | |||
| 1640 | Ga0070663_100005344 | |||
| 1641 | Ga0070663_100029905 | |||
| 1642 | Ga0070663_100066818 | |||
| 1643 | Ga0070663_100068130 | |||
| 1644 | Ga0070663_100092861 | |||
| 1645 | Ga0070663_100116537 | |||
| 1646 | Ga0070663_100158224 | |||
| 1647 | Ga0070663_100217826 | |||
| 1648 | Ga0070663_100515882 | |||
| 1649 | Ga0070663_100870154 | |||
| 1650 | Ga0070663_101607202 | |||
| 1651 | Ga0070678_100060739 | |||
| 1652 | Ga0070678_100159057 | |||
| 1653 | Ga0070678_100201609 | |||
| 1654 | Ga0070678_100238721 | |||
| 1655 | Ga0070678_100635020 | |||
| 1656 | Ga0070678_100858280 | |||
| 1657 | Ga0070678_101015869 | |||
| 1658 | Ga0070678_101513040 | |||
| 1659 | Ga0070662_100069945 | |||
| 1660 | Ga0070662_100113397 | |||
| 1661 | Ga0070662_100129713 | |||
| 1662 | Ga0070662_100387962 | |||
| 1663 | Ga0070662_100691538 | |||
| 1664 | Ga0070662_100846803 | |||
| 1665 | Ga0070662_101549466 | |||
| 1666 | Ga0070681_10017850 | |||
| 1667 | Ga0070681_10075708 | |||
| 1668 | Ga0070681_11985184 | |||
| 1669 | Ga0068867_100040545 | |||
| 1670 | Ga0068867_100395975 | |||
| 1671 | Ga0068867_100783106 | |||
| 1672 | Ga0068867_100827894 | |||
| 1673 | Ga0068867_101422410 | |||
| 1674 | Ga0070685_11030807 | |||
| 1675 | Ga0070706_101116188 | |||
| 1676 | Ga0070707_100417084 | |||
| 1677 | Ga0070707_102055847 | |||
| 1678 | Ga0070698_100717158 | |||
| 1679 | Ga0070699_100076497 | |||
| 1680 | Ga0070679_100016197 | |||
| 1681 | Ga0070684_100486351 | |||
| 1682 | Ga0070684_101137982 | |||
| 1683 | Ga0070697_100004451 | |||
| 1684 | Ga0070697_100135729 | |||
| 1685 | Ga0068853_100161116 | |||
| 1686 | Ga0068853_100465173 | |||
| 1687 | Ga0068853_100559794 | |||
| 1688 | Ga0068853_100614682 | |||
| 1689 | Ga0068853_100972901 | |||
| 1690 | Ga0070672_100066208 | |||
| 1691 | Ga0070672_100071717 | |||
| 1692 | Ga0070672_100155105 | |||
| 1693 | Ga0070672_100441775 | |||
| 1694 | Ga0070672_100479031 | |||
| 1695 | Ga0070686_100168236 | |||
| 1696 | Ga0070686_100493701 | |||
| 1697 | Ga0070686_101258045 | |||
| 1698 | Ga0070695_100600882 | |||
| 1699 | Ga0070696_100004044 | |||
| 1700 | Ga0070693_101366634 | |||
| 1701 | Ga0070665_100073912 | |||
| 1702 | Ga0070665_100077066 | |||
| 1703 | Ga0070665_100119741 | |||
| 1704 | Ga0070665_100157407 | |||
| 1705 | Ga0070665_100163266 | |||
| 1706 | Ga0070665_100179577 | |||
| 1707 | Ga0070665_100248456 | |||
| 1708 | Ga0070665_100329487 | |||
| 1709 | Ga0070665_100507035 | |||
| 1710 | Ga0070665_100811717 | |||
| 1711 | Ga0070665_100862365 | |||
| 1712 | Ga0070665_101590078 | |||
| 1713 | Ga0070665_102220081 | |||
| 1714 | Ga0070665_102539250 | |||
| 1715 | Ga0070704_100166364 | |||
| 1716 | Ga0070704_100500104 | |||
| 1717 | Ga0068855_100024487 | |||
| 1718 | Ga0068855_100056894 | |||
| 1719 | Ga0068855_100391792 | |||
| 1720 | Ga0068855_100631088 | |||
| 1721 | Ga0070664_100211131 | |||
| 1722 | Ga0070664_100238206 | |||
| 1723 | Ga0070664_100295224 | |||
| 1724 | Ga0070664_101035900 | |||
| 1725 | Ga0068857_100090741 | |||
| 1726 | Ga0068854_100481961 | |||
| 1727 | Ga0068854_100845743 | |||
| 1728 | Ga0068854_101019839 | |||
| 1729 | Ga0068854_101600086 | |||
| 1730 | Ga0068856_100056023 | |||
| 1731 | Ga0068856_100179411 | |||
| 1732 | Ga0068856_100227402 | |||
| 1733 | Ga0068856_100421406 | |||
| 1734 | Ga0068856_101375046 | |||
| 1735 | Ga0068856_101604781 | |||
| 1736 | Ga0070702_100355009 | |||
| 1737 | Ga0070702_100494706 | |||
| 1738 | Ga0070702_100973243 | |||
| 1739 | Ga0070702_101126228 | |||
| 1740 | Ga0068852_100089252 | |||
| 1741 | Ga0068852_101875406 | |||
| 1742 | Ga0068852_101986698 | |||
| 1743 | Ga0068852_102610686 | |||
| 1744 | Ga0068859_100047364 | |||
| 1745 | Ga0068859_100488623 | |||
| 1746 | Ga0068859_100610383 | |||
| 1747 | Ga0068859_101281148 | |||
| 1748 | Ga0068864_100083102 | |||
| 1749 | Ga0068864_100105122 | |||
| 1750 | Ga0068864_100132872 | |||
| 1751 | Ga0068864_100612450 | |||
| 1752 | Ga0068864_102142255 | |||
| 1753 | Ga0068866_10013320 | |||
| 1754 | Ga0068866_10303705 | |||
| 1755 | Ga0068866_11138574 | |||
| 1756 | Ga0068861_100078768 | |||
| 1757 | Ga0068861_100349039 | |||
| 1758 | Ga0068861_100812324 | |||
| 1759 | Ga0068861_102011202 | |||
| 1760 | Ga0068861_102502096 | |||
| 1761 | Ga0068851_10320260 | |||
| 1762 | Ga0068870_10024241 | |||
| 1763 | Ga0068870_10099778 | |||
| 1764 | Ga0068870_10541088 | |||
| 1765 | Ga0068863_100391681 | |||
| 1766 | Ga0068863_100437199 | |||
| 1767 | Ga0068863_100579479 | |||
| 1768 | Ga0068863_102174242 | |||
| 1769 | Ga0068863_102429550 | |||
| 1770 | Ga0068858_100170116 | |||
| 1771 | Ga0068858_100498234 | |||
| 1772 | Ga0068858_100795333 | |||
| 1773 | Ga0068858_100845982 | |||
| 1774 | Ga0068858_101018503 | |||
| 1775 | Ga0068860_100048315 | |||
| 1776 | Ga0068860_100184421 | |||
| 1777 | Ga0068860_100192407 | |||
| 1778 | Ga0068860_100725409 | |||
| 1779 | Ga0068860_100764295 | |||
| 1780 | Ga0068860_100807953 | |||
| 1781 | Ga0068860_102236253 | |||
| 1782 | Ga0068862_100072737 | |||
| 1783 | Ga0068862_100443256 | |||
| 1784 | Ga0068862_100583737 | |||
| 1785 | Ga0068862_100847633 | |||
| 1786 | Ga0068862_101112348 | |||
| 1787 | Ga0081455_10006300 | |||
| 1788 | Ga0081455_10006921 | |||
| 1789 | Ga0081455_10023250 | |||
| 1790 | Ga0081455_10031610 | |||
| 1791 | Ga0081455_10065139 | |||
| 1792 | Ga0081455_10132001 | |||
| 1793 | Ga0081455_11040593 | |||
| 1794 | Ga0081538_10032860 | |||
| 1795 | Ga0081540_1002991 | |||
| 1796 | Ga0081540_1003839 | |||
| 1797 | Ga0081540_1005442 | |||
| 1798 | Ga0081540_1005804 | |||
| 1799 | Ga0081540_1016025 | |||
| 1800 | Ga0081540_1020260 | |||
| 1801 | Ga0081540_1084572 | |||
| 1802 | Ga0081540_1113094 | |||
| 1803 | Ga0081540_1130387 | |||
| 1804 | Ga0081539_10000048 | |||
| 1805 | Ga0081539_10000530 | |||
| 1806 | Ga0081539_10050176 | |||
| 1807 | Ga0081539_10051204 | |||
| 1808 | Ga0081539_10244445 | |||
| 1809 | Ga0070717_10910367 | |||
| 1810 | Ga0075365_10017775 | |||
| 1811 | Ga0075365_10060788 | |||
| 1812 | Ga0075365_10155141 | |||
| 1813 | Ga0075365_10299015 | |||
| 1814 | Ga0075365_10580751 | |||
| 1815 | Ga0075365_10631181 | |||
| 1816 | Ga0075368_10007497 | |||
| 1817 | Ga0075368_10022410 | |||
| 1818 | Ga0075368_10088178 | |||
| 1819 | Ga0075368_10206187 | |||
| 1820 | Ga0075368_10221025 | |||
| 1821 | Ga0075363_100038051 | |||
| 1822 | Ga0075363_100042275 | |||
| 1823 | Ga0075363_100057153 | |||
| 1824 | Ga0075363_100492048 | |||
| 1825 | Ga0075363_100568309 | |||
| 1826 | Ga0075364_10044838 | |||
| 1827 | Ga0075364_10124008 | |||
| 1828 | Ga0075364_11156462 | |||
| 1829 | Ga0075432_10504298 | |||
| 1830 | Ga0070715_10353674 | |||
| 1831 | Ga0070716_100153248 | |||
| 1832 | Ga0070716_100482051 | |||
| 1833 | Ga0070712_100020761 | |||
| 1834 | Ga0075362_10101204 | |||
| 1835 | Ga0075362_10108671 | |||
| 1836 | Ga0075367_10036197 | |||
| 1837 | Ga0075367_10124896 | |||
| 1838 | Ga0075367_10142643 | |||
| 1839 | Ga0075367_10158624 | |||
| 1840 | Ga0075367_10189044 | |||
| 1841 | Ga0075367_10440437 | |||
| 1842 | Ga0075369_10018011 | |||
| 1843 | Ga0075369_10027822 | |||
| 1844 | Ga0075369_10208213 | |||
| 1845 | Ga0075369_10265837 | |||
| 1846 | Ga0075366_10294510 | |||
| 1847 | Ga0075366_10840185 | |||
| 1848 | Ga0097621_100083441 | |||
| 1849 | Ga0097621_100183983 | |||
| 1850 | Ga0097621_100658663 | |||
| 1851 | Ga0097621_101584182 | |||
| 1852 | Ga0097621_101917153 | |||
| 1853 | Ga0097621_102435346 | |||
| 1854 | Ga0075370_10112237 | |||
| 1855 | Ga0075370_10174721 | |||
| 1856 | Ga0075370_10204812 | |||
| 1857 | Ga0075370_10392905 | |||
| 1858 | Ga0075370_10627614 | |||
| 1859 | Ga0068871_100054328 | |||
| 1860 | Ga0068871_100167157 | |||
| 1861 | Ga0068871_100202872 | |||
| 1862 | Ga0068871_100632250 | |||
| 1863 | Ga0068871_100724482 | |||
| 1864 | Ga0075428_100251556 | |||
| 1865 | Ga0075428_100524829 | |||
| 1866 | Ga0075433_10021008 | |||
| 1867 | Ga0075433_11418037 | |||
| 1868 | Ga0075434_100105793 | |||
| 1869 | Ga0075434_100138919 | |||
| 1870 | Ga0075434_100194275 | |||
| 1871 | Ga0075429_100242711 | |||
| 1872 | Ga0068865_100107324 | |||
| 1873 | Ga0068865_100154792 | |||
| 1874 | Ga0068865_100231300 | |||
| 1875 | Ga0068865_100885254 | |||
| 1876 | Ga0068865_101529252 | |||
| 1877 | Ga0097620_100047363 | |||
| 1878 | Ga0097620_100488647 | |||
| 1879 | Ga0097620_100610405 | |||
| 1880 | Ga0097620_101281217 | |||
| 1881 | Ga0099825_1039829 | |||
| 1882 | Ga0099824_1001145 | |||
| 1883 | Ga0099822_1000135 | |||
| 1884 | Ga0075435_100427104 | |||
| 1885 | Ga0075435_100619687 | |||
| 1886 | Ga0099794_10024170 | |||
| 1887 | Ga0099795_10085987 | |||
| 1888 | Ga0099795_10231433 | |||
| 1889 | Ga0105251_10081797 | |||
| 1890 | Ga0105250_10169871 | |||
| 1891 | Ga0105250_10327001 | |||
| 1892 | Ga0105240_10029904 | |||
| 1893 | Ga0105240_10129948 | |||
| 1894 | Ga0105240_10982937 | |||
| 1895 | Ga0105240_11913295 | |||
| 1896 | Ga0111539_10152799 | |||
| 1897 | Ga0111539_10177955 | |||
| 1898 | Ga0105245_10074427 | |||
| 1899 | Ga0105245_10179241 | |||
| 1900 | Ga0105245_10373307 | |||
| 1901 | Ga0105245_10413188 | |||
| 1902 | Ga0105245_11045782 | |||
| 1903 | Ga0105245_12046499 | |||
| 1904 | Ga0105245_12364707 | |||
| 1905 | Ga0105247_10154366 | |||
| 1906 | Ga0105247_10405991 | |||
| 1907 | Ga0105247_10476365 | |||
| 1908 | Ga0105247_10641782 | |||
| 1909 | Ga0105247_10767735 | |||
| 1910 | Ga0114129_10078294 | |||
| 1911 | Ga0114129_10210804 | |||
| 1912 | Ga0105243_10047809 | |||
| 1913 | Ga0105243_10187241 | |||
| 1914 | Ga0105243_10225060 | |||
| 1915 | Ga0105243_11326545 | |||
| 1916 | Ga0105243_12502863 | |||
| 1917 | Ga0105241_10261336 | |||
| 1918 | Ga0105241_10560585 | |||
| 1919 | Ga0105242_10064098 | |||
| 1920 | Ga0105242_10297075 | |||
| 1921 | Ga0105242_10356703 | |||
| 1922 | Ga0105242_10810605 | |||
| 1923 | Ga0105242_10863828 | |||
| 1924 | Ga0105242_12011807 | |||
| 1925 | Ga0105242_13294974 | |||
| 1926 | Ga0105248_10018433 | |||
| 1927 | Ga0105248_10050589 | |||
| 1928 | Ga0105248_10055840 | |||
| 1929 | Ga0105248_10069718 | |||
| 1930 | Ga0105248_10240916 | |||
| 1931 | Ga0105248_10343953 | |||
| 1932 | Ga0105248_10675268 | |||
| 1933 | Ga0105237_10039147 | |||
| 1934 | Ga0105237_10061747 | |||
| 1935 | Ga0105237_10118985 | |||
| 1936 | Ga0105237_10435460 | |||
| 1937 | Ga0105237_10760708 | |||
| 1938 | Ga0105238_10022088 | |||
| 1939 | Ga0105238_10563999 | |||
| 1940 | Ga0105238_10665053 | |||
| 1941 | Ga0105238_10926026 | |||
| 1942 | Ga0105238_11194397 | |||
| 1943 | Ga0105238_12362616 | |||
| 1944 | Ga0105249_10038388 | |||
| 1945 | Ga0105249_10678818 | |||
| 1946 | Ga0105249_11040082 | |||
| 1947 | Ga0105249_11117026 | |||
| 1948 | Ga0105249_12710184 | |||
| 1949 | Ga0099796_10133782 | |||
| 1950 | Ga0099796_10286595 | |||
| 1951 | Ga0099796_10498084 | |||
| 1952 | Ga0105239_10034475 | |||
| 1953 | Ga0105239_10059090 | |||
| 1954 | Ga0105239_10094281 | |||
| 1955 | Ga0105239_10130316 | |||
| 1956 | Ga0105239_10178549 | |||
| 1957 | Ga0105239_10586875 | |||
| 1958 | Ga0105239_10709642 | |||
| 1959 | Ga0105239_11663433 | |||
| 1960 | Ga0105239_11732962 | |||
| 1961 | Ga0105239_13304635 | |||
| 1962 | Ga0105239_13529616 | |||
| 1963 | Ga0105246_10032650 | |||
| 1964 | Ga0105246_10344074 | |||
| 1965 | Ga0105246_10621992 | |||
| 1966 | Ga0105246_10699414 | |||
| 1967 | Ga0105246_11051449 | |||
| 1968 | Ga0105246_11645602 | |||
| 1969 | Ga0105246_12547576 | |||
| 1970 | Ga0157336_1025455 | |||
| 1971 | Ga0157318_1013438 | |||
| 1972 | Ga0157322_1008862 | |||
| 1973 | Ga0157347_1072336 | |||
| 1974 | Ga0157373_10825973 | |||
| 1975 | Ga0157371_10635123 | |||
| 1976 | Ga0157370_10035427 | |||
| 1977 | Ga0157369_10797574 | |||
| 1978 | Ga0157374_10182677 | |||
| 1979 | Ga0157374_10198384 | |||
| 1980 | Ga0157374_10242882 | |||
| 1981 | Ga0157374_10393576 | |||
| 1982 | Ga0157374_10928569 | |||
| 1983 | Ga0157374_10929831 | |||
| 1984 | Ga0157374_11532103 | |||
| 1985 | Ga0157378_10136259 | |||
| 1986 | Ga0157378_10230435 | |||
| 1987 | Ga0157378_10273127 | |||
| 1988 | Ga0157378_10668202 | |||
| 1989 | Ga0157378_10935240 | |||
| 1990 | Ga0163162_10148514 | |||
| 1991 | Ga0163162_10196777 | |||
| 1992 | Ga0163162_10512542 | |||
| 1993 | Ga0163162_10534083 | |||
| 1994 | Ga0163162_10718107 | |||
| 1995 | Ga0163162_11299147 | |||
| 1996 | Ga0163162_12267132 | |||
| 1997 | Ga0163162_12317854 | |||
| 1998 | Ga0157372_11257864 | |||
| 1999 | Ga0157372_11286481 | |||
| 2000 | Ga0157375_10136682 | |||
| 2001 | Ga0157375_10223750 | |||
| 2002 | Ga0157375_10381915 | |||
| 2003 | Ga0157375_10617134 | |||
| 2004 | Ga0157375_10947418 | |||
| 2005 | Ga0157375_11747371 | |||
| 2006 | Ga0157375_11907399 | |||
| 2007 | Ga0157375_12457879 | |||
| 2008 | Ga0157375_12947295 | |||
| 2009 | Ga0163163_10009917 | |||
| 2010 | Ga0163163_10130136 | |||
| 2011 | Ga0163163_10245979 | |||
| 2012 | Ga0163163_10296258 | |||
| 2013 | Ga0163163_10450840 | |||
| 2014 | Ga0163163_10542988 | |||
| 2015 | Ga0163163_11092056 | |||
| 2016 | Ga0157380_10181827 | |||
| 2017 | Ga0157380_10241111 | |||
| 2018 | Ga0157380_10436182 | |||
| 2019 | Ga0157380_10712153 | |||
| 2020 | Ga0157380_10835300 | |||
| 2021 | Ga0157380_12823328 | |||
| 2022 | Ga0182008_10187574 | |||
| 2023 | Ga0182008_10319645 | |||
| 2024 | Ga0182008_10590922 | |||
| 2025 | Ga0157377_10491109 | |||
| 2026 | Ga0157377_10499532 | |||
| 2027 | Ga0157377_10553221 | |||
| 2028 | Ga0157377_10689290 | |||
| 2029 | Ga0157377_11167244 | |||
| 2030 | Ga0157377_11565427 | |||
| 2031 | Ga0157379_10054384 | |||
| 2032 | Ga0157379_10059691 | |||
| 2033 | Ga0157379_10070735 | |||
| 2034 | Ga0157379_10883340 | |||
| 2035 | Ga0157379_10968395 | |||
| 2036 | Ga0157379_11213729 | |||
| 2037 | Ga0157376_10098051 | |||
| 2038 | Ga0157376_10300126 | |||
| 2039 | Ga0157376_10606722 | |||
| 2040 | Ga0157376_11272773 | |||
| 2041 | Ga0182006_1085697 | |||
| 2042 | Ga0182006_1287445 | |||
| 2043 | Ga0163161_10078523 | |||
| 2044 | Ga0163161_10485769 | |||
| 2045 | Ga0163161_11649508 | |||
| 2046 | Ga0213873_10003627 | |||
| 2047 | Ga0213874_10018962 | |||
| 2048 | Ga0213876_10009766 | |||
| 2049 | Ga0213875_10015369 | |||
| 2050 | Ga0213875_10145474 | |||
| 2051 | Ga0213875_10489006 | |||
| 2052 | Ga0209563_102525 | |||
| 2053 | Ga0209677_105322 | |||
| 2054 | Ga0209233_1001483 | |||
| 2055 | Ga0207666_1040651 | |||
| 2056 | Ga0209758_1010323 | |||
| 2057 | Ga0209758_1012517 | |||
| 2058 | Ga0209758_1018538 | |||
| 2059 | Ga0209257_1007532 | |||
| 2060 | Ga0207697_10165591 | |||
| 2061 | Ga0207697_10267198 | |||
| 2062 | Ga0207656_10208906 | |||
| 2063 | Ga0207656_10466409 | |||
| 2064 | Ga0207653_10012944 | |||
| 2065 | Ga0207682_10040789 | |||
| 2066 | Ga0207692_10178730 | |||
| 2067 | Ga0207692_10769265 | |||
| 2068 | Ga0207642_10695640 | |||
| 2069 | Ga0207642_10879672 | |||
| 2070 | Ga0207710_10078255 | |||
| 2071 | Ga0207710_10129615 | |||
| 2072 | Ga0207688_10015995 | |||
| 2073 | Ga0207688_10098145 | |||
| 2074 | Ga0207688_10195032 | |||
| 2075 | Ga0207688_10238307 | |||
| 2076 | Ga0207680_10057219 | |||
| 2077 | Ga0207680_10140792 | |||
| 2078 | Ga0207680_10425691 | |||
| 2079 | Ga0207647_10016721 | |||
| 2080 | Ga0207647_10418201 | |||
| 2081 | Ga0207685_10380636 | |||
| 2082 | Ga0207699_10128655 | |||
| 2083 | Ga0207699_10441168 | |||
| 2084 | Ga0207699_10875859 | |||
| 2085 | Ga0207645_10268380 | |||
| 2086 | Ga0207645_10569798 | |||
| 2087 | Ga0207643_10064992 | |||
| 2088 | Ga0207643_10542204 | |||
| 2089 | Ga0207705_10110790 | |||
| 2090 | Ga0207705_10636402 | |||
| 2091 | Ga0207684_10976327 | |||
| 2092 | Ga0207654_10065446 | |||
| 2093 | Ga0207707_10020967 | |||
| 2094 | Ga0207707_10094717 | |||
| 2095 | Ga0207695_10042176 | |||
| 2096 | Ga0207671_10023286 | |||
| 2097 | Ga0207671_10047312 | |||
| 2098 | Ga0207671_10651752 | |||
| 2099 | Ga0207671_10777036 | |||
| 2100 | Ga0207671_10985916 | |||
| 2101 | Ga0207693_10001776 | |||
| 2102 | Ga0207693_10043158 | |||
| 2103 | Ga0207663_10191210 | |||
| 2104 | Ga0207663_11000225 | |||
| 2105 | Ga0207660_10077105 | |||
| 2106 | Ga0207660_10382402 | |||
| 2107 | Ga0207657_10120290 | |||
| 2108 | Ga0207657_11029008 | |||
| 2109 | Ga0207657_11173886 | |||
| 2110 | Ga0207649_10433121 | |||
| 2111 | Ga0207649_10506765 | |||
| 2112 | Ga0207649_10716218 | |||
| 2113 | Ga0207649_11208549 | |||
| 2114 | Ga0207652_10025043 | |||
| 2115 | Ga0207646_11061347 | |||
| 2116 | Ga0207681_10112595 | |||
| 2117 | Ga0207681_10605775 | |||
| 2118 | Ga0207681_10916060 | |||
| 2119 | Ga0207681_11236804 | |||
| 2120 | Ga0207694_10097619 | |||
| 2121 | Ga0207694_10405315 | |||
| 2122 | Ga0207694_10757634 | |||
| 2123 | Ga0207694_10867228 | |||
| 2124 | Ga0207694_11006221 | |||
| 2125 | Ga0207650_10363570 | |||
| 2126 | Ga0207650_10804729 | |||
| 2127 | Ga0207659_10122990 | |||
| 2128 | Ga0207659_10216009 | |||
| 2129 | Ga0207659_10346958 | |||
| 2130 | Ga0207659_10676858 | |||
| 2131 | Ga0207659_11582218 | |||
| 2132 | Ga0207687_10040881 | |||
| 2133 | Ga0207687_10109880 | |||
| 2134 | Ga0207687_10184149 | |||
| 2135 | Ga0207687_10412033 | |||
| 2136 | Ga0207687_10671536 | |||
| 2137 | Ga0207700_11000318 | |||
| 2138 | Ga0207664_10127444 | |||
| 2139 | Ga0207664_10195831 | |||
| 2140 | Ga0207664_10594727 | |||
| 2141 | Ga0207664_11331170 | |||
| 2142 | Ga0207664_11902336 | |||
| 2143 | Ga0207644_10017213 | |||
| 2144 | Ga0207644_10084165 | |||
| 2145 | Ga0207644_10243620 | |||
| 2146 | Ga0207644_10748431 | |||
| 2147 | Ga0207690_10265452 | |||
| 2148 | Ga0207690_10934542 | |||
| 2149 | Ga0207706_10061004 | |||
| 2150 | Ga0207706_10192068 | |||
| 2151 | Ga0207706_10294633 | |||
| 2152 | Ga0207706_10519880 | |||
| 2153 | Ga0207706_10673373 | |||
| 2154 | Ga0207706_11383529 | |||
| 2155 | Ga0207706_11393112 | |||
| 2156 | Ga0207686_10122395 | |||
| 2157 | Ga0207686_10213285 | |||
| 2158 | Ga0207709_10007124 | |||
| 2159 | Ga0207709_10035091 | |||
| 2160 | Ga0207709_10058680 | |||
| 2161 | Ga0207709_10227821 | |||
| 2162 | Ga0207709_10396848 | |||
| 2163 | Ga0207709_10927707 | |||
| 2164 | Ga0207709_10939777 | |||
| 2165 | Ga0207670_10227617 | |||
| 2166 | Ga0207670_10439585 | |||
| 2167 | Ga0207669_10004832 | |||
| 2168 | Ga0207669_10940992 | |||
| 2169 | Ga0207669_10973255 | |||
| 2170 | Ga0207669_11371487 | |||
| 2171 | Ga0207704_10082769 | |||
| 2172 | Ga0207704_10105331 | |||
| 2173 | Ga0207665_10072206 | |||
| 2174 | Ga0207665_10590193 | |||
| 2175 | Ga0207691_10035507 | |||
| 2176 | Ga0207691_10043336 | |||
| 2177 | Ga0207691_10225732 | |||
| 2178 | Ga0207691_10515468 | |||
| 2179 | Ga0207691_10644201 | |||
| 2180 | Ga0207691_11310226 | |||
| 2181 | Ga0207691_11662397 | |||
| 2182 | Ga0207711_10025676 | |||
| 2183 | Ga0207711_10051529 | |||
| 2184 | Ga0207711_10257779 | |||
| 2185 | Ga0207711_10342670 | |||
| 2186 | Ga0207689_10071969 | |||
| 2187 | Ga0207689_10131217 | |||
| 2188 | Ga0207689_10136896 | |||
| 2189 | Ga0207689_10797887 | |||
| 2190 | Ga0207661_10129788 | |||
| 2191 | Ga0207661_10331027 | |||
| 2192 | Ga0207661_11544333 | |||
| 2193 | Ga0207679_10162166 | |||
| 2194 | Ga0207679_10654536 | |||
| 2195 | Ga0207679_11186901 | |||
| 2196 | Ga0207667_10022929 | |||
| 2197 | Ga0207667_10243413 | |||
| 2198 | Ga0207667_10328905 | |||
| 2199 | Ga0207651_10071181 | |||
| 2200 | Ga0207651_10129964 | |||
| 2201 | Ga0207651_10165791 | |||
| 2202 | Ga0207651_10297411 | |||
| 2203 | Ga0207651_12018466 | |||
| 2204 | Ga0207712_10031864 | |||
| 2205 | Ga0207712_10242489 | |||
| 2206 | Ga0207712_10242517 | |||
| 2207 | Ga0207712_10310442 | |||
| 2208 | Ga0207712_11011028 | |||
| 2209 | Ga0207712_11203079 | |||
| 2210 | Ga0207712_11340674 | |||
| 2211 | Ga0207668_10005400 | |||
| 2212 | Ga0207668_10010669 | |||
| 2213 | Ga0207668_10031458 | |||
| 2214 | Ga0207668_10105758 | |||
| 2215 | Ga0207668_10158155 | |||
| 2216 | Ga0207668_10240804 | |||
| 2217 | Ga0207668_10285085 | |||
| 2218 | Ga0207668_10497087 | |||
| 2219 | Ga0207668_11150898 | |||
| 2220 | Ga0207668_11226283 | |||
| 2221 | Ga0207640_10715238 | |||
| 2222 | Ga0207640_10908234 | |||
| 2223 | Ga0207658_10647843 | |||
| 2224 | Ga0207658_11188627 | |||
| 2225 | Ga0207658_11218586 | |||
| 2226 | Ga0207677_10036816 | |||
| 2227 | Ga0207677_10099950 | |||
| 2228 | Ga0207703_10100551 | |||
| 2229 | Ga0207703_10269514 | |||
| 2230 | Ga0207703_10482868 | |||
| 2231 | Ga0207703_10959799 | |||
| 2232 | Ga0207703_11031463 | |||
| 2233 | Ga0207703_11529223 | |||
| 2234 | Ga0207639_10043497 | |||
| 2235 | Ga0207639_10183014 | |||
| 2236 | Ga0207639_10379349 | |||
| 2237 | Ga0207639_10568724 | |||
| 2238 | Ga0207678_10011493 | |||
| 2239 | Ga0207678_10023466 | |||
| 2240 | Ga0207678_10060221 | |||
| 2241 | Ga0207678_10128588 | |||
| 2242 | Ga0207678_10151873 | |||
| 2243 | Ga0207678_10217522 | |||
| 2244 | Ga0207678_10568720 | |||
| 2245 | Ga0207678_11582308 | |||
| 2246 | Ga0207708_10034273 | |||
| 2247 | Ga0207708_10093420 | |||
| 2248 | Ga0207708_10424969 | |||
| 2249 | Ga0207708_10568406 | |||
| 2250 | Ga0207702_10186015 | |||
| 2251 | Ga0207702_10192543 | |||
| 2252 | Ga0207702_10597653 | |||
| 2253 | Ga0207702_10684208 | |||
| 2254 | Ga0207702_11529657 | |||
| 2255 | Ga0207641_10072841 | |||
| 2256 | Ga0207641_10318080 | |||
| 2257 | Ga0207641_10344419 | |||
| 2258 | Ga0207641_10418815 | |||
| 2259 | Ga0207641_10472200 | |||
| 2260 | Ga0207641_10762942 | |||
| 2261 | Ga0207641_11358420 | |||
| 2262 | Ga0207641_11977484 | |||
| 2263 | Ga0207641_12531698 | |||
| 2264 | Ga0207648_10040868 | |||
| 2265 | Ga0207648_10220075 | |||
| 2266 | Ga0207648_11096314 | |||
| 2267 | Ga0207648_11974125 | |||
| 2268 | Ga0207676_10024271 | |||
| 2269 | Ga0207676_10255635 | |||
| 2270 | Ga0207676_10373689 | |||
| 2271 | Ga0207676_10388364 | |||
| 2272 | Ga0207676_10786552 | |||
| 2273 | Ga0207674_10098670 | |||
| 2274 | Ga0207674_10230355 | |||
| 2275 | Ga0207674_11257747 | |||
| 2276 | Ga0207674_11445702 | |||
| 2277 | Ga0207675_100029414 | |||
| 2278 | Ga0207675_100105861 | |||
| 2279 | Ga0207675_100290042 | |||
| 2280 | Ga0207675_100684804 | |||
| 2281 | Ga0207675_100714122 | |||
| 2282 | Ga0207675_101450526 | |||
| 2283 | Ga0207675_101875778 | |||
| 2284 | Ga0207683_10074092 | |||
| 2285 | Ga0207683_10113783 | |||
| 2286 | Ga0207683_10425324 | |||
| 2287 | Ga0207683_10439288 | |||
| 2288 | Ga0207683_10564592 | |||
| 2289 | Ga0207683_10691493 | |||
| 2290 | Ga0207683_10694099 | |||
| 2291 | Ga0207683_11036331 | |||
| 2292 | Ga0207683_11039015 | |||
| 2293 | Ga0207698_10795968 | |||
| 2294 | Ga0207698_11061216 | |||
| 2295 | Ga0207698_11882704 | |||
| 2296 | Ga0207698_12406598 | |||
| 2297 | Ga0209589_1000017 | |||
| 2298 | Ga0209489_100018 | |||
| 2299 | Ga0209700_100028 | |||
| 2300 | Ga0209813_10025407 | |||
| 2301 | Ga0209813_10057796 | |||
| 2302 | Ga0209813_10129722 | |||
| 2303 | Ga0207428_10748512 | |||
| 2304 | Ga0268266_10009701 | |||
| 2305 | Ga0268266_10056273 | |||
| 2306 | Ga0268266_10168478 | |||
| 2307 | Ga0268266_10210870 | |||
| 2308 | Ga0268266_10328791 | |||
| 2309 | Ga0268266_10366984 | |||
| 2310 | Ga0268266_10368279 | |||
| 2311 | Ga0268266_10372858 | |||
| 2312 | Ga0268266_10391936 | |||
| 2313 | Ga0268266_10429327 | |||
| 2314 | Ga0268266_10764883 | |||
| 2315 | Ga0268266_10780968 | |||
| 2316 | Ga0268266_11080855 | |||
| 2317 | Ga0268266_11287307 | |||
| 2318 | Ga0268266_11974106 | |||
| 2319 | Ga0268266_12057335 | |||
| 2320 | Ga0268265_10024844 | |||
| 2321 | Ga0268265_10361800 | |||
| 2322 | Ga0268265_10363542 | |||
| 2323 | Ga0268265_10575173 | |||
| 2324 | Ga0268265_10754730 | |||
| 2325 | Ga0268265_11505685 | |||
| 2326 | Ga0268265_12193264 | |||
| 2327 | Ga0268264_10140404 | |||
| 2328 | Ga0268264_11053984 | |||
| 2329 | Ga0268264_12074797 | |||
| 2330 | Ga0307517_10000766 | |||
| 2331 | Ga0307517_10437143 | |||
| 2332 | Ga0307515_10400275 | |||
| 2333 | Ga0307515_10433670 | |||
| 2334 | Ga0307515_10581065 | |||
| 2335 | Ga0307512_10102275 | |||
| 2336 | Ga0265339_10007291 | |||
| 2337 | Ga0265339_10056423 | |||
| 2338 | Ga0265316_10576294 | |||
| 2339 | Ga0307513_10117890 | |||
| 2340 | Ga0307513_10119162 | |||
| 2341 | Ga0307513_10719587 | |||
| 2342 | Ga0307509_10138101 | |||
| 2343 | Ga0307509_10736302 | |||
| 2344 | Ga0307509_10790459 | |||
| 2345 | Ga0307508_10011825 | |||
| 2346 | Ga0307508_10307473 | |||
| 2347 | Ga0307508_10693637 | |||
| 2348 | Ga0265314_10198417 | |||
| 2349 | Ga0265342_10058172 | |||
| 2350 | Ga0307516_10007966 | |||
| 2351 | Ga0307516_10029291 | |||
| 2352 | Ga0307516_10145252 | |||
| 2353 | Ga0307516_10716711 | |||
| 2354 | Ga0307405_10792261 | |||
| 2355 | Ga0307413_10291406 | |||
| 2356 | Ga0307410_10053396 | |||
| 2357 | Ga0307410_10356697 | |||
| 2358 | Ga0307410_10658659 | |||
| 2359 | Ga0326468_10046356 | |||
| 2360 | Ga0307406_10301156 | |||
| 2361 | Ga0307406_10482928 | |||
| 2362 | Ga0307406_10860173 | |||
| 2363 | Ga0307407_11618952 | |||
| 2364 | Ga0307412_10525785 | |||
| 2365 | Ga0307412_11496999 | |||
| 2366 | Ga0307409_101384233 | |||
| 2367 | Ga0307409_102712910 | |||
| 2368 | Ga0307416_100246326 | |||
| 2369 | Ga0307416_100494514 | |||
| 2370 | Ga0307416_101035278 | |||
| 2371 | Ga0307416_103244268 | |||
| 2372 | Ga0307414_10457183 | |||
| 2373 | Ga0307411_10487557 | |||
| 2374 | Ga0307411_10787610 | |||
| 2375 | Ga0307415_100627497 | |||
| 2376 | Ga0307415_100731665 | |||
| 2377 | Ga0307415_100852391 | |||
| 2378 | Ga0307415_101014639 | |||
| 2379 | Ga0307510_10001273 | |||
| 2380 | Ga0307510_10069809 | |||
| 2381 | Ga0315911_1000033 | |||
| 2382 | Ga0373928_0192895 | |||
| 2383 | Ga0373949_0044980 | |||
| 2384 | Ga0373923_0249718 | |||
| 2385 | Ga0373932_0255812 | |||
| 2386 | Ga0373936_0254779 | |||
| 2387 | Ga0373936_0332662 | |||
| 2388 | Ga0373953_0015608 | |||
| 2389 | Ga0373954_0179742 | |||
| 2390 | Ga0373954_0531412 | |||
| 2391 | Ga0373956_0287764 | |||
| 2392 | Ga0373957_0074306 | |||
| 2393 | Ga0373960_0142049 | |||
| 2394 | Ga0373943_0266814 | |||
| 2395 | Ga0373943_0633392 | |||
| 2396 | Ga0373946_0142566 | |||
| 2397 | Ga0373955_0024853 | |||
| 2398 | Ga0373955_0110252 | |||
| 2399 | Ga0373924_0126971 | |||
| 2400 | Ga0373931_0189843 | |||
| 2401 | Ga0373931_0421876 | |||
| 2402 | Ga0373935_0314935 | |||
| 2403 | Ga0373927_0038587 | |||
| 2404 | Ga0373927_0167722 | |||
| 2405 | Ga0373927_0251276 | |||
| 2406 | Ga0373933_0110446 | |||
| 2407 | Ga0373947_0036019 | |||
| 2408 | Ga0373947_0145981 | |||
| 2409 | Ga0373947_0174409 | |||
| 2410 | Ga0373925_0035939 | |||
| 2411 | Ga0373925_0195438 | |||
| 2412 | Ga0373925_1655806 | |||
| 2413 | Ga0395900_0005520 | |||
| 2414 | Ga0395900_0276293 | |||
| 2415 | Ga0395898_0037127 | |||
| 2416 | Ga0395898_0138371 | |||
| 2417 | Ga0395905_1838390 | |||
| 2418 | Ga0436364_0851724 | |||
| 2419 | Ga0436364_1384846 | |||
| 2420 | Ga0436364_1525576 | |||
| 2421 | Ga0395901_0139896 | |||
| 2422 | Ga0395901_0386542 | |||
| 2423 | Ga0395901_0955999 | |||
| 2424 | Ga0436365_0650112 | |||
| 2425 | Ga0436365_0762255 | |||
| 2426 | Ga0436365_1011842 | |||
| 2427 | Ga0436365_1020322 | |||
| 2428 | Ga0436365_1439408 | |||
| 2429 | Ga0436365_1490043 | |||
| 2430 | Ga0436360_0774184 | |||
| 2431 | Ga0436363_0280053 | |||
| 2432 | Ga0436363_1091320 | |||
| 2433 | Ga0436362_0326822 | |||
| 2434 | Ga0436362_0465319 | |||
| 2435 | Ga0439439_0243865 | |||
| 2436 | Ga0439461_0109522 | |||
| 2437 | Ga0439465_0097054 | |||
| 2438 | Ga0439465_0236761 | |||
| 2439 | Ga0451791_0351032 | |||
| 2440 | Ga0451791_0779637 | |||
| 2441 | Ga0451793_1056007 | |||
| 2442 | Ga0451795_1447378 | |||
| 2443 | Ga0451798_0116531 | |||
| 2444 | Ga0451802_1480618 | |||
| 2445 | Ga0451802_1993911 | |||
| 2446 | Ga0451802_2170941 | |||
| 2447 | Ga0451804_0756001 | |||
| 2448 | Ga0451807_1552806 | |||
| 2449 | Ga0451807_1643728 | |||
| 2450 | Ga0451807_2306262 | |||
| 2451 | Ga0451837_1520441 | |||
| 2452 | Ga0451841_0434281 | |||
| 2453 | Ga0451843_0781848 | |||
| 2454 | Ga0451843_1073320 | |||
| 2455 | Ga0451855_0748553 | |||
| 2456 | Ga0451853_0022904 | |||
| 2457 | Ga0451853_1309630 | |||
| 2458 | Ga0439431_0164142 | |||
| 2459 | Ga0439434_0042721 | |||
| 2460 | Ga0439459_0032648 | |||
| 2461 | Ga0439464_0319996 | |||
| 2462 | Ga0439460_0164675 | |||
| 2463 | Ga0466972_0000103 | |||
| 2464 | Ga0466963_0504605 | |||
| 2465 | Ga0466964_0114755 | |||
| 2466 | Ga0466964_0422816 | |||
| 2467 | Ga0466968_0057719 | |||
| 2468 | Ga0466968_0141319 | |||
| 2469 | Ga0466957_0352469 | |||
| 2470 | Ga0466960_0538011 | |||
| 2471 | Ga0466967_0054063 | |||
| 2472 | Ga0466967_0315072 | |||
| 2473 | Ga0466967_0482997 | |||
| 2474 | Ga0495617_027265 | |||
| 2475 | Ga0495617_033846 | |||
| 2476 | Ga0495617_151985 | |||
| 2477 | Ga0495592_0006419 | |||
| 2478 | Ga0495603_0004004 | |||
| 2479 | Ga0495603_0040916 | |||
| 2480 | Ga0495603_0199878 | |||
| 2481 | Ga0495603_0213819 | |||
| 2482 | Ga0495603_0235945 | |||
| 2483 | Ga0495603_0286982 | |||
| 2484 | Ga0495603_0509490 | |||
| 2485 | Ga0495603_0706715 | |||
| 2486 | Ga0495590_0071553 | |||
| 2487 | Ga0495590_0196845 | |||
| 2488 | Ga0495590_0259714 | |||
| 2489 | Ga0495590_0267416 | |||
| 2490 | Ga0495629_0048237 | |||
| 2491 | Ga0495629_0522075 | |||
| 2492 | Ga0495629_0921208 | |||
| 2493 | Ga0495638_0007023 | |||
| 2494 | Ga0495638_0333428 | |||
| 2495 | Ga0495638_0589454 | |||
| 2496 | Ga0495641_0160039 | |||
| 2497 | Ga0495641_0195243 | |||
| 2498 | Ga0495651_0104835 | |||
| 2499 | Ga0495651_0957228 | |||
| 2500 | Ga0495653_0256417 | |||
| 2501 | Ga0495650_0062372 | |||
| 2502 | Ga0495650_0114779 | |||
| 2503 | Ga0495580_0062442 | |||
| 2504 | Ga0495582_0140032 | |||
| 2505 | Ga0495605_0074591 | |||
| 2506 | Ga0495605_0159424 | |||
| 2507 | Ga0495605_0169003 | |||
| 2508 | Ga0495605_0196321 | |||
| 2509 | Ga0495605_0479851 | |||
| 2510 | Ga0495639_0097098 | |||
| 2511 | Ga0495662_0102808 | |||
| 2512 | Ga0495662_0367183 | |||
| 2513 | Ga0495664_0039454 | |||
| 2514 | Ga0495664_0341228 | |||
| 2515 | Ga0495585_0118621 | |||
| 2516 | Ga0495585_0232256 | |||
| 2517 | Ga0495585_0245502 | |||
| 2518 | Ga0495585_0550741 | |||
| 2519 | Ga0495585_0575128 | |||
| 2520 | Ga0495594_0015597 | |||
| 2521 | Ga0495594_0325893 | |||
| 2522 | Ga0495594_0348650 | |||
| 2523 | Ga0495596_0168844 | |||
| 2524 | Ga0495607_0070719 | |||
| 2525 | Ga0495607_0211818 | |||
| 2526 | Ga0495607_0525195 | |||
| 2527 | Ga0495583_0155558 | |||
| 2528 | Ga0495583_0348019 | |||
| 2529 | Ga0495583_0374122 | |||
| 2530 | Ga0495606_0259403 | |||
| 2531 | Ga0495608_0146937 | |||
| 2532 | Ga0495608_0408249 | |||
| 2533 | Ga0495610_0101402 | |||
| 2534 | Ga0495616_0036522 | |||
| 2535 | Ga0495616_0220123 | |||
| 2536 | Ga0495618_0103673 | |||
| 2537 | Ga0495620_0144181 | |||
| 2538 | Ga0495620_0263225 | |||
| 2539 | Ga0495628_0046957 | |||
| 2540 | Ga0495628_0781912 | |||
| 2541 | Ga0495630_0160306 | |||
| 2542 | Ga0495630_1470468 | |||
| 2543 | Ga0495631_0104132 | |||
| 2544 | Ga0495631_0136765 | |||
| 2545 | Ga0495631_0140579 | |||
| 2546 | Ga0495632_0019670 | |||
| 2547 | Ga0495632_0045655 | |||
| 2548 | Ga0495632_0426113 | |||
| 2549 | Ga0495632_0438840 | |||
| 2550 | Ga0495632_0462512 | |||
| 2551 | Ga0495643_0018978 | |||
| 2552 | Ga0495643_0372475 | |||
| 2553 | Ga0495643_0534198 | |||
| 2554 | Ga0495644_0125630 | |||
| 2555 | Ga0495648_0204062 | |||
| 2556 | Ga0495648_0353047 | |||
| 2557 | Ga0495663_0023116 | |||
| 2558 | Ga0495663_0163643 | |||
| 2559 | Ga0495666_0022400 | |||
| 2560 | Ga0495642_0449519 | |||
| 2561 | Ga0495652_0125924 | |||
| 2562 | Ga0495652_0423941 | |||
| 2563 | Ga0495665_0400678 | |||
| 2564 | Ga0495586_0450721 | |||
| 2565 | Ga0495587_0045966 | |||
| 2566 | Ga0495587_0263905 | |||
| 2567 | Ga0495598_0006848 | |||
| 2568 | Ga0495598_0086324 | |||
| 2569 | Ga0495598_0293577 | |||
| 2570 | Ga0495598_0328446 | |||
| 2571 | Ga0495609_0169740 | |||
| 2572 | Ga0495609_0170849 | |||
| 2573 | Ga0495621_0060031 | |||
| 2574 | Ga0495621_0439845 | |||
| 2575 | Ga0495597_0016739 | |||
| 2576 | Ga0495597_0161475 | |||
| 2577 | Ga0495597_0189414 | |||
| 2578 | Ga0495645_0059254 | |||
| 2579 | Ga0495622_0043255 | |||
| 2580 | Ga0495622_0248839 | |||
| 2581 | Ga0495622_0316789 | |||
| 2582 | Ga0495633_0090948 | |||
| 2583 | Ga0495633_0103185 | |||
| 2584 | Ga0495633_0487312 | |||
| 2585 | Ga0495667_0093822 | |||
| 2586 | Ga0495667_0294854 | |||
| 2587 | Ga0495656_0014489 | |||
| 2588 | Ga0495656_0025167 | |||
| 2589 | Ga0495656_0380705 | |||
| 2590 | Ga0495656_0398765 | |||
| 2591 | Ga0495656_0412102 | |||
| 2592 | Ga0495656_0487813 | |||
| 2593 | Ga0495668_0036843 | |||
| 2594 | Ga0495668_0074226 | |||
| 2595 | Ga0495668_0107302 | |||
| 2596 | Ga0495668_0139602 | |||
| 2597 | Ga0495668_0177552 | |||
| 2598 | Ga0495668_0178521 | |||
| 2599 | Ga0495668_0279679 | |||
| 2600 | Ga0495668_0372247 | |||
| 2601 | Ga0495634_0212718 | |||
| 2602 | Ga0495634_0292385 | |||
| 2603 | Ga0495611_0153435 | |||
| 2604 | Ga0495611_0360463 | |||
| 2605 | Ga0495625_0295045 | |||
| 2606 | Ga0495625_0327765 | |||
| 2607 | Ga0495625_0333958 | |||
| 2608 | Ga0495625_0379973 | |||
| 2609 | Ga0495625_0401986 | |||
| 2610 | Ga0495625_0593625 | |||
| 2611 | Ga0495635_0148174 | |||
| 2612 | Ga0495635_0398418 | |||
| 2613 | Ga0495659_0022069 | |||
| 2614 | Ga0495659_0153402 | |||
| 2615 | Ga0495659_0369175 | |||
| 2616 | Ga0495661_0233281 | |||
| 2617 | Ga0495661_0282504 | |||
| 2618 | Ga0495588_0013335 | |||
| 2619 | Ga0495588_0404279 | |||
| 2620 | Ga0495657_0045052 | |||
| 2621 | Ga0495657_0191237 | |||
| 2622 | Ga0495623_0246181 | |||
| 2623 | Ga0495623_0727030 | |||
| 2624 | Ga0495646_0277428 | |||
| 2625 | Ga0495647_0143356 | |||
| 2626 | Ga0495647_0161801 | |||
| 2627 | Ga0495647_0606606 | |||
| 2628 | Ga0495658_0047124 | |||
| 2629 | Ga0495658_0229965 | |||
| 2630 | Ga0495669_0009770 | |||
| 2631 | Ga0495669_0178578 | |||
| 2632 | Ga0495669_0371833 | |||
| 2633 | Ga0495669_0395627 | |||
| 2634 | Ga0495613_0215885 | |||
| 2635 | Ga0495624_0166371 | |||
| 2636 | Ga0495624_0184441 | |||
| 2637 | Ga0495624_0492823 | |||
| 2638 | Ga0495670_0063192 | |||
| 2639 | Ga0495670_0151618 | |||
| 2640 | Ga0495670_0170032 | |||
| 2641 | Ga0495670_0178012 | |||
| 2642 | Ga0495670_0305677 | |||
| 2643 | Ga0495670_0493325 | |||
| 2644 | Ga0495670_0751582 | |||
| 2645 | Ga0495671_0032886 | |||
| 2646 | Ga0495671_0375221 | |||
| 2647 | Ga0495671_0464718 | |||
| 2648 | Ga0495671_0594957 | |||
| 2649 | Ga0495649_0128503 | |||
| 2650 | Ga0495649_0287481 | |||
| 2651 | Ga0495649_0555943 | |||
| 2652 | Ga0495589_0110014 | |||
| 2653 | Ga0495589_0465141 | |||
| 2654 | Ga0495589_0538120 | |||
| 2655 | Ga0495589_0575384 | |||
| 2656 | Ga0495600_0163840 | |||
| 2657 | Ga0495600_0267556 | |||
| 2658 | Ga0495660_0333527 | |||
| 2659 | Ga0495581_0162232 | |||
| 2660 | Ga0495581_0171175 | |||
| 2661 | Ga0495581_0411880 | |||
| 2662 | Ga0495604_0946401 | |||
| 2663 | Ga0495674_0118456 | |||
| 2664 | Ga0495674_0529027 | |||
| 2665 | Ga0495674_0697183 | |||
| 2666 | Ga0495674_0951857 | |||
| 2667 | Ga0495674_1130939 | |||
| 2668 | Ga0495672_0312047 | |||
| 2669 | Ga0495676_0068390 | |||
| 2670 | Ga0495676_0080875 | |||
| 2671 | Ga0495676_0847075 | |||
| 2672 | Ga0495680_0121242 | |||
| 2673 | Ga0495680_0513413 | |||
| 2674 | Ga0495683_0070352 | |||
| 2675 | Ga0495683_0169811 | |||
| 2676 | Ga0495683_0373852 | |||
| 2677 | Ga0495687_026059 | |||
| 2678 | Ga0495675_0061810 | |||
| 2679 | Ga0495677_0142896 | |||
| 2680 | Ga0495677_0322087 | |||
| 2681 | Ga0495685_148898 | |||
| 2682 | Ga0495673_0240891 | |||
| 2683 | Ga0495686_0220865 | |||
| 2684 | Ga0495686_0325015 | |||
| 2685 | Ga0495686_0338735 | |||
| 2686 | Ga0495686_0458610 | |||
| 2687 | Ga0495593_0718801 | |||
| 2688 | Ga0495602_0251574 | |||
| 2689 | Ga0495602_0617432 | |||
| 2690 | Ga0495615_0046998 | |||
| 2691 | Ga0495626_0062379 | |||
| 2692 | Ga0496100_0036087 | |||
| 2693 | Ga0496100_0257733 | |||
| 2694 | Ga0496100_0279430 | |||
| 2695 | Ga0496100_1532967 | |||
| 2696 | Ga0496101_0119028 | |||
| 2697 | Ga0496101_0181314 | |||
| 2698 | Ga0496101_0314994 | |||
| 2699 | Ga0496101_0338786 | |||
| 2700 | Ga0496101_0374878 | |||
| 2701 | Ga0496101_0855810 | |||
| 2702 | Ga0496101_1029200 | |||
| 2703 | Ga0496102_0020395 | |||
| 2704 | Ga0496102_0063796 | |||
| 2705 | Ga0496102_0169871 | |||
| 2706 | Ga0496102_0413866 | |||
| 2707 | Ga0496102_0815625 | |||
| 2708 | Ga0496102_0840779 | |||
| 2709 | Ga0496103_0012448 | |||
| 2710 | Ga0496103_0168383 | |||
| 2711 | Ga0496103_0248696 | |||
| 2712 | Ga0496103_0457552 | |||
| 2713 | Ga0496103_0569827 | |||
| 2714 | Ga0496104_0005304 | |||
| 2715 | Ga0496104_0028812 | |||
| 2716 | Ga0496104_0032218 | |||
| 2717 | Ga0496104_0160497 | |||
| 2718 | Ga0496104_0164757 | |||
| 2719 | Ga0496104_0237782 | |||
| 2720 | Ga0496104_0528289 | |||
| 2721 | Ga0496104_0804067 | |||
| 2722 | Ga0496104_0887891 | |||
| 2723 | Ga0496104_1397581 | |||
| 2724 | Ga0496104_1818190 | |||
| 2725 | Ga0496105_0031279 | |||
| 2726 | Ga0496105_0134113 | |||
| 2727 | Ga0496105_0137428 | |||
| 2728 | Ga0496105_0253075 | |||
| 2729 | Ga0496105_0327141 | |||
| 2730 | Ga0496106_0121425 | |||
| 2731 | Ga0496106_0286971 | |||
| 2732 | Ga0496106_0649612 | |||
| 2733 | Ga0496106_0834071 | |||
| 2734 | Ga0496107_0003794 | |||
| 2735 | Ga0496107_0040653 | |||
| 2736 | Ga0496107_0362702 | |||
| 2737 | Ga0496107_0375479 | |||
| 2738 | Ga0496107_0465183 | |||
| 2739 | Ga0496107_0509951 | |||
| 2740 | Ga0496107_0841801 | |||
| 2741 | Ga0496108_0058299 | |||
| 2742 | Ga0496108_0099447 | |||
| 2743 | Ga0496108_0416753 | |||
| 2744 | Ga0496108_0833165 | |||
| 2745 | Ga0496108_0887637 | |||
| 2746 | Ga0496108_1108332 | |||
| 2747 | Ga0496108_1535273 | |||
| 2748 | Ga0496109_0025525 | |||
| 2749 | Ga0496109_0159771 | |||
| 2750 | Ga0496109_0162816 | |||
| 2751 | Ga0496109_0212245 | |||
| 2752 | Ga0496109_0281849 | |||
| 2753 | Ga0496109_1101649 | |||
| 2754 | Ga0496110_0011045 | |||
| 2755 | Ga0496110_0031931 | |||
| 2756 | Ga0496110_0140768 | |||
| 2757 | Ga0496110_0166098 | |||
| 2758 | Ga0496110_0246615 | |||
| 2759 | Ga0496110_0460076 | |||
| 2760 | Ga0496110_0569665 | |||
| 2761 | Ga0496110_1413380 | |||
| 2762 | Ga0496110_1678913 | |||
| 2763 | Ga0496111_0193593 | |||
| 2764 | Ga0496111_0279829 | |||
| 2765 | Ga0496111_0285505 | |||
| 2766 | Ga0496111_0294227 | |||
| 2767 | Ga0496112_0002348 | |||
| 2768 | Ga0496112_0024571 | |||
| 2769 | Ga0496112_0032266 | |||
| 2770 | Ga0496112_0161748 | |||
| 2771 | Ga0496112_0264925 | |||
| 2772 | Ga0496112_0641936 | |||
| 2773 | Ga0496112_0847424 | |||
| 2774 | Ga0496112_0922201 | |||
| 2775 | Ga0496112_1104583 | |||
| 2776 | Ga0496113_0010309 | |||
| 2777 | Ga0496113_0077551 | |||
| 2778 | Ga0496113_0106478 | |||
| 2779 | Ga0496113_0210828 | |||
| 2780 | Ga0496113_0607093 | |||
| 2781 | Ga0496113_0810652 | |||
| 2782 | Ga0496114_0127199 | |||
| 2783 | Ga0496114_0176754 | |||
| 2784 | Ga0496114_0695250 | |||
| 2785 | Ga0496114_0977498 | |||
| 2786 | Ga0496114_1043281 | |||
| 2787 | Ga0496114_1084395 | |||
| 2788 | Ga0496114_1287531 | |||
| 2789 | Ga0496114_1437162 | |||
| 2790 | Ga0496114_1793286 | |||
| 2791 | Ga0496115_0031637 | |||
| 2792 | Ga0496115_0082169 | |||
| 2793 | Ga0496115_0137195 | |||
| 2794 | Ga0496115_0165538 | |||
| 2795 | Ga0496115_0349061 | |||
| 2796 | Ga0496115_0361198 | |||
| 2797 | Ga0496115_1415319 | |||
| 2798 | Ga0496116_0215047 | |||
| 2799 | Ga0496117_0135251 | |||
| 2800 | Ga0496117_0608482 | |||
| 2801 | Ga0496118_0060394 | |||
| 2802 | Ga0496118_0232542 | |||
| 2803 | Ga0496118_0243162 | |||
| 2804 | Ga0496118_0268683 | |||
| 2805 | Ga0496118_0630617 | |||
| 2806 | Ga0496119_0499896 | |||
| 2807 | Ga0496120_0458354 | |||
| 2808 | Ga0496121_0040767 | |||
| 2809 | Ga0496121_0124235 | |||
| 2810 | Ga0496121_0147495 | |||
| 2811 | Ga0496121_0320748 | |||
| 2812 | Ga0496121_0383791 | |||
| 2813 | Ga0496121_0397045 | |||
| 2814 | Ga0496121_0432689 | |||
| 2815 | Ga0496121_0474454 | |||
| 2816 | Ga0496124_0042163 | |||
| 2817 | Ga0496124_0092171 | |||
| 2818 | Ga0496124_0456445 | |||
| 2819 | Ga0496125_0064993 | |||
| 2820 | Ga0496125_0184109 | |||
| 2821 | Ga0496125_0541521 | |||
| 2822 | Ga0496125_0605295 | |||
| 2823 | Ga0496125_0717242 | |||
| 2824 | Ga0496126_0076414 | |||
| 2825 | Ga0496126_0109357 | |||
| 2826 | Ga0496126_0183915 | |||
| 2827 | Ga0496126_0371718 | |||
| 2828 | Ga0495678_268874 | |||
| 2829 | Ga0495682_0068866 | |||
| 2830 | Ga0495682_0190605 | |||
| 2831 | Ga0501032_0023304 | |||
| 2832 | Ga0501034_0435990 | |||
| 2833 | Ga0501036_0078202 | |||
| 2834 | Ga0501036_0127553 | |||
| 2835 | Ga0501036_1476751 | |||
| 2836 | Ga0501037_0019267 | |||
| 2837 | Ga0501037_0214971 | |||
| 2838 | Ga0501038_0006071 | |||
| 2839 | Ga0501039_0532010 | |||
| 2840 | Ga0501042_0857248 | |||
| 2841 | Ga0501047_0040644 | |||
| 2842 | Ga0501067_0025603 | |||
| 2843 | Ga0501067_0089839 | |||
| 2844 | Ga0501070_0204410 | |||
| 2845 | Ga0501071_0491521 | |||
| 2846 | Ga0501071_0559757 | |||
| 2847 | Ga0501072_0752131 | |||
| 2848 | Ga0501073_0228990 | |||
| 2849 | Ga0501073_0271726 | |||
| 2850 | Ga0501074_1299807 | |||
| 2851 | Ga0501075_0597190 | |||
| 2852 | Ga0501079_0441549 | |||
| 2853 | Ga0501079_0762325 | |||
| 2854 | Ga0501081_0678878 | |||
| 2855 | Ga0501081_0879323 | |||
| 2856 | Ga0501035_0036749 | |||
| 2857 | Ga0501035_0914083 | |||
| 2858 | Ga0501044_0048353 | |||
| 2859 | nmdc:mga03683_32653_c1 | |||
| 2860 | nmdc:mga03683_427858_c1 | |||
| 2861 | nmdc:mga03n38_66284_c1 | |||
| 2862 | nmdc:mga03n38_750_c1 | |||
| 2863 | nmdc:mga00v17_145356_c2 | |||
| 2864 | nmdc:mga00v17_89925_c1 | |||
| 2865 | nmdc:mga0yw44_110342_c2 | |||
| 2866 | nmdc:mga0yw44_134708_c1 | |||
| 2867 | nmdc:mga0yw44_194989_c1 | |||
| 2868 | nmdc:mga0yw44_460391_c1 | |||
| 2869 | nmdc:mga0yw44_71352_c1 | |||
| 2870 | nmdc:mga0k408_218592_c1 | |||
| 2871 | nmdc:mga0k408_383205_c1 | |||
| 2872 | nmdc:mga06z11_115086_c1 | |||
| 2873 | nmdc:mga06z11_406481_c1 | |||
| 2874 | nmdc:mga06z11_57843_c1 | |||
| 2875 | nmdc:mga06z11_718052_c1 | |||
| 2876 | nmdc:mga06z11_805031_c1 | |||
| 2877 | nmdc:mga06z11_902165_c1 | |||
| 2878 | nmdc:mga06z11_96061_c1 | |||
| 2879 | nmdc:mga04h51_162340_c1 | |||
| 2880 | nmdc:mga04h51_28282_c1 | |||
| 2881 | nmdc:mga04h51_436293_c1 | |||
| 2882 | nmdc:mga04h51_76018_c1 | |||
| 2883 | nmdc:mga07m45_152413_c1 | |||
| 2884 | nmdc:mga07m45_18580_c1 | |||
| 2885 | nmdc:mga07m45_742882_c1 | |||
| 2886 | nmdc:mga07m45_846283_c1 | |||
| 2887 | nmdc:mga05p37_178885_c1 | |||
| 2888 | nmdc:mga05p37_847321_c1 | |||
| 2889 | nmdc:mga09592_167996_c1 | |||
| 2890 | nmdc:mga08y16_1042042_c1 | |||
| 2891 | nmdc:mga08y16_728993_c1 | |||
| 2892 | nmdc:mga08y16_88998_c1 | |||
| 2893 | nmdc:mga0n895_393875_c1 | |||
| 2894 | nmdc:mga0n895_477290_c1 | |||
| 2895 | nmdc:mga0n895_689952_c1 | |||
| 2896 | nmdc:mga0n895_98616_c1 | |||
| 2897 | nmdc:mga0rr50_1261245_c1 | |||
| 2898 | nmdc:mga0rr50_248225_c1 | |||
| 2899 | nmdc:mga0rr50_673997_c1 | |||
| 2900 | nmdc:mga08x19_337831_c1 | |||
| 2901 | nmdc:mga0a205_19766_c1 | |||
| 2902 | nmdc:mga0sz30_12546_c1 | |||
| 2903 | nmdc:mga0sz30_260904_c1 | |||
| 2904 | nmdc:mga0sz30_278376_c1 | |||
| 2905 | Ga0495601_0057492 | |||
| 2906 | Ga0495612_0171066 | |||
| 2907 | Ga0495612_0469031 | |||
| 2908 | Ga0500610_0144165 | |||
| 2909 | Ga0500635_0003021 | |||
| 2910 | Ga0495655_0024332 | |||
| 2911 | Ga0495655_0226456 | |||
| 2912 | Ga0495655_0228803 | |||
| 2913 | Ga0495655_0300812 | |||
| 2914 | Ga0495595_0164547 | |||
| 2915 | Ga0495619_0269980 | |||
| 2916 | Ga0495619_0591042 | |||
| 2917 | Ga0500578_0554088 | |||
| 2918 | Ga0500643_038351 | |||
| 2919 | Ga0500647_0212298 | |||
| 2920 | Ga0500583_0515884 | |||
| 2921 | Ga0500566_0000896 | |||
| 2922 | Ga0500566_0002969 | |||
| 2923 | Ga0500640_280486 | |||
| 2924 | Ga0500641_0001155 | |||
| 2925 | Ga0500641_0209835 | |||
| 2926 | Ga0500554_040612 | |||
| 2927 | Ga0500569_127264 | |||
| 2928 | Ga0500572_010166 | |||
| 2929 | Ga0500595_000253 | |||
| 2930 | Ga0500595_012401 | |||
| 2931 | Ga0500608_118739 | |||
| 2932 | Ga0500614_036518 | |||
| 2933 | Ga0500628_098555 | |||
| 2934 | Ga0500655_012023 | |||
| 2935 | Ga0500658_0318055 | |||
| 2936 | Ga0500559_0027725 | |||
| 2937 | Ga0500561_0174895 | |||
| 2938 | Ga0500564_305873 | |||
| 2939 | Ga0500568_0065287 | |||
| 2940 | Ga0500568_0396271 | |||
| 2941 | Ga0500577_0018436 | |||
| 2942 | Ga0500589_267915 | |||
| 2943 | Ga0500603_015135 | |||
| 2944 | Ga0500603_108860 | |||
| 2945 | Ga0500604_0221342 | |||
| 2946 | Ga0500604_0265456 | |||
| 2947 | Ga0500630_031989 | |||
| 2948 | Ga0500638_059966 | |||
| 2949 | Ga0500638_140278 | |||
| 2950 | Ga0500639_004728 | |||
| 2951 | Ga0500639_212850 | |||
| 2952 | Ga0500636_0211929 | |||
| 2953 | Ga0500637_0002240 | |||
| 2954 | Ga0500637_0030173 | |||
| 2955 | Ga0500576_233524 | |||
| 2956 | Ga0500611_037453 | |||
| 2957 | Ga0500609_053211 | |||
| 2958 | Ga0501084_0281801 | |||
| 2959 | Ga0500661_011310 | |||
| 2960 | Ga0500661_036659 | |||
| 2961 | Ga0587072_166359 | |||
| 2962 | Ga0530510_1345142 | |||
| 2963 | 2509149797 | |||
| 2964 | 2513647963 | |||
| 2965 | 2513658233 | |||
| 2966 | 2513694927 | |||
| 2967 | 2513862937 | |||
| 2968 | 2513889781 | |||
| 2969 | 2513920275 | |||
| 2970 | 2517102387 | |||
| 2971 | 2517889305 | |||
| 2972 | 2523105219 | |||
| 2973 | 2524540350 | |||
| 2974 | 2528855139 | |||
| 2975 | 2723842026 | |||
| 2976 | 2728755361 | |||
| 2977 | 2793070962 | |||
| 2978 | 2793077425 | |||
| 2979 | 2818237279 | |||
| 2980 | 2824664728 | |||
| 2981 | 2841964614 | |||
| 2982 | 2849082674 | |||
| 2983 | 2874610362 | |||
| 2984 | 2874617920 | |||
| 2985 | 2876812841 | |||
| 2986 | 2879111681 | |||
| 2987 | 2885377733 | |||
| 2988 | 2888379964 | |||
| 2989 | 2888391042 | |||
| 2990 | 2889035074 | |||
| 2991 | 2903749922 | |||
| 2992 | 2904692504 | |||
| 2993 | 2904709175 | |||
| 2994 | 2906635490 | |||
| 2995 | 2906668621 | |||
| 2996 | 2908747905 | |||
| 2997 | 2908756772 | |||
| 2998 | 2922363333 | |||
| 2999 | 2922378350 | |||
| 3000 | 2922388612 | |||
| 3001 | 2922433716 | |||
| 3002 | 2929622549 | |||
| 3003 | 2929631233 | |||
| 3004 | 2932786345 | |||
| 3005 | 2932829583 | |||
| 3006 | 2933584372 | |||
| 3007 | 2935618101 | |||
| 3008 | 2935634762 | |||
| 3009 | 2935641501 | |||
| 3010 | 2935669441 | |||
| 3011 | 2935677961 | |||
| 3012 | 2935701801 | |||
| 3013 | 2935707266 | |||
| 3014 | 2935804355 | |||
| 3015 | 2935817216 | |||
| 3016 | 2935831232 | |||
| 3017 | 2935841841 | |||
| 3018 | 2935856400 | |||
| 3019 | 2935871077 | |||
| 3020 | 2935874574 | |||
| 3021 | 2935964145 | |||
| 3022 | 2935994035 | |||
| 3023 | 2936004954 | |||
| 3024 | 2936044012 | |||
| 3025 | 2941511908 | |||
| 3026 | 2941519610 | |||
| 3027 | 2941527698 | |||
| 3028 | 2941543914 | |||
| 3029 | 3005475545 | |||
| 3030 | 8006935753 | |||
| 3031 | 8006968313 | |||
| 3032 | 8006975672 | |||
| 3033 | 8006985952 | |||
| 3034 | 8007000244 | |||
| 3035 | 8016518627 | |||
| 3036 | 8017058043 | |||
| 3037 | 8019563039 | |||
| 3038 | 8019573120 | |||
| 3039 | 8019577691 | |||
| 3040 | 8019595790 | |||
| 3041 | 8019612562 | |||
| 3042 | 8055751000 | |||
| 3043 | 8056677726 | |||
| 3044 | 8056694112 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2oxh-assembly1.cif.gz_Z | the soxyz complex of paracoccus pantotrophus | 0.8907 | 3 | 103 |
| 2oxg-assembly4.cif.gz_E | the soxyz complex of paracoccus pantotrophus | 0.8696 | 3 | 103 |
| 2oxh-assembly1.cif.gz_Z | the soxyz complex of paracoccus pantotrophus | 0.8667 | 3 | 103 |
| 1v8h-assembly1.cif.gz_B | crystal structure of tt0351 protein from thermus thermophilus hb8 | 0.8538 | 4 | 102 |
| 2oxg-assembly3.cif.gz_C | the soxyz complex of paracoccus pantotrophus | 0.8513 | 3 | 103 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2oxgE00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8696 | 3 | 103 | 2.60.40.10 |
| 1v8hB00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8538 | 4 | 102 | 2.60.40.10 |
| 2oxgE00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.837 | 3 | 103 | 2.60.40.10 |
| 1v8hB00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8157 | 4 | 102 | 2.60.40.10 |
| af_A0A0R0L9U5_1_180_3.30.420.110 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;MutS, connector domain | 0.7866 | 2 | 27 | 3.30.420.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W2A9W3-F1-model_v4 | Thiosulfate oxidation carrier complex protein SoxZ | 0.991 | 5 | 103 |
|
| AF-F5RF90-F1-model_v4 | Secreted protein | 0.9872 | 4 | 103 |
|
| AF-A0A6N1XHJ9-F1-model_v4 | Thiosulfate oxidation carrier complex protein SoxZ | 0.9864 | 6 | 103 |
|
| AF-I3UAU9-F1-model_v4 | Sulfur oxidation protein SoxZ | 0.9859 | 6 | 103 |
|
| AF-A0A7D4E3B4-F1-model_v4 | Thiosulfate oxidation carrier complex protein SoxZ | 0.9855 | 6 | 103 |
|