F494361

General Info

Members Datasets Scaffolds Average Seq Length
1495 1065 816 307

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10028483|Ga0307513_100284833
Length 342
Sequence MRSHGEAPCLPSPLTTKAWCDDVQKQTAIAGKPAATATAPVALRSASVLDGRNTLGFLFMLPGAALLLVFLTYPLGLGVWLGFTDTRIGRDGSFVGFENYQMLWDDTVFWLSVFNTVLYTVAASILKFALGLWLALLLNQHLPFKAFLRAIVLLPWVVPTVLSAIAFWWIFDAQFSIISWALIKIGLIHAPINFLGDSTNARASVIAANVWRGIPFVAITLLAGLQTIPQSLYEAATLDGATSWQRFRFITLPMLTPIIAVVMTFSVLFTFTDFQLIYVLTRGGPVNATHLMATLSFQRAIAGGQLGEGAAIAVSMIPFLLSAILFSYFGLQRRKWQQGGRD

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501050 Microvirga lupini Lut6 Isolate Nodule
3 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
8 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
9 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
10 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
11 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
12 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
13 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
14 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
15 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
16 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
17 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
18 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
19 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
20 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
21 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
22 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
23 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
24 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
25 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
26 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
27 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
28 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
29 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
30 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
31 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
32 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
33 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
34 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
35 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
36 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
37 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
38 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
39 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
40 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
41 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
42 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
43 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
44 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
45 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
46 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
47 2516143018 Ensifer sp. BR816 Isolate Nodule
48 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
49 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
50 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
51 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
52 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
53 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
54 2519899620 Rhizobium sp. Pop5 Isolate Nodule
55 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
56 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
57 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
58 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
59 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
60 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
61 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
62 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
63 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
64 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
65 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
66 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
67 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
68 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
69 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
70 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
71 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
72 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
73 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
74 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
75 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
76 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
77 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
78 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
79 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
80 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
81 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
82 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
83 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
84 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
85 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
86 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
87 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
88 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
89 2643221558 Rhizobium sp. Root149 Isolate Unclassified
90 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
91 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
92 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
93 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
94 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
95 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
96 2643221723 Ensifer sp. Root278 Isolate Unclassified
97 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
98 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
99 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
100 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
101 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
102 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
103 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
104 2718217882 Rhizobium sp. N741 Isolate Nodule
105 2718217927 Rhizobium sp. N324 Isolate Nodule
106 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
107 2718218009 Rhizobium sp. N561 Isolate Nodule
108 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
109 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
110 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
111 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
112 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
113 2718218363 Rhizobium sp. N113 Isolate Nodule
114 2718218365 Rhizobium sp. N731 Isolate Nodule
115 2718218366 Rhizobium sp. N621 Isolate Nodule
116 2718218423 Rhizobium sp. N941 Isolate Nodule
117 2721755514 Rhizobium sp. N6212 Isolate Nodule
118 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
119 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
120 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
121 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
122 2721755809 Rhizobium sp. N541 Isolate Nodule
123 2721755810 Rhizobium sp. N871 Isolate Nodule
124 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
125 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
126 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
127 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
128 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
129 2728369365 Rhizobium sp. N1341 Isolate Nodule
130 2728369397 Rhizobium sp. N1314 Isolate Nodule
131 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
132 2738543013 Variovorax sp. BT01 Isolate Unclassified
133 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
134 2751185800 Brucella pituitosa AA2 Isolate Unclassified
135 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
136 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
137 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
138 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
139 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
140 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
141 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
142 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
143 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
144 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
145 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
146 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
147 2791355256 Rhizobium sp. M10 Isolate Nodule
148 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
149 2791355260 Rhizobium sp. L9 Isolate Nodule
150 2791355261 Rhizobium sp. J15 Isolate Nodule
151 2791355262 Rhizobium sp. M1 Isolate Nodule
152 2791355263 Rhizobium chutanense C5 Isolate Nodule
153 2791355264 Rhizobium sp. S9 Isolate Nodule
154 2791355265 Rhizobium sp. H4 Isolate Nodule
155 2791355266 Rhizobium sp. L43 Isolate Nodule
156 2791355267 Rhizobium sp. L18 Isolate Nodule
157 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
158 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
159 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
160 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
161 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
162 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
163 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
164 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
165 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
166 2802429633 Rhizobium anhuiense J3 Isolate Nodule
167 2802429634 Rhizobium anhuiense S10 Isolate Nodule
168 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
169 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
170 2802429637 Rhizobium anhuiense C15 Isolate Nodule
171 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
172 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
173 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
174 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
175 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
176 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
177 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
178 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
179 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
180 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
181 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
182 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
183 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
184 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
185 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
186 2838048938 Rhizobium pisi 27/80 Isolate Nodule
187 2838061910 Rhizobium phaseoli L15 Isolate Nodule
188 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
189 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
190 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
191 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
192 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
193 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
194 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
195 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
196 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
197 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
198 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
199 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
200 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
201 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
202 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
203 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
204 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
205 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
206 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
207 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
208 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
209 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
210 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
211 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
212 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
213 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
214 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
215 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
216 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
217 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
218 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
219 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
220 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
221 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
222 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
223 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
224 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
225 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
226 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
227 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
228 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
229 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
230 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
231 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
232 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
233 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
234 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
235 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
236 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
237 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
238 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
239 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
240 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
241 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
242 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
243 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
244 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
245 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
246 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
247 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
248 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
249 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
250 2842694124 Methylopila sp. R-72369 Isolate Unclassified
251 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
252 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
253 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
254 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
255 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
256 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
257 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
258 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
259 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
260 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
261 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
262 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
263 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
264 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
265 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
266 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
267 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
268 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
269 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
270 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
271 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
272 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
273 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
274 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
275 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
276 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
277 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
278 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
279 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
280 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
281 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
282 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
283 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
284 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
285 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
286 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
287 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
288 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
289 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
290 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
291 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
292 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
293 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
294 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
295 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
296 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
297 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
298 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
299 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
300 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
301 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
302 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
303 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
304 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
305 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
306 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
307 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
308 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
309 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
310 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
311 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
312 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
313 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
314 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
315 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
316 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
317 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
318 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
319 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
320 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
321 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
322 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
323 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
324 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
325 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
326 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
327 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
328 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
329 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
330 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
331 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
332 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
333 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
334 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
335 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
336 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
337 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
338 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
339 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
340 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
341 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
342 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
343 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
344 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
345 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
346 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
347 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
348 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
349 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
350 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
351 2909042592 Labrys sp. LIt4 Isolate Nodule
352 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
353 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
354 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
355 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
356 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
357 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
358 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
359 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
360 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
361 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
362 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
363 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
364 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
365 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
366 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
367 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
368 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
369 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
370 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
371 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
372 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
373 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
374 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
375 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
376 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
377 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
378 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
379 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
380 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
381 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
382 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
383 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
384 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
385 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
386 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
387 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
388 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
389 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
390 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
391 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
392 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
393 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
394 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
395 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
396 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
397 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
398 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
399 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
400 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
401 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
402 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
403 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
404 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
405 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
406 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
407 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
408 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
409 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
410 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
411 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
412 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
413 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
414 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
415 2933599457 Rhizobium phaseoli M3 Isolate Nodule
416 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
417 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
418 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
419 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
420 2936381700 Rhizobium chutanense C16 Isolate Unclassified
421 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
422 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
423 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
424 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
425 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
426 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
427 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
428 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
429 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
430 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
431 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
432 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
433 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
434 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
435 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
436 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
437 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
438 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
439 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
440 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
441 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
442 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
443 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
444 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
445 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
446 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
447 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
448 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
449 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
450 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
451 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
452 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
453 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
454 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
455 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
456 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
457 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
458 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
459 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
460 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
461 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
462 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
463 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
464 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
465 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
466 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
467 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
468 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
469 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
470 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
471 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
472 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
473 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
474 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
475 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
476 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
477 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
478 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
479 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
480 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
481 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
482 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
483 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
484 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
485 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
486 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
487 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
488 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
489 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
490 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
491 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
492 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
493 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
494 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
495 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
496 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
497 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
498 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
499 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
500 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
501 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
502 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
503 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
504 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
505 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
506 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
507 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
508 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
509 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
510 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
511 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
512 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
513 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
514 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
515 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
516 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
517 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
518 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
519 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
520 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
521 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
522 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
523 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
524 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
525 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
526 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
527 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
528 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
529 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
530 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
531 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
532 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
533 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
534 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
535 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
536 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
537 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
538 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
539 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
540 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
541 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
542 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
543 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
544 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
545 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
546 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
547 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
548 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
549 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
550 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
551 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
552 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
553 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
554 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
555 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
556 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
557 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
558 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
559 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
560 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
561 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
562 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
563 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
564 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
565 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
566 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
567 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
568 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
569 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
570 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
571 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
572 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
573 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
574 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
575 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
576 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
577 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
578 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
579 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
580 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
581 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
582 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
583 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
584 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
585 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
586 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
587 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
588 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
589 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
590 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
591 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
592 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
593 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
594 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
595 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
596 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
597 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
598 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
599 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
600 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
601 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
602 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
603 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
604 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
605 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
606 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
607 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
608 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
609 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
610 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
611 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
612 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
613 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
614 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
615 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
616 2996893221 Rhizobium sp. R635 Isolate Nodule
617 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
618 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
619 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
620 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
621 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
622 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
623 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
624 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
625 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
626 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
627 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
628 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
629 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
630 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
631 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
632 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
633 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
634 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
635 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
636 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
637 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
638 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
639 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
640 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
641 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
642 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
643 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
644 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
645 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
646 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
647 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
648 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
649 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
650 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
651 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
652 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
653 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
654 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
655 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
656 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
657 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
658 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
659 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
660 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
661 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
662 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
663 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
664 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
665 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
666 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
667 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
668 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
669 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
670 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
671 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
672 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
673 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
674 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
675 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
676 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
677 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
678 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
679 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
680 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
681 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
682 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
683 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
684 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
685 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
686 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
687 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
688 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
689 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
690 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
691 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
692 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
693 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
694 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
695 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
696 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
697 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
698 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
699 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
700 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
701 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
702 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
703 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
704 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
705 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
706 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
707 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
708 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
709 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
710 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
711 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
712 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
713 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
714 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
715 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
716 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
717 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
718 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
719 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
720 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
721 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
722 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
723 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
724 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
725 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
726 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
727 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
728 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
729 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
730 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
731 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
732 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
733 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
734 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
735 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
736 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
737 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
738 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
739 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
740 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
741 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
742 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
743 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
744 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
745 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
746 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
747 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
748 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
749 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
750 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
751 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
752 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
753 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
754 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
755 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
756 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
757 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
758 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
759 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
760 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
761 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
762 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
763 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
764 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
765 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
766 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
767 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
768 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
769 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
770 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
771 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
772 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
773 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
774 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
775 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
776 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
777 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
778 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
779 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
780 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
781 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
782 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
783 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
784 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
785 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
786 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
787 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
788 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
789 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
790 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
791 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
792 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
793 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
794 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
795 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
796 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
797 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
798 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
799 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
800 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
801 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
802 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
803 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
804 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
805 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
806 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
807 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
808 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
809 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
810 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
811 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
812 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
813 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
814 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
815 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
816 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
817 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
818 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
819 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
820 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
821 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
822 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
823 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
824 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
825 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
826 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
827 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
828 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
829 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
830 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
831 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
832 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
833 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
834 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
835 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
836 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
837 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
838 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
839 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
840 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
841 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
842 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
843 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
844 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
845 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
846 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
847 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
848 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
849 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
850 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
851 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
852 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
853 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
854 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
855 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
856 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
857 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
858 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
859 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
860 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
861 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
862 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
863 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
864 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
865 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
866 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
867 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
868 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
869 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
870 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
871 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
872 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
873 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
874 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
875 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
876 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
877 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
878 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
879 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
880 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
881 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
882 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
883 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
884 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
885 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
886 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
887 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
888 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
889 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
890 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
891 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
892 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
893 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
894 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
895 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
896 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
897 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
898 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
899 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
900 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
901 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
902 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
903 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
904 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
905 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
906 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
907 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
908 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
909 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
910 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
911 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
912 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
913 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
914 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
915 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
916 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
917 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
918 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
919 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
920 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
921 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
922 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
923 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
924 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
925 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
926 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
927 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
928 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
929 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
930 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
931 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
932 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
933 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
934 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
935 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
936 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
937 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
938 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
939 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
940 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
941 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
942 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
943 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
944 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
945 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
946 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
947 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
948 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
949 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
950 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
951 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
952 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
953 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
954 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
955 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
956 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
957 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
958 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
959 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
960 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
961 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
962 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
963 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
964 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
965 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
966 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
967 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
968 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
969 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
970 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
971 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
972 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
973 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
974 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
975 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
976 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
977 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
978 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
979 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
980 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
981 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
982 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
983 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
984 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
985 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
986 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
987 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
988 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
989 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
990 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
991 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
992 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
993 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
994 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
995 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
996 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
997 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
998 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
999 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1000 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
1001 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1002 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
1003 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
1004 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1005 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1006 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1007 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1008 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
1009 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1010 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
1011 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1012 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
1013 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1014 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1015 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1016 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1017 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1018 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1019 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1020 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1021 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1022 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1023 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1024 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1025 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1026 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1027 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1028 8005275841 Rhizobium sp. N4311 Isolate Nodule
1029 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1030 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1031 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1032 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1033 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1034 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1035 8005382845 Rhizobium sp. R634 Isolate Nodule
1036 8005395548 Rhizobium sp. R339 Isolate Nodule
1037 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1038 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1039 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1040 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1041 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1042 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1043 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1044 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1045 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1046 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1047 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1048 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1049 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1050 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1051 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1052 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1053 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1054 8018176218 Rhizobium sp. N122 Isolate Nodule
1055 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1056 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1057 8024501048 Rhizobium sp. H4 Isolate Nodule
1058 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
1059 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1060 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1061 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
1062 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1063 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1064 8056382006 Rhizobium croatiense 13T Isolate Nodule
1065 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.58
Metatranscriptomes 0
Isolates 45.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.71
Nodule 38.13
Rhizoplane 0.67
Rhizosphere 39.67
Stem 0
Stem Tuber 0.07
Unclassified 8.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000111 3300001979 Bacteria 29540
2 JGI25156J39149_1000675 3300002705 Bacteria 18418
3 JGI25162J39368_1000794 3300002737 Bacteria 21085
4 JGI25162J39368_1001832 3300002737 Bacteria 9928
5 JGI25158J39367_1000448 3300002739 Bacteria 8533
6 JGI25157J39369_1001106 3300002741 Bacteria 12030
7 JGI25152J39213_1002959 3300002773 Bacteria 6045
8 JGI25152J39213_1005931 3300002773 Bacteria 3437
9 JGI25159J45721_1000071 3300002987 Bacteria 48764
10 JGI25159J45721_1000191 3300002987 Bacteria 28445
11 JGI25159J45721_1008482 3300002987 Bacteria 2818
12 JGI25159J45721_1013545 3300002987 Bacteria 1881
13 JGI25151J46595_10000458 3300003187 Bacteria 39262
14 JGI25151J46595_10000508 3300003187 Bacteria 36520
15 JGI25151J46595_10001193 3300003187 Bacteria 18647
16 JGI25151J46595_10009780 3300003187 Bacteria 4515
17 JGI25165J46597_1000018 3300003214 Bacteria 374701
18 JGI25153J46596_10000042 3300003215 Bacteria 161788
19 JGI25153J46596_10000087 3300003215 Bacteria 111217
20 JGI25153J46596_10002535 3300003215 Bacteria 10466
21 JGI25153J46596_10009620 3300003215 Bacteria 4461
22 JGI25153J46596_10010647 3300003215 Bacteria 4140
23 JGI25153J46596_10014909 3300003215 Bacteria 3199
24 rootH1_10191308 3300003323 Bacteria 1612
25 JGI25160J50197_1000162 3300003354 Bacteria 57595
26 JGI25160J50197_1001578 3300003354 Bacteria 11244
27 JGI25160J50197_1003716 3300003354 Bacteria 6735
28 JGI25161J50226_1000075 3300003374 Bacteria 84775
29 JGI25161J50226_1006294 3300003374 Bacteria 2167
30 Ga0055538_1000054 3300003751 Bacteria 123566
31 Ga0055539_1000066 3300003752 Bacteria 136557
32 Ga0055533_1000076 3300003756 Bacteria 136557
33 Ga0055532_1000157 3300003758 Bacteria 59670
34 Ga0055525_1000098 3300003759 Bacteria 136557
35 Ga0055535_1006969 3300003761 Bacteria 2213
36 Ga0055529_1001031 3300003763 Bacteria 13246
37 Ga0055526_1001457 3300003771 Bacteria 16792
38 Ga0055526_1001852 3300003771 Bacteria 14644
39 Ga0055526_1004947 3300003771 Bacteria 7826
40 Ga0055526_1005597 3300003771 Bacteria 7157
41 Ga0055526_1006049 3300003771 Bacteria 6703
42 Ga0055526_1007227 3300003771 Bacteria 5828
43 Ga0055524_1001068 3300003775 Bacteria 16849
44 Ga0055524_1006553 3300003775 Bacteria 5036
45 Ga0055536_1000219 3300003781 Bacteria 46718
46 Ga0055536_1000667 3300003781 Bacteria 23117
47 Ga0055534_1002873 3300003784 Bacteria 5719
48 Ga0055534_1003753 3300003784 Bacteria 4678
49 Ga0055528_1000054 3300003790 Bacteria 90334
50 Ga0055528_1002349 3300003790 Bacteria 10235
51 Ga0055528_1009718 3300003790 Bacteria 3994
52 Ga0055528_1023104 3300003790 Bacteria 1910
53 Ga0055540_1000255 3300003792 Bacteria 48177
54 Ga0055540_1009900 3300003792 Bacteria 3228
55 Ga0055531_10000192 3300003794 Bacteria 67874
56 Ga0055531_10016286 3300003794 Bacteria 3216
57 Ga0055541_1000056 3300003841 Bacteria 123566
58 Ga0058692_1020804 3300003856 Bacteria 1372
59 Ga0055543_1000096 3300004625 Bacteria 75972
60 Ga0055543_1000578 3300004625 Bacteria 20193
61 Ga0055543_1001124 3300004625 Bacteria 11482
62 Ga0065165_1000535 3300005262 Bacteria 57606
63 Ga0065165_1007353 3300005262 Bacteria 5443
64 Ga0065165_1011236 3300005262 Bacteria 3763
65 Ga0065712_10009354 3300005290 Bacteria 2612
66 Ga0065715_10037650 3300005293 Bacteria 1256
67 Ga0065715_10097689 3300005293 Bacteria 3666
68 Ga0065715_10193679 3300005293 Bacteria 1400
69 Ga0070658_10158696 3300005327 Bacteria 1897
70 Ga0070683_100232746 3300005329 Bacteria 1752
71 Ga0070683_100252189 3300005329 Bacteria 1678
72 Ga0070690_100000104 3300005330 Bacteria 43588
73 Ga0070670_100000403 3300005331 Bacteria 35526
74 Ga0070670_100016185 3300005331 Bacteria 6401
75 Ga0070670_100168655 3300005331 Bacteria 1898
76 Ga0070670_100234155 3300005331 Bacteria 1598
77 Ga0070677_10002422 3300005333 Bacteria 5953
78 Ga0070677_10074465 3300005333 Bacteria 1436
79 Ga0068869_100000970 3300005334 Bacteria 16682
80 Ga0068869_100001111 3300005334 Bacteria 15680
81 Ga0070666_10116012 3300005335 Bacteria 1854
82 Ga0070666_10229207 3300005335 Bacteria 1312
83 Ga0070680_100009735 3300005336 Bacteria 7396
84 Ga0070680_100450075 3300005336 Bacteria 1100
85 Ga0070682_100069986 3300005337 Bacteria 2242
86 Ga0068868_100238094 3300005338 Bacteria 1528
87 Ga0068868_100295442 3300005338 Bacteria 1375
88 Ga0070660_100341222 3300005339 Bacteria 1233
89 Ga0070689_100010513 3300005340 Bacteria 6597
90 Ga0070691_10036418 3300005341 Bacteria 2319
91 Ga0070687_100172920 3300005343 Bacteria 1287
92 Ga0070661_100004818 3300005344 Bacteria 9289
93 Ga0070661_100133299 3300005344 Bacteria 1867
94 Ga0070692_10001690 3300005345 Bacteria 8182
95 Ga0070668_100029428 3300005347 Bacteria 4172
96 Ga0070669_100244746 3300005353 Bacteria 1426
97 Ga0070675_100015525 3300005354 Bacteria 6023
98 Ga0070671_100014895 3300005355 Bacteria 6282
99 Ga0070671_100065045 3300005355 Bacteria 3037
100 Ga0070671_100101194 3300005355 Bacteria 2418
101 Ga0070671_100169477 3300005355 Bacteria 1846
102 Ga0070674_100175461 3300005356 Bacteria 1637
103 Ga0070674_100193148 3300005356 Bacteria 1567
104 Ga0070673_100081833 3300005364 Bacteria 2619
105 Ga0070688_100017786 3300005365 Bacteria 4086
106 Ga0070667_100003805 3300005367 Bacteria 12830
107 Ga0070667_100208707 3300005367 Bacteria 1735
108 Ga0070667_100298841 3300005367 Bacteria 1449
109 Ga0070701_10000947 3300005438 Bacteria 10503
110 Ga0070701_10009247 3300005438 Bacteria 4309
111 Ga0070701_10013615 3300005438 Bacteria 3705
112 Ga0070705_100030887 3300005440 Bacteria 2961
113 Ga0070700_100001391 3300005441 Bacteria 12017
114 Ga0070700_100013467 3300005441 Bacteria 4594
115 Ga0070700_100040608 3300005441 Bacteria 2849
116 Ga0070663_100023155 3300005455 Bacteria 4160
117 Ga0070663_100071282 3300005455 Bacteria 2528
118 Ga0070663_100172481 3300005455 Bacteria 1673
119 Ga0070678_100013439 3300005456 Bacteria 5133
120 Ga0070678_100039073 3300005456 Bacteria 3345
121 Ga0070678_100067388 3300005456 Bacteria 2664
122 Ga0070678_100176079 3300005456 Bacteria 1747
123 Ga0070678_100185348 3300005456 Bacteria 1707
124 Ga0070662_100004864 3300005457 Bacteria 8520
125 Ga0070681_10397484 3300005458 Bacteria 1289
126 Ga0070706_100196043 3300005467 Bacteria 1887
127 Ga0070698_100379075 3300005471 Bacteria 1347
128 Ga0070679_100002199 3300005530 Bacteria 17619
129 Ga0068853_100020351 3300005539 Bacteria 5518
130 Ga0068853_100095778 3300005539 Bacteria 2618
131 Ga0068853_100369417 3300005539 Bacteria 1338
132 Ga0070672_100001817 3300005543 Bacteria 13320
133 Ga0070686_100001046 3300005544 Bacteria 15928
134 Ga0070695_100005269 3300005545 Bacteria 7612
135 Ga0070693_100014082 3300005547 Bacteria 4088
136 Ga0070693_100035112 3300005547 Bacteria 2778
137 Ga0070665_100013700 3300005548 Bacteria 8159
138 Ga0070665_100030832 3300005548 Bacteria 5396
139 Ga0070665_100069602 3300005548 Bacteria 3527
140 Ga0070665_100230392 3300005548 Bacteria 1852
141 Ga0070704_100074861 3300005549 Bacteria 2471
142 Ga0070704_100528500 3300005549 Bacteria 1028
143 Ga0068855_100000791 3300005563 Bacteria 39102
144 Ga0068855_100007145 3300005563 Bacteria 13553
145 Ga0068855_100106657 3300005563 Bacteria 3219
146 Ga0070664_100004354 3300005564 Bacteria 11375
147 Ga0070664_100020289 3300005564 Bacteria 5471
148 Ga0070664_100062640 3300005564 Bacteria 3171
149 Ga0068857_100000949 3300005577 Bacteria 22107
150 Ga0068857_100097381 3300005577 Bacteria 2637
151 Ga0068857_100290409 3300005577 Bacteria 1505
152 Ga0068857_100543437 3300005577 Bacteria 1094
153 Ga0068854_100001709 3300005578 Bacteria 13372
154 Ga0068854_100035336 3300005578 Bacteria 3496
155 Ga0068854_100146515 3300005578 Bacteria 1817
156 Ga0068854_100162153 3300005578 Bacteria 1733
157 Ga0068856_100002246 3300005614 Bacteria 19947
158 Ga0068856_100041781 3300005614 Bacteria 4508
159 Ga0070702_100000641 3300005615 Bacteria 12981
160 Ga0070702_100007399 3300005615 Bacteria 5256
161 Ga0068852_100006348 3300005616 Bacteria 8534
162 Ga0068852_100018994 3300005616 Bacteria 5429
163 Ga0068852_100048697 3300005616 Bacteria 3622
164 Ga0068859_100000096 3300005617 Bacteria 81199
165 Ga0068859_100082410 3300005617 Bacteria 3259
166 Ga0068864_100006259 3300005618 Bacteria 9762
167 Ga0068864_100092466 3300005618 Bacteria 2670
168 Ga0068864_100589867 3300005618 Bacteria 1077
169 Ga0068866_10003238 3300005718 Bacteria 6706
170 Ga0068866_10134408 3300005718 Bacteria 1411
171 Ga0068866_10196355 3300005718 Bacteria 1202
172 Ga0068861_100008612 3300005719 Bacteria 7015
173 Ga0068851_10016960 3300005834 Bacteria 3491
174 Ga0068870_10010548 3300005840 Bacteria 4251
175 Ga0068870_10081068 3300005840 Bacteria 1794
176 Ga0068863_100052015 3300005841 Bacteria 3882
177 Ga0068863_100249931 3300005841 Bacteria 1713
178 Ga0068858_100000679 3300005842 Bacteria 35449
179 Ga0068858_100002939 3300005842 Bacteria 17148
180 Ga0068860_100000990 3300005843 Bacteria 31411
181 Ga0068860_100033901 3300005843 Bacteria 4898
182 Ga0068860_100114734 3300005843 Bacteria 2576
183 Ga0068862_100004384 3300005844 Bacteria 11933
184 Ga0068862_100010857 3300005844 Bacteria 7520
185 Ga0068862_100131143 3300005844 Bacteria 2217
186 Ga0081455_10232284 3300005937 Bacteria 1360
187 Ga0081455_10241886 3300005937 Bacteria 1326
188 Ga0081538_10036106 3300005981 Bacteria 3232
189 Ga0081538_10112765 3300005981 Bacteria 1330
190 Ga0081539_10064645 3300005985 Bacteria 1990
191 Ga0075365_10013860 3300006038 Bacteria 4835
192 Ga0075365_10016988 3300006038 Bacteria 4443
193 Ga0075365_10111174 3300006038 Bacteria 1883
194 Ga0075363_100053961 3300006048 Bacteria 2149
195 Ga0075363_100156153 3300006048 Bacteria 1290
196 Ga0075432_10016468 3300006058 Bacteria 2523
197 Ga0075362_10006876 3300006177 Bacteria 4262
198 Ga0075367_10048271 3300006178 Bacteria 2507
199 Ga0075369_10002677 3300006186 Bacteria 6381
200 Ga0075369_10039559 3300006186 Bacteria 2014
201 Ga0075366_10021996 3300006195 Bacteria 3707
202 Ga0075366_10023241 3300006195 Bacteria 3611
203 Ga0075366_10052539 3300006195 Bacteria 2421
204 Ga0075366_10119205 3300006195 Bacteria 1590
205 Ga0075366_10193510 3300006195 Bacteria 1236
206 Ga0097621_100017693 3300006237 Bacteria 5421
207 Ga0097621_100103634 3300006237 Bacteria 2397
208 Ga0075370_10009575 3300006353 Bacteria 5038
209 Ga0075370_10014589 3300006353 Bacteria 4194
210 Ga0075370_10045211 3300006353 Bacteria 2490
211 Ga0075370_10138890 3300006353 Bacteria 1420
212 Ga0068871_100006781 3300006358 Bacteria 8138
213 Ga0075430_100057231 3300006846 Bacteria 3280
214 Ga0075431_100014362 3300006847 Bacteria 8009
215 Ga0075431_100015726 3300006847 Bacteria 7672
216 Ga0075431_100219742 3300006847 Bacteria 1938
217 Ga0075433_10129370 3300006852 Bacteria 2243
218 Ga0068865_100029089 3300006881 Bacteria 3662
219 Ga0068865_100044124 3300006881 Bacteria 3050
220 Ga0097620_100000096 3300006931 Bacteria 81199
221 Ga0097620_100082414 3300006931 Bacteria 3259
222 Ga0079104_1004787 3300006946 Bacteria 5640
223 Ga0079104_1006482 3300006946 Bacteria 4418
224 Ga0079104_1006593 3300006946 Bacteria 4357
225 Ga0099826_10179734 3300006948 Bacteria 1179
226 Ga0099794_10016591 3300007265 Bacteria 3268
227 Ga0105251_10025196 3300009011 Bacteria 3047
228 Ga0105240_10002015 3300009093 Bacteria 33500
229 Ga0105240_10009479 3300009093 Bacteria 13784
230 Ga0105240_10015015 3300009093 Bacteria 10546
231 Ga0105240_10044364 3300009093 Bacteria 5650
232 Ga0105240_10151407 3300009093 Bacteria 2762
233 Ga0105240_10164525 3300009093 Bacteria 2632
234 Ga0111539_10000285 3300009094 Bacteria 60808
235 Ga0111539_10016103 3300009094 Bacteria 9277
236 Ga0111539_10104109 3300009094 Bacteria 3330
237 Ga0105245_10004092 3300009098 Bacteria 12945
238 Ga0105245_10117457 3300009098 Bacteria 2481
239 Ga0105247_10005387 3300009101 Bacteria 8061
240 Ga0114129_10002208 3300009147 Bacteria 26833
241 Ga0114129_10604603 3300009147 Bacteria 1420
242 Ga0105243_10035348 3300009148 Bacteria 3873
243 Ga0105243_10051108 3300009148 Bacteria 3268
244 Ga0105243_10131794 3300009148 Bacteria 2121
245 Ga0105241_10170531 3300009174 Bacteria 1797
246 Ga0105242_10008454 3300009176 Bacteria 7909
247 Ga0105242_10010144 3300009176 Bacteria 7216
248 Ga0105242_10222304 3300009176 Bacteria 1688
249 Ga0105248_10022473 3300009177 Bacteria 6995
250 Ga0105248_10135127 3300009177 Bacteria 2782
251 Ga0105237_10031873 3300009545 Bacteria 5338
252 Ga0105237_10111587 3300009545 Bacteria 2726
253 Ga0105237_10264298 3300009545 Bacteria 1724
254 Ga0105237_10332075 3300009545 Bacteria 1525
255 Ga0105238_10000632 3300009551 Bacteria 37034
256 Ga0105238_10006338 3300009551 Bacteria 11764
257 Ga0105238_10007883 3300009551 Bacteria 10653
258 Ga0105249_10575860 3300009553 Bacteria 1179
259 Ga0123341_1000012 3300009765 Bacteria 105056
260 Ga0123341_1077652 3300009765 Bacteria 1344
261 Ga0123342_1021599 3300009766 Bacteria 4496
262 Ga0105239_10058642 3300010375 Bacteria 4224
263 Ga0105239_10101033 3300010375 Bacteria 3190
264 Ga0105239_10112133 3300010375 Bacteria 3024
265 Ga0105239_10661471 3300010375 Bacteria 1193
266 Ga0105246_10221040 3300011119 Bacteria 1485
267 Ga0105246_10297245 3300011119 Bacteria 1302
268 Ga0157371_10117900 3300013102 Bacteria 1887
269 Ga0157370_10149843 3300013104 Bacteria 2171
270 Ga0157370_10382074 3300013104 Bacteria 1297
271 Ga0157369_10008064 3300013105 Bacteria 12076
272 Ga0157374_10359312 3300013296 Bacteria 1448
273 Ga0157378_10003424 3300013297 Bacteria 14077
274 Ga0157378_10025128 3300013297 Bacteria 5248
275 Ga0157378_10227349 3300013297 Bacteria 1776
276 Ga0157375_10123740 3300013308 Bacteria 2699
277 Ga0157375_10210215 3300013308 Bacteria 2103
278 Ga0157375_10296110 3300013308 Bacteria 1781
279 Ga0163163_10011828 3300014325 Bacteria 7935
280 Ga0163163_10116193 3300014325 Bacteria 2707
281 Ga0163163_10712870 3300014325 Bacteria 1067
282 Ga0157380_10003649 3300014326 Bacteria 10586
283 Ga0157380_10007607 3300014326 Bacteria 7700
284 Ga0157380_10074057 3300014326 Bacteria 2763
285 Ga0157379_10003873 3300014968 Bacteria 12755
286 Ga0157379_10073386 3300014968 Bacteria 3063
287 Ga0157379_10075283 3300014968 Bacteria 3022
288 Ga0157379_10106342 3300014968 Bacteria 2519
289 Ga0182006_1005634 3300015261 Bacteria 5941
290 Ga0182005_1006788 3300015265 Bacteria 3469
291 Ga0163161_10093925 3300017792 Bacteria 2223
292 Ga0214544_1001716 3300021320 Bacteria 46024
293 Ga0214542_1000082 3300021321 Bacteria 120825
294 Ga0214543_1000005 3300021327 Bacteria 454523
295 Ga0214543_1000075 3300021327 Bacteria 120861
296 Ga0213872_10040241 3300021361 Bacteria 2134
297 Ga0213874_10027685 3300021377 Bacteria 1614
298 Ga0228711_1000045 3300022739 Bacteria 85435
299 Ga0228710_1000036 3300022740 Bacteria 91904
300 Ga0209435_100085 3300025206 Bacteria 45218
301 Ga0209435_100486 3300025206 Bacteria 7854
302 Ga0209436_100035 3300025208 Bacteria 79010
303 Ga0209784_100002 3300025224 Bacteria 1753105
304 Ga0209566_100003 3300025225 Bacteria 1753105
305 Ga0209674_100004 3300025226 Bacteria 1753105
306 Ga0209147_100217 3300025229 Bacteria 59789
307 Ga0209563_100006 3300025230 Bacteria 1753105
308 Ga0209437_100022 3300025233 Bacteria 625694
309 Ga0209437_100432 3300025233 Bacteria 36626
310 Ga0209258_100390 3300025242 Bacteria 55905
311 Ga0209258_102714 3300025242 Bacteria 4309
312 Ga0207425_1000448 3300025245 Bacteria 26903
313 Ga0207425_1002132 3300025245 Bacteria 7266
314 Ga0209646_1000204 3300025246 Bacteria 69552
315 Ga0209646_1000227 3300025246 Bacteria 59789
316 Ga0209026_1000340 3300025250 Bacteria 45211
317 Ga0209677_100003 3300025253 Bacteria 1753105
318 Ga0209759_1000298 3300025256 Bacteria 68472
319 Ga0209759_1000561 3300025256 Bacteria 37637
320 Ga0209129_1000124 3300025258 Bacteria 133610
321 Ga0209129_1003154 3300025258 Bacteria 7387
322 Ga0209233_1000031 3300025261 Bacteria 624646
323 Ga0209565_1000021 3300025263 Bacteria 406281
324 Ga0209565_1006164 3300025263 Bacteria 3396
325 Ga0209455_1000841 3300025272 Bacteria 16532
326 Ga0209673_1000067 3300025273 Bacteria 249077
327 Ga0209673_1000750 3300025273 Bacteria 44330
328 Ga0209673_1001376 3300025273 Bacteria 23910
329 Ga0209673_1004094 3300025273 Bacteria 8025
330 Ga0209673_1004568 3300025273 Bacteria 7350
331 Ga0209673_1009563 3300025273 Bacteria 4178
332 Ga0209673_1014607 3300025273 Bacteria 3030
333 Ga0209130_1000031 3300025284 Bacteria 322932
334 Ga0209130_1000147 3300025284 Bacteria 109796
335 Ga0209130_1000467 3300025284 Bacteria 41801
336 Ga0209130_1005106 3300025284 Bacteria 4677
337 Ga0209130_1015385 3300025284 Bacteria 1887
338 Ga0209675_1000040 3300025291 Bacteria 247535
339 Ga0209675_1001148 3300025291 Bacteria 16132
340 Ga0209675_1003321 3300025291 Bacteria 7730
341 Ga0209676_1000014 3300025292 Bacteria 793514
342 Ga0209676_1001620 3300025292 Bacteria 19915
343 Ga0209676_1006751 3300025292 Bacteria 5580
344 Ga0209676_1011806 3300025292 Bacteria 3488
345 Ga0209025_1000092 3300025294 Bacteria 247020
346 Ga0209025_1000099 3300025294 Bacteria 231353
347 Ga0209025_1000240 3300025294 Bacteria 128397
348 Ga0209025_1000397 3300025294 Bacteria 89703
349 Ga0209025_1008454 3300025294 Bacteria 7407
350 Ga0209025_1040334 3300025294 Bacteria 2021
351 Ga0209025_1049135 3300025294 Bacteria 1702
352 Ga0209564_1000057 3300025295 Bacteria 340400
353 Ga0209564_1000092 3300025295 Bacteria 249018
354 Ga0209564_1000159 3300025295 Bacteria 164319
355 Ga0209564_1000218 3300025295 Bacteria 130563
356 Ga0209564_1000452 3300025295 Bacteria 69505
357 Ga0209564_1000511 3300025295 Bacteria 63773
358 Ga0209564_1000925 3300025295 Bacteria 38190
359 Ga0209564_1001127 3300025295 Bacteria 31429
360 Ga0209758_1000110 3300025297 Bacteria 213110
361 Ga0209758_1000214 3300025297 Bacteria 126364
362 Ga0209758_1000232 3300025297 Bacteria 117382
363 Ga0209758_1000504 3300025297 Bacteria 63308
364 Ga0209758_1000585 3300025297 Bacteria 56861
365 Ga0209758_1001602 3300025297 Bacteria 25857
366 Ga0209758_1005532 3300025297 Bacteria 9647
367 Ga0209758_1030022 3300025297 Bacteria 2259
368 Ga0209758_1034835 3300025297 Bacteria 1995
369 Ga0209758_1050320 3300025297 Bacteria 1462
370 Ga0209050_1003004 3300025298 Bacteria 13099
371 Ga0209050_1004942 3300025298 Bacteria 8693
372 Ga0209050_1021600 3300025298 Bacteria 2339
373 Ga0209050_1023735 3300025298 Bacteria 2146
374 Ga0209256_1000170 3300025299 Bacteria 130504
375 Ga0209256_1001569 3300025299 Bacteria 22476
376 Ga0209256_1003336 3300025299 Bacteria 11391
377 Ga0209256_1004342 3300025299 Bacteria 8997
378 Ga0209256_1007078 3300025299 Bacteria 5669
379 Ga0209256_1015056 3300025299 Bacteria 2732
380 Ga0207426_1000042 3300025302 Bacteria 433289
381 Ga0207426_1000065 3300025302 Bacteria 353625
382 Ga0207426_1000267 3300025302 Bacteria 109797
383 Ga0207426_1000355 3300025302 Bacteria 83450
384 Ga0209051_1000062 3300025303 Bacteria 251081
385 Ga0209051_1000281 3300025303 Bacteria 83196
386 Ga0209051_1004860 3300025303 Bacteria 8071
387 Ga0209051_1009790 3300025303 Bacteria 4909
388 Ga0209051_1039794 3300025303 Bacteria 1693
389 Ga0209257_1000039 3300025304 Bacteria 591694
390 Ga0209257_1000376 3300025304 Bacteria 89065
391 Ga0209257_1000970 3300025304 Bacteria 39244
392 Ga0209257_1002116 3300025304 Bacteria 20743
393 Ga0209257_1007196 3300025304 Bacteria 6828
394 Ga0209257_1049783 3300025304 Bacteria 1190
395 Ga0207697_10009556 3300025315 Bacteria 4185
396 Ga0207656_10036968 3300025321 Bacteria 2051
397 Ga0207682_10001129 3300025893 Bacteria 12342
398 Ga0207682_10001921 3300025893 Bacteria 9445
399 Ga0207642_10000792 3300025899 Bacteria 9809
400 Ga0207642_10138412 3300025899 Bacteria 1280
401 Ga0207710_10014855 3300025900 Bacteria 3288
402 Ga0207680_10034211 3300025903 Bacteria 2906
403 Ga0207647_10195773 3300025904 Bacteria 1170
404 Ga0207645_10002683 3300025907 Bacteria 13861
405 Ga0207643_10000796 3300025908 Bacteria 19199
406 Ga0207643_10012951 3300025908 Bacteria 4510
407 Ga0207684_10106293 3300025910 Bacteria 2401
408 Ga0207695_10001105 3300025913 Bacteria 46872
409 Ga0207695_10001995 3300025913 Bacteria 31509
410 Ga0207695_10018728 3300025913 Bacteria 7993
411 Ga0207695_10049214 3300025913 Bacteria 4445
412 Ga0207695_10134260 3300025913 Bacteria 2429
413 Ga0207671_10065756 3300025914 Bacteria 2697
414 Ga0207660_10010630 3300025917 Bacteria 5980
415 Ga0207662_10151178 3300025918 Bacteria 1476
416 Ga0207662_10216086 3300025918 Bacteria 1246
417 Ga0207649_10013416 3300025920 Bacteria 4575
418 Ga0207649_10112774 3300025920 Bacteria 1820
419 Ga0207681_10102095 3300025923 Bacteria 2070
420 Ga0207681_10172367 3300025923 Bacteria 1641
421 Ga0207694_10000171 3300025924 Bacteria 66876
422 Ga0207694_10040036 3300025924 Bacteria 3608
423 Ga0207694_10162317 3300025924 Bacteria 1805
424 Ga0207650_10000408 3300025925 Bacteria 38515
425 Ga0207650_10075606 3300025925 Bacteria 2542
426 Ga0207650_10382634 3300025925 Bacteria 1162
427 Ga0207659_10000256 3300025926 Bacteria 32624
428 Ga0207659_10047076 3300025926 Bacteria 3049
429 Ga0207659_10047482 3300025926 Bacteria 3037
430 Ga0207687_10003861 3300025927 Bacteria 10059
431 Ga0207644_10061939 3300025931 Bacteria 2711
432 Ga0207644_10135086 3300025931 Bacteria 1893
433 Ga0207690_10008231 3300025932 Bacteria 6185
434 Ga0207690_10208126 3300025932 Bacteria 1490
435 Ga0207706_10011643 3300025933 Bacteria 8017
436 Ga0207686_10001479 3300025934 Bacteria 13268
437 Ga0207686_10136773 3300025934 Bacteria 1688
438 Ga0207686_10149679 3300025934 Bacteria 1623
439 Ga0207709_10007010 3300025935 Bacteria 6301
440 Ga0207709_10071435 3300025935 Bacteria 2204
441 Ga0207709_10079160 3300025935 Bacteria 2112
442 Ga0207709_10277474 3300025935 Bacteria 1236
443 Ga0207670_10003899 3300025936 Bacteria 7960
444 Ga0207669_10019594 3300025937 Bacteria 3527
445 Ga0207669_10164210 3300025937 Bacteria 1572
446 Ga0207704_10236774 3300025938 Bacteria 1361
447 Ga0207691_10000360 3300025940 Bacteria 45895
448 Ga0207711_10008363 3300025941 Bacteria 8658
449 Ga0207689_10000392 3300025942 Bacteria 41178
450 Ga0207689_10001083 3300025942 Bacteria 26263
451 Ga0207689_10003617 3300025942 Bacteria 14127
452 Ga0207661_10187473 3300025944 Bacteria 1812
453 Ga0207679_10088713 3300025945 Bacteria 2385
454 Ga0207679_10143879 3300025945 Bacteria 1931
455 Ga0207667_10000191 3300025949 Bacteria 89641
456 Ga0207667_10003921 3300025949 Bacteria 18305
457 Ga0207667_10020526 3300025949 Bacteria 7343
458 Ga0207667_10041636 3300025949 Bacteria 4884
459 Ga0207667_10048606 3300025949 Bacteria 4485
460 Ga0207667_10316662 3300025949 Bacteria 1593
461 Ga0207651_10002638 3300025960 Bacteria 8571
462 Ga0207651_10008778 3300025960 Bacteria 5484
463 Ga0207651_10013533 3300025960 Bacteria 4672
464 Ga0207668_10040301 3300025972 Bacteria 3150
465 Ga0207668_10077168 3300025972 Bacteria 2401
466 Ga0207640_10024716 3300025981 Bacteria 3629
467 Ga0207640_10070453 3300025981 Bacteria 2352
468 Ga0207640_10233545 3300025981 Bacteria 1416
469 Ga0207658_10006579 3300025986 Bacteria 7921
470 Ga0207677_10151862 3300026023 Bacteria 1788
471 Ga0207677_10394827 3300026023 Bacteria 1171
472 Ga0207703_10000206 3300026035 Bacteria 68955
473 Ga0207703_10008734 3300026035 Bacteria 7997
474 Ga0207639_10014797 3300026041 Bacteria 5495
475 Ga0207639_10016794 3300026041 Bacteria 5186
476 Ga0207678_10041294 3300026067 Bacteria 4000
477 Ga0207678_10065216 3300026067 Bacteria 3128
478 Ga0207708_10002193 3300026075 Bacteria 14415
479 Ga0207708_10004853 3300026075 Bacteria 9910
480 Ga0207708_10058747 3300026075 Bacteria 2934
481 Ga0207702_10008513 3300026078 Bacteria 8649
482 Ga0207641_10018478 3300026088 Bacteria 5716
483 Ga0207648_10003800 3300026089 Bacteria 15788
484 Ga0207648_10003985 3300026089 Bacteria 15326
485 Ga0207648_10006481 3300026089 Bacteria 11625
486 Ga0207648_10014008 3300026089 Bacteria 7429
487 Ga0207648_10021649 3300026089 Bacteria 5776
488 Ga0207648_10103380 3300026089 Bacteria 2498
489 Ga0207676_10004246 3300026095 Bacteria 10121
490 Ga0207676_10357518 3300026095 Bacteria 1352
491 Ga0207674_10005154 3300026116 Bacteria 15575
492 Ga0207674_10011720 3300026116 Bacteria 9839
493 Ga0207674_10257878 3300026116 Bacteria 1691
494 Ga0207674_10371125 3300026116 Bacteria 1383
495 Ga0207675_100001654 3300026118 Bacteria 22285
496 Ga0207675_100003993 3300026118 Bacteria 14308
497 Ga0207675_100004949 3300026118 Bacteria 12840
498 Ga0207675_100270391 3300026118 Bacteria 1649
499 Ga0207683_10003821 3300026121 Bacteria 13050
500 Ga0207683_10016849 3300026121 Bacteria 6217
501 Ga0207683_10027137 3300026121 Bacteria 4949
502 Ga0207698_10057249 3300026142 Bacteria 3015
503 Ga0207698_10086278 3300026142 Bacteria 2552
504 Ga0209281_1000178 3300027111 Bacteria 148152
505 Ga0209281_1000417 3300027111 Bacteria 64228
506 Ga0209281_1006414 3300027111 Bacteria 3073
507 Ga0209371_1004784 3300027312 Bacteria 5704
508 Ga0209983_1004868 3300027665 Bacteria 2804
509 Ga0209282_1000023 3300027666 Bacteria 173309
510 Ga0209974_10006207 3300027876 Bacteria 4183
511 Ga0207428_10000339 3300027907 Bacteria 60728
512 Ga0207428_10074571 3300027907 Bacteria 2661
513 Ga0207428_10076537 3300027907 Bacteria 2620
514 Ga0268265_10028054 3300028380 Bacteria 4027
515 Ga0268265_10035938 3300028380 Bacteria 3625
516 Ga0268265_10055740 3300028380 Bacteria 3004
517 Ga0268265_10083585 3300028380 Bacteria 2528
518 Ga0268265_10317874 3300028380 Bacteria 1409
519 Ga0268264_10000570 3300028381 Bacteria 44804
520 Ga0268264_10025112 3300028381 Bacteria 4868
521 Ga0265319_1000177 3300028563 Bacteria 48363
522 Ga0265318_10000258 3300028577 Bacteria 46107
523 Ga0307517_10006989 3300028786 Bacteria 16571
524 Ga0307515_10000145 3300028794 Bacteria 170814
525 Ga0307515_10006043 3300028794 Bacteria 24341
526 Ga0307515_10024560 3300028794 Bacteria 10497
527 Ga0268256_1004561 3300030500 Bacteria 5704
528 Ga0307512_10111845 3300030522 Bacteria 1795
529 Ga0265330_10000359 3300031235 Bacteria 32172
530 Ga0265332_10000138 3300031238 Bacteria 60108
531 Ga0265328_10032042 3300031239 Bacteria 1952
532 Ga0265320_10000284 3300031240 Bacteria 40965
533 Ga0265325_10081223 3300031241 Bacteria 1611
534 Ga0265329_10000076 3300031242 Bacteria 44517
535 Ga0265340_10000688 3300031247 Bacteria 18993
536 Ga0265339_10082625 3300031249 Bacteria 1695
537 Ga0265331_10001134 3300031250 Bacteria 20335
538 Ga0265327_10026162 3300031251 Bacteria 3385
539 Ga0265316_10000843 3300031344 Bacteria 33894
540 Ga0307513_10023595 3300031456 Bacteria 7183
541 Ga0307513_10028483 3300031456 Bacteria 6386
542 Ga0307509_10005306 3300031507 Bacteria 18025
543 Ga0307509_10139564 3300031507 Bacteria 2362
544 Ga0307408_100041302 3300031548 Bacteria 3270
545 Ga0307408_100065328 3300031548 Bacteria 2668
546 Ga0307408_100217199 3300031548 Bacteria 1558
547 Ga0265313_10000089 3300031595 Bacteria 90452
548 Ga0265314_10000211 3300031711 Bacteria 86370
549 Ga0265342_10000390 3300031712 Bacteria 48465
550 Ga0316578_10129310 3300031728 Bacteria 1519
551 Ga0307516_10008188 3300031730 Bacteria 11874
552 Ga0307516_10058949 3300031730 Bacteria 3735
553 Ga0307516_10115698 3300031730 Bacteria 2478
554 Ga0307516_10138472 3300031730 Bacteria 2206
555 Ga0307516_10143542 3300031730 Bacteria 2154
556 Ga0307516_10307254 3300031730 Bacteria 1260
557 Ga0307405_10105597 3300031731 Bacteria 1898
558 Ga0307413_10093966 3300031824 Bacteria 1962
559 Ga0307410_10000433 3300031852 Bacteria 16724
560 Ga0307410_10051802 3300031852 Bacteria 2769
561 Ga0307410_10126557 3300031852 Bacteria 1871
562 Ga0307410_10414393 3300031852 Bacteria 1091
563 Ga0307406_10158956 3300031901 Bacteria 1622
564 Ga0307407_10000903 3300031903 Bacteria 10021
565 Ga0307407_10161473 3300031903 Bacteria 1467
566 Ga0307412_10011920 3300031911 Bacteria 5048
567 Ga0315914_1000016 3300031967 Bacteria 126814
568 Ga0307409_100063242 3300031995 Bacteria 2901
569 Ga0307409_100376629 3300031995 Bacteria 1348
570 Ga0307409_100509822 3300031995 Bacteria 1173
571 Ga0307416_100007289 3300032002 Bacteria 7013
572 Ga0307416_100141755 3300032002 Bacteria 2186
573 Ga0307416_100353900 3300032002 Bacteria 1487
574 Ga0307414_10014216 3300032004 Bacteria 4763
575 Ga0307414_10107416 3300032004 Bacteria 2115
576 Ga0307411_10015181 3300032005 Bacteria 4317
577 Ga0307411_10017969 3300032005 Bacteria 4046
578 Ga0307411_10031050 3300032005 Bacteria 3282
579 Ga0307415_100004225 3300032126 Bacteria 7420
580 Ga0307415_100062302 3300032126 Bacteria 2586
581 Ga0307507_10026219 3300033179 Bacteria 6291
582 Ga0307507_10047478 3300033179 Bacteria 4193
583 Ga0307510_10015777 3300033180 Bacteria 8931
584 Ga0307510_10092443 3300033180 Bacteria 2861
585 Ga0315913_1000027 3300033430 Bacteria 83484
586 Ga0315915_1000007 3300033464 Bacteria 319225
587 Ga0373924_0112174 3300035410 Bacteria 1179
588 Ga0395898_0161500 3300037466 Bacteria 2143
589 Ga0395898_0167942 3300037466 Bacteria 2098
590 Ga0395905_0000377 3300037471 Bacteria 63595
591 Ga0395905_0014555 3300037471 Bacteria 7504
592 Ga0395905_0036652 3300037471 Bacteria 4607
593 Ga0436364_0295982 3300037853 Bacteria 987
594 Ga0436364_0780289 3300037853 Bacteria 1200
595 Ga0436364_1376234 3300037853 Bacteria 1180
596 Ga0395901_0187809 3300038443 Bacteria 2167
597 Ga0395901_0269656 3300038443 Bacteria 1771
598 Ga0395901_0591232 3300038443 Bacteria 1120
599 Ga0436360_0865156 3300039438 Bacteria 2755
600 Ga0436361_0069918 3300039447 Bacteria 1571
601 Ga0436361_0532183 3300039447 Bacteria 5597
602 Ga0436361_0589976 3300039447 Bacteria 1149
603 Ga0436361_1085109 3300039447 Bacteria 7859
604 Ga0436363_0629987 3300039450 Bacteria 5406
605 Ga0436362_0758258 3300039453 Bacteria 2532
606 Ga0451843_0757209 3300041509 Bacteria 1426
607 Ga0451853_2198736 3300041512 Bacteria 5299
608 Ga0451853_2516453 3300041512 Bacteria 1128
609 Ga0439431_0005666 3300041997 Bacteria 2755
610 Ga0439445_0025023 3300042004 Bacteria 1521
611 Ga0450911_000152 3300042115 Bacteria 27922
612 Ga0451577_0016723 3300042876 Bacteria 6783
613 Ga0466969_0071730 3300044656 Bacteria 1665
614 Ga0466960_0066206 3300044901 Bacteria 1786
615 Ga0451576_0007753 3300045051 Bacteria 12749
616 Ga0466958_0082323 3300045836 Bacteria 1982
617 Ga0466967_0144164 3300045976 Bacteria 2221
618 Ga0495592_0000142 3300046454 Bacteria 63571
619 Ga0495638_0000475 3300046460 Bacteria 48300
620 Ga0495638_0053901 3300046460 Bacteria 2502
621 Ga0495610_0012550 3300046512 Bacteria 5091
622 Ga0495610_0032117 3300046512 Bacteria 2732
623 Ga0495620_0045866 3300046515 Bacteria 1890
624 Ga0495632_0008357 3300046519 Bacteria 6363
625 Ga0495643_0059573 3300046522 Bacteria 2029
626 Ga0495642_0040094 3300046528 Bacteria 1901
627 Ga0495621_0022362 3300046539 Bacteria 2095
628 Ga0495597_0018419 3300046542 Bacteria 3277
629 Ga0495625_0014315 3300046660 Bacteria 6337
630 Ga0495625_0035602 3300046660 Bacteria 3668
631 Ga0495625_0240517 3300046660 Bacteria 1179
632 Ga0495661_0113359 3300046665 Bacteria 1508
633 Ga0495670_0080575 3300046691 Bacteria 1658
634 Ga0495649_0006612 3300046694 Bacteria 7204
635 Ga0495660_0026540 3300046810 Bacteria 3283
636 Ga0495660_0156147 3300046810 Bacteria 1123
637 Ga0495604_0104577 3300047317 Bacteria 2074
638 Ga0495687_018568 3300047443 Bacteria 3435
639 Ga0495687_018940 3300047443 Bacteria 3389
640 Ga0495687_033923 3300047443 Bacteria 2311
641 Ga0495686_0038269 3300047472 Bacteria 3068
642 Ga0496100_0194589 3300048903 Bacteria 1474
643 Ga0496102_0041195 3300048905 Bacteria 4181
644 Ga0496102_0148052 3300048905 Bacteria 2205
645 Ga0496109_0144804 3300048912 Bacteria 2222
646 Ga0496111_0112707 3300048914 Bacteria 2004
647 Ga0496115_0131086 3300048918 Bacteria 2066
648 Ga0496116_0009436 3300048919 Bacteria 8312
649 Ga0496116_0014781 3300048919 Bacteria 6209
650 Ga0496118_0002068 3300048921 Bacteria 28261
651 Ga0496119_0008868 3300048922 Bacteria 8749
652 Ga0496121_0000239 3300048924 Bacteria 118051
653 Ga0496122_0010146 3300048925 Bacteria 9761
654 Ga0496122_0023409 3300048925 Bacteria 5447
655 Ga0496123_0000433 3300048926 Bacteria 75427
656 Ga0496123_0045546 3300048926 Bacteria 2987
657 Ga0496123_0155976 3300048926 Bacteria 1224
658 Ga0496124_0073085 3300048927 Bacteria 2838
659 Ga0496125_0000145 3300048928 Bacteria 156267
660 Ga0496125_0000471 3300048928 Bacteria 71765
661 Ga0496125_0007428 3300048928 Bacteria 11659
662 Ga0496125_0010847 3300048928 Bacteria 9172
663 Ga0501031_0013786 3300049568 Bacteria 5269
664 Ga0501032_0002871 3300049569 Bacteria 13397
665 Ga0501032_0167929 3300049569 Bacteria 1439
666 Ga0501032_0180722 3300049569 Bacteria 1381
667 Ga0501033_0002505 3300049570 Bacteria 15563
668 Ga0501033_0010498 3300049570 Bacteria 7103
669 Ga0501033_0050127 3300049570 Bacteria 3098
670 Ga0501033_0101516 3300049570 Bacteria 2098
671 Ga0501033_0236793 3300049570 Bacteria 1295
672 Ga0501034_0031160 3300049571 Bacteria 5419
673 Ga0501034_0055207 3300049571 Bacteria 3998
674 Ga0501034_0225363 3300049571 Bacteria 1825
675 Ga0501034_0332749 3300049571 Bacteria 1450
676 Ga0501036_0012812 3300049572 Bacteria 6957
677 Ga0501036_0173751 3300049572 Bacteria 1815
678 Ga0501037_0000107 3300049573 Bacteria 78666
679 Ga0501037_0033589 3300049573 Bacteria 3788
680 Ga0501037_0102109 3300049573 Bacteria 2069
681 Ga0501037_0144077 3300049573 Bacteria 1704
682 Ga0501037_0201802 3300049573 Bacteria 1405
683 Ga0501038_0027545 3300049574 Bacteria 5056
684 Ga0501038_0098912 3300049574 Bacteria 2432
685 Ga0501038_0236680 3300049574 Bacteria 1451
686 Ga0501039_0201010 3300049575 Bacteria 1567
687 Ga0501039_0245138 3300049575 Bacteria 1409
688 Ga0501042_0178491 3300049578 Bacteria 1532
689 Ga0501043_0000005 3300049579 Bacteria 254466
690 Ga0501043_0002916 3300049579 Bacteria 14275
691 Ga0501043_0042607 3300049579 Bacteria 3567
692 Ga0501043_0212931 3300049579 Bacteria 1497
693 Ga0501043_0221968 3300049579 Bacteria 1462
694 Ga0501043_0250813 3300049579 Bacteria 1363
695 Ga0501046_0002308 3300049580 Bacteria 17982
696 Ga0501046_0182122 3300049580 Bacteria 1570
697 Ga0501046_0269625 3300049580 Bacteria 1249
698 Ga0501047_0024036 3300049581 Bacteria 5852
699 Ga0501047_0024292 3300049581 Bacteria 5819
700 Ga0501047_0025195 3300049581 Bacteria 5715
701 Ga0501047_0026236 3300049581 Bacteria 5605
702 Ga0501047_0046794 3300049581 Bacteria 4180
703 Ga0501047_0061392 3300049581 Bacteria 3627
704 Ga0501047_0091859 3300049581 Bacteria 2914
705 Ga0501047_0406122 3300049581 Bacteria 1195
706 Ga0501067_0240352 3300049583 Bacteria 1008
707 Ga0501068_0007123 3300049584 Bacteria 6188
708 Ga0501068_0317673 3300049584 Bacteria 998
709 Ga0501069_0000033 3300049585 Bacteria 92477
710 Ga0501069_0001322 3300049585 Bacteria 12147
711 Ga0501069_0059776 3300049585 Bacteria 2127
712 Ga0501069_0242466 3300049585 Bacteria 1050
713 Ga0501070_0000739 3300049586 Bacteria 29890
714 Ga0501070_0000913 3300049586 Bacteria 26864
715 Ga0501070_0002192 3300049586 Bacteria 17163
716 Ga0501070_0004818 3300049586 Bacteria 11531
717 Ga0501070_0048714 3300049586 Bacteria 3519
718 Ga0501070_0052204 3300049586 Bacteria 3393
719 Ga0501070_0062213 3300049586 Bacteria 3092
720 Ga0501070_0087003 3300049586 Bacteria 2587
721 Ga0501070_0181903 3300049586 Bacteria 1730
722 Ga0501070_0207899 3300049586 Bacteria 1607
723 Ga0501071_0217626 3300049587 Bacteria 1437
724 Ga0501072_0175271 3300049588 Bacteria 1711
725 Ga0501073_0001103 3300049589 Bacteria 19577
726 Ga0501073_0041167 3300049589 Bacteria 3265
727 Ga0501073_0060391 3300049589 Bacteria 2646
728 Ga0501073_0093108 3300049589 Bacteria 2094
729 Ga0501073_0122498 3300049589 Bacteria 1802
730 Ga0501074_0000571 3300049590 Bacteria 22782
731 Ga0501074_0001626 3300049590 Bacteria 15235
732 Ga0501074_0064696 3300049590 Bacteria 2633
733 Ga0501074_0076350 3300049590 Bacteria 2405
734 Ga0501074_0191368 3300049590 Bacteria 1459
735 Ga0501075_0217699 3300049591 Bacteria 1457
736 Ga0501076_0300308 3300049592 Bacteria 1316
737 Ga0501077_0114122 3300049593 Bacteria 1713
738 Ga0501079_0018396 3300049741 Bacteria 5340
739 Ga0501080_0001237 3300049742 Bacteria 21233
740 Ga0501080_0001592 3300049742 Bacteria 19267
741 Ga0501080_0017171 3300049742 Bacteria 6685
742 Ga0501080_0048231 3300049742 Bacteria 3964
743 Ga0501080_0053387 3300049742 Bacteria 3762
744 Ga0501080_0068537 3300049742 Bacteria 3300
745 Ga0501080_0145255 3300049742 Bacteria 2193
746 Ga0501081_0408593 3300049743 Bacteria 1006
747 Ga0501083_0000355 3300049744 Bacteria 29001
748 Ga0501083_0006285 3300049744 Bacteria 8428
749 Ga0501083_0028777 3300049744 Bacteria 3827
750 Ga0501035_0000086 3300049822 Bacteria 115822
751 Ga0501035_0000933 3300049822 Bacteria 30964
752 Ga0501035_0006474 3300049822 Bacteria 11001
753 Ga0501035_0009526 3300049822 Bacteria 9032
754 Ga0501035_0083516 3300049822 Bacteria 2818
755 Ga0501035_0098834 3300049822 Bacteria 2562
756 Ga0501035_0141374 3300049822 Bacteria 2092
757 Ga0501035_0169890 3300049822 Bacteria 1884
758 Ga0501044_0000223 3300049823 Bacteria 71752
759 Ga0501044_0010628 3300049823 Bacteria 9986
760 Ga0501044_0014960 3300049823 Bacteria 8365
761 Ga0501044_0015139 3300049823 Bacteria 8312
762 Ga0501044_0018664 3300049823 Bacteria 7429
763 Ga0501044_0031354 3300049823 Bacteria 5595
764 Ga0501044_0046382 3300049823 Bacteria 4499
765 Ga0501044_0069128 3300049823 Bacteria 3596
766 Ga0501044_0114589 3300049823 Bacteria 2701
767 Ga0501044_0134722 3300049823 Bacteria 2462
768 Ga0501044_0153181 3300049823 Bacteria 2286
769 Ga0501044_0177481 3300049823 Bacteria 2098
770 Ga0501044_0267514 3300049823 Bacteria 1646
771 Ga0501044_0375135 3300049823 Bacteria 1338
772 Ga0501045_0224309 3300049824 Bacteria 1399
773 nmdc:mga03683_117211_c1 3300050489 Bacteria 1181
774 nmdc:mga00v17_14_c1 3300050491 Bacteria 126589
775 nmdc:mga0k408_215773_c1 3300050493 Bacteria 1146
776 nmdc:mga06z11_20882_c2 3300050494 Bacteria 2155
777 nmdc:mga07m45_2012_c1 3300050496 Bacteria 9421
778 nmdc:mga07m45_62540_c1 3300050496 Bacteria 2110
779 nmdc:mga05p37_379666_c1 3300050507 Bacteria 1656
780 nmdc:mga05p37_40366_c1 3300050507 Bacteria 5731
781 nmdc:mga0qj67_107510_c1 3300050509 Bacteria 2250
782 nmdc:mga0qj67_77679_c1 3300050509 Bacteria 2656
783 nmdc:mga06r32_22751_c1 3300050510 Bacteria 5797
784 nmdc:mga08y16_1044_c1 3300050511 Bacteria 27165
785 nmdc:mga08y16_192047_c1 3300050511 Bacteria 2118
786 nmdc:mga08y16_676473_c1 3300050511 Bacteria 1034
787 nmdc:mga08y16_699023_c1 3300050511 Bacteria 1014
788 nmdc:mga08y16_76334_c1 3300050511 Bacteria 3493
789 nmdc:mga0a205_134935_c1 3300050515 Bacteria 2368
790 nmdc:mga0a205_377792_c1 3300050515 Bacteria 1282
791 nmdc:mga0sz30_18177_c1 3300050516 Bacteria 2811
792 Ga0500578_0000442 3300053086 Bacteria 50642
793 Ga0500643_044588 3300053087 Bacteria 1288
794 Ga0500594_0052345 3300053118 Bacteria 1153
795 Ga0500642_0001036 3300053130 Bacteria 8013
796 Ga0500658_0002498 3300053134 Bacteria 7116
797 Ga0500658_0007229 3300053134 Bacteria 4101
798 Ga0500559_0000014 3300053136 Bacteria 160139
799 Ga0500568_0000436 3300053139 Bacteria 31383
800 Ga0500568_0016368 3300053139 Bacteria 3299
801 Ga0500588_0017792 3300053146 Bacteria 1862
802 Ga0500588_0029486 3300053146 Bacteria 1565
803 Ga0500590_021314 3300053148 Bacteria 3364
804 Ga0500604_0010562 3300053151 Bacteria 2472
805 Ga0500616_0000472 3300053153 Bacteria 52191
806 Ga0500616_0038335 3300053153 Bacteria 2589
807 Ga0500622_0006682 3300053156 Bacteria 6647
808 Ga0500634_0000507 3300053161 Bacteria 12661
809 Ga0500645_007944 3300053730 Bacteria 3658
810 Ga0501084_0138069 3300054114 Bacteria 2052
811 Ga0590071_013079 3300059421 Bacteria 1945
812 Ga0501082_0032114 3300060353 Bacteria 4529
813 Ga0501082_0034523 3300060353 Bacteria 4360
814 Ga0501082_0083700 3300060353 Bacteria 2752
815 Ga0501082_0084199 3300060353 Bacteria 2743
816 Ga0530510_0023194 3300061734 Bacteria 4420

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047443 Ga0495687_033923 Ga0495687_033923_819_1718 277
2 iso_pu_bacteria 2970489779 2970495186 279
3 3300031730 Ga0307516_10143542 Ga0307516_101435422 282
4 3300053118 Ga0500594_0052345 Ga0500594_0052345_18_869 282
5 iso_pu_bacteria 2979742915 2979750770 282
6 3300009545 Ga0105237_10264298 Ga0105237_102642982 283
7 3300026023 Ga0207677_10394827 Ga0207677_103948272 283
8 3300053139 Ga0500568_0000436 Ga0500568_0000436_8078_8929 283
9 3300046539 Ga0495621_0022362 Ga0495621_0022362_301_1200 284
10 3300049591 Ga0501075_0217699 Ga0501075_0217699_194_1141 288
11 3300009765 Ga0123341_1077652 Ga0123341_10776522 289
12 3300010375 Ga0105239_10101033 Ga0105239_101010335 289
13 3300050507 nmdc:mga05p37_379666_c1 nmdc:mga05p37_379666_c1_17_889 289
14 iso_pu_bacteria 2839094727 2839096587 289
15 3300039447 Ga0436361_0069918 Ga0436361_0069918_548_1498 290
16 3300039453 Ga0436362_0758258 Ga0436362_0758258_952_1902 290
17 3300053148 Ga0500590_021314 Ga0500590_021314_493_1476 290
18 iso_pu_bacteria 2842264693 2842265264 290
19 iso_pu_bacteria 2842428310 2842428683 290
20 iso_pu_bacteria 2842434925 2842435296 290
21 iso_pu_bacteria 2842441272 2842441841 290
22 iso_pu_bacteria 2842462802 2842463107 290
23 iso_pu_bacteria 2842469257 2842469627 290
24 3300005438 Ga0070701_10013615 Ga0070701_100136152 291
25 3300014325 Ga0163163_10116193 Ga0163163_101161932 291
26 3300021327 Ga0214543_1000005 Ga0214543_1000005277 291
27 iso_pu_bacteria 2844533157 2844535281 291
28 3300003763 Ga0055529_1001031 Ga0055529_10010314 292
29 3300025242 Ga0209258_102714 Ga0209258_1027142 292
30 3300025272 Ga0209455_1000841 Ga0209455_10008414 292
31 3300031456 Ga0307513_10023595 Ga0307513_100235953 293
32 3300039438 Ga0436360_0865156 Ga0436360_0865156_932_1882 293
33 3300009093 Ga0105240_10015015 Ga0105240_1001501510 294
34 iso_pu_bacteria 2511231003 2511252191 294
35 iso_pu_bacteria 2511231026 2511383673 294
36 iso_pu_bacteria 2521172590 2521559296 294
37 iso_pu_bacteria 2548876994 2550696175 294
38 iso_pu_bacteria 2551306416 2553004095 294
39 iso_pu_bacteria 2739367655 2739612867 294
40 iso_pu_bacteria 2765235838 2765568534 294
41 iso_pu_bacteria 2808606386 2808981267 294
42 iso_pu_bacteria 2808606415 2809128850 294
43 iso_pu_bacteria 2808606419 2809148471 294
44 iso_pu_bacteria 2818991445 2819595493 294
45 iso_pu_bacteria 2818991449 2819615810 294
46 iso_pu_bacteria 2852618963 2852621004 294
47 iso_pu_bacteria 2881927736 2881928157 294
48 iso_pu_bacteria 2884811622 2884817056 294
49 iso_pu_bacteria 2884836552 2884836739 294
50 iso_pu_bacteria 2884852848 2884853030 294
51 iso_pu_bacteria 2887375801 2887376940 294
52 iso_pu_bacteria 2896154374 2896155852 294
53 iso_pu_bacteria 2904439833 2904443705 294
54 iso_pu_bacteria 2904530477 2904532602 294
55 iso_pu_bacteria 2904584206 2904585100 294
56 iso_pu_bacteria 2904589729 2904593449 294
57 iso_pu_bacteria 2904601388 2904605629 294
58 iso_pu_bacteria 2919046199 2919048092 294
59 iso_pu_bacteria 2919079590 2919081424 294
60 iso_pu_bacteria 2923510766 2923512969 294
61 iso_pu_bacteria 2928130867 2928133808 294
62 3300047472 Ga0495686_0038269 Ga0495686_0038269_1338_2225 295
63 iso_pu_bacteria 2585428058 2587733828 296
64 iso_pu_bacteria 2588253510 2588291635 296
65 iso_pu_bacteria 2643221654 2644302448 296
66 3300005471 Ga0070698_100379075 Ga0070698_1003790752 297
67 iso_pu_bacteria 2643221592 2643972532 297
68 iso_pu_bacteria 2643221625 2644138460 297
69 iso_pu_bacteria 2643221648 2644273040 297
70 3300002705 JGI25156J39149_1000675 JGI25156J39149_100067518 298
71 3300002741 JGI25157J39369_1001106 JGI25157J39369_10011068 298
72 3300003187 JGI25151J46595_10009780 JGI25151J46595_100097802 298
73 3300003751 Ga0055538_1000054 Ga0055538_100005498 298
74 3300003752 Ga0055539_1000066 Ga0055539_100006698 298
75 3300003756 Ga0055533_1000076 Ga0055533_100007698 298
76 3300003758 Ga0055532_1000157 Ga0055532_100015733 298
77 3300003759 Ga0055525_1000098 Ga0055525_100009898 298
78 3300003761 Ga0055535_1006969 Ga0055535_10069692 298
79 3300003771 Ga0055526_1006049 Ga0055526_10060493 298
80 3300003775 Ga0055524_1001068 Ga0055524_10010688 298
81 3300003784 Ga0055534_1003753 Ga0055534_10037534 298
82 3300003841 Ga0055541_1000056 Ga0055541_100005698 298
83 3300005293 Ga0065715_10193679 Ga0065715_101936791 298
84 3300005329 Ga0070683_100232746 Ga0070683_1002327462 298
85 3300005331 Ga0070670_100234155 Ga0070670_1002341551 298
86 3300005333 Ga0070677_10074465 Ga0070677_100744651 298
87 3300005335 Ga0070666_10116012 Ga0070666_101160121 298
88 3300005365 Ga0070688_100017786 Ga0070688_1000177864 298
89 3300005367 Ga0070667_100298841 Ga0070667_1002988412 298
90 3300005438 Ga0070701_10009247 Ga0070701_100092472 298
91 3300005441 Ga0070700_100013467 Ga0070700_1000134672 298
92 3300005456 Ga0070678_100185348 Ga0070678_1001853482 298
93 3300005539 Ga0068853_100020351 Ga0068853_1000203513 298
94 3300005539 Ga0068853_100369417 Ga0068853_1003694172 298
95 3300005548 Ga0070665_100013700 Ga0070665_1000137003 298
96 3300005549 Ga0070704_100074861 Ga0070704_1000748612 298
97 3300005563 Ga0068855_100000791 Ga0068855_1000007913 298
98 3300005564 Ga0070664_100062640 Ga0070664_1000626403 298
99 3300005578 Ga0068854_100001709 Ga0068854_10000170912 298
100 3300005578 Ga0068854_100162153 Ga0068854_1001621533 298
101 3300005615 Ga0070702_100007399 Ga0070702_1000073993 298
102 3300005618 Ga0068864_100589867 Ga0068864_1005898671 298
103 3300005718 Ga0068866_10196355 Ga0068866_101963552 298
104 3300005841 Ga0068863_100052015 Ga0068863_1000520153 298
105 3300005843 Ga0068860_100033901 Ga0068860_1000339013 298
106 3300006237 Ga0097621_100103634 Ga0097621_1001036342 298
107 3300006881 Ga0068865_100029089 Ga0068865_1000290892 298
108 3300006881 Ga0068865_100044124 Ga0068865_1000441242 298
109 3300006946 Ga0079104_1004787 Ga0079104_10047872 298
110 3300007265 Ga0099794_10016591 Ga0099794_100165914 298
111 3300009011 Ga0105251_10025196 Ga0105251_100251963 298
112 3300009093 Ga0105240_10002015 Ga0105240_100020158 298
113 3300009093 Ga0105240_10044364 Ga0105240_100443642 298
114 3300009094 Ga0111539_10016103 Ga0111539_100161035 298
115 3300009098 Ga0105245_10117457 Ga0105245_101174572 298
116 3300009148 Ga0105243_10051108 Ga0105243_100511082 298
117 3300009148 Ga0105243_10131794 Ga0105243_101317942 298
118 3300009176 Ga0105242_10010144 Ga0105242_100101446 298
119 3300009176 Ga0105242_10222304 Ga0105242_102223042 298
120 3300009177 Ga0105248_10135127 Ga0105248_101351272 298
121 3300009545 Ga0105237_10031873 Ga0105237_100318733 298
122 3300009551 Ga0105238_10000632 Ga0105238_100006325 298
123 3300009551 Ga0105238_10007883 Ga0105238_100078835 298
124 3300009766 Ga0123342_1021599 Ga0123342_10215992 298
125 3300010375 Ga0105239_10058642 Ga0105239_100586421 298
126 3300011119 Ga0105246_10297245 Ga0105246_102972452 298
127 3300013104 Ga0157370_10382074 Ga0157370_103820742 298
128 3300013297 Ga0157378_10025128 Ga0157378_100251285 298
129 3300013297 Ga0157378_10227349 Ga0157378_102273492 298
130 3300014325 Ga0163163_10712870 Ga0163163_107128701 298
131 3300014326 Ga0157380_10074057 Ga0157380_100740573 298
132 3300014968 Ga0157379_10073386 Ga0157379_100733863 298
133 3300014968 Ga0157379_10075283 Ga0157379_100752832 298
134 3300015261 Ga0182006_1005634 Ga0182006_10056347 298
135 3300017792 Ga0163161_10093925 Ga0163161_100939251 298
136 3300025206 Ga0209435_100085 Ga0209435_10008521 298
137 3300025206 Ga0209435_100486 Ga0209435_1004867 298
138 3300025224 Ga0209784_100002 Ga0209784_1000021586 298
139 3300025225 Ga0209566_100003 Ga0209566_1000031586 298
140 3300025226 Ga0209674_100004 Ga0209674_1000041586 298
141 3300025229 Ga0209147_100217 Ga0209147_10021734 298
142 3300025230 Ga0209563_100006 Ga0209563_1000061586 298
143 3300025242 Ga0209258_100390 Ga0209258_10039021 298
144 3300025246 Ga0209646_1000204 Ga0209646_100020411 298
145 3300025246 Ga0209646_1000227 Ga0209646_100022721 298
146 3300025250 Ga0209026_1000340 Ga0209026_100034020 298
147 3300025253 Ga0209677_100003 Ga0209677_1000031586 298
148 3300025256 Ga0209759_1000298 Ga0209759_100029811 298
149 3300025256 Ga0209759_1000561 Ga0209759_100056121 298
150 3300025263 Ga0209565_1000021 Ga0209565_1000021101 298
151 3300025291 Ga0209675_1003321 Ga0209675_10033212 298
152 3300025292 Ga0209676_1001620 Ga0209676_10016208 298
153 3300025294 Ga0209025_1008454 Ga0209025_10084542 298
154 3300025295 Ga0209564_1000218 Ga0209564_100021812 298
155 3300025295 Ga0209564_1000452 Ga0209564_100045227 298
156 3300025298 Ga0209050_1003004 Ga0209050_10030048 298
157 3300025299 Ga0209256_1001569 Ga0209256_100156910 298
158 3300025299 Ga0209256_1003336 Ga0209256_10033362 298
159 3300025303 Ga0209051_1004860 Ga0209051_10048606 298
160 3300025304 Ga0209257_1002116 Ga0209257_100211617 298
161 3300025315 Ga0207697_10009556 Ga0207697_100095565 298
162 3300025893 Ga0207682_10001921 Ga0207682_100019217 298
163 3300025907 Ga0207645_10002683 Ga0207645_100026833 298
164 3300025908 Ga0207643_10000796 Ga0207643_100007964 298
165 3300025913 Ga0207695_10001105 Ga0207695_1000110521 298
166 3300025913 Ga0207695_10018728 Ga0207695_100187282 298
167 3300025918 Ga0207662_10151178 Ga0207662_101511782 298
168 3300025924 Ga0207694_10000171 Ga0207694_1000017154 298
169 3300025925 Ga0207650_10382634 Ga0207650_103826341 298
170 3300025926 Ga0207659_10047076 Ga0207659_100470762 298
171 3300025934 Ga0207686_10136773 Ga0207686_101367732 298
172 3300025935 Ga0207709_10071435 Ga0207709_100714353 298
173 3300025935 Ga0207709_10079160 Ga0207709_100791602 298
174 3300025942 Ga0207689_10003617 Ga0207689_100036177 298
175 3300025949 Ga0207667_10000191 Ga0207667_100001913 298
176 3300025949 Ga0207667_10003921 Ga0207667_1000392115 298
177 3300025949 Ga0207667_10020526 Ga0207667_100205263 298
178 3300026041 Ga0207639_10014797 Ga0207639_100147973 298
179 3300026075 Ga0207708_10004853 Ga0207708_100048532 298
180 3300026089 Ga0207648_10003800 Ga0207648_100038008 298
181 3300026089 Ga0207648_10014008 Ga0207648_100140088 298
182 3300026116 Ga0207674_10371125 Ga0207674_103711252 298
183 3300026118 Ga0207675_100003993 Ga0207675_10000399310 298
184 3300026121 Ga0207683_10016849 Ga0207683_100168496 298
185 3300027111 Ga0209281_1006414 Ga0209281_10064142 298
186 3300027907 Ga0207428_10076537 Ga0207428_100765372 298
187 3300028786 Ga0307517_10006989 Ga0307517_100069899 298
188 3300030522 Ga0307512_10111845 Ga0307512_101118452 298
189 3300031507 Ga0307509_10005306 Ga0307509_1000530613 298
190 3300031824 Ga0307413_10093966 Ga0307413_100939661 298
191 3300031852 Ga0307410_10051802 Ga0307410_100518023 298
192 3300032002 Ga0307416_100141755 Ga0307416_1001417552 298
193 3300032126 Ga0307415_100004225 Ga0307415_1000042256 298
194 3300033180 Ga0307510_10015777 Ga0307510_100157772 298
195 3300033180 Ga0307510_10092443 Ga0307510_100924432 298
196 3300037466 Ga0395898_0167942 Ga0395898_0167942_398_1297 298
197 3300037853 Ga0436364_0295982 Ga0436364_0295982_58_960 298
198 3300038443 Ga0395901_0187809 Ga0395901_0187809_38_937 298
199 3300039447 Ga0436361_0532183 Ga0436361_0532183_2033_2932 298
200 3300046512 Ga0495610_0032117 Ga0495610_0032117_598_1497 298
201 3300047317 Ga0495604_0104577 Ga0495604_0104577_525_1484 298
202 3300048919 Ga0496116_0014781 Ga0496116_0014781_105_1004 298
203 3300048926 Ga0496123_0000433 Ga0496123_0000433_8229_9128 298
204 3300048928 Ga0496125_0007428 Ga0496125_0007428_925_1824 298
205 3300050511 nmdc:mga08y16_192047_c1 nmdc:mga08y16_192047_c1_519_1418 298
206 3300050511 nmdc:mga08y16_699023_c1 nmdc:mga08y16_699023_c1_44_943 298
207 3300053136 Ga0500559_0000014 Ga0500559_0000014_147705_148604 298
208 3300053156 Ga0500622_0006682 Ga0500622_0006682_2276_3175 298
209 3300005290 Ga0065712_10009354 Ga0065712_100093543 299
210 3300005293 Ga0065715_10037650 Ga0065715_100376502 299
211 3300005330 Ga0070690_100000104 Ga0070690_10000010413 299
212 3300005331 Ga0070670_100000403 Ga0070670_10000040322 299
213 3300005333 Ga0070677_10002422 Ga0070677_100024223 299
214 3300005334 Ga0068869_100001111 Ga0068869_10000111112 299
215 3300005337 Ga0070682_100069986 Ga0070682_1000699862 299
216 3300005338 Ga0068868_100295442 Ga0068868_1002954422 299
217 3300005340 Ga0070689_100010513 Ga0070689_1000105134 299
218 3300005341 Ga0070691_10036418 Ga0070691_100364182 299
219 3300005345 Ga0070692_10001690 Ga0070692_100016904 299
220 3300005354 Ga0070675_100015525 Ga0070675_1000155253 299
221 3300005355 Ga0070671_100014895 Ga0070671_1000148954 299
222 3300005356 Ga0070674_100175461 Ga0070674_1001754612 299
223 3300005438 Ga0070701_10000947 Ga0070701_1000094710 299
224 3300005440 Ga0070705_100030887 Ga0070705_1000308872 299
225 3300005441 Ga0070700_100001391 Ga0070700_1000013913 299
226 3300005456 Ga0070678_100013439 Ga0070678_1000134393 299
227 3300005456 Ga0070678_100067388 Ga0070678_1000673883 299
228 3300005543 Ga0070672_100001817 Ga0070672_10000181713 299
229 3300005544 Ga0070686_100001046 Ga0070686_1000010467 299
230 3300005545 Ga0070695_100005269 Ga0070695_1000052694 299
231 3300005547 Ga0070693_100014082 Ga0070693_1000140822 299
232 3300005548 Ga0070665_100230392 Ga0070665_1002303922 299
233 3300005615 Ga0070702_100000641 Ga0070702_10000064112 299
234 3300005617 Ga0068859_100082410 Ga0068859_1000824102 299
235 3300005718 Ga0068866_10003238 Ga0068866_100032383 299
236 3300005840 Ga0068870_10010548 Ga0068870_100105483 299
237 3300005842 Ga0068858_100000679 Ga0068858_1000006793 299
238 3300005843 Ga0068860_100114734 Ga0068860_1001147342 299
239 3300006195 Ga0075366_10052539 Ga0075366_100525392 299
240 3300006195 Ga0075366_10119205 Ga0075366_101192051 299
241 3300006237 Ga0097621_100017693 Ga0097621_1000176931 299
242 3300006358 Ga0068871_100006781 Ga0068871_1000067813 299
243 3300006931 Ga0097620_100082414 Ga0097620_1000824142 299
244 3300009098 Ga0105245_10004092 Ga0105245_1000409212 299
245 3300009148 Ga0105243_10035348 Ga0105243_100353483 299
246 3300009176 Ga0105242_10008454 Ga0105242_100084543 299
247 3300013297 Ga0157378_10003424 Ga0157378_1000342412 299
248 3300014326 Ga0157380_10003649 Ga0157380_100036498 299
249 3300014968 Ga0157379_10106342 Ga0157379_101063422 299
250 3300025893 Ga0207682_10001129 Ga0207682_1000112912 299
251 3300025899 Ga0207642_10000792 Ga0207642_100007925 299
252 3300025925 Ga0207650_10000408 Ga0207650_1000040814 299
253 3300025926 Ga0207659_10000256 Ga0207659_100002569 299
254 3300025927 Ga0207687_10003861 Ga0207687_100038612 299
255 3300025934 Ga0207686_10001479 Ga0207686_1000147912 299
256 3300025934 Ga0207686_10149679 Ga0207686_101496791 299
257 3300025935 Ga0207709_10007010 Ga0207709_100070107 299
258 3300025936 Ga0207670_10003899 Ga0207670_100038993 299
259 3300025937 Ga0207669_10019594 Ga0207669_100195943 299
260 3300025937 Ga0207669_10164210 Ga0207669_101642101 299
261 3300025938 Ga0207704_10236774 Ga0207704_102367742 299
262 3300025940 Ga0207691_10000360 Ga0207691_1000036022 299
263 3300025942 Ga0207689_10000392 Ga0207689_1000039213 299
264 3300025960 Ga0207651_10013533 Ga0207651_100135333 299
265 3300026035 Ga0207703_10008734 Ga0207703_100087343 299
266 3300026075 Ga0207708_10002193 Ga0207708_1000219312 299
267 3300026089 Ga0207648_10003985 Ga0207648_1000398515 299
268 3300026089 Ga0207648_10006481 Ga0207648_100064811 299
269 3300026089 Ga0207648_10103380 Ga0207648_101033801 299
270 3300026118 Ga0207675_100004949 Ga0207675_1000049493 299
271 3300026121 Ga0207683_10003821 Ga0207683_100038213 299
272 3300026121 Ga0207683_10027137 Ga0207683_100271373 299
273 3300028380 Ga0268265_10083585 Ga0268265_100835851 299
274 3300028794 Ga0307515_10006043 Ga0307515_1000604317 299
275 3300031548 Ga0307408_100065328 Ga0307408_1000653282 299
276 3300031911 Ga0307412_10011920 Ga0307412_100119202 299
277 3300032004 Ga0307414_10014216 Ga0307414_100142163 299
278 3300032005 Ga0307411_10015181 Ga0307411_100151812 299
279 3300042115 Ga0450911_000152 Ga0450911_000152_13413_14312 299
280 3300050493 nmdc:mga0k408_215773_c1 nmdc:mga0k408_215773_c1_148_1047 299
281 3300002773 JGI25152J39213_1002959 JGI25152J39213_10029594 300
282 3300003215 JGI25153J46596_10009620 JGI25153J46596_100096204 300
283 3300003771 Ga0055526_1007227 Ga0055526_10072275 300
284 3300005456 Ga0070678_100176079 Ga0070678_1001760792 300
285 3300005548 Ga0070665_100030832 Ga0070665_1000308325 300
286 3300006195 Ga0075366_10023241 Ga0075366_100232413 300
287 3300006353 Ga0075370_10138890 Ga0075370_101388902 300
288 3300025245 Ga0207425_1000448 Ga0207425_100044813 300
289 3300025258 Ga0209129_1000124 Ga0209129_100012452 300
290 3300025263 Ga0209565_1006164 Ga0209565_10061642 300
291 3300025273 Ga0209673_1004568 Ga0209673_10045683 300
292 3300025295 Ga0209564_1000057 Ga0209564_100005769 300
293 3300025297 Ga0209758_1000214 Ga0209758_100021439 300
294 3300027665 Ga0209983_1004868 Ga0209983_10048683 300
295 3300027876 Ga0209974_10006207 Ga0209974_100062072 300
296 3300028563 Ga0265319_1000177 Ga0265319_100017734 300
297 3300028577 Ga0265318_10000258 Ga0265318_1000025830 300
298 3300031235 Ga0265330_10000359 Ga0265330_1000035915 300
299 3300031238 Ga0265332_10000138 Ga0265332_1000013845 300
300 3300031239 Ga0265328_10032042 Ga0265328_100320422 300
301 3300031240 Ga0265320_10000284 Ga0265320_100002843 300
302 3300031241 Ga0265325_10081223 Ga0265325_100812232 300
303 3300031242 Ga0265329_10000076 Ga0265329_1000007616 300
304 3300031247 Ga0265340_10000688 Ga0265340_1000068812 300
305 3300031249 Ga0265339_10082625 Ga0265339_100826252 300
306 3300031250 Ga0265331_10001134 Ga0265331_100011349 300
307 3300031344 Ga0265316_10000843 Ga0265316_100008439 300
308 3300031507 Ga0307509_10139564 Ga0307509_101395642 300
309 3300031595 Ga0265313_10000089 Ga0265313_1000008970 300
310 3300031711 Ga0265314_10000211 Ga0265314_1000021168 300
311 3300031712 Ga0265342_10000390 Ga0265342_1000039028 300
312 3300033179 Ga0307507_10026219 Ga0307507_100262193 300
313 3300053086 Ga0500578_0000442 Ga0500578_0000442_14079_14984 300
314 3300005327 Ga0070658_10158696 Ga0070658_101586962 301
315 3300005329 Ga0070683_100252189 Ga0070683_1002521892 301
316 3300005335 Ga0070666_10229207 Ga0070666_102292071 301
317 3300005336 Ga0070680_100009735 Ga0070680_1000097353 301
318 3300005339 Ga0070660_100341222 Ga0070660_1003412221 301
319 3300005344 Ga0070661_100004818 Ga0070661_1000048187 301
320 3300005355 Ga0070671_100065045 Ga0070671_1000650452 301
321 3300005355 Ga0070671_100101194 Ga0070671_1001011942 301
322 3300005355 Ga0070671_100169477 Ga0070671_1001694772 301
323 3300005364 Ga0070673_100081833 Ga0070673_1000818332 301
324 3300005455 Ga0070663_100071282 Ga0070663_1000712823 301
325 3300005455 Ga0070663_100172481 Ga0070663_1001724812 301
326 3300005456 Ga0070678_100039073 Ga0070678_1000390733 301
327 3300005457 Ga0070662_100004864 Ga0070662_1000048647 301
328 3300005530 Ga0070679_100002199 Ga0070679_1000021995 301
329 3300005547 Ga0070693_100035112 Ga0070693_1000351122 301
330 3300005564 Ga0070664_100004354 Ga0070664_10000435410 301
331 3300005564 Ga0070664_100020289 Ga0070664_1000202894 301
332 3300005578 Ga0068854_100035336 Ga0068854_1000353363 301
333 3300005614 Ga0068856_100041781 Ga0068856_1000417814 301
334 3300005616 Ga0068852_100018994 Ga0068852_1000189944 301
335 3300005616 Ga0068852_100048697 Ga0068852_1000486973 301
336 3300005618 Ga0068864_100092466 Ga0068864_1000924662 301
337 3300005834 Ga0068851_10016960 Ga0068851_100169602 301
338 3300009545 Ga0105237_10332075 Ga0105237_103320752 301
339 3300009551 Ga0105238_10006338 Ga0105238_100063383 301
340 3300013102 Ga0157371_10117900 Ga0157371_101179002 301
341 3300013105 Ga0157369_10008064 Ga0157369_100080643 301
342 3300013308 Ga0157375_10123740 Ga0157375_101237402 301
343 3300025297 Ga0209758_1000232 Ga0209758_100023236 301
344 3300025321 Ga0207656_10036968 Ga0207656_100369683 301
345 3300025900 Ga0207710_10014855 Ga0207710_100148552 301
346 3300025903 Ga0207680_10034211 Ga0207680_100342113 301
347 3300025917 Ga0207660_10010630 Ga0207660_100106303 301
348 3300025920 Ga0207649_10013416 Ga0207649_100134162 301
349 3300025931 Ga0207644_10061939 Ga0207644_100619392 301
350 3300025932 Ga0207690_10008231 Ga0207690_100082312 301
351 3300025945 Ga0207679_10088713 Ga0207679_100887132 301
352 3300025960 Ga0207651_10008778 Ga0207651_100087783 301
353 3300025981 Ga0207640_10024716 Ga0207640_100247163 301
354 3300026023 Ga0207677_10151862 Ga0207677_101518622 301
355 3300026067 Ga0207678_10065216 Ga0207678_100652162 301
356 3300026078 Ga0207702_10008513 Ga0207702_1000851310 301
357 3300026095 Ga0207676_10357518 Ga0207676_103575181 301
358 3300026142 Ga0207698_10057249 Ga0207698_100572493 301
359 3300026142 Ga0207698_10086278 Ga0207698_100862782 301
360 3300002737 JGI25162J39368_1001832 JGI25162J39368_10018328 302
361 3300005293 Ga0065715_10097689 Ga0065715_100976892 302
362 3300005331 Ga0070670_100016185 Ga0070670_1000161852 302
363 3300005331 Ga0070670_100168655 Ga0070670_1001686552 302
364 3300005334 Ga0068869_100000970 Ga0068869_1000009708 302
365 3300005343 Ga0070687_100172920 Ga0070687_1001729201 302
366 3300005347 Ga0070668_100029428 Ga0070668_1000294284 302
367 3300005367 Ga0070667_100003805 Ga0070667_10000380511 302
368 3300005548 Ga0070665_100069602 Ga0070665_1000696025 302
369 3300005563 Ga0068855_100106657 Ga0068855_1001066573 302
370 3300005577 Ga0068857_100000949 Ga0068857_1000009493 302
371 3300005578 Ga0068854_100146515 Ga0068854_1001465152 302
372 3300005616 Ga0068852_100006348 Ga0068852_1000063487 302
373 3300005617 Ga0068859_100000096 Ga0068859_10000009673 302
374 3300005618 Ga0068864_100006259 Ga0068864_1000062592 302
375 3300005719 Ga0068861_100008612 Ga0068861_1000086127 302
376 3300005840 Ga0068870_10081068 Ga0068870_100810682 302
377 3300005841 Ga0068863_100249931 Ga0068863_1002499312 302
378 3300005842 Ga0068858_100002939 Ga0068858_1000029395 302
379 3300005843 Ga0068860_100000990 Ga0068860_10000099021 302
380 3300005844 Ga0068862_100010857 Ga0068862_1000108574 302
381 3300005844 Ga0068862_100131143 Ga0068862_1001311433 302
382 3300006931 Ga0097620_100000096 Ga0097620_10000009673 302
383 3300009093 Ga0105240_10164525 Ga0105240_101645253 302
384 3300009101 Ga0105247_10005387 Ga0105247_100053877 302
385 3300009177 Ga0105248_10022473 Ga0105248_100224732 302
386 3300010375 Ga0105239_10661471 Ga0105239_106614712 302
387 3300014325 Ga0163163_10011828 Ga0163163_100118287 302
388 3300014968 Ga0157379_10003873 Ga0157379_100038738 302
389 3300025233 Ga0209437_100432 Ga0209437_10043228 302
390 3300025908 Ga0207643_10012951 Ga0207643_100129514 302
391 3300025913 Ga0207695_10001995 Ga0207695_100019959 302
392 3300025918 Ga0207662_10216086 Ga0207662_102160862 302
393 3300025923 Ga0207681_10102095 Ga0207681_101020952 302
394 3300025924 Ga0207694_10162317 Ga0207694_101623172 302
395 3300025925 Ga0207650_10075606 Ga0207650_100756062 302
396 3300025931 Ga0207644_10135086 Ga0207644_101350863 302
397 3300025935 Ga0207709_10277474 Ga0207709_102774742 302
398 3300025941 Ga0207711_10008363 Ga0207711_100083632 302
399 3300025942 Ga0207689_10001083 Ga0207689_100010838 302
400 3300025949 Ga0207667_10316662 Ga0207667_103166622 302
401 3300025960 Ga0207651_10002638 Ga0207651_100026385 302
402 3300025972 Ga0207668_10040301 Ga0207668_100403014 302
403 3300025981 Ga0207640_10070453 Ga0207640_100704533 302
404 3300025986 Ga0207658_10006579 Ga0207658_100065795 302
405 3300026035 Ga0207703_10000206 Ga0207703_1000020610 302
406 3300026088 Ga0207641_10018478 Ga0207641_100184783 302
407 3300026089 Ga0207648_10021649 Ga0207648_100216492 302
408 3300026095 Ga0207676_10004246 Ga0207676_100042462 302
409 3300026116 Ga0207674_10005154 Ga0207674_100051545 302
410 3300026118 Ga0207675_100001654 Ga0207675_10000165415 302
411 3300028380 Ga0268265_10028054 Ga0268265_100280544 302
412 3300028380 Ga0268265_10035938 Ga0268265_100359383 302
413 3300028381 Ga0268264_10000570 Ga0268264_100005707 302
414 3300028381 Ga0268264_10025112 Ga0268264_100251122 302
415 3300031852 Ga0307410_10000433 Ga0307410_100004335 302
416 3300031903 Ga0307407_10000903 Ga0307407_100009031 302
417 3300031995 Ga0307409_100063242 Ga0307409_1000632424 302
418 3300032002 Ga0307416_100007289 Ga0307416_1000072893 302
419 3300032005 Ga0307411_10017969 Ga0307411_100179691 302
420 3300032126 Ga0307415_100062302 Ga0307415_1000623024 302
421 3300048905 Ga0496102_0041195 Ga0496102_0041195_929_1849 302
422 3300048912 Ga0496109_0144804 Ga0496109_0144804_1001_1921 302
423 3300048914 Ga0496111_0112707 Ga0496111_0112707_861_1823 302
424 3300003187 JGI25151J46595_10001193 JGI25151J46595_100011938 303
425 3300003771 Ga0055526_1001852 Ga0055526_10018529 303
426 3300003781 Ga0055536_1000219 Ga0055536_10002192 303
427 3300025284 Ga0209130_1015385 Ga0209130_10153852 303
428 3300025291 Ga0209675_1000040 Ga0209675_100004088 303
429 3300025292 Ga0209676_1000014 Ga0209676_1000014566 303
430 3300025294 Ga0209025_1000092 Ga0209025_100009288 303
431 3300025295 Ga0209564_1000159 Ga0209564_100015958 303
432 3300031730 Ga0307516_10115698 Ga0307516_101156982 303
433 3300038443 Ga0395901_0591232 Ga0395901_0591232_62_994 303
434 3300049571 Ga0501034_0332749 Ga0501034_0332749_394_1335 303
435 3300049579 Ga0501043_0221968 Ga0501043_0221968_509_1450 303
436 3300049581 Ga0501047_0024036 Ga0501047_0024036_472_1413 303
437 3300049586 Ga0501070_0004818 Ga0501070_0004818_2102_3043 303
438 3300049586 Ga0501070_0181903 Ga0501070_0181903_370_1317 303
439 3300049822 Ga0501035_0000933 Ga0501035_0000933_28542_29483 303
440 3300049823 Ga0501044_0046382 Ga0501044_0046382_2828_3769 303
441 3300049823 Ga0501044_0134722 Ga0501044_0134722_213_1160 303
442 3300005367 Ga0070667_100208707 Ga0070667_1002087072 304
443 3300005563 Ga0068855_100007145 Ga0068855_1000071454 304
444 3300006353 Ga0075370_10014589 Ga0075370_100145892 304
445 3300009093 Ga0105240_10009479 Ga0105240_100094797 304
446 3300021361 Ga0213872_10040241 Ga0213872_100402412 304
447 3300025913 Ga0207695_10049214 Ga0207695_100492143 304
448 3300025924 Ga0207694_10040036 Ga0207694_100400363 304
449 3300025949 Ga0207667_10041636 Ga0207667_100416362 304
450 3300031251 Ga0265327_10026162 Ga0265327_100261623 304
451 3300031730 Ga0307516_10008188 Ga0307516_1000818810 304
452 3300037471 Ga0395905_0036652 Ga0395905_0036652_317_1264 304
453 3300039447 Ga0436361_1085109 Ga0436361_1085109_2493_3443 304
454 3300046454 Ga0495592_0000142 Ga0495592_0000142_24999_25940 304
455 3300046512 Ga0495610_0012550 Ga0495610_0012550_4034_4966 304
456 3300046515 Ga0495620_0045866 Ga0495620_0045866_594_1526 304
457 3300046519 Ga0495632_0008357 Ga0495632_0008357_1402_2334 304
458 3300046528 Ga0495642_0040094 Ga0495642_0040094_479_1426 304
459 3300046660 Ga0495625_0035602 Ga0495625_0035602_2528_3460 304
460 3300046665 Ga0495661_0113359 Ga0495661_0113359_62_1009 304
461 3300046810 Ga0495660_0156147 Ga0495660_0156147_180_1112 304
462 3300047443 Ga0495687_018568 Ga0495687_018568_429_1376 304
463 3300049581 Ga0501047_0026236 Ga0501047_0026236_1553_2503 304
464 3300049585 Ga0501069_0242466 Ga0501069_0242466_67_1017 304
465 3300049742 Ga0501080_0053387 Ga0501080_0053387_1465_2415 304
466 iso_pu_bacteria 2519899620 2520381022 304
467 iso_pu_bacteria 2615840624 2616294744 304
468 iso_pu_bacteria 2718217882 2719184498 304
469 iso_pu_bacteria 2718218009 2719728518 304
470 iso_pu_bacteria 2718218363 2721144206 304
471 iso_pu_bacteria 2718218365 2721156304 304
472 iso_pu_bacteria 2718218366 2721161581 304
473 iso_pu_bacteria 2721755514 2722842726 304
474 iso_pu_bacteria 2721755810 2724041543 304
475 iso_pu_bacteria 2728369365 2730160614 304
476 iso_pu_bacteria 2728369397 2730295837 304
477 iso_pu_bacteria 2791355260 2793323111 304
478 iso_pu_bacteria 2791355261 2793329871 304
479 iso_pu_bacteria 2791355264 2793345378 304
480 iso_pu_bacteria 2791355265 2793354923 304
481 iso_pu_bacteria 2802429605 2805927143 304
482 iso_pu_bacteria 2802429606 2805934431 304
483 iso_pu_bacteria 2838022645 2838028329 304
484 iso_pu_bacteria 2838668709 2838669553 304
485 iso_pu_bacteria 2838701080 2838701925 304
486 iso_pu_bacteria 2842192696 2842198538 304
487 iso_pu_bacteria 2842198810 2842204305 304
488 iso_pu_bacteria 2842250916 2842251652 304
489 iso_pu_bacteria 2842317721 2842323362 304
490 iso_pu_bacteria 2842489311 2842489629 304
491 iso_pu_bacteria 2842495871 2842500461 304
492 iso_pu_bacteria 2996893221 2996894490 304
493 iso_pu_bacteria 3002141150 3002141962 304
494 iso_pu_bacteria 3005445848 3005452050 304
495 iso_pu_bacteria 8005382845 8005383404 304
496 iso_pu_bacteria 8005395548 8005398998 304
497 iso_pu_bacteria 8018127388 8018131904 304
498 iso_pu_bacteria 8024501048 8024507169 304
499 iso_pu_bacteria 8056382006 8056382490 304
500 3300002987 JGI25159J45721_1008482 JGI25159J45721_10084822 305
501 3300003187 JGI25151J46595_10000458 JGI25151J46595_1000045813 305
502 3300003354 JGI25160J50197_1003716 JGI25160J50197_10037163 305
503 3300005937 Ga0081455_10241886 Ga0081455_102418862 305
504 3300009553 Ga0105249_10575860 Ga0105249_105758601 305
505 3300025284 Ga0209130_1000467 Ga0209130_10004672 305
506 3300025294 Ga0209025_1000099 Ga0209025_100009925 305
507 3300025297 Ga0209758_1001602 Ga0209758_100160217 305
508 3300025302 Ga0207426_1000065 Ga0207426_1000065149 305
509 3300041997 Ga0439431_0005666 Ga0439431_0005666_1348_2292 305
510 3300049574 Ga0501038_0027545 Ga0501038_0027545_3380_4318 305
511 3300049581 Ga0501047_0406122 Ga0501047_0406122_97_1035 305
512 3300049586 Ga0501070_0207899 Ga0501070_0207899_120_1058 305
513 3300049589 Ga0501073_0122498 Ga0501073_0122498_186_1124 305
514 3300049592 Ga0501076_0300308 Ga0501076_0300308_268_1209 305
515 3300049823 Ga0501044_0010628 Ga0501044_0010628_684_1622 305
516 3300049823 Ga0501044_0267514 Ga0501044_0267514_44_982 305
517 iso_pu_bacteria 2503198000 2503200952 305
518 iso_pu_bacteria 2508501127 2509144700 305
519 iso_pu_bacteria 2509276018 2509369536 305
520 iso_pu_bacteria 2509276022 2509395733 305
521 iso_pu_bacteria 2510065059 2510319292 305
522 iso_pu_bacteria 2512875026 2512969744 305
523 iso_pu_bacteria 2513237089 2513603100 305
524 iso_pu_bacteria 2513237090 2513611659 305
525 iso_pu_bacteria 2513237156 2513985826 305
526 iso_pu_bacteria 2513237160 2514004529 305
527 iso_pu_bacteria 2513237305 2514423071 305
528 iso_pu_bacteria 2517487022 2517565377 305
529 iso_pu_bacteria 2597489875 2597814607 305
530 iso_pu_bacteria 2643221595 2643987170 305
531 iso_pu_bacteria 2643221627 2644155720 305
532 iso_pu_bacteria 2687453392 2688597245 305
533 iso_pu_bacteria 2693429783 2694629540 305
534 iso_pu_bacteria 2693429784 2694639196 305
535 iso_pu_bacteria 2713897090 2715501878 305
536 iso_pu_bacteria 2721755686 2723577072 305
537 iso_pu_bacteria 2802428858 2802716170 305
538 iso_pu_bacteria 2802428859 2802722792 305
539 iso_pu_bacteria 2802428860 2802729063 305
540 iso_pu_bacteria 2802428861 2802735457 305
541 iso_pu_bacteria 2802428862 2802741967 305
542 iso_pu_bacteria 2802428863 2802748417 305
543 iso_pu_bacteria 2841734538 2841740582 305
544 iso_pu_bacteria 2844009547 2844012628 305
545 iso_pu_bacteria 2847670302 2847671437 305
546 iso_pu_bacteria 2847686936 2847687591 305
547 iso_pu_bacteria 2856314179 2856315396 305
548 iso_pu_bacteria 2856328259 2856334867 305
549 iso_pu_bacteria 2856334872 2856341582 305
550 iso_pu_bacteria 2856342000 2856347705 305
551 iso_pu_bacteria 2856349417 2856353000 305
552 iso_pu_bacteria 2856356410 2856362011 305
553 iso_pu_bacteria 2869162929 2869166736 305
554 iso_pu_bacteria 2869169390 2869171174 305
555 iso_pu_bacteria 2869234852 2869238808 305
556 iso_pu_bacteria 2869249662 2869251559 305
557 iso_pu_bacteria 2869256925 2869260094 305
558 iso_pu_bacteria 2869264136 2869271067 305
559 iso_pu_bacteria 2869271264 2869277775 305
560 iso_pu_bacteria 2871435913 2871436914 305
561 iso_pu_bacteria 2871444079 2871448473 305
562 iso_pu_bacteria 2871451962 2871454631 305
563 iso_pu_bacteria 2871459585 2871465716 305
564 iso_pu_bacteria 2871474448 2871478199 305
565 iso_pu_bacteria 2871481445 2871487693 305
566 iso_pu_bacteria 2871488783 2871493617 305
567 iso_pu_bacteria 2871495908 2871497150 305
568 iso_pu_bacteria 2874102143 2874103788 305
569 iso_pu_bacteria 2874109183 2874110345 305
570 iso_pu_bacteria 2874116593 2874122792 305
571 iso_pu_bacteria 2874123672 2874128309 305
572 iso_pu_bacteria 2874162495 2874167955 305
573 iso_pu_bacteria 2876369609 2876369641 305
574 iso_pu_bacteria 2876386047 2876389738 305
575 iso_pu_bacteria 2876392853 2876393334 305
576 iso_pu_bacteria 2876399893 2876402862 305
577 iso_pu_bacteria 2876406927 2876408478 305
578 iso_pu_bacteria 2876420981 2876427446 305
579 iso_pu_bacteria 2878035449 2878036541 305
580 iso_pu_bacteria 2878753008 2878756190 305
581 iso_pu_bacteria 2878760144 2878761371 305
582 iso_pu_bacteria 2878767105 2878768338 305
583 iso_pu_bacteria 2878774303 2878775067 305
584 iso_pu_bacteria 2878781027 2878783595 305
585 iso_pu_bacteria 2881147464 2881153238 305
586 iso_pu_bacteria 2881155292 2881156998 305
587 iso_pu_bacteria 2881161766 2881162432 305
588 iso_pu_bacteria 2881853255 2881860305 305
589 iso_pu_bacteria 2881861095 2881864926 305
590 iso_pu_bacteria 2882632389 2882633808 305
591 iso_pu_bacteria 2882912400 2882918126 305
592 iso_pu_bacteria 2885305155 2885311240 305
593 iso_pu_bacteria 2885312484 2885316899 305
594 iso_pu_bacteria 2885318864 2885321320 305
595 iso_pu_bacteria 2885326080 2885326412 305
596 iso_pu_bacteria 2885334103 2885334139 305
597 iso_pu_bacteria 2885342637 2885343951 305
598 iso_pu_bacteria 2885350715 2885352798 305
599 iso_pu_bacteria 2888343758 2888348046 305
600 iso_pu_bacteria 2888350351 2888356720 305
601 iso_pu_bacteria 2889016732 2889023298 305
602 iso_pu_bacteria 2903492973 2903502879 305
603 iso_pu_bacteria 2903513507 2903518434 305
604 iso_pu_bacteria 2903540706 2903541945 305
605 iso_pu_bacteria 2904659560 2904659840 305
606 iso_pu_bacteria 2906328253 2906332394 305
607 iso_pu_bacteria 2906354277 2906363077 305
608 iso_pu_bacteria 2906363423 2906364669 305
609 iso_pu_bacteria 2906370794 2906376935 305
610 iso_pu_bacteria 2906401398 2906401781 305
611 iso_pu_bacteria 2906408224 2906411358 305
612 iso_pu_bacteria 2906414383 2906415391 305
613 iso_pu_bacteria 2906427513 2906428634 305
614 iso_pu_bacteria 2915980308 2915983868 305
615 iso_pu_bacteria 2916061851 2916068473 305
616 iso_pu_bacteria 2921250672 2921256178 305
617 iso_pu_bacteria 2922130491 2922135487 305
618 iso_pu_bacteria 2922151315 2922155929 305
619 iso_pu_bacteria 2922158528 2922164775 305
620 iso_pu_bacteria 2922172374 2922177626 305
621 iso_pu_bacteria 2922185730 2922192519 305
622 iso_pu_bacteria 2923556063 2923560130 305
623 iso_pu_bacteria 2924726620 2924731900 305
624 iso_pu_bacteria 2924733363 2924737864 305
625 iso_pu_bacteria 2924741084 2924742682 305
626 iso_pu_bacteria 2924748358 2924749426 305
627 iso_pu_bacteria 2924754689 2924757663 305
628 iso_pu_bacteria 2924762789 2924765983 305
629 iso_pu_bacteria 2924784321 2924787760 305
630 iso_pu_bacteria 2937029754 2937032373 305
631 iso_pu_bacteria 2937036028 2937038359 305
632 iso_pu_bacteria 2937078374 2937081836 305
633 iso_pu_bacteria 2937084907 2937090310 305
634 iso_pu_bacteria 2937836603 2937839864 305
635 iso_pu_bacteria 2937843397 2937847157 305
636 iso_pu_bacteria 2937861824 2937862655 305
637 iso_pu_bacteria 2937891427 2937895313 305
638 iso_pu_bacteria 2937980651 2937981211 305
639 iso_pu_bacteria 2937994558 2937995801 305
640 iso_pu_bacteria 2957375807 2957381041 305
641 iso_pu_bacteria 2957437181 2957442761 305
642 iso_pu_bacteria 2958071322 2958075137 305
643 iso_pu_bacteria 2958100919 2958105500 305
644 iso_pu_bacteria 2958108152 2958115081 305
645 iso_pu_bacteria 2958115193 2958117427 305
646 iso_pu_bacteria 2958122699 2958129825 305
647 iso_pu_bacteria 2958158011 2958158294 305
648 iso_pu_bacteria 2958165035 2958166273 305
649 iso_pu_bacteria 2958172287 2958178764 305
650 iso_pu_bacteria 2960591022 2960596659 305
651 iso_pu_bacteria 2960631154 2960634555 305
652 iso_pu_bacteria 2960680706 2960685750 305
653 iso_pu_bacteria 2960693952 2960694977 305
654 iso_pu_bacteria 2961114664 2961115165 305
655 iso_pu_bacteria 2961127735 2961129929 305
656 iso_pu_bacteria 2961163497 2961164735 305
657 iso_pu_bacteria 2961170736 2961172478 305
658 iso_pu_bacteria 2965018300 2965019561 305
659 iso_pu_bacteria 2965025482 2965027622 305
660 iso_pu_bacteria 2965032056 2965036222 305
661 iso_pu_bacteria 2965040258 2965043331 305
662 iso_pu_bacteria 2965047637 2965049653 305
663 iso_pu_bacteria 2965062239 2965069431 305
664 iso_pu_bacteria 2965089291 2965090547 305
665 iso_pu_bacteria 2965102966 2965107375 305
666 iso_pu_bacteria 2965110997 2965111227 305
667 iso_pu_bacteria 2967686174 2967692657 305
668 iso_pu_bacteria 2967728569 2967731780 305
669 iso_pu_bacteria 2967996073 2967997694 305
670 iso_pu_bacteria 2968003550 2968008345 305
671 iso_pu_bacteria 2968091066 2968092941 305
672 iso_pu_bacteria 2968097103 2968099463 305
673 iso_pu_bacteria 2968110612 2968110897 305
674 iso_pu_bacteria 2968128360 2968133098 305
675 iso_pu_bacteria 2968138860 2968141127 305
676 iso_pu_bacteria 2968171901 2968173137 305
677 iso_pu_bacteria 2970026789 2970028495 305
678 iso_pu_bacteria 2970122695 2970124998 305
679 iso_pu_bacteria 2970143518 2970147095 305
680 iso_pu_bacteria 2970503327 2970505072 305
681 iso_pu_bacteria 2970510686 2970512376 305
682 iso_pu_bacteria 2970524798 2970531948 305
683 iso_pu_bacteria 2970547951 2970552323 305
684 iso_pu_bacteria 2970554993 2970556227 305
685 iso_pu_bacteria 2970619444 2970626596 305
686 iso_pu_bacteria 2970627176 2970627860 305
687 iso_pu_bacteria 2977530762 2977533169 305
688 iso_pu_bacteria 2977544691 2977546241 305
689 iso_pu_bacteria 2977821940 2977825371 305
690 iso_pu_bacteria 2977828996 2977832681 305
691 iso_pu_bacteria 2977851361 2977852028 305
692 iso_pu_bacteria 2977858184 2977864399 305
693 iso_pu_bacteria 2977864932 2977872198 305
694 iso_pu_bacteria 2977872689 2977873862 305
695 iso_pu_bacteria 2977898635 2977905079 305
696 iso_pu_bacteria 2977915119 2977916507 305
697 iso_pu_bacteria 2977935797 2977941667 305
698 iso_pu_bacteria 2977950692 2977951033 305
699 iso_pu_bacteria 2977957713 2977960463 305
700 iso_pu_bacteria 2977971508 2977974931 305
701 iso_pu_bacteria 2979710463 2979716027 305
702 iso_pu_bacteria 2979764755 2979769649 305
703 iso_pu_bacteria 2979779861 2979785685 305
704 iso_pu_bacteria 2979793036 2979797188 305
705 iso_pu_bacteria 2979808191 2979809793 305
706 iso_pu_bacteria 2987645492 2987648177 305
707 iso_pu_bacteria 2987659509 2987660744 305
708 iso_pu_bacteria 2987666974 2987668501 305
709 iso_pu_bacteria 2987673487 2987680947 305
710 iso_pu_bacteria 2996341866 2996342926 305
711 iso_pu_bacteria 2996386984 2996390032 305
712 iso_pu_bacteria 3004188549 3004189792 305
713 iso_pu_bacteria 3004232784 3004235874 305
714 iso_pu_bacteria 3004239961 3004243287 305
715 iso_pu_bacteria 3004268573 3004273895 305
716 iso_pu_bacteria 649633066 649871798 305
717 iso_pu_bacteria 8003999396 8004003859 305
718 iso_pu_bacteria 8004312739 8004312761 305
719 iso_pu_bacteria 8004361976 8004365153 305
720 iso_pu_bacteria 8004374579 8004377779 305
721 iso_pu_bacteria 8004395343 8004397840 305
722 iso_pu_bacteria 8004445564 8004448316 305
723 iso_pu_bacteria 8004633249 8004634517 305
724 iso_pu_bacteria 8004695233 8004702368 305
725 iso_pu_bacteria 8004703790 8004711312 305
726 iso_pu_bacteria 8004727605 8004731569 305
727 iso_pu_bacteria 8055617313 8055622157 305
728 3300005577 Ga0068857_100097381 Ga0068857_1000973812 306
729 3300006353 Ga0075370_10045211 Ga0075370_100452112 306
730 3300009093 Ga0105240_10151407 Ga0105240_101514072 306
731 3300025292 Ga0209676_1011806 Ga0209676_10118062 306
732 3300025913 Ga0207695_10134260 Ga0207695_101342602 306
733 3300025933 Ga0207706_10011643 Ga0207706_100116433 306
734 3300026116 Ga0207674_10011720 Ga0207674_1001172010 306
735 3300049569 Ga0501032_0002871 Ga0501032_0002871_8036_8974 306
736 3300049570 Ga0501033_0002505 Ga0501033_0002505_12285_13223 306
737 3300049571 Ga0501034_0031160 Ga0501034_0031160_4384_5322 306
738 3300049572 Ga0501036_0012812 Ga0501036_0012812_97_1035 306
739 3300049573 Ga0501037_0033589 Ga0501037_0033589_2754_3692 306
740 3300049575 Ga0501039_0245138 Ga0501039_0245138_415_1341 306
741 3300049578 Ga0501042_0178491 Ga0501042_0178491_134_1072 306
742 3300049579 Ga0501043_0002916 Ga0501043_0002916_13313_14251 306
743 3300049579 Ga0501043_0250813 Ga0501043_0250813_56_997 306
744 3300049580 Ga0501046_0002308 Ga0501046_0002308_8554_9492 306
745 3300049581 Ga0501047_0046794 Ga0501047_0046794_2755_3693 306
746 3300049584 Ga0501068_0317673 Ga0501068_0317673_12_953 306
747 3300049585 Ga0501069_0001322 Ga0501069_0001322_11010_11948 306
748 3300049586 Ga0501070_0002192 Ga0501070_0002192_8573_9511 306
749 3300049589 Ga0501073_0001103 Ga0501073_0001103_7761_8699 306
750 3300049590 Ga0501074_0001626 Ga0501074_0001626_8036_8974 306
751 3300049742 Ga0501080_0001592 Ga0501080_0001592_12929_13867 306
752 3300049742 Ga0501080_0068537 Ga0501080_0068537_1601_2542 306
753 3300049822 Ga0501035_0006474 Ga0501035_0006474_1066_2004 306
754 3300049823 Ga0501044_0018664 Ga0501044_0018664_2625_3563 306
755 3300049823 Ga0501044_0069128 Ga0501044_0069128_2401_3342 306
756 3300050496 nmdc:mga07m45_2012_c1 nmdc:mga07m45_2012_c1_6817_7758 306
757 3300053139 Ga0500568_0016368 Ga0500568_0016368_1920_2861 306
758 3300054114 Ga0501084_0138069 Ga0501084_0138069_965_1906 306
759 3300060353 Ga0501082_0083700 Ga0501082_0083700_126_1067 306
760 iso_pu_bacteria 2508501122 2509110550 306
761 iso_pu_bacteria 2509276019 2509377204 306
762 iso_pu_bacteria 2509276021 2509385618 306
763 iso_pu_bacteria 2509276033 2509448334 306
764 iso_pu_bacteria 2510065019 2510136430 306
765 iso_pu_bacteria 2510065057 2510307816 306
766 iso_pu_bacteria 2510461076 2510892309 306
767 iso_pu_bacteria 2510917028 2511185823 306
768 iso_pu_bacteria 2510917030 2511198101 306
769 iso_pu_bacteria 2511231027 2511392104 306
770 iso_pu_bacteria 2511231052 2511497571 306
771 iso_pu_bacteria 2512047086 2512530013 306
772 iso_pu_bacteria 2513237084 2513568059 306
773 iso_pu_bacteria 2513237085 2513578387 306
774 iso_pu_bacteria 2513237086 2513581826 306
775 iso_pu_bacteria 2513237091 2513619290 306
776 iso_pu_bacteria 2513237093 2513631000 306
777 iso_pu_bacteria 2513237103 2513711080 306
778 iso_pu_bacteria 2513237138 2513871129 306
779 iso_pu_bacteria 2513237140 2513887194 306
780 iso_pu_bacteria 2513237143 2513901446 306
781 iso_pu_bacteria 2513237159 2513999350 306
782 iso_pu_bacteria 2513237162 2514021106 306
783 iso_pu_bacteria 2515075009 2515108614 306
784 iso_pu_bacteria 2515154107 2515609860 306
785 iso_pu_bacteria 2515154113 2515632216 306
786 iso_pu_bacteria 2515154114 2515643532 306
787 iso_pu_bacteria 2515154116 2515658331 306
788 iso_pu_bacteria 2515154134 2515738117 306
789 iso_pu_bacteria 2516143018 2516207740 306
790 iso_pu_bacteria 2516653046 2516896770 306
791 iso_pu_bacteria 2516653077 2517041201 306
792 iso_pu_bacteria 2516653085 2517080173 306
793 iso_pu_bacteria 2517093000 2517098174 306
794 iso_pu_bacteria 2517287029 2517410063 306
795 iso_pu_bacteria 2524023207 2524451443 306
796 iso_pu_bacteria 2529292951 2530644671 306
797 iso_pu_bacteria 2551306084 2551677225 306
798 iso_pu_bacteria 2551306085 2551688377 306
799 iso_pu_bacteria 2551306086 2551697043 306
800 iso_pu_bacteria 2551306087 2551700604 306
801 iso_pu_bacteria 2551306089 2551715081 306
802 iso_pu_bacteria 2551306090 2551721344 306
803 iso_pu_bacteria 2551306090 2551722702 306
804 iso_pu_bacteria 2551306091 2551729428 306
805 iso_pu_bacteria 2551306092 2551738397 306
806 iso_pu_bacteria 2551306093 2551743855 306
807 iso_pu_bacteria 2558860100 2558862270 306
808 iso_pu_bacteria 2582581306 2585268517 306
809 iso_pu_bacteria 2582581866 2585394049 306
810 iso_pu_bacteria 2582581867 2585404966 306
811 iso_pu_bacteria 2585427526 2585525579 306
812 iso_pu_bacteria 2585427528 2585538690 306
813 iso_pu_bacteria 2585427590 2585820340 306
814 iso_pu_bacteria 2585427593 2585836643 306
815 iso_pu_bacteria 2599185352 2600196385 306
816 iso_pu_bacteria 2643221723 2644673521 306
817 iso_pu_bacteria 2657244999 2657683509 306
818 iso_pu_bacteria 2690316117 2692319273 306
819 iso_pu_bacteria 2718217927 2719388582 306
820 iso_pu_bacteria 2718217997 2719668391 306
821 iso_pu_bacteria 2718218199 2720489084 306
822 iso_pu_bacteria 2718218232 2720609776 306
823 iso_pu_bacteria 2718218233 2720617208 306
824 iso_pu_bacteria 2718218235 2720628349 306
825 iso_pu_bacteria 2718218269 2720772303 306
826 iso_pu_bacteria 2718218423 2721403207 306
827 iso_pu_bacteria 2721755556 2723029724 306
828 iso_pu_bacteria 2721755684 2723564093 306
829 iso_pu_bacteria 2721755685 2723570213 306
830 iso_pu_bacteria 2721755809 2724035564 306
831 iso_pu_bacteria 2721755819 2724092332 306
832 iso_pu_bacteria 2721755822 2724101760 306
833 iso_pu_bacteria 2721755823 2724112708 306
834 iso_pu_bacteria 2724679232 2725947835 306
835 iso_pu_bacteria 2728369352 2730110257 306
836 iso_pu_bacteria 2738541333 2739034113 306
837 iso_pu_bacteria 2751185821 2753458946 306
838 iso_pu_bacteria 2765235802 2765465966 306
839 iso_pu_bacteria 2765235942 2766065112 306
840 iso_pu_bacteria 2767802442 2770196602 306
841 iso_pu_bacteria 2775506902 2776269288 306
842 iso_pu_bacteria 2775506904 2776283573 306
843 iso_pu_bacteria 2791355082 2792584702 306
844 iso_pu_bacteria 2791355091 2792621517 306
845 iso_pu_bacteria 2791355092 2792627795 306
846 iso_pu_bacteria 2791355094 2792640235 306
847 iso_pu_bacteria 2791355256 2793297446 306
848 iso_pu_bacteria 2791355259 2793317317 306
849 iso_pu_bacteria 2791355262 2793336603 306
850 iso_pu_bacteria 2791355263 2793344512 306
851 iso_pu_bacteria 2791355266 2793358162 306
852 iso_pu_bacteria 2791355267 2793369828 306
853 iso_pu_bacteria 2802429268 2804754546 306
854 iso_pu_bacteria 2802429633 2806042910 306
855 iso_pu_bacteria 2802429634 2806050863 306
856 iso_pu_bacteria 2802429635 2806057969 306
857 iso_pu_bacteria 2802429636 2806065318 306
858 iso_pu_bacteria 2802429637 2806076801 306
859 iso_pu_bacteria 2838016132 2838016392 306
860 iso_pu_bacteria 2838042994 2838045838 306
861 iso_pu_bacteria 2838048938 2838049497 306
862 iso_pu_bacteria 2838061910 2838065226 306
863 iso_pu_bacteria 2838068647 2838068928 306
864 iso_pu_bacteria 2838074704 2838075652 306
865 iso_pu_bacteria 2838680041 2838686243 306
866 iso_pu_bacteria 2838686498 2838687470 306
867 iso_pu_bacteria 2838707686 2838713952 306
868 iso_pu_bacteria 2838729681 2838734118 306
869 iso_pu_bacteria 2838742623 2838746570 306
870 iso_pu_bacteria 2839993093 2839993599 306
871 iso_pu_bacteria 2840764183 2840766620 306
872 iso_pu_bacteria 2841851746 2841854020 306
873 iso_pu_bacteria 2841864319 2841869338 306
874 iso_pu_bacteria 2842077413 2842083350 306
875 iso_pu_bacteria 2842110456 2842116731 306
876 iso_pu_bacteria 2842118031 2842124297 306
877 iso_pu_bacteria 2842156927 2842159613 306
878 iso_pu_bacteria 2842163707 2842164062 306
879 iso_pu_bacteria 2842180545 2842182817 306
880 iso_pu_bacteria 2842205361 2842209370 306
881 iso_pu_bacteria 2842217011 2842221592 306
882 iso_pu_bacteria 2842229732 2842232528 306
883 iso_pu_bacteria 2842237096 2842243367 306
884 iso_pu_bacteria 2842243621 2842247229 306
885 iso_pu_bacteria 2842257432 2842259084 306
886 iso_pu_bacteria 2842271015 2842272496 306
887 iso_pu_bacteria 2842278818 2842282586 306
888 iso_pu_bacteria 2842291075 2842297549 306
889 iso_pu_bacteria 2842304105 2842309830 306
890 iso_pu_bacteria 2842311132 2842313405 306
891 iso_pu_bacteria 2842341865 2842344114 306
892 iso_pu_bacteria 2842363717 2842369247 306
893 iso_pu_bacteria 2842370503 2842376580 306
894 iso_pu_bacteria 2842377471 2842383833 306
895 iso_pu_bacteria 2842384541 2842390974 306
896 iso_pu_bacteria 2842395702 2842396474 306
897 iso_pu_bacteria 2842402390 2842405725 306
898 iso_pu_bacteria 2842409023 2842412309 306
899 iso_pu_bacteria 2842415677 2842418955 306
900 iso_pu_bacteria 2842422224 2842423074 306
901 iso_pu_bacteria 2842447887 2842448113 306
902 iso_pu_bacteria 2842521101 2842525142 306
903 iso_pu_bacteria 2842871566 2842874921 306
904 iso_pu_bacteria 2844454524 2844460466 306
905 iso_pu_bacteria 2847417321 2847422218 306
906 iso_pu_bacteria 2848992105 2848998283 306
907 iso_pu_bacteria 2850079185 2850085342 306
908 iso_pu_bacteria 2854896431 2854899957 306
909 iso_pu_bacteria 2855825444 2855828403 306
910 iso_pu_bacteria 2855839649 2855843515 306
911 iso_pu_bacteria 2855872281 2855875661 306
912 iso_pu_bacteria 2857516855 2857518031 306
913 iso_pu_bacteria 2858800743 2858807223 306
914 iso_pu_bacteria 2894652903 2894653442 306
915 iso_pu_bacteria 2896384573 2896388160 306
916 iso_pu_bacteria 2904578770 2904579703 306
917 iso_pu_bacteria 2913295892 2913296625 306
918 iso_pu_bacteria 2915986958 2915988998 306
919 iso_pu_bacteria 2915993759 2916000143 306
920 iso_pu_bacteria 2916000859 2916004805 306
921 iso_pu_bacteria 2916007675 2916013135 306
922 iso_pu_bacteria 2916014648 2916020228 306
923 iso_pu_bacteria 2916021584 2916027048 306
924 iso_pu_bacteria 2916028427 2916029956 306
925 iso_pu_bacteria 2916035215 2916041099 306
926 iso_pu_bacteria 2916041962 2916048577 306
927 iso_pu_bacteria 2916048683 2916052115 306
928 iso_pu_bacteria 2916055098 2916058735 306
929 iso_pu_bacteria 2916068649 2916075187 306
930 iso_pu_bacteria 2916076590 2916083036 306
931 iso_pu_bacteria 2919100787 2919102788 306
932 iso_pu_bacteria 2919119836 2919120630 306
933 iso_pu_bacteria 2920760137 2920764268 306
934 iso_pu_bacteria 2921201388 2921203076 306
935 iso_pu_bacteria 2921208531 2921210190 306
936 iso_pu_bacteria 2921237296 2921238613 306
937 iso_pu_bacteria 2921244191 2921247670 306
938 iso_pu_bacteria 2921257292 2921263499 306
939 iso_pu_bacteria 2921263974 2921265385 306
940 iso_pu_bacteria 2921282425 2921283176 306
941 iso_pu_bacteria 2921289301 2921296030 306
942 iso_pu_bacteria 2921296804 2921302015 306
943 iso_pu_bacteria 2924144063 2924148975 306
944 iso_pu_bacteria 2924150972 2924155391 306
945 iso_pu_bacteria 2924158325 2924158643 306
946 iso_pu_bacteria 2924165586 2924167298 306
947 iso_pu_bacteria 2924172951 2924175842 306
948 iso_pu_bacteria 2924179722 2924183893 306
949 iso_pu_bacteria 2924186466 2924193439 306
950 iso_pu_bacteria 2924193448 2924198812 306
951 iso_pu_bacteria 2924200457 2924204686 306
952 iso_pu_bacteria 2924207177 2924212270 306
953 iso_pu_bacteria 2924221636 2924222437 306
954 iso_pu_bacteria 2924228884 2924232556 306
955 iso_pu_bacteria 2928521798 2928522502 306
956 iso_pu_bacteria 2933570622 2933576272 306
957 iso_pu_bacteria 2933586486 2933592947 306
958 iso_pu_bacteria 2933599457 2933599596 306
959 iso_pu_bacteria 2935894831 2935900992 306
960 iso_pu_bacteria 2935901341 2935903163 306
961 iso_pu_bacteria 2936367885 2936374398 306
962 iso_pu_bacteria 2936375103 2936378760 306
963 iso_pu_bacteria 2936381700 2936386550 306
964 iso_pu_bacteria 2936996657 2936996673 306
965 iso_pu_bacteria 2937002841 2937008420 306
966 iso_pu_bacteria 2937009748 2937015607 306
967 iso_pu_bacteria 2937016420 2937020116 306
968 iso_pu_bacteria 2937023124 2937026374 306
969 iso_pu_bacteria 2937042894 2937043472 306
970 iso_pu_bacteria 2937049772 2937050472 306
971 iso_pu_bacteria 2937056579 2937057125 306
972 iso_pu_bacteria 2937063883 2937069051 306
973 iso_pu_bacteria 2937071275 2937076752 306
974 iso_pu_bacteria 2937091812 2937093341 306
975 iso_pu_bacteria 2937098957 2937099163 306
976 iso_pu_bacteria 2937106411 2937106759 306
977 iso_pu_bacteria 2937113482 2937116907 306
978 iso_pu_bacteria 2937119839 2937125302 306
979 iso_pu_bacteria 2937126314 2937131840 306
980 iso_pu_bacteria 2939669807 2939671540 306
981 iso_pu_bacteria 2954011201 2954014102 306
982 iso_pu_bacteria 2957382221 2957387240 306
983 iso_pu_bacteria 2957388812 2957394314 306
984 iso_pu_bacteria 2957402308 2957408160 306
985 iso_pu_bacteria 2957408893 2957412364 306
986 iso_pu_bacteria 2957415311 2957417886 306
987 iso_pu_bacteria 2957430029 2957437062 306
988 iso_pu_bacteria 2957443900 2957444073 306
989 iso_pu_bacteria 2957450854 2957455007 306
990 iso_pu_bacteria 2957457609 2957460768 306
991 iso_pu_bacteria 2957464669 2957470746 306
992 iso_pu_bacteria 2957471148 2957472808 306
993 iso_pu_bacteria 2957478035 2957479284 306
994 iso_pu_bacteria 2957484790 2957487216 306
995 iso_pu_bacteria 2957491536 2957497400 306
996 iso_pu_bacteria 2957498199 2957505431 306
997 iso_pu_bacteria 2957505466 2957506374 306
998 iso_pu_bacteria 2960584000 2960589895 306
999 iso_pu_bacteria 2960597568 2960603229 306
1000 iso_pu_bacteria 2960603979 2960607533 306
1001 iso_pu_bacteria 2960610863 2960616405 306
1002 iso_pu_bacteria 2960617483 2960619239 306
1003 iso_pu_bacteria 2960624210 2960624698 306
1004 iso_pu_bacteria 2960637947 2960642942 306
1005 iso_pu_bacteria 2960645483 2960645955 306
1006 iso_pu_bacteria 2960652885 2960653485 306
1007 iso_pu_bacteria 2960660292 2960662606 306
1008 iso_pu_bacteria 2960667422 2960673008 306
1009 iso_pu_bacteria 2960674078 2960678372 306
1010 iso_pu_bacteria 2960687367 2960692356 306
1011 iso_pu_bacteria 2964607997 2964608273 306
1012 iso_pu_bacteria 2964615318 2964621289 306
1013 iso_pu_bacteria 2964621998 2964622287 306
1014 iso_pu_bacteria 2964628898 2964632213 306
1015 iso_pu_bacteria 2964636051 2964639387 306
1016 iso_pu_bacteria 2964643177 2964647662 306
1017 iso_pu_bacteria 2964649959 2964653469 306
1018 iso_pu_bacteria 2964656573 2964658572 306
1019 iso_pu_bacteria 2964663802 2964670475 306
1020 iso_pu_bacteria 2964670856 2964675982 306
1021 iso_pu_bacteria 2964678106 2964681500 306
1022 iso_pu_bacteria 2964685014 2964685562 306
1023 iso_pu_bacteria 2964691889 2964692307 306
1024 iso_pu_bacteria 2964698721 2964699242 306
1025 iso_pu_bacteria 2964705432 2964708823 306
1026 iso_pu_bacteria 2964719344 2964720170 306
1027 iso_pu_bacteria 2967664464 2967666374 306
1028 iso_pu_bacteria 2967671571 2967672556 306
1029 iso_pu_bacteria 2967678726 2967679621 306
1030 iso_pu_bacteria 2967693043 2967696545 306
1031 iso_pu_bacteria 2967699805 2967701073 306
1032 iso_pu_bacteria 2967706974 2967707744 306
1033 iso_pu_bacteria 2967714385 2967717113 306
1034 iso_pu_bacteria 2967721400 2967728515 306
1035 iso_pu_bacteria 2967735183 2967741647 306
1036 iso_pu_bacteria 2967742019 2967743059 306
1037 iso_pu_bacteria 2967748971 2967753949 306
1038 iso_pu_bacteria 2967755722 2967761878 306
1039 iso_pu_bacteria 2967762386 2967766173 306
1040 iso_pu_bacteria 2967769361 2967771858 306
1041 iso_pu_bacteria 2967775926 2967777299 306
1042 iso_pu_bacteria 2970019648 2970023846 306
1043 iso_pu_bacteria 2970033650 2970040777 306
1044 iso_pu_bacteria 2970040964 2970047530 306
1045 iso_pu_bacteria 2970047711 2970054122 306
1046 iso_pu_bacteria 2970054988 2970055272 306
1047 iso_pu_bacteria 2970061556 2970063376 306
1048 iso_pu_bacteria 2970068827 2970075946 306
1049 iso_pu_bacteria 2970076120 2970081916 306
1050 iso_pu_bacteria 2970082768 2970085822 306
1051 iso_pu_bacteria 2970088815 2970092338 306
1052 iso_pu_bacteria 2970095765 2970096231 306
1053 iso_pu_bacteria 2970102677 2970107897 306
1054 iso_pu_bacteria 2970109326 2970109643 306
1055 iso_pu_bacteria 2970116247 2970122222 306
1056 iso_pu_bacteria 2970129317 2970132521 306
1057 iso_pu_bacteria 2970136068 2970136903 306
1058 iso_pu_bacteria 2970149975 2970156076 306
1059 iso_pu_bacteria 2970156795 2970157607 306
1060 iso_pu_bacteria 2970164137 2970169439 306
1061 iso_pu_bacteria 2970170962 2970176499 306
1062 iso_pu_bacteria 2970177841 2970182851 306
1063 iso_pu_bacteria 2970184632 2970188970 306
1064 iso_pu_bacteria 2970191845 2970198620 306
1065 iso_pu_bacteria 2977516862 2977520423 306
1066 iso_pu_bacteria 2977523885 2977526837 306
1067 iso_pu_bacteria 2977537788 2977538340 306
1068 iso_pu_bacteria 2977551784 2977555670 306
1069 iso_pu_bacteria 2977558990 2977562918 306
1070 iso_pu_bacteria 2977565890 2977569642 306
1071 iso_pu_bacteria 2977572785 2977572954 306
1072 iso_pu_bacteria 2977579622 2977583107 306
1073 iso_pu_bacteria 2996310559 2996316206 306
1074 iso_pu_bacteria 3003930520 3003934209 306
1075 iso_pu_bacteria 643692032 643823876 306
1076 iso_pu_bacteria 648276728 648740341 306
1077 iso_pu_bacteria 8003992118 8003996094 306
1078 iso_pu_bacteria 8005275841 8005277298 306
1079 iso_pu_bacteria 8005282627 8005287612 306
1080 iso_pu_bacteria 8005289223 8005295519 306
1081 iso_pu_bacteria 8005301065 8005306311 306
1082 iso_pu_bacteria 8005307578 8005307932 306
1083 iso_pu_bacteria 8005376324 8005379799 306
1084 iso_pu_bacteria 8005430974 8005431768 306
1085 iso_pu_bacteria 8005460587 8005467212 306
1086 iso_pu_bacteria 8005497431 8005502599 306
1087 iso_pu_bacteria 8005556819 8005562359 306
1088 iso_pu_bacteria 8005563573 8005565521 306
1089 iso_pu_bacteria 8005570704 8005575763 306
1090 iso_pu_bacteria 8005619151 8005623806 306
1091 iso_pu_bacteria 8005626139 8005626365 306
1092 iso_pu_bacteria 8005668836 8005674028 306
1093 iso_pu_bacteria 8005688590 8005693993 306
1094 iso_pu_bacteria 8005695170 8005701815 306
1095 iso_pu_bacteria 8018163183 8018165503 306
1096 iso_pu_bacteria 8018176218 8018182374 306
1097 iso_pu_bacteria 8023680758 8023688084 306
1098 iso_pu_bacteria 8024479707 8024485039 306
1099 iso_pu_bacteria 8045864390 8045867007 306
1100 iso_pu_bacteria 8049293176 8049296778 306
1101 iso_pu_bacteria 8054558443 8054559313 306
1102 iso_pu_bacteria 8056375014 8056375042 306
1103 iso_pu_bacteria 8057874678 8057878014 306
1104 3300006048 Ga0075363_100156153 Ga0075363_1001561531 307
1105 3300031456 Ga0307513_10028483 Ga0307513_100284833 307
1106 3300031728 Ga0316578_10129310 Ga0316578_101293102 307
1107 3300033179 Ga0307507_10047478 Ga0307507_100474783 307
1108 3300037466 Ga0395898_0161500 Ga0395898_0161500_500_1438 307
1109 3300042876 Ga0451577_0016723 Ga0451577_0016723_5143_6093 307
1110 3300049570 Ga0501033_0101516 Ga0501033_0101516_762_1769 307
1111 3300049573 Ga0501037_0144077 Ga0501037_0144077_587_1525 307
1112 3300049583 Ga0501067_0240352 Ga0501067_0240352_37_975 307
1113 3300049584 Ga0501068_0007123 Ga0501068_0007123_5023_6030 307
1114 3300049586 Ga0501070_0048714 Ga0501070_0048714_2337_3275 307
1115 3300049588 Ga0501072_0175271 Ga0501072_0175271_166_1104 307
1116 3300049589 Ga0501073_0041167 Ga0501073_0041167_843_1781 307
1117 3300049742 Ga0501080_0048231 Ga0501080_0048231_2846_3784 307
1118 3300049822 Ga0501035_0141374 Ga0501035_0141374_756_1763 307
1119 3300049823 Ga0501044_0153181 Ga0501044_0153181_762_1700 307
1120 3300049823 Ga0501044_0177481 Ga0501044_0177481_762_1769 307
1121 3300053087 Ga0500643_044588 Ga0500643_044588_192_1133 307
1122 iso_pu_bacteria 2508501050 2508728167 307
1123 iso_pu_bacteria 2510917022 2511136356 307
1124 iso_pu_bacteria 2513237146 2513927215 307
1125 iso_pu_bacteria 2524023209 2524462978 307
1126 iso_pu_bacteria 2582581307 2585274723 307
1127 iso_pu_bacteria 2585427531 2585562089 307
1128 iso_pu_bacteria 2585427608 2585902392 307
1129 iso_pu_bacteria 2585427609 2585907835 307
1130 iso_pu_bacteria 2585428125 2587983255 307
1131 iso_pu_bacteria 2599185170 2599415344 307
1132 iso_pu_bacteria 2667528174 2671113071 307
1133 iso_pu_bacteria 2818991448 2819612348 307
1134 iso_pu_bacteria 2835312727 2835316040 307
1135 iso_pu_bacteria 2838029111 2838031592 307
1136 iso_pu_bacteria 2838035591 2838038931 307
1137 iso_pu_bacteria 2838661181 2838664479 307
1138 iso_pu_bacteria 2842298080 2842303873 307
1139 iso_pu_bacteria 2842357229 2842362696 307
1140 iso_pu_bacteria 2842475841 2842478324 307
1141 iso_pu_bacteria 2842502639 2842505730 307
1142 iso_pu_bacteria 2894232714 2894237775 307
1143 iso_pu_bacteria 2909042592 2909047803 307
1144 iso_pu_bacteria 2919408235 2919412858 307
1145 iso_pu_bacteria 2933016740 2933022950 307
1146 iso_pu_bacteria 2996336353 2996339820 307
1147 iso_pu_bacteria 3005409236 3005413506 307
1148 iso_pu_bacteria 3005416602 3005419787 307
1149 iso_pu_bacteria 8005314921 8005317789 307
1150 iso_pu_bacteria 8005484373 8005486760 307
1151 iso_pu_bacteria 8005645114 8005645609 307
1152 iso_pu_bacteria 8005682033 8005686801 307
1153 3300003215 JGI25153J46596_10000042 JGI25153J46596_10000042116 308
1154 3300003215 JGI25153J46596_10000087 JGI25153J46596_1000008710 308
1155 3300005455 Ga0070663_100023155 Ga0070663_1000231554 308
1156 3300005844 Ga0068862_100004384 Ga0068862_1000043847 308
1157 3300005985 Ga0081539_10064645 Ga0081539_100646452 308
1158 3300006186 Ga0075369_10002677 Ga0075369_100026778 308
1159 3300025297 Ga0209758_1000110 Ga0209758_100011088 308
1160 3300025297 Ga0209758_1030022 Ga0209758_10300222 308
1161 3300025298 Ga0209050_1023735 Ga0209050_10237352 308
1162 3300025304 Ga0209257_1000376 Ga0209257_100037631 308
1163 3300026067 Ga0207678_10041294 Ga0207678_100412944 308
1164 3300028380 Ga0268265_10055740 Ga0268265_100557402 308
1165 3300031730 Ga0307516_10058949 Ga0307516_100589493 308
1166 3300046460 Ga0495638_0053901 Ga0495638_0053901_752_1699 308
1167 3300046660 Ga0495625_0014315 Ga0495625_0014315_1611_2582 308
1168 3300046660 Ga0495625_0240517 Ga0495625_0240517_14_961 308
1169 3300046691 Ga0495670_0080575 Ga0495670_0080575_670_1596 308
1170 3300046694 Ga0495649_0006612 Ga0495649_0006612_3353_4324 308
1171 3300046810 Ga0495660_0026540 Ga0495660_0026540_226_1197 308
1172 3300047443 Ga0495687_018940 Ga0495687_018940_700_1671 308
1173 3300049575 Ga0501039_0201010 Ga0501039_0201010_118_1065 308
1174 3300050496 nmdc:mga07m45_62540_c1 nmdc:mga07m45_62540_c1_581_1537 308
1175 3300050516 nmdc:mga0sz30_18177_c1 nmdc:mga0sz30_18177_c1_1019_1975 308
1176 3300053130 Ga0500642_0001036 Ga0500642_0001036_708_1655 308
1177 3300053134 Ga0500658_0007229 Ga0500658_0007229_2939_3910 308
1178 3300053146 Ga0500588_0029486 Ga0500588_0029486_10_957 308
1179 3300053151 Ga0500604_0010562 Ga0500604_0010562_383_1330 308
1180 iso_pu_bacteria 2513237087 2513591256 308
1181 iso_pu_bacteria 2643221558 2643814632 308
1182 iso_pu_bacteria 2837678835 2837682159 308
1183 iso_pu_bacteria 2842694124 2842695718 308
1184 iso_pu_bacteria 2855020534 2855022100 308
1185 iso_pu_bacteria 639633055 639644989 308
1186 iso_pu_bacteria 8018150411 8018150445 308
1187 3300003792 Ga0055540_1009900 Ga0055540_10099002 309
1188 3300003794 Ga0055531_10000192 Ga0055531_1000019268 309
1189 3300005338 Ga0068868_100238094 Ga0068868_1002380942 309
1190 3300005344 Ga0070661_100133299 Ga0070661_1001332992 309
1191 3300005356 Ga0070674_100193148 Ga0070674_1001931482 309
1192 3300005441 Ga0070700_100040608 Ga0070700_1000406082 309
1193 3300005458 Ga0070681_10397484 Ga0070681_103974842 309
1194 3300005539 Ga0068853_100095778 Ga0068853_1000957781 309
1195 3300005577 Ga0068857_100290409 Ga0068857_1002904092 309
1196 3300005718 Ga0068866_10134408 Ga0068866_101344082 309
1197 3300005981 Ga0081538_10112765 Ga0081538_101127651 309
1198 3300006058 Ga0075432_10016468 Ga0075432_100164682 309
1199 3300006178 Ga0075367_10048271 Ga0075367_100482711 309
1200 3300006195 Ga0075366_10193510 Ga0075366_101935102 309
1201 3300006846 Ga0075430_100057231 Ga0075430_1000572312 309
1202 3300006847 Ga0075431_100014362 Ga0075431_1000143622 309
1203 3300006946 Ga0079104_1006482 Ga0079104_10064824 309
1204 3300006946 Ga0079104_1006593 Ga0079104_10065932 309
1205 3300006948 Ga0099826_10179734 Ga0099826_101797341 309
1206 3300009147 Ga0114129_10002208 Ga0114129_100022086 309
1207 3300009174 Ga0105241_10170531 Ga0105241_101705311 309
1208 3300009545 Ga0105237_10111587 Ga0105237_101115872 309
1209 3300010375 Ga0105239_10112133 Ga0105239_101121333 309
1210 3300011119 Ga0105246_10221040 Ga0105246_102210401 309
1211 3300013296 Ga0157374_10359312 Ga0157374_103593122 309
1212 3300013308 Ga0157375_10210215 Ga0157375_102102152 309
1213 3300014326 Ga0157380_10007607 Ga0157380_100076073 309
1214 3300021377 Ga0213874_10027685 Ga0213874_100276852 309
1215 3300022739 Ga0228711_1000045 Ga0228711_100004510 309
1216 3300022740 Ga0228710_1000036 Ga0228710_100003692 309
1217 3300025273 Ga0209673_1009563 Ga0209673_10095634 309
1218 3300025297 Ga0209758_1034835 Ga0209758_10348352 309
1219 3300025303 Ga0209051_1000281 Ga0209051_100028184 309
1220 3300025304 Ga0209257_1000039 Ga0209257_100003998 309
1221 3300025899 Ga0207642_10138412 Ga0207642_101384121 309
1222 3300025914 Ga0207671_10065756 Ga0207671_100657563 309
1223 3300025920 Ga0207649_10112774 Ga0207649_101127742 309
1224 3300025926 Ga0207659_10047482 Ga0207659_100474822 309
1225 3300025944 Ga0207661_10187473 Ga0207661_101874732 309
1226 3300025945 Ga0207679_10143879 Ga0207679_101438792 309
1227 3300025949 Ga0207667_10048606 Ga0207667_100486064 309
1228 3300025972 Ga0207668_10077168 Ga0207668_100771682 309
1229 3300026041 Ga0207639_10016794 Ga0207639_100167945 309
1230 3300026075 Ga0207708_10058747 Ga0207708_100587472 309
1231 3300026116 Ga0207674_10257878 Ga0207674_102578781 309
1232 3300027111 Ga0209281_1000178 Ga0209281_100017827 309
1233 3300027111 Ga0209281_1000417 Ga0209281_100041763 309
1234 3300027666 Ga0209282_1000023 Ga0209282_100002353 309
1235 3300027907 Ga0207428_10074571 Ga0207428_100745712 309
1236 3300031548 Ga0307408_100217199 Ga0307408_1002171992 309
1237 3300031730 Ga0307516_10307254 Ga0307516_103072541 309
1238 3300031731 Ga0307405_10105597 Ga0307405_101055972 309
1239 3300031852 Ga0307410_10126557 Ga0307410_101265572 309
1240 3300031852 Ga0307410_10414393 Ga0307410_104143931 309
1241 3300031903 Ga0307407_10161473 Ga0307407_101614732 309
1242 3300031967 Ga0315914_1000016 Ga0315914_100001610 309
1243 3300031995 Ga0307409_100376629 Ga0307409_1003766292 309
1244 3300031995 Ga0307409_100509822 Ga0307409_1005098222 309
1245 3300032002 Ga0307416_100353900 Ga0307416_1003539002 309
1246 3300032004 Ga0307414_10107416 Ga0307414_101074162 309
1247 3300032005 Ga0307411_10031050 Ga0307411_100310502 309
1248 3300033430 Ga0315913_1000027 Ga0315913_100002784 309
1249 3300033464 Ga0315915_1000007 Ga0315915_100000788 309
1250 3300035410 Ga0373924_0112174 Ga0373924_0112174_49_1008 309
1251 3300037471 Ga0395905_0000377 Ga0395905_0000377_38444_39403 309
1252 3300037471 Ga0395905_0014555 Ga0395905_0014555_1560_2504 309
1253 3300037853 Ga0436364_0780289 Ga0436364_0780289_175_1125 309
1254 3300037853 Ga0436364_1376234 Ga0436364_1376234_89_1039 309
1255 3300039447 Ga0436361_0589976 Ga0436361_0589976_121_1071 309
1256 3300039450 Ga0436363_0629987 Ga0436363_0629987_2599_3549 309
1257 3300044901 Ga0466960_0066206 Ga0466960_0066206_152_1096 309
1258 3300048905 Ga0496102_0148052 Ga0496102_0148052_885_1844 309
1259 3300048922 Ga0496119_0008868 Ga0496119_0008868_33_986 309
1260 3300048925 Ga0496122_0023409 Ga0496122_0023409_2474_3427 309
1261 3300048928 Ga0496125_0000471 Ga0496125_0000471_36023_36976 309
1262 3300049743 Ga0501081_0408593 Ga0501081_0408593_11_949 309
1263 3300050507 nmdc:mga05p37_40366_c1 nmdc:mga05p37_40366_c1_729_1670 309
1264 3300050509 nmdc:mga0qj67_77679_c1 nmdc:mga0qj67_77679_c1_969_1910 309
1265 3300050510 nmdc:mga06r32_22751_c1 nmdc:mga06r32_22751_c1_2849_3790 309
1266 iso_pu_bacteria 2751185800 2753361092 309
1267 iso_pu_bacteria 2821443989 2821450963 309
1268 iso_pu_bacteria 2828305725 2828310328 309
1269 3300002739 JGI25158J39367_1000448 JGI25158J39367_10004481 310
1270 3300002773 JGI25152J39213_1005931 JGI25152J39213_10059314 310
1271 3300002987 JGI25159J45721_1000071 JGI25159J45721_100007134 310
1272 3300002987 JGI25159J45721_1000191 JGI25159J45721_100019118 310
1273 3300002987 JGI25159J45721_1013545 JGI25159J45721_10135451 310
1274 3300003187 JGI25151J46595_10000508 JGI25151J46595_1000050827 310
1275 3300003215 JGI25153J46596_10002535 JGI25153J46596_1000253512 310
1276 3300003215 JGI25153J46596_10010647 JGI25153J46596_100106472 310
1277 3300003215 JGI25153J46596_10014909 JGI25153J46596_100149092 310
1278 3300003323 rootH1_10191308 rootH1_101913082 310
1279 3300003354 JGI25160J50197_1000162 JGI25160J50197_100016229 310
1280 3300003354 JGI25160J50197_1001578 JGI25160J50197_100157812 310
1281 3300003374 JGI25161J50226_1000075 JGI25161J50226_100007555 310
1282 3300003374 JGI25161J50226_1006294 JGI25161J50226_10062941 310
1283 3300003771 Ga0055526_1001457 Ga0055526_10014574 310
1284 3300003771 Ga0055526_1004947 Ga0055526_10049478 310
1285 3300003771 Ga0055526_1005597 Ga0055526_10055972 310
1286 3300003775 Ga0055524_1006553 Ga0055524_10065533 310
1287 3300003781 Ga0055536_1000667 Ga0055536_100066711 310
1288 3300003784 Ga0055534_1002873 Ga0055534_10028735 310
1289 3300003790 Ga0055528_1000054 Ga0055528_100005461 310
1290 3300003790 Ga0055528_1002349 Ga0055528_10023493 310
1291 3300003790 Ga0055528_1009718 Ga0055528_10097183 310
1292 3300003790 Ga0055528_1023104 Ga0055528_10231042 310
1293 3300003792 Ga0055540_1000255 Ga0055540_100025522 310
1294 3300003794 Ga0055531_10016286 Ga0055531_100162862 310
1295 3300004625 Ga0055543_1000096 Ga0055543_100009643 310
1296 3300004625 Ga0055543_1000578 Ga0055543_10005783 310
1297 3300004625 Ga0055543_1001124 Ga0055543_10011246 310
1298 3300005262 Ga0065165_1000535 Ga0065165_100053529 310
1299 3300005262 Ga0065165_1007353 Ga0065165_10073533 310
1300 3300005262 Ga0065165_1011236 Ga0065165_10112365 310
1301 3300005353 Ga0070669_100244746 Ga0070669_1002447462 310
1302 3300005467 Ga0070706_100196043 Ga0070706_1001960432 310
1303 3300005577 Ga0068857_100543437 Ga0068857_1005434371 310
1304 3300005937 Ga0081455_10232284 Ga0081455_102322842 310
1305 3300005981 Ga0081538_10036106 Ga0081538_100361062 310
1306 3300006038 Ga0075365_10013860 Ga0075365_100138603 310
1307 3300006038 Ga0075365_10016988 Ga0075365_100169882 310
1308 3300006038 Ga0075365_10111174 Ga0075365_101111742 310
1309 3300006048 Ga0075363_100053961 Ga0075363_1000539612 310
1310 3300006177 Ga0075362_10006876 Ga0075362_100068762 310
1311 3300006186 Ga0075369_10039559 Ga0075369_100395592 310
1312 3300006195 Ga0075366_10021996 Ga0075366_100219962 310
1313 3300006847 Ga0075431_100219742 Ga0075431_1002197422 310
1314 3300006852 Ga0075433_10129370 Ga0075433_101293702 310
1315 3300009094 Ga0111539_10000285 Ga0111539_1000028538 310
1316 3300009765 Ga0123341_1000012 Ga0123341_100001247 310
1317 3300013104 Ga0157370_10149843 Ga0157370_101498432 310
1318 3300015265 Ga0182005_1006788 Ga0182005_10067883 310
1319 3300021320 Ga0214544_1001716 Ga0214544_100171633 310
1320 3300021321 Ga0214542_1000082 Ga0214542_100008212 310
1321 3300021327 Ga0214543_1000075 Ga0214543_100007512 310
1322 3300025208 Ga0209436_100035 Ga0209436_10003514 310
1323 3300025245 Ga0207425_1002132 Ga0207425_10021325 310
1324 3300025258 Ga0209129_1003154 Ga0209129_10031544 310
1325 3300025273 Ga0209673_1000067 Ga0209673_1000067171 310
1326 3300025273 Ga0209673_1000750 Ga0209673_100075023 310
1327 3300025273 Ga0209673_1001376 Ga0209673_100137623 310
1328 3300025273 Ga0209673_1004094 Ga0209673_10040947 310
1329 3300025273 Ga0209673_1014607 Ga0209673_10146072 310
1330 3300025284 Ga0209130_1000031 Ga0209130_1000031190 310
1331 3300025284 Ga0209130_1000147 Ga0209130_100014738 310
1332 3300025284 Ga0209130_1005106 Ga0209130_10051063 310
1333 3300025291 Ga0209675_1001148 Ga0209675_100114815 310
1334 3300025292 Ga0209676_1006751 Ga0209676_10067512 310
1335 3300025294 Ga0209025_1000240 Ga0209025_100024049 310
1336 3300025294 Ga0209025_1000397 Ga0209025_100039773 310
1337 3300025294 Ga0209025_1040334 Ga0209025_10403342 310
1338 3300025294 Ga0209025_1049135 Ga0209025_10491352 310
1339 3300025295 Ga0209564_1000092 Ga0209564_1000092171 310
1340 3300025295 Ga0209564_1000511 Ga0209564_10005118 310
1341 3300025295 Ga0209564_1000925 Ga0209564_10009257 310
1342 3300025295 Ga0209564_1001127 Ga0209564_100112719 310
1343 3300025297 Ga0209758_1000504 Ga0209758_100050439 310
1344 3300025297 Ga0209758_1000585 Ga0209758_100058512 310
1345 3300025297 Ga0209758_1005532 Ga0209758_10055329 310
1346 3300025297 Ga0209758_1050320 Ga0209758_10503202 310
1347 3300025298 Ga0209050_1004942 Ga0209050_10049426 310
1348 3300025298 Ga0209050_1021600 Ga0209050_10216002 310
1349 3300025299 Ga0209256_1000170 Ga0209256_1000170111 310
1350 3300025299 Ga0209256_1004342 Ga0209256_10043427 310
1351 3300025299 Ga0209256_1007078 Ga0209256_10070785 310
1352 3300025299 Ga0209256_1015056 Ga0209256_10150562 310
1353 3300025302 Ga0207426_1000042 Ga0207426_1000042220 310
1354 3300025302 Ga0207426_1000267 Ga0207426_100026781 310
1355 3300025302 Ga0207426_1000355 Ga0207426_100035564 310
1356 3300025303 Ga0209051_1000062 Ga0209051_100006265 310
1357 3300025303 Ga0209051_1009790 Ga0209051_10097902 310
1358 3300025303 Ga0209051_1039794 Ga0209051_10397942 310
1359 3300025304 Ga0209257_1000970 Ga0209257_100097018 310
1360 3300025304 Ga0209257_1007196 Ga0209257_10071964 310
1361 3300025304 Ga0209257_1049783 Ga0209257_10497832 310
1362 3300025904 Ga0207647_10195773 Ga0207647_101957732 310
1363 3300025910 Ga0207684_10106293 Ga0207684_101062932 310
1364 3300025923 Ga0207681_10172367 Ga0207681_101723672 310
1365 3300025932 Ga0207690_10208126 Ga0207690_102081262 310
1366 3300025981 Ga0207640_10233545 Ga0207640_102335452 310
1367 3300026118 Ga0207675_100270391 Ga0207675_1002703912 310
1368 3300027907 Ga0207428_10000339 Ga0207428_1000033938 310
1369 3300028380 Ga0268265_10317874 Ga0268265_103178742 310
1370 3300028794 Ga0307515_10000145 Ga0307515_10000145124 310
1371 3300028794 Ga0307515_10024560 Ga0307515_100245604 310
1372 3300031548 Ga0307408_100041302 Ga0307408_1000413023 310
1373 3300031730 Ga0307516_10138472 Ga0307516_101384722 310
1374 3300031901 Ga0307406_10158956 Ga0307406_101589562 310
1375 3300038443 Ga0395901_0269656 Ga0395901_0269656_721_1674 310
1376 3300041509 Ga0451843_0757209 Ga0451843_0757209_362_1294 310
1377 3300041512 Ga0451853_2198736 Ga0451853_2198736_667_1599 310
1378 3300041512 Ga0451853_2516453 Ga0451853_2516453_36_968 310
1379 3300046460 Ga0495638_0000475 Ga0495638_0000475_4622_5554 310
1380 3300046522 Ga0495643_0059573 Ga0495643_0059573_676_1608 310
1381 3300046542 Ga0495597_0018419 Ga0495597_0018419_1531_2463 310
1382 3300048919 Ga0496116_0009436 Ga0496116_0009436_5547_6479 310
1383 3300048921 Ga0496118_0002068 Ga0496118_0002068_6891_7823 310
1384 3300048924 Ga0496121_0000239 Ga0496121_0000239_112750_113682 310
1385 3300048926 Ga0496123_0045546 Ga0496123_0045546_1049_1981 310
1386 3300048927 Ga0496124_0073085 Ga0496124_0073085_894_1826 310
1387 3300048928 Ga0496125_0010847 Ga0496125_0010847_4855_5787 310
1388 3300049568 Ga0501031_0013786 Ga0501031_0013786_1049_2002 310
1389 3300049569 Ga0501032_0167929 Ga0501032_0167929_64_1017 310
1390 3300049569 Ga0501032_0180722 Ga0501032_0180722_437_1369 310
1391 3300049570 Ga0501033_0010498 Ga0501033_0010498_5056_6009 310
1392 3300049570 Ga0501033_0050127 Ga0501033_0050127_1526_2479 310
1393 3300049570 Ga0501033_0236793 Ga0501033_0236793_152_1084 310
1394 3300049571 Ga0501034_0055207 Ga0501034_0055207_2920_3873 310
1395 3300049571 Ga0501034_0225363 Ga0501034_0225363_236_1168 310
1396 3300049572 Ga0501036_0173751 Ga0501036_0173751_569_1501 310
1397 3300049573 Ga0501037_0000107 Ga0501037_0000107_24096_25049 310
1398 3300049573 Ga0501037_0102109 Ga0501037_0102109_85_1017 310
1399 3300049573 Ga0501037_0201802 Ga0501037_0201802_425_1378 310
1400 3300049574 Ga0501038_0098912 Ga0501038_0098912_1242_2174 310
1401 3300049574 Ga0501038_0236680 Ga0501038_0236680_405_1358 310
1402 3300049579 Ga0501043_0000005 Ga0501043_0000005_245701_246654 310
1403 3300049579 Ga0501043_0042607 Ga0501043_0042607_231_1163 310
1404 3300049579 Ga0501043_0212931 Ga0501043_0212931_514_1467 310
1405 3300049580 Ga0501046_0182122 Ga0501046_0182122_544_1497 310
1406 3300049580 Ga0501046_0269625 Ga0501046_0269625_239_1183 310
1407 3300049581 Ga0501047_0024292 Ga0501047_0024292_4047_5000 310
1408 3300049581 Ga0501047_0025195 Ga0501047_0025195_723_1676 310
1409 3300049581 Ga0501047_0061392 Ga0501047_0061392_765_1697 310
1410 3300049581 Ga0501047_0091859 Ga0501047_0091859_652_1605 310
1411 3300049585 Ga0501069_0000033 Ga0501069_0000033_83667_84620 310
1412 3300049585 Ga0501069_0059776 Ga0501069_0059776_640_1593 310
1413 3300049586 Ga0501070_0000739 Ga0501070_0000739_18097_19050 310
1414 3300049586 Ga0501070_0000913 Ga0501070_0000913_475_1428 310
1415 3300049586 Ga0501070_0052204 Ga0501070_0052204_1268_2221 310
1416 3300049586 Ga0501070_0062213 Ga0501070_0062213_1840_2793 310
1417 3300049587 Ga0501071_0217626 Ga0501071_0217626_447_1400 310
1418 3300049589 Ga0501073_0060391 Ga0501073_0060391_768_1721 310
1419 3300049589 Ga0501073_0093108 Ga0501073_0093108_62_1015 310
1420 3300049590 Ga0501074_0000571 Ga0501074_0000571_14016_14969 310
1421 3300049590 Ga0501074_0076350 Ga0501074_0076350_1043_1996 310
1422 3300049742 Ga0501080_0001237 Ga0501080_0001237_16206_17159 310
1423 3300049742 Ga0501080_0017171 Ga0501080_0017171_5168_6121 310
1424 3300049742 Ga0501080_0145255 Ga0501080_0145255_701_1654 310
1425 3300049744 Ga0501083_0000355 Ga0501083_0000355_3425_4378 310
1426 3300049744 Ga0501083_0028777 Ga0501083_0028777_1598_2530 310
1427 3300049822 Ga0501035_0000086 Ga0501035_0000086_107012_107965 310
1428 3300049822 Ga0501035_0009526 Ga0501035_0009526_4455_5408 310
1429 3300049822 Ga0501035_0083516 Ga0501035_0083516_306_1259 310
1430 3300049822 Ga0501035_0098834 Ga0501035_0098834_1545_2498 310
1431 3300049822 Ga0501035_0169890 Ga0501035_0169890_812_1744 310
1432 3300049823 Ga0501044_0000223 Ga0501044_0000223_37969_38922 310
1433 3300049823 Ga0501044_0014960 Ga0501044_0014960_3194_4147 310
1434 3300049823 Ga0501044_0015139 Ga0501044_0015139_1907_2860 310
1435 3300049823 Ga0501044_0031354 Ga0501044_0031354_1769_2722 310
1436 3300049823 Ga0501044_0114589 Ga0501044_0114589_387_1319 310
1437 3300049823 Ga0501044_0375135 Ga0501044_0375135_284_1237 310
1438 3300050489 nmdc:mga03683_117211_c1 nmdc:mga03683_117211_c1_171_1130 310
1439 3300050491 nmdc:mga00v17_14_c1 nmdc:mga00v17_14_c1_104153_105085 310
1440 3300050494 nmdc:mga06z11_20882_c2 nmdc:mga06z11_20882_c2_982_1944 310
1441 3300050511 nmdc:mga08y16_1044_c1 nmdc:mga08y16_1044_c1_11719_12663 310
1442 3300050515 nmdc:mga0a205_377792_c1 nmdc:mga0a205_377792_c1_300_1244 310
1443 3300053134 Ga0500658_0002498 Ga0500658_0002498_6146_7078 310
1444 3300053146 Ga0500588_0017792 Ga0500588_0017792_336_1286 310
1445 3300053153 Ga0500616_0000472 Ga0500616_0000472_8461_9393 310
1446 3300053161 Ga0500634_0000507 Ga0500634_0000507_10255_11187 310
1447 3300053730 Ga0500645_007944 Ga0500645_007944_2093_3067 310
1448 3300059421 Ga0590071_013079 Ga0590071_013079_48_992 310
1449 3300060353 Ga0501082_0034523 Ga0501082_0034523_2978_3910 310
1450 iso_pu_bacteria 2738543013 2739248455 310
1451 iso_pu_bacteria 2758568016 2758637828 310
1452 iso_pu_bacteria 2894817345 2894822087 310
1453 iso_pu_bacteria 8054563764 8054567186 310
1454 3300001979 JGI24740J21852_10000111 JGI24740J21852_1000011121 311
1455 3300002737 JGI25162J39368_1000794 JGI25162J39368_10007943 311
1456 3300003214 JGI25165J46597_1000018 JGI25165J46597_1000018152 311
1457 3300003856 Ga0058692_1020804 Ga0058692_10208041 311
1458 3300005336 Ga0070680_100450075 Ga0070680_1004500751 311
1459 3300005549 Ga0070704_100528500 Ga0070704_1005285001 311
1460 3300005614 Ga0068856_100002246 Ga0068856_10000224614 311
1461 3300006353 Ga0075370_10009575 Ga0075370_100095754 311
1462 3300006847 Ga0075431_100015726 Ga0075431_1000157264 311
1463 3300009094 Ga0111539_10104109 Ga0111539_101041092 311
1464 3300009147 Ga0114129_10604603 Ga0114129_106046031 311
1465 3300013308 Ga0157375_10296110 Ga0157375_102961102 311
1466 3300025233 Ga0209437_100022 Ga0209437_100022213 311
1467 3300025261 Ga0209233_1000031 Ga0209233_1000031213 311
1468 3300027312 Ga0209371_1004784 Ga0209371_10047844 311
1469 3300030500 Ga0268256_1004561 Ga0268256_10045614 311
1470 3300042004 Ga0439445_0025023 Ga0439445_0025023_314_1249 311
1471 3300044656 Ga0466969_0071730 Ga0466969_0071730_414_1373 311
1472 3300045051 Ga0451576_0007753 Ga0451576_0007753_2601_3548 311
1473 3300045836 Ga0466958_0082323 Ga0466958_0082323_558_1517 311
1474 3300045976 Ga0466967_0144164 Ga0466967_0144164_335_1270 311
1475 3300048903 Ga0496100_0194589 Ga0496100_0194589_277_1287 311
1476 3300048918 Ga0496115_0131086 Ga0496115_0131086_932_1888 311
1477 3300048925 Ga0496122_0010146 Ga0496122_0010146_880_1839 311
1478 3300048926 Ga0496123_0155976 Ga0496123_0155976_126_1085 311
1479 3300048928 Ga0496125_0000145 Ga0496125_0000145_61490_62449 311
1480 3300049586 Ga0501070_0087003 Ga0501070_0087003_303_1247 311
1481 3300049590 Ga0501074_0064696 Ga0501074_0064696_359_1306 311
1482 3300049590 Ga0501074_0191368 Ga0501074_0191368_482_1426 311
1483 3300049593 Ga0501077_0114122 Ga0501077_0114122_423_1370 311
1484 3300049741 Ga0501079_0018396 Ga0501079_0018396_3171_4118 311
1485 3300049744 Ga0501083_0006285 Ga0501083_0006285_713_1657 311
1486 3300049824 Ga0501045_0224309 Ga0501045_0224309_195_1142 311
1487 3300050509 nmdc:mga0qj67_107510_c1 nmdc:mga0qj67_107510_c1_1031_1981 311
1488 3300050511 nmdc:mga08y16_676473_c1 nmdc:mga08y16_676473_c1_65_1021 311
1489 3300050511 nmdc:mga08y16_76334_c1 nmdc:mga08y16_76334_c1_2070_3083 311
1490 3300050515 nmdc:mga0a205_134935_c1 nmdc:mga0a205_134935_c1_230_1186 311
1491 3300053153 Ga0500616_0038335 Ga0500616_0038335_116_1069 311
1492 3300060353 Ga0501082_0032114 Ga0501082_0032114_852_1796 311
1493 3300060353 Ga0501082_0084199 Ga0501082_0084199_621_1568 311
1494 3300061734 Ga0530510_0023194 Ga0530510_0023194_2544_3491 311
1495 iso_pu_bacteria 2842333319 2842337383 311

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

127

338

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8036 22 298
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.7854 22 298
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.7798 22 299
4xtc-assembly1.cif.gz_M crystal structure of bacterial alginate abc transporter in complex with alginate pentasaccharide-bound periplasmic protein 0.775 24 302
4tqv-assembly4.cif.gz_M crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.7734 14 304
ID Description Score Start End Superfamily
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8149 62 303 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8114 62 305 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8055 62 303 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8026 62 305 1.10.3720.10
af_I6XFF3_60_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7993 62 302 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A2V6X1C5-F1-model_v4 Sugar ABC transporter permease 0.8543 22 239 GO:0005886
GO:0055085
AF-A0A4Q3MWV4-F1-model_v4 deleted 0.8525 14 231
AF-A0A4Q3MWV4-F1-model_v4 deleted 0.8421 14 231
AF-A0A7C5CYE7-F1-model_v4 Sugar ABC transporter permease 0.8407 20 303 GO:0005886
GO:0055085
AF-A0A7J3WCB2-F1-model_v4 Sugar ABC transporter permease 0.8395 18 309 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
72.92 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map