F494361
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1495 | 1065 | 816 | 307 |
Family's Representative Sequence
| Representative Sequence | 3300031456|Ga0307513_10028483|Ga0307513_100284833 |
| Length | 342 |
| Sequence | MRSHGEAPCLPSPLTTKAWCDDVQKQTAIAGKPAATATAPVALRSASVLDGRNTLGFLFMLPGAALLLVFLTYPLGLGVWLGFTDTRIGRDGSFVGFENYQMLWDDTVFWLSVFNTVLYTVAASILKFALGLWLALLLNQHLPFKAFLRAIVLLPWVVPTVLSAIAFWWIFDAQFSIISWALIKIGLIHAPINFLGDSTNARASVIAANVWRGIPFVAITLLAGLQTIPQSLYEAATLDGATSWQRFRFITLPMLTPIIAVVMTFSVLFTFTDFQLIYVLTRGGPVNATHLMATLSFQRAIAGGQLGEGAAIAVSMIPFLLSAILFSYFGLQRRKWQQGGRD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 3 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 4 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 5 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 6 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 7 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 8 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 9 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 10 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 11 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 12 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 13 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 14 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 15 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 16 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 17 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 18 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 19 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 20 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 21 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 22 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 23 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 24 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 25 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 26 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 27 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 28 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 29 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 30 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 31 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 32 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 33 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 34 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 35 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 36 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 37 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 38 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 39 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 40 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 41 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 42 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 43 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 44 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 45 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 46 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 47 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 48 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 49 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 50 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 51 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 52 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 53 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 54 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 55 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 56 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 57 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 58 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 59 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 60 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 61 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 62 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 63 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 64 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 65 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 66 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 67 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 68 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 69 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 70 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 71 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 72 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 73 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 74 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 75 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 76 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 77 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 78 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 79 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 80 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 81 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 82 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 83 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 84 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 85 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 86 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 87 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 88 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 89 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 90 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 91 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 92 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 93 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 94 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 95 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 96 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 97 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 98 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 99 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 100 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 101 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 102 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 103 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 104 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 105 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 106 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 107 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 108 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 109 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 110 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 111 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 112 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 113 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 114 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 115 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 116 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 117 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 118 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 119 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 120 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 121 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 122 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 123 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 124 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 125 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 126 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 127 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 128 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 129 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 130 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 131 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 132 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 133 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 134 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 135 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 136 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 137 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 138 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 139 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 140 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 141 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 142 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 143 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 144 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 145 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 146 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 147 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 148 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 149 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 150 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 151 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 152 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 153 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 154 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 155 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 156 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 157 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 158 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 159 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 160 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 161 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 162 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 163 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 164 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 165 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 166 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 167 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 168 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 169 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 170 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 171 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 172 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 173 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 174 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 175 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 176 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 177 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 178 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 179 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 180 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 181 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 182 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 183 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 184 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 185 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 186 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 187 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 188 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 189 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 190 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 191 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 192 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 193 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 194 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 195 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 196 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 197 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 198 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 199 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 200 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 201 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 202 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 203 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 204 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 205 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 206 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 207 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 208 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 209 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 210 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 211 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 212 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 213 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 214 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 215 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 216 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 217 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 218 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 219 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 220 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 221 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 222 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 223 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 224 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 225 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 226 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 227 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 228 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 229 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 230 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 231 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 232 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 233 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 234 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 235 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 236 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 237 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 238 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 239 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 240 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 241 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 242 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 243 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 244 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 245 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 246 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 247 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 248 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 249 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 250 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 251 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 252 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 253 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 254 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 255 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 256 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 257 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 258 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 259 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 260 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 261 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 262 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 263 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 264 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 265 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 266 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 267 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 268 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 269 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 270 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 271 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 272 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 273 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 274 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 275 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 276 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 277 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 278 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 279 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 280 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 281 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 282 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 283 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 284 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 285 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 286 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 287 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 288 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 289 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 290 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 291 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 292 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 293 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 294 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 295 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 296 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 297 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 298 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 299 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 300 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 301 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 302 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 303 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 304 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 305 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 306 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 307 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 308 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 309 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 310 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 311 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 312 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 313 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 314 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 315 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 316 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 317 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 318 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 319 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 320 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 321 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 322 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 323 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 324 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 325 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 326 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 327 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 328 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 329 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 330 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 331 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 332 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 333 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 334 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 335 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 336 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 337 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 338 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 339 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 340 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 341 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 342 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 343 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 344 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 345 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 346 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 347 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 348 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 349 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 350 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 351 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 352 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 353 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 354 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 355 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 356 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 357 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 358 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 359 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 360 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 361 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 362 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 363 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 364 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 365 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 366 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 367 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 368 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 369 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 370 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 371 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 372 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 373 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 374 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 375 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 376 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 377 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 378 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 379 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 380 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 381 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 382 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 383 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 384 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 385 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 386 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 387 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 388 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 389 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 390 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 391 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 392 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 393 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 394 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 395 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 396 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 397 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 398 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 399 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 400 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 401 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 402 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 403 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 404 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 405 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 406 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 407 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 408 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 409 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 410 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 411 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 412 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 413 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 414 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 415 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 416 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 417 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 418 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 419 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 420 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 421 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 422 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 423 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 424 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 425 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 426 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 427 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 428 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 429 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 430 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 431 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 432 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 433 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 434 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 435 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 436 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 437 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 438 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 439 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 440 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 441 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 442 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 443 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 444 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 445 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 446 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 447 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 448 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 449 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 450 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 451 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 452 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 453 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 454 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 455 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 456 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 457 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 458 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 459 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 460 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 461 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 462 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 463 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 464 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 465 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 466 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 467 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 468 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 469 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 470 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 471 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 472 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 473 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 474 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 475 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 476 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 477 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 478 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 479 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 480 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 481 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 482 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 483 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 484 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 485 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 486 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 487 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 488 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 489 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 490 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 491 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 492 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 493 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 494 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 495 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 496 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 497 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 498 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 499 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 500 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 501 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 502 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 503 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 504 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 505 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 506 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 507 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 508 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 509 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 510 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 511 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 512 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 513 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 514 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 515 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 516 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 517 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 518 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 519 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 520 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 521 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 522 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 523 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 524 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 525 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 526 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 527 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 528 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 529 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 530 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 531 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 532 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 533 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 534 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 535 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 536 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 537 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 538 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 539 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 540 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 541 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 542 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 543 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 544 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 545 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 546 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 547 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 548 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 549 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 550 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 551 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 552 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 553 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 554 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 555 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 556 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 557 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 558 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 559 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 560 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 561 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 562 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 563 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 564 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 565 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 566 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 567 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 568 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 569 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 570 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 571 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 572 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 573 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 574 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 575 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 576 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 577 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 578 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 579 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 580 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 581 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 582 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 583 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 584 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 585 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 586 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 587 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 588 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 589 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 590 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 591 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 592 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 593 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 594 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 595 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 596 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 597 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 598 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 599 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 600 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 601 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 602 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 603 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 604 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 605 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 606 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 607 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 608 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 609 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 610 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 611 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 612 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 613 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 614 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 615 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 616 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 617 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 618 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 619 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 620 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 621 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 622 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 623 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 624 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 625 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 626 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 627 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 628 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 629 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 630 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 631 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 632 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 633 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 634 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 635 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 636 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 637 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 638 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 639 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 640 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 641 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 642 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 643 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 644 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 645 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 646 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 647 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 648 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 649 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 650 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 651 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 652 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 653 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 654 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 655 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 656 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 657 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 658 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 659 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 660 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 661 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 662 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 663 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 664 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 665 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 666 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 667 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 668 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 669 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 670 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 671 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 672 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 673 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 674 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 675 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 676 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 677 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 678 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 679 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 680 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 681 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 682 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 683 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 684 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 685 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 686 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 687 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 688 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 689 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 690 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 691 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 692 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 693 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 694 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 695 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 696 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 697 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 698 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 699 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 700 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 701 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 702 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 703 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 704 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 705 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 706 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 707 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 708 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 709 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 710 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 711 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 712 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 713 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 714 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 715 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 716 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 717 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 718 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 719 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 720 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 721 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 722 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 723 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 724 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 725 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 726 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 727 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 728 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 729 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 730 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 731 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 732 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 733 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 734 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 735 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 736 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 737 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 738 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 739 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 740 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 741 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 742 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 743 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 744 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 745 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 746 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 747 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 748 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 749 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 750 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 751 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 752 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 753 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 754 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 755 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 756 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 757 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 758 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 759 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 760 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 761 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 762 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 763 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 764 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 765 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 766 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 767 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 768 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 769 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 770 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 771 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 772 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 773 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 774 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 775 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 776 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 777 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 778 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 779 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 780 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 781 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 782 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 783 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 784 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 785 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 786 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 787 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 788 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 789 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 790 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 791 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 792 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 793 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 794 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 795 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 796 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 797 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 798 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 799 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 800 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 801 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 802 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 803 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 804 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 805 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 806 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 807 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 808 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 809 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 810 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 811 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 812 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 813 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 814 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 815 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 816 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 817 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 818 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 819 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 820 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 821 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 822 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 823 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 824 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 825 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 826 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 827 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 828 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 829 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 830 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 831 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 832 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 833 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 834 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 835 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 836 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 837 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 838 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 839 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 840 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 841 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 842 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 843 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 844 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 845 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 846 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 847 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 848 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 849 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 850 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 851 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 852 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 853 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 854 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 855 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 856 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 857 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 858 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 859 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 860 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 861 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 862 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 863 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 864 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 865 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 866 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 867 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 868 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 869 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 870 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 871 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 872 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 873 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 874 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 875 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 876 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 877 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 878 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 879 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 880 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 881 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 882 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 883 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 884 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 885 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 886 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 887 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 888 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 889 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 890 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 891 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 892 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 893 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 894 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 895 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 896 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 897 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 898 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 899 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 900 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 901 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 902 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 903 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 904 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 905 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 906 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 907 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 908 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 909 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 910 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 911 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 912 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 913 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 914 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 915 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 916 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 917 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 918 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 919 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 920 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 921 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 922 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 923 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 924 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 925 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 926 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 927 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 928 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 929 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 930 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 931 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 932 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 933 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 934 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 935 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 936 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 937 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 938 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 939 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 940 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 941 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 942 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 943 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 944 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 945 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 946 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 947 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 948 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 949 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 950 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 951 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 952 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 953 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 954 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 955 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 956 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 957 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 958 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 959 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 960 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 961 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 962 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 963 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 964 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 965 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 966 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 967 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 968 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 969 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 970 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 971 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 972 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 973 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 974 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 975 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 976 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 977 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 978 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 979 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 980 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 981 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 982 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 983 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 984 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 985 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 986 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 987 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 988 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 989 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 990 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 991 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 992 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 993 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 994 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 995 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 996 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 997 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 998 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 999 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 1000 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 1001 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 1002 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 1003 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 1004 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 1005 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 1006 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 1007 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 1008 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 1009 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1010 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 1011 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1012 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 1013 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1014 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 1015 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1016 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 1017 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1018 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1019 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 1020 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 1021 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 1022 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 1023 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 1024 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 1025 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 1026 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 1027 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 1028 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1029 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1030 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1031 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1032 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1033 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1034 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1035 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1036 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1037 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1038 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1039 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 1040 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1041 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1042 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1043 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1044 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1045 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1046 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 1047 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1048 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 1049 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1050 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1051 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1052 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 1053 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1054 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1055 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1056 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1057 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1058 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 1059 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1060 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 1061 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 1062 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 1063 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1064 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1065 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 54.58 |
| Metatranscriptomes | 0 |
| Isolates | 45.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.71 |
| Nodule | 38.13 |
| Rhizoplane | 0.67 |
| Rhizosphere | 39.67 |
| Stem | 0 |
| Stem Tuber | 0.07 |
| Unclassified | 8.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000111 | 3300001979 | Bacteria | 29540 |
| 2 | JGI25156J39149_1000675 | 3300002705 | Bacteria | 18418 |
| 3 | JGI25162J39368_1000794 | 3300002737 | Bacteria | 21085 |
| 4 | JGI25162J39368_1001832 | 3300002737 | Bacteria | 9928 |
| 5 | JGI25158J39367_1000448 | 3300002739 | Bacteria | 8533 |
| 6 | JGI25157J39369_1001106 | 3300002741 | Bacteria | 12030 |
| 7 | JGI25152J39213_1002959 | 3300002773 | Bacteria | 6045 |
| 8 | JGI25152J39213_1005931 | 3300002773 | Bacteria | 3437 |
| 9 | JGI25159J45721_1000071 | 3300002987 | Bacteria | 48764 |
| 10 | JGI25159J45721_1000191 | 3300002987 | Bacteria | 28445 |
| 11 | JGI25159J45721_1008482 | 3300002987 | Bacteria | 2818 |
| 12 | JGI25159J45721_1013545 | 3300002987 | Bacteria | 1881 |
| 13 | JGI25151J46595_10000458 | 3300003187 | Bacteria | 39262 |
| 14 | JGI25151J46595_10000508 | 3300003187 | Bacteria | 36520 |
| 15 | JGI25151J46595_10001193 | 3300003187 | Bacteria | 18647 |
| 16 | JGI25151J46595_10009780 | 3300003187 | Bacteria | 4515 |
| 17 | JGI25165J46597_1000018 | 3300003214 | Bacteria | 374701 |
| 18 | JGI25153J46596_10000042 | 3300003215 | Bacteria | 161788 |
| 19 | JGI25153J46596_10000087 | 3300003215 | Bacteria | 111217 |
| 20 | JGI25153J46596_10002535 | 3300003215 | Bacteria | 10466 |
| 21 | JGI25153J46596_10009620 | 3300003215 | Bacteria | 4461 |
| 22 | JGI25153J46596_10010647 | 3300003215 | Bacteria | 4140 |
| 23 | JGI25153J46596_10014909 | 3300003215 | Bacteria | 3199 |
| 24 | rootH1_10191308 | 3300003323 | Bacteria | 1612 |
| 25 | JGI25160J50197_1000162 | 3300003354 | Bacteria | 57595 |
| 26 | JGI25160J50197_1001578 | 3300003354 | Bacteria | 11244 |
| 27 | JGI25160J50197_1003716 | 3300003354 | Bacteria | 6735 |
| 28 | JGI25161J50226_1000075 | 3300003374 | Bacteria | 84775 |
| 29 | JGI25161J50226_1006294 | 3300003374 | Bacteria | 2167 |
| 30 | Ga0055538_1000054 | 3300003751 | Bacteria | 123566 |
| 31 | Ga0055539_1000066 | 3300003752 | Bacteria | 136557 |
| 32 | Ga0055533_1000076 | 3300003756 | Bacteria | 136557 |
| 33 | Ga0055532_1000157 | 3300003758 | Bacteria | 59670 |
| 34 | Ga0055525_1000098 | 3300003759 | Bacteria | 136557 |
| 35 | Ga0055535_1006969 | 3300003761 | Bacteria | 2213 |
| 36 | Ga0055529_1001031 | 3300003763 | Bacteria | 13246 |
| 37 | Ga0055526_1001457 | 3300003771 | Bacteria | 16792 |
| 38 | Ga0055526_1001852 | 3300003771 | Bacteria | 14644 |
| 39 | Ga0055526_1004947 | 3300003771 | Bacteria | 7826 |
| 40 | Ga0055526_1005597 | 3300003771 | Bacteria | 7157 |
| 41 | Ga0055526_1006049 | 3300003771 | Bacteria | 6703 |
| 42 | Ga0055526_1007227 | 3300003771 | Bacteria | 5828 |
| 43 | Ga0055524_1001068 | 3300003775 | Bacteria | 16849 |
| 44 | Ga0055524_1006553 | 3300003775 | Bacteria | 5036 |
| 45 | Ga0055536_1000219 | 3300003781 | Bacteria | 46718 |
| 46 | Ga0055536_1000667 | 3300003781 | Bacteria | 23117 |
| 47 | Ga0055534_1002873 | 3300003784 | Bacteria | 5719 |
| 48 | Ga0055534_1003753 | 3300003784 | Bacteria | 4678 |
| 49 | Ga0055528_1000054 | 3300003790 | Bacteria | 90334 |
| 50 | Ga0055528_1002349 | 3300003790 | Bacteria | 10235 |
| 51 | Ga0055528_1009718 | 3300003790 | Bacteria | 3994 |
| 52 | Ga0055528_1023104 | 3300003790 | Bacteria | 1910 |
| 53 | Ga0055540_1000255 | 3300003792 | Bacteria | 48177 |
| 54 | Ga0055540_1009900 | 3300003792 | Bacteria | 3228 |
| 55 | Ga0055531_10000192 | 3300003794 | Bacteria | 67874 |
| 56 | Ga0055531_10016286 | 3300003794 | Bacteria | 3216 |
| 57 | Ga0055541_1000056 | 3300003841 | Bacteria | 123566 |
| 58 | Ga0058692_1020804 | 3300003856 | Bacteria | 1372 |
| 59 | Ga0055543_1000096 | 3300004625 | Bacteria | 75972 |
| 60 | Ga0055543_1000578 | 3300004625 | Bacteria | 20193 |
| 61 | Ga0055543_1001124 | 3300004625 | Bacteria | 11482 |
| 62 | Ga0065165_1000535 | 3300005262 | Bacteria | 57606 |
| 63 | Ga0065165_1007353 | 3300005262 | Bacteria | 5443 |
| 64 | Ga0065165_1011236 | 3300005262 | Bacteria | 3763 |
| 65 | Ga0065712_10009354 | 3300005290 | Bacteria | 2612 |
| 66 | Ga0065715_10037650 | 3300005293 | Bacteria | 1256 |
| 67 | Ga0065715_10097689 | 3300005293 | Bacteria | 3666 |
| 68 | Ga0065715_10193679 | 3300005293 | Bacteria | 1400 |
| 69 | Ga0070658_10158696 | 3300005327 | Bacteria | 1897 |
| 70 | Ga0070683_100232746 | 3300005329 | Bacteria | 1752 |
| 71 | Ga0070683_100252189 | 3300005329 | Bacteria | 1678 |
| 72 | Ga0070690_100000104 | 3300005330 | Bacteria | 43588 |
| 73 | Ga0070670_100000403 | 3300005331 | Bacteria | 35526 |
| 74 | Ga0070670_100016185 | 3300005331 | Bacteria | 6401 |
| 75 | Ga0070670_100168655 | 3300005331 | Bacteria | 1898 |
| 76 | Ga0070670_100234155 | 3300005331 | Bacteria | 1598 |
| 77 | Ga0070677_10002422 | 3300005333 | Bacteria | 5953 |
| 78 | Ga0070677_10074465 | 3300005333 | Bacteria | 1436 |
| 79 | Ga0068869_100000970 | 3300005334 | Bacteria | 16682 |
| 80 | Ga0068869_100001111 | 3300005334 | Bacteria | 15680 |
| 81 | Ga0070666_10116012 | 3300005335 | Bacteria | 1854 |
| 82 | Ga0070666_10229207 | 3300005335 | Bacteria | 1312 |
| 83 | Ga0070680_100009735 | 3300005336 | Bacteria | 7396 |
| 84 | Ga0070680_100450075 | 3300005336 | Bacteria | 1100 |
| 85 | Ga0070682_100069986 | 3300005337 | Bacteria | 2242 |
| 86 | Ga0068868_100238094 | 3300005338 | Bacteria | 1528 |
| 87 | Ga0068868_100295442 | 3300005338 | Bacteria | 1375 |
| 88 | Ga0070660_100341222 | 3300005339 | Bacteria | 1233 |
| 89 | Ga0070689_100010513 | 3300005340 | Bacteria | 6597 |
| 90 | Ga0070691_10036418 | 3300005341 | Bacteria | 2319 |
| 91 | Ga0070687_100172920 | 3300005343 | Bacteria | 1287 |
| 92 | Ga0070661_100004818 | 3300005344 | Bacteria | 9289 |
| 93 | Ga0070661_100133299 | 3300005344 | Bacteria | 1867 |
| 94 | Ga0070692_10001690 | 3300005345 | Bacteria | 8182 |
| 95 | Ga0070668_100029428 | 3300005347 | Bacteria | 4172 |
| 96 | Ga0070669_100244746 | 3300005353 | Bacteria | 1426 |
| 97 | Ga0070675_100015525 | 3300005354 | Bacteria | 6023 |
| 98 | Ga0070671_100014895 | 3300005355 | Bacteria | 6282 |
| 99 | Ga0070671_100065045 | 3300005355 | Bacteria | 3037 |
| 100 | Ga0070671_100101194 | 3300005355 | Bacteria | 2418 |
| 101 | Ga0070671_100169477 | 3300005355 | Bacteria | 1846 |
| 102 | Ga0070674_100175461 | 3300005356 | Bacteria | 1637 |
| 103 | Ga0070674_100193148 | 3300005356 | Bacteria | 1567 |
| 104 | Ga0070673_100081833 | 3300005364 | Bacteria | 2619 |
| 105 | Ga0070688_100017786 | 3300005365 | Bacteria | 4086 |
| 106 | Ga0070667_100003805 | 3300005367 | Bacteria | 12830 |
| 107 | Ga0070667_100208707 | 3300005367 | Bacteria | 1735 |
| 108 | Ga0070667_100298841 | 3300005367 | Bacteria | 1449 |
| 109 | Ga0070701_10000947 | 3300005438 | Bacteria | 10503 |
| 110 | Ga0070701_10009247 | 3300005438 | Bacteria | 4309 |
| 111 | Ga0070701_10013615 | 3300005438 | Bacteria | 3705 |
| 112 | Ga0070705_100030887 | 3300005440 | Bacteria | 2961 |
| 113 | Ga0070700_100001391 | 3300005441 | Bacteria | 12017 |
| 114 | Ga0070700_100013467 | 3300005441 | Bacteria | 4594 |
| 115 | Ga0070700_100040608 | 3300005441 | Bacteria | 2849 |
| 116 | Ga0070663_100023155 | 3300005455 | Bacteria | 4160 |
| 117 | Ga0070663_100071282 | 3300005455 | Bacteria | 2528 |
| 118 | Ga0070663_100172481 | 3300005455 | Bacteria | 1673 |
| 119 | Ga0070678_100013439 | 3300005456 | Bacteria | 5133 |
| 120 | Ga0070678_100039073 | 3300005456 | Bacteria | 3345 |
| 121 | Ga0070678_100067388 | 3300005456 | Bacteria | 2664 |
| 122 | Ga0070678_100176079 | 3300005456 | Bacteria | 1747 |
| 123 | Ga0070678_100185348 | 3300005456 | Bacteria | 1707 |
| 124 | Ga0070662_100004864 | 3300005457 | Bacteria | 8520 |
| 125 | Ga0070681_10397484 | 3300005458 | Bacteria | 1289 |
| 126 | Ga0070706_100196043 | 3300005467 | Bacteria | 1887 |
| 127 | Ga0070698_100379075 | 3300005471 | Bacteria | 1347 |
| 128 | Ga0070679_100002199 | 3300005530 | Bacteria | 17619 |
| 129 | Ga0068853_100020351 | 3300005539 | Bacteria | 5518 |
| 130 | Ga0068853_100095778 | 3300005539 | Bacteria | 2618 |
| 131 | Ga0068853_100369417 | 3300005539 | Bacteria | 1338 |
| 132 | Ga0070672_100001817 | 3300005543 | Bacteria | 13320 |
| 133 | Ga0070686_100001046 | 3300005544 | Bacteria | 15928 |
| 134 | Ga0070695_100005269 | 3300005545 | Bacteria | 7612 |
| 135 | Ga0070693_100014082 | 3300005547 | Bacteria | 4088 |
| 136 | Ga0070693_100035112 | 3300005547 | Bacteria | 2778 |
| 137 | Ga0070665_100013700 | 3300005548 | Bacteria | 8159 |
| 138 | Ga0070665_100030832 | 3300005548 | Bacteria | 5396 |
| 139 | Ga0070665_100069602 | 3300005548 | Bacteria | 3527 |
| 140 | Ga0070665_100230392 | 3300005548 | Bacteria | 1852 |
| 141 | Ga0070704_100074861 | 3300005549 | Bacteria | 2471 |
| 142 | Ga0070704_100528500 | 3300005549 | Bacteria | 1028 |
| 143 | Ga0068855_100000791 | 3300005563 | Bacteria | 39102 |
| 144 | Ga0068855_100007145 | 3300005563 | Bacteria | 13553 |
| 145 | Ga0068855_100106657 | 3300005563 | Bacteria | 3219 |
| 146 | Ga0070664_100004354 | 3300005564 | Bacteria | 11375 |
| 147 | Ga0070664_100020289 | 3300005564 | Bacteria | 5471 |
| 148 | Ga0070664_100062640 | 3300005564 | Bacteria | 3171 |
| 149 | Ga0068857_100000949 | 3300005577 | Bacteria | 22107 |
| 150 | Ga0068857_100097381 | 3300005577 | Bacteria | 2637 |
| 151 | Ga0068857_100290409 | 3300005577 | Bacteria | 1505 |
| 152 | Ga0068857_100543437 | 3300005577 | Bacteria | 1094 |
| 153 | Ga0068854_100001709 | 3300005578 | Bacteria | 13372 |
| 154 | Ga0068854_100035336 | 3300005578 | Bacteria | 3496 |
| 155 | Ga0068854_100146515 | 3300005578 | Bacteria | 1817 |
| 156 | Ga0068854_100162153 | 3300005578 | Bacteria | 1733 |
| 157 | Ga0068856_100002246 | 3300005614 | Bacteria | 19947 |
| 158 | Ga0068856_100041781 | 3300005614 | Bacteria | 4508 |
| 159 | Ga0070702_100000641 | 3300005615 | Bacteria | 12981 |
| 160 | Ga0070702_100007399 | 3300005615 | Bacteria | 5256 |
| 161 | Ga0068852_100006348 | 3300005616 | Bacteria | 8534 |
| 162 | Ga0068852_100018994 | 3300005616 | Bacteria | 5429 |
| 163 | Ga0068852_100048697 | 3300005616 | Bacteria | 3622 |
| 164 | Ga0068859_100000096 | 3300005617 | Bacteria | 81199 |
| 165 | Ga0068859_100082410 | 3300005617 | Bacteria | 3259 |
| 166 | Ga0068864_100006259 | 3300005618 | Bacteria | 9762 |
| 167 | Ga0068864_100092466 | 3300005618 | Bacteria | 2670 |
| 168 | Ga0068864_100589867 | 3300005618 | Bacteria | 1077 |
| 169 | Ga0068866_10003238 | 3300005718 | Bacteria | 6706 |
| 170 | Ga0068866_10134408 | 3300005718 | Bacteria | 1411 |
| 171 | Ga0068866_10196355 | 3300005718 | Bacteria | 1202 |
| 172 | Ga0068861_100008612 | 3300005719 | Bacteria | 7015 |
| 173 | Ga0068851_10016960 | 3300005834 | Bacteria | 3491 |
| 174 | Ga0068870_10010548 | 3300005840 | Bacteria | 4251 |
| 175 | Ga0068870_10081068 | 3300005840 | Bacteria | 1794 |
| 176 | Ga0068863_100052015 | 3300005841 | Bacteria | 3882 |
| 177 | Ga0068863_100249931 | 3300005841 | Bacteria | 1713 |
| 178 | Ga0068858_100000679 | 3300005842 | Bacteria | 35449 |
| 179 | Ga0068858_100002939 | 3300005842 | Bacteria | 17148 |
| 180 | Ga0068860_100000990 | 3300005843 | Bacteria | 31411 |
| 181 | Ga0068860_100033901 | 3300005843 | Bacteria | 4898 |
| 182 | Ga0068860_100114734 | 3300005843 | Bacteria | 2576 |
| 183 | Ga0068862_100004384 | 3300005844 | Bacteria | 11933 |
| 184 | Ga0068862_100010857 | 3300005844 | Bacteria | 7520 |
| 185 | Ga0068862_100131143 | 3300005844 | Bacteria | 2217 |
| 186 | Ga0081455_10232284 | 3300005937 | Bacteria | 1360 |
| 187 | Ga0081455_10241886 | 3300005937 | Bacteria | 1326 |
| 188 | Ga0081538_10036106 | 3300005981 | Bacteria | 3232 |
| 189 | Ga0081538_10112765 | 3300005981 | Bacteria | 1330 |
| 190 | Ga0081539_10064645 | 3300005985 | Bacteria | 1990 |
| 191 | Ga0075365_10013860 | 3300006038 | Bacteria | 4835 |
| 192 | Ga0075365_10016988 | 3300006038 | Bacteria | 4443 |
| 193 | Ga0075365_10111174 | 3300006038 | Bacteria | 1883 |
| 194 | Ga0075363_100053961 | 3300006048 | Bacteria | 2149 |
| 195 | Ga0075363_100156153 | 3300006048 | Bacteria | 1290 |
| 196 | Ga0075432_10016468 | 3300006058 | Bacteria | 2523 |
| 197 | Ga0075362_10006876 | 3300006177 | Bacteria | 4262 |
| 198 | Ga0075367_10048271 | 3300006178 | Bacteria | 2507 |
| 199 | Ga0075369_10002677 | 3300006186 | Bacteria | 6381 |
| 200 | Ga0075369_10039559 | 3300006186 | Bacteria | 2014 |
| 201 | Ga0075366_10021996 | 3300006195 | Bacteria | 3707 |
| 202 | Ga0075366_10023241 | 3300006195 | Bacteria | 3611 |
| 203 | Ga0075366_10052539 | 3300006195 | Bacteria | 2421 |
| 204 | Ga0075366_10119205 | 3300006195 | Bacteria | 1590 |
| 205 | Ga0075366_10193510 | 3300006195 | Bacteria | 1236 |
| 206 | Ga0097621_100017693 | 3300006237 | Bacteria | 5421 |
| 207 | Ga0097621_100103634 | 3300006237 | Bacteria | 2397 |
| 208 | Ga0075370_10009575 | 3300006353 | Bacteria | 5038 |
| 209 | Ga0075370_10014589 | 3300006353 | Bacteria | 4194 |
| 210 | Ga0075370_10045211 | 3300006353 | Bacteria | 2490 |
| 211 | Ga0075370_10138890 | 3300006353 | Bacteria | 1420 |
| 212 | Ga0068871_100006781 | 3300006358 | Bacteria | 8138 |
| 213 | Ga0075430_100057231 | 3300006846 | Bacteria | 3280 |
| 214 | Ga0075431_100014362 | 3300006847 | Bacteria | 8009 |
| 215 | Ga0075431_100015726 | 3300006847 | Bacteria | 7672 |
| 216 | Ga0075431_100219742 | 3300006847 | Bacteria | 1938 |
| 217 | Ga0075433_10129370 | 3300006852 | Bacteria | 2243 |
| 218 | Ga0068865_100029089 | 3300006881 | Bacteria | 3662 |
| 219 | Ga0068865_100044124 | 3300006881 | Bacteria | 3050 |
| 220 | Ga0097620_100000096 | 3300006931 | Bacteria | 81199 |
| 221 | Ga0097620_100082414 | 3300006931 | Bacteria | 3259 |
| 222 | Ga0079104_1004787 | 3300006946 | Bacteria | 5640 |
| 223 | Ga0079104_1006482 | 3300006946 | Bacteria | 4418 |
| 224 | Ga0079104_1006593 | 3300006946 | Bacteria | 4357 |
| 225 | Ga0099826_10179734 | 3300006948 | Bacteria | 1179 |
| 226 | Ga0099794_10016591 | 3300007265 | Bacteria | 3268 |
| 227 | Ga0105251_10025196 | 3300009011 | Bacteria | 3047 |
| 228 | Ga0105240_10002015 | 3300009093 | Bacteria | 33500 |
| 229 | Ga0105240_10009479 | 3300009093 | Bacteria | 13784 |
| 230 | Ga0105240_10015015 | 3300009093 | Bacteria | 10546 |
| 231 | Ga0105240_10044364 | 3300009093 | Bacteria | 5650 |
| 232 | Ga0105240_10151407 | 3300009093 | Bacteria | 2762 |
| 233 | Ga0105240_10164525 | 3300009093 | Bacteria | 2632 |
| 234 | Ga0111539_10000285 | 3300009094 | Bacteria | 60808 |
| 235 | Ga0111539_10016103 | 3300009094 | Bacteria | 9277 |
| 236 | Ga0111539_10104109 | 3300009094 | Bacteria | 3330 |
| 237 | Ga0105245_10004092 | 3300009098 | Bacteria | 12945 |
| 238 | Ga0105245_10117457 | 3300009098 | Bacteria | 2481 |
| 239 | Ga0105247_10005387 | 3300009101 | Bacteria | 8061 |
| 240 | Ga0114129_10002208 | 3300009147 | Bacteria | 26833 |
| 241 | Ga0114129_10604603 | 3300009147 | Bacteria | 1420 |
| 242 | Ga0105243_10035348 | 3300009148 | Bacteria | 3873 |
| 243 | Ga0105243_10051108 | 3300009148 | Bacteria | 3268 |
| 244 | Ga0105243_10131794 | 3300009148 | Bacteria | 2121 |
| 245 | Ga0105241_10170531 | 3300009174 | Bacteria | 1797 |
| 246 | Ga0105242_10008454 | 3300009176 | Bacteria | 7909 |
| 247 | Ga0105242_10010144 | 3300009176 | Bacteria | 7216 |
| 248 | Ga0105242_10222304 | 3300009176 | Bacteria | 1688 |
| 249 | Ga0105248_10022473 | 3300009177 | Bacteria | 6995 |
| 250 | Ga0105248_10135127 | 3300009177 | Bacteria | 2782 |
| 251 | Ga0105237_10031873 | 3300009545 | Bacteria | 5338 |
| 252 | Ga0105237_10111587 | 3300009545 | Bacteria | 2726 |
| 253 | Ga0105237_10264298 | 3300009545 | Bacteria | 1724 |
| 254 | Ga0105237_10332075 | 3300009545 | Bacteria | 1525 |
| 255 | Ga0105238_10000632 | 3300009551 | Bacteria | 37034 |
| 256 | Ga0105238_10006338 | 3300009551 | Bacteria | 11764 |
| 257 | Ga0105238_10007883 | 3300009551 | Bacteria | 10653 |
| 258 | Ga0105249_10575860 | 3300009553 | Bacteria | 1179 |
| 259 | Ga0123341_1000012 | 3300009765 | Bacteria | 105056 |
| 260 | Ga0123341_1077652 | 3300009765 | Bacteria | 1344 |
| 261 | Ga0123342_1021599 | 3300009766 | Bacteria | 4496 |
| 262 | Ga0105239_10058642 | 3300010375 | Bacteria | 4224 |
| 263 | Ga0105239_10101033 | 3300010375 | Bacteria | 3190 |
| 264 | Ga0105239_10112133 | 3300010375 | Bacteria | 3024 |
| 265 | Ga0105239_10661471 | 3300010375 | Bacteria | 1193 |
| 266 | Ga0105246_10221040 | 3300011119 | Bacteria | 1485 |
| 267 | Ga0105246_10297245 | 3300011119 | Bacteria | 1302 |
| 268 | Ga0157371_10117900 | 3300013102 | Bacteria | 1887 |
| 269 | Ga0157370_10149843 | 3300013104 | Bacteria | 2171 |
| 270 | Ga0157370_10382074 | 3300013104 | Bacteria | 1297 |
| 271 | Ga0157369_10008064 | 3300013105 | Bacteria | 12076 |
| 272 | Ga0157374_10359312 | 3300013296 | Bacteria | 1448 |
| 273 | Ga0157378_10003424 | 3300013297 | Bacteria | 14077 |
| 274 | Ga0157378_10025128 | 3300013297 | Bacteria | 5248 |
| 275 | Ga0157378_10227349 | 3300013297 | Bacteria | 1776 |
| 276 | Ga0157375_10123740 | 3300013308 | Bacteria | 2699 |
| 277 | Ga0157375_10210215 | 3300013308 | Bacteria | 2103 |
| 278 | Ga0157375_10296110 | 3300013308 | Bacteria | 1781 |
| 279 | Ga0163163_10011828 | 3300014325 | Bacteria | 7935 |
| 280 | Ga0163163_10116193 | 3300014325 | Bacteria | 2707 |
| 281 | Ga0163163_10712870 | 3300014325 | Bacteria | 1067 |
| 282 | Ga0157380_10003649 | 3300014326 | Bacteria | 10586 |
| 283 | Ga0157380_10007607 | 3300014326 | Bacteria | 7700 |
| 284 | Ga0157380_10074057 | 3300014326 | Bacteria | 2763 |
| 285 | Ga0157379_10003873 | 3300014968 | Bacteria | 12755 |
| 286 | Ga0157379_10073386 | 3300014968 | Bacteria | 3063 |
| 287 | Ga0157379_10075283 | 3300014968 | Bacteria | 3022 |
| 288 | Ga0157379_10106342 | 3300014968 | Bacteria | 2519 |
| 289 | Ga0182006_1005634 | 3300015261 | Bacteria | 5941 |
| 290 | Ga0182005_1006788 | 3300015265 | Bacteria | 3469 |
| 291 | Ga0163161_10093925 | 3300017792 | Bacteria | 2223 |
| 292 | Ga0214544_1001716 | 3300021320 | Bacteria | 46024 |
| 293 | Ga0214542_1000082 | 3300021321 | Bacteria | 120825 |
| 294 | Ga0214543_1000005 | 3300021327 | Bacteria | 454523 |
| 295 | Ga0214543_1000075 | 3300021327 | Bacteria | 120861 |
| 296 | Ga0213872_10040241 | 3300021361 | Bacteria | 2134 |
| 297 | Ga0213874_10027685 | 3300021377 | Bacteria | 1614 |
| 298 | Ga0228711_1000045 | 3300022739 | Bacteria | 85435 |
| 299 | Ga0228710_1000036 | 3300022740 | Bacteria | 91904 |
| 300 | Ga0209435_100085 | 3300025206 | Bacteria | 45218 |
| 301 | Ga0209435_100486 | 3300025206 | Bacteria | 7854 |
| 302 | Ga0209436_100035 | 3300025208 | Bacteria | 79010 |
| 303 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 304 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 305 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 306 | Ga0209147_100217 | 3300025229 | Bacteria | 59789 |
| 307 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 308 | Ga0209437_100022 | 3300025233 | Bacteria | 625694 |
| 309 | Ga0209437_100432 | 3300025233 | Bacteria | 36626 |
| 310 | Ga0209258_100390 | 3300025242 | Bacteria | 55905 |
| 311 | Ga0209258_102714 | 3300025242 | Bacteria | 4309 |
| 312 | Ga0207425_1000448 | 3300025245 | Bacteria | 26903 |
| 313 | Ga0207425_1002132 | 3300025245 | Bacteria | 7266 |
| 314 | Ga0209646_1000204 | 3300025246 | Bacteria | 69552 |
| 315 | Ga0209646_1000227 | 3300025246 | Bacteria | 59789 |
| 316 | Ga0209026_1000340 | 3300025250 | Bacteria | 45211 |
| 317 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 318 | Ga0209759_1000298 | 3300025256 | Bacteria | 68472 |
| 319 | Ga0209759_1000561 | 3300025256 | Bacteria | 37637 |
| 320 | Ga0209129_1000124 | 3300025258 | Bacteria | 133610 |
| 321 | Ga0209129_1003154 | 3300025258 | Bacteria | 7387 |
| 322 | Ga0209233_1000031 | 3300025261 | Bacteria | 624646 |
| 323 | Ga0209565_1000021 | 3300025263 | Bacteria | 406281 |
| 324 | Ga0209565_1006164 | 3300025263 | Bacteria | 3396 |
| 325 | Ga0209455_1000841 | 3300025272 | Bacteria | 16532 |
| 326 | Ga0209673_1000067 | 3300025273 | Bacteria | 249077 |
| 327 | Ga0209673_1000750 | 3300025273 | Bacteria | 44330 |
| 328 | Ga0209673_1001376 | 3300025273 | Bacteria | 23910 |
| 329 | Ga0209673_1004094 | 3300025273 | Bacteria | 8025 |
| 330 | Ga0209673_1004568 | 3300025273 | Bacteria | 7350 |
| 331 | Ga0209673_1009563 | 3300025273 | Bacteria | 4178 |
| 332 | Ga0209673_1014607 | 3300025273 | Bacteria | 3030 |
| 333 | Ga0209130_1000031 | 3300025284 | Bacteria | 322932 |
| 334 | Ga0209130_1000147 | 3300025284 | Bacteria | 109796 |
| 335 | Ga0209130_1000467 | 3300025284 | Bacteria | 41801 |
| 336 | Ga0209130_1005106 | 3300025284 | Bacteria | 4677 |
| 337 | Ga0209130_1015385 | 3300025284 | Bacteria | 1887 |
| 338 | Ga0209675_1000040 | 3300025291 | Bacteria | 247535 |
| 339 | Ga0209675_1001148 | 3300025291 | Bacteria | 16132 |
| 340 | Ga0209675_1003321 | 3300025291 | Bacteria | 7730 |
| 341 | Ga0209676_1000014 | 3300025292 | Bacteria | 793514 |
| 342 | Ga0209676_1001620 | 3300025292 | Bacteria | 19915 |
| 343 | Ga0209676_1006751 | 3300025292 | Bacteria | 5580 |
| 344 | Ga0209676_1011806 | 3300025292 | Bacteria | 3488 |
| 345 | Ga0209025_1000092 | 3300025294 | Bacteria | 247020 |
| 346 | Ga0209025_1000099 | 3300025294 | Bacteria | 231353 |
| 347 | Ga0209025_1000240 | 3300025294 | Bacteria | 128397 |
| 348 | Ga0209025_1000397 | 3300025294 | Bacteria | 89703 |
| 349 | Ga0209025_1008454 | 3300025294 | Bacteria | 7407 |
| 350 | Ga0209025_1040334 | 3300025294 | Bacteria | 2021 |
| 351 | Ga0209025_1049135 | 3300025294 | Bacteria | 1702 |
| 352 | Ga0209564_1000057 | 3300025295 | Bacteria | 340400 |
| 353 | Ga0209564_1000092 | 3300025295 | Bacteria | 249018 |
| 354 | Ga0209564_1000159 | 3300025295 | Bacteria | 164319 |
| 355 | Ga0209564_1000218 | 3300025295 | Bacteria | 130563 |
| 356 | Ga0209564_1000452 | 3300025295 | Bacteria | 69505 |
| 357 | Ga0209564_1000511 | 3300025295 | Bacteria | 63773 |
| 358 | Ga0209564_1000925 | 3300025295 | Bacteria | 38190 |
| 359 | Ga0209564_1001127 | 3300025295 | Bacteria | 31429 |
| 360 | Ga0209758_1000110 | 3300025297 | Bacteria | 213110 |
| 361 | Ga0209758_1000214 | 3300025297 | Bacteria | 126364 |
| 362 | Ga0209758_1000232 | 3300025297 | Bacteria | 117382 |
| 363 | Ga0209758_1000504 | 3300025297 | Bacteria | 63308 |
| 364 | Ga0209758_1000585 | 3300025297 | Bacteria | 56861 |
| 365 | Ga0209758_1001602 | 3300025297 | Bacteria | 25857 |
| 366 | Ga0209758_1005532 | 3300025297 | Bacteria | 9647 |
| 367 | Ga0209758_1030022 | 3300025297 | Bacteria | 2259 |
| 368 | Ga0209758_1034835 | 3300025297 | Bacteria | 1995 |
| 369 | Ga0209758_1050320 | 3300025297 | Bacteria | 1462 |
| 370 | Ga0209050_1003004 | 3300025298 | Bacteria | 13099 |
| 371 | Ga0209050_1004942 | 3300025298 | Bacteria | 8693 |
| 372 | Ga0209050_1021600 | 3300025298 | Bacteria | 2339 |
| 373 | Ga0209050_1023735 | 3300025298 | Bacteria | 2146 |
| 374 | Ga0209256_1000170 | 3300025299 | Bacteria | 130504 |
| 375 | Ga0209256_1001569 | 3300025299 | Bacteria | 22476 |
| 376 | Ga0209256_1003336 | 3300025299 | Bacteria | 11391 |
| 377 | Ga0209256_1004342 | 3300025299 | Bacteria | 8997 |
| 378 | Ga0209256_1007078 | 3300025299 | Bacteria | 5669 |
| 379 | Ga0209256_1015056 | 3300025299 | Bacteria | 2732 |
| 380 | Ga0207426_1000042 | 3300025302 | Bacteria | 433289 |
| 381 | Ga0207426_1000065 | 3300025302 | Bacteria | 353625 |
| 382 | Ga0207426_1000267 | 3300025302 | Bacteria | 109797 |
| 383 | Ga0207426_1000355 | 3300025302 | Bacteria | 83450 |
| 384 | Ga0209051_1000062 | 3300025303 | Bacteria | 251081 |
| 385 | Ga0209051_1000281 | 3300025303 | Bacteria | 83196 |
| 386 | Ga0209051_1004860 | 3300025303 | Bacteria | 8071 |
| 387 | Ga0209051_1009790 | 3300025303 | Bacteria | 4909 |
| 388 | Ga0209051_1039794 | 3300025303 | Bacteria | 1693 |
| 389 | Ga0209257_1000039 | 3300025304 | Bacteria | 591694 |
| 390 | Ga0209257_1000376 | 3300025304 | Bacteria | 89065 |
| 391 | Ga0209257_1000970 | 3300025304 | Bacteria | 39244 |
| 392 | Ga0209257_1002116 | 3300025304 | Bacteria | 20743 |
| 393 | Ga0209257_1007196 | 3300025304 | Bacteria | 6828 |
| 394 | Ga0209257_1049783 | 3300025304 | Bacteria | 1190 |
| 395 | Ga0207697_10009556 | 3300025315 | Bacteria | 4185 |
| 396 | Ga0207656_10036968 | 3300025321 | Bacteria | 2051 |
| 397 | Ga0207682_10001129 | 3300025893 | Bacteria | 12342 |
| 398 | Ga0207682_10001921 | 3300025893 | Bacteria | 9445 |
| 399 | Ga0207642_10000792 | 3300025899 | Bacteria | 9809 |
| 400 | Ga0207642_10138412 | 3300025899 | Bacteria | 1280 |
| 401 | Ga0207710_10014855 | 3300025900 | Bacteria | 3288 |
| 402 | Ga0207680_10034211 | 3300025903 | Bacteria | 2906 |
| 403 | Ga0207647_10195773 | 3300025904 | Bacteria | 1170 |
| 404 | Ga0207645_10002683 | 3300025907 | Bacteria | 13861 |
| 405 | Ga0207643_10000796 | 3300025908 | Bacteria | 19199 |
| 406 | Ga0207643_10012951 | 3300025908 | Bacteria | 4510 |
| 407 | Ga0207684_10106293 | 3300025910 | Bacteria | 2401 |
| 408 | Ga0207695_10001105 | 3300025913 | Bacteria | 46872 |
| 409 | Ga0207695_10001995 | 3300025913 | Bacteria | 31509 |
| 410 | Ga0207695_10018728 | 3300025913 | Bacteria | 7993 |
| 411 | Ga0207695_10049214 | 3300025913 | Bacteria | 4445 |
| 412 | Ga0207695_10134260 | 3300025913 | Bacteria | 2429 |
| 413 | Ga0207671_10065756 | 3300025914 | Bacteria | 2697 |
| 414 | Ga0207660_10010630 | 3300025917 | Bacteria | 5980 |
| 415 | Ga0207662_10151178 | 3300025918 | Bacteria | 1476 |
| 416 | Ga0207662_10216086 | 3300025918 | Bacteria | 1246 |
| 417 | Ga0207649_10013416 | 3300025920 | Bacteria | 4575 |
| 418 | Ga0207649_10112774 | 3300025920 | Bacteria | 1820 |
| 419 | Ga0207681_10102095 | 3300025923 | Bacteria | 2070 |
| 420 | Ga0207681_10172367 | 3300025923 | Bacteria | 1641 |
| 421 | Ga0207694_10000171 | 3300025924 | Bacteria | 66876 |
| 422 | Ga0207694_10040036 | 3300025924 | Bacteria | 3608 |
| 423 | Ga0207694_10162317 | 3300025924 | Bacteria | 1805 |
| 424 | Ga0207650_10000408 | 3300025925 | Bacteria | 38515 |
| 425 | Ga0207650_10075606 | 3300025925 | Bacteria | 2542 |
| 426 | Ga0207650_10382634 | 3300025925 | Bacteria | 1162 |
| 427 | Ga0207659_10000256 | 3300025926 | Bacteria | 32624 |
| 428 | Ga0207659_10047076 | 3300025926 | Bacteria | 3049 |
| 429 | Ga0207659_10047482 | 3300025926 | Bacteria | 3037 |
| 430 | Ga0207687_10003861 | 3300025927 | Bacteria | 10059 |
| 431 | Ga0207644_10061939 | 3300025931 | Bacteria | 2711 |
| 432 | Ga0207644_10135086 | 3300025931 | Bacteria | 1893 |
| 433 | Ga0207690_10008231 | 3300025932 | Bacteria | 6185 |
| 434 | Ga0207690_10208126 | 3300025932 | Bacteria | 1490 |
| 435 | Ga0207706_10011643 | 3300025933 | Bacteria | 8017 |
| 436 | Ga0207686_10001479 | 3300025934 | Bacteria | 13268 |
| 437 | Ga0207686_10136773 | 3300025934 | Bacteria | 1688 |
| 438 | Ga0207686_10149679 | 3300025934 | Bacteria | 1623 |
| 439 | Ga0207709_10007010 | 3300025935 | Bacteria | 6301 |
| 440 | Ga0207709_10071435 | 3300025935 | Bacteria | 2204 |
| 441 | Ga0207709_10079160 | 3300025935 | Bacteria | 2112 |
| 442 | Ga0207709_10277474 | 3300025935 | Bacteria | 1236 |
| 443 | Ga0207670_10003899 | 3300025936 | Bacteria | 7960 |
| 444 | Ga0207669_10019594 | 3300025937 | Bacteria | 3527 |
| 445 | Ga0207669_10164210 | 3300025937 | Bacteria | 1572 |
| 446 | Ga0207704_10236774 | 3300025938 | Bacteria | 1361 |
| 447 | Ga0207691_10000360 | 3300025940 | Bacteria | 45895 |
| 448 | Ga0207711_10008363 | 3300025941 | Bacteria | 8658 |
| 449 | Ga0207689_10000392 | 3300025942 | Bacteria | 41178 |
| 450 | Ga0207689_10001083 | 3300025942 | Bacteria | 26263 |
| 451 | Ga0207689_10003617 | 3300025942 | Bacteria | 14127 |
| 452 | Ga0207661_10187473 | 3300025944 | Bacteria | 1812 |
| 453 | Ga0207679_10088713 | 3300025945 | Bacteria | 2385 |
| 454 | Ga0207679_10143879 | 3300025945 | Bacteria | 1931 |
| 455 | Ga0207667_10000191 | 3300025949 | Bacteria | 89641 |
| 456 | Ga0207667_10003921 | 3300025949 | Bacteria | 18305 |
| 457 | Ga0207667_10020526 | 3300025949 | Bacteria | 7343 |
| 458 | Ga0207667_10041636 | 3300025949 | Bacteria | 4884 |
| 459 | Ga0207667_10048606 | 3300025949 | Bacteria | 4485 |
| 460 | Ga0207667_10316662 | 3300025949 | Bacteria | 1593 |
| 461 | Ga0207651_10002638 | 3300025960 | Bacteria | 8571 |
| 462 | Ga0207651_10008778 | 3300025960 | Bacteria | 5484 |
| 463 | Ga0207651_10013533 | 3300025960 | Bacteria | 4672 |
| 464 | Ga0207668_10040301 | 3300025972 | Bacteria | 3150 |
| 465 | Ga0207668_10077168 | 3300025972 | Bacteria | 2401 |
| 466 | Ga0207640_10024716 | 3300025981 | Bacteria | 3629 |
| 467 | Ga0207640_10070453 | 3300025981 | Bacteria | 2352 |
| 468 | Ga0207640_10233545 | 3300025981 | Bacteria | 1416 |
| 469 | Ga0207658_10006579 | 3300025986 | Bacteria | 7921 |
| 470 | Ga0207677_10151862 | 3300026023 | Bacteria | 1788 |
| 471 | Ga0207677_10394827 | 3300026023 | Bacteria | 1171 |
| 472 | Ga0207703_10000206 | 3300026035 | Bacteria | 68955 |
| 473 | Ga0207703_10008734 | 3300026035 | Bacteria | 7997 |
| 474 | Ga0207639_10014797 | 3300026041 | Bacteria | 5495 |
| 475 | Ga0207639_10016794 | 3300026041 | Bacteria | 5186 |
| 476 | Ga0207678_10041294 | 3300026067 | Bacteria | 4000 |
| 477 | Ga0207678_10065216 | 3300026067 | Bacteria | 3128 |
| 478 | Ga0207708_10002193 | 3300026075 | Bacteria | 14415 |
| 479 | Ga0207708_10004853 | 3300026075 | Bacteria | 9910 |
| 480 | Ga0207708_10058747 | 3300026075 | Bacteria | 2934 |
| 481 | Ga0207702_10008513 | 3300026078 | Bacteria | 8649 |
| 482 | Ga0207641_10018478 | 3300026088 | Bacteria | 5716 |
| 483 | Ga0207648_10003800 | 3300026089 | Bacteria | 15788 |
| 484 | Ga0207648_10003985 | 3300026089 | Bacteria | 15326 |
| 485 | Ga0207648_10006481 | 3300026089 | Bacteria | 11625 |
| 486 | Ga0207648_10014008 | 3300026089 | Bacteria | 7429 |
| 487 | Ga0207648_10021649 | 3300026089 | Bacteria | 5776 |
| 488 | Ga0207648_10103380 | 3300026089 | Bacteria | 2498 |
| 489 | Ga0207676_10004246 | 3300026095 | Bacteria | 10121 |
| 490 | Ga0207676_10357518 | 3300026095 | Bacteria | 1352 |
| 491 | Ga0207674_10005154 | 3300026116 | Bacteria | 15575 |
| 492 | Ga0207674_10011720 | 3300026116 | Bacteria | 9839 |
| 493 | Ga0207674_10257878 | 3300026116 | Bacteria | 1691 |
| 494 | Ga0207674_10371125 | 3300026116 | Bacteria | 1383 |
| 495 | Ga0207675_100001654 | 3300026118 | Bacteria | 22285 |
| 496 | Ga0207675_100003993 | 3300026118 | Bacteria | 14308 |
| 497 | Ga0207675_100004949 | 3300026118 | Bacteria | 12840 |
| 498 | Ga0207675_100270391 | 3300026118 | Bacteria | 1649 |
| 499 | Ga0207683_10003821 | 3300026121 | Bacteria | 13050 |
| 500 | Ga0207683_10016849 | 3300026121 | Bacteria | 6217 |
| 501 | Ga0207683_10027137 | 3300026121 | Bacteria | 4949 |
| 502 | Ga0207698_10057249 | 3300026142 | Bacteria | 3015 |
| 503 | Ga0207698_10086278 | 3300026142 | Bacteria | 2552 |
| 504 | Ga0209281_1000178 | 3300027111 | Bacteria | 148152 |
| 505 | Ga0209281_1000417 | 3300027111 | Bacteria | 64228 |
| 506 | Ga0209281_1006414 | 3300027111 | Bacteria | 3073 |
| 507 | Ga0209371_1004784 | 3300027312 | Bacteria | 5704 |
| 508 | Ga0209983_1004868 | 3300027665 | Bacteria | 2804 |
| 509 | Ga0209282_1000023 | 3300027666 | Bacteria | 173309 |
| 510 | Ga0209974_10006207 | 3300027876 | Bacteria | 4183 |
| 511 | Ga0207428_10000339 | 3300027907 | Bacteria | 60728 |
| 512 | Ga0207428_10074571 | 3300027907 | Bacteria | 2661 |
| 513 | Ga0207428_10076537 | 3300027907 | Bacteria | 2620 |
| 514 | Ga0268265_10028054 | 3300028380 | Bacteria | 4027 |
| 515 | Ga0268265_10035938 | 3300028380 | Bacteria | 3625 |
| 516 | Ga0268265_10055740 | 3300028380 | Bacteria | 3004 |
| 517 | Ga0268265_10083585 | 3300028380 | Bacteria | 2528 |
| 518 | Ga0268265_10317874 | 3300028380 | Bacteria | 1409 |
| 519 | Ga0268264_10000570 | 3300028381 | Bacteria | 44804 |
| 520 | Ga0268264_10025112 | 3300028381 | Bacteria | 4868 |
| 521 | Ga0265319_1000177 | 3300028563 | Bacteria | 48363 |
| 522 | Ga0265318_10000258 | 3300028577 | Bacteria | 46107 |
| 523 | Ga0307517_10006989 | 3300028786 | Bacteria | 16571 |
| 524 | Ga0307515_10000145 | 3300028794 | Bacteria | 170814 |
| 525 | Ga0307515_10006043 | 3300028794 | Bacteria | 24341 |
| 526 | Ga0307515_10024560 | 3300028794 | Bacteria | 10497 |
| 527 | Ga0268256_1004561 | 3300030500 | Bacteria | 5704 |
| 528 | Ga0307512_10111845 | 3300030522 | Bacteria | 1795 |
| 529 | Ga0265330_10000359 | 3300031235 | Bacteria | 32172 |
| 530 | Ga0265332_10000138 | 3300031238 | Bacteria | 60108 |
| 531 | Ga0265328_10032042 | 3300031239 | Bacteria | 1952 |
| 532 | Ga0265320_10000284 | 3300031240 | Bacteria | 40965 |
| 533 | Ga0265325_10081223 | 3300031241 | Bacteria | 1611 |
| 534 | Ga0265329_10000076 | 3300031242 | Bacteria | 44517 |
| 535 | Ga0265340_10000688 | 3300031247 | Bacteria | 18993 |
| 536 | Ga0265339_10082625 | 3300031249 | Bacteria | 1695 |
| 537 | Ga0265331_10001134 | 3300031250 | Bacteria | 20335 |
| 538 | Ga0265327_10026162 | 3300031251 | Bacteria | 3385 |
| 539 | Ga0265316_10000843 | 3300031344 | Bacteria | 33894 |
| 540 | Ga0307513_10023595 | 3300031456 | Bacteria | 7183 |
| 541 | Ga0307513_10028483 | 3300031456 | Bacteria | 6386 |
| 542 | Ga0307509_10005306 | 3300031507 | Bacteria | 18025 |
| 543 | Ga0307509_10139564 | 3300031507 | Bacteria | 2362 |
| 544 | Ga0307408_100041302 | 3300031548 | Bacteria | 3270 |
| 545 | Ga0307408_100065328 | 3300031548 | Bacteria | 2668 |
| 546 | Ga0307408_100217199 | 3300031548 | Bacteria | 1558 |
| 547 | Ga0265313_10000089 | 3300031595 | Bacteria | 90452 |
| 548 | Ga0265314_10000211 | 3300031711 | Bacteria | 86370 |
| 549 | Ga0265342_10000390 | 3300031712 | Bacteria | 48465 |
| 550 | Ga0316578_10129310 | 3300031728 | Bacteria | 1519 |
| 551 | Ga0307516_10008188 | 3300031730 | Bacteria | 11874 |
| 552 | Ga0307516_10058949 | 3300031730 | Bacteria | 3735 |
| 553 | Ga0307516_10115698 | 3300031730 | Bacteria | 2478 |
| 554 | Ga0307516_10138472 | 3300031730 | Bacteria | 2206 |
| 555 | Ga0307516_10143542 | 3300031730 | Bacteria | 2154 |
| 556 | Ga0307516_10307254 | 3300031730 | Bacteria | 1260 |
| 557 | Ga0307405_10105597 | 3300031731 | Bacteria | 1898 |
| 558 | Ga0307413_10093966 | 3300031824 | Bacteria | 1962 |
| 559 | Ga0307410_10000433 | 3300031852 | Bacteria | 16724 |
| 560 | Ga0307410_10051802 | 3300031852 | Bacteria | 2769 |
| 561 | Ga0307410_10126557 | 3300031852 | Bacteria | 1871 |
| 562 | Ga0307410_10414393 | 3300031852 | Bacteria | 1091 |
| 563 | Ga0307406_10158956 | 3300031901 | Bacteria | 1622 |
| 564 | Ga0307407_10000903 | 3300031903 | Bacteria | 10021 |
| 565 | Ga0307407_10161473 | 3300031903 | Bacteria | 1467 |
| 566 | Ga0307412_10011920 | 3300031911 | Bacteria | 5048 |
| 567 | Ga0315914_1000016 | 3300031967 | Bacteria | 126814 |
| 568 | Ga0307409_100063242 | 3300031995 | Bacteria | 2901 |
| 569 | Ga0307409_100376629 | 3300031995 | Bacteria | 1348 |
| 570 | Ga0307409_100509822 | 3300031995 | Bacteria | 1173 |
| 571 | Ga0307416_100007289 | 3300032002 | Bacteria | 7013 |
| 572 | Ga0307416_100141755 | 3300032002 | Bacteria | 2186 |
| 573 | Ga0307416_100353900 | 3300032002 | Bacteria | 1487 |
| 574 | Ga0307414_10014216 | 3300032004 | Bacteria | 4763 |
| 575 | Ga0307414_10107416 | 3300032004 | Bacteria | 2115 |
| 576 | Ga0307411_10015181 | 3300032005 | Bacteria | 4317 |
| 577 | Ga0307411_10017969 | 3300032005 | Bacteria | 4046 |
| 578 | Ga0307411_10031050 | 3300032005 | Bacteria | 3282 |
| 579 | Ga0307415_100004225 | 3300032126 | Bacteria | 7420 |
| 580 | Ga0307415_100062302 | 3300032126 | Bacteria | 2586 |
| 581 | Ga0307507_10026219 | 3300033179 | Bacteria | 6291 |
| 582 | Ga0307507_10047478 | 3300033179 | Bacteria | 4193 |
| 583 | Ga0307510_10015777 | 3300033180 | Bacteria | 8931 |
| 584 | Ga0307510_10092443 | 3300033180 | Bacteria | 2861 |
| 585 | Ga0315913_1000027 | 3300033430 | Bacteria | 83484 |
| 586 | Ga0315915_1000007 | 3300033464 | Bacteria | 319225 |
| 587 | Ga0373924_0112174 | 3300035410 | Bacteria | 1179 |
| 588 | Ga0395898_0161500 | 3300037466 | Bacteria | 2143 |
| 589 | Ga0395898_0167942 | 3300037466 | Bacteria | 2098 |
| 590 | Ga0395905_0000377 | 3300037471 | Bacteria | 63595 |
| 591 | Ga0395905_0014555 | 3300037471 | Bacteria | 7504 |
| 592 | Ga0395905_0036652 | 3300037471 | Bacteria | 4607 |
| 593 | Ga0436364_0295982 | 3300037853 | Bacteria | 987 |
| 594 | Ga0436364_0780289 | 3300037853 | Bacteria | 1200 |
| 595 | Ga0436364_1376234 | 3300037853 | Bacteria | 1180 |
| 596 | Ga0395901_0187809 | 3300038443 | Bacteria | 2167 |
| 597 | Ga0395901_0269656 | 3300038443 | Bacteria | 1771 |
| 598 | Ga0395901_0591232 | 3300038443 | Bacteria | 1120 |
| 599 | Ga0436360_0865156 | 3300039438 | Bacteria | 2755 |
| 600 | Ga0436361_0069918 | 3300039447 | Bacteria | 1571 |
| 601 | Ga0436361_0532183 | 3300039447 | Bacteria | 5597 |
| 602 | Ga0436361_0589976 | 3300039447 | Bacteria | 1149 |
| 603 | Ga0436361_1085109 | 3300039447 | Bacteria | 7859 |
| 604 | Ga0436363_0629987 | 3300039450 | Bacteria | 5406 |
| 605 | Ga0436362_0758258 | 3300039453 | Bacteria | 2532 |
| 606 | Ga0451843_0757209 | 3300041509 | Bacteria | 1426 |
| 607 | Ga0451853_2198736 | 3300041512 | Bacteria | 5299 |
| 608 | Ga0451853_2516453 | 3300041512 | Bacteria | 1128 |
| 609 | Ga0439431_0005666 | 3300041997 | Bacteria | 2755 |
| 610 | Ga0439445_0025023 | 3300042004 | Bacteria | 1521 |
| 611 | Ga0450911_000152 | 3300042115 | Bacteria | 27922 |
| 612 | Ga0451577_0016723 | 3300042876 | Bacteria | 6783 |
| 613 | Ga0466969_0071730 | 3300044656 | Bacteria | 1665 |
| 614 | Ga0466960_0066206 | 3300044901 | Bacteria | 1786 |
| 615 | Ga0451576_0007753 | 3300045051 | Bacteria | 12749 |
| 616 | Ga0466958_0082323 | 3300045836 | Bacteria | 1982 |
| 617 | Ga0466967_0144164 | 3300045976 | Bacteria | 2221 |
| 618 | Ga0495592_0000142 | 3300046454 | Bacteria | 63571 |
| 619 | Ga0495638_0000475 | 3300046460 | Bacteria | 48300 |
| 620 | Ga0495638_0053901 | 3300046460 | Bacteria | 2502 |
| 621 | Ga0495610_0012550 | 3300046512 | Bacteria | 5091 |
| 622 | Ga0495610_0032117 | 3300046512 | Bacteria | 2732 |
| 623 | Ga0495620_0045866 | 3300046515 | Bacteria | 1890 |
| 624 | Ga0495632_0008357 | 3300046519 | Bacteria | 6363 |
| 625 | Ga0495643_0059573 | 3300046522 | Bacteria | 2029 |
| 626 | Ga0495642_0040094 | 3300046528 | Bacteria | 1901 |
| 627 | Ga0495621_0022362 | 3300046539 | Bacteria | 2095 |
| 628 | Ga0495597_0018419 | 3300046542 | Bacteria | 3277 |
| 629 | Ga0495625_0014315 | 3300046660 | Bacteria | 6337 |
| 630 | Ga0495625_0035602 | 3300046660 | Bacteria | 3668 |
| 631 | Ga0495625_0240517 | 3300046660 | Bacteria | 1179 |
| 632 | Ga0495661_0113359 | 3300046665 | Bacteria | 1508 |
| 633 | Ga0495670_0080575 | 3300046691 | Bacteria | 1658 |
| 634 | Ga0495649_0006612 | 3300046694 | Bacteria | 7204 |
| 635 | Ga0495660_0026540 | 3300046810 | Bacteria | 3283 |
| 636 | Ga0495660_0156147 | 3300046810 | Bacteria | 1123 |
| 637 | Ga0495604_0104577 | 3300047317 | Bacteria | 2074 |
| 638 | Ga0495687_018568 | 3300047443 | Bacteria | 3435 |
| 639 | Ga0495687_018940 | 3300047443 | Bacteria | 3389 |
| 640 | Ga0495687_033923 | 3300047443 | Bacteria | 2311 |
| 641 | Ga0495686_0038269 | 3300047472 | Bacteria | 3068 |
| 642 | Ga0496100_0194589 | 3300048903 | Bacteria | 1474 |
| 643 | Ga0496102_0041195 | 3300048905 | Bacteria | 4181 |
| 644 | Ga0496102_0148052 | 3300048905 | Bacteria | 2205 |
| 645 | Ga0496109_0144804 | 3300048912 | Bacteria | 2222 |
| 646 | Ga0496111_0112707 | 3300048914 | Bacteria | 2004 |
| 647 | Ga0496115_0131086 | 3300048918 | Bacteria | 2066 |
| 648 | Ga0496116_0009436 | 3300048919 | Bacteria | 8312 |
| 649 | Ga0496116_0014781 | 3300048919 | Bacteria | 6209 |
| 650 | Ga0496118_0002068 | 3300048921 | Bacteria | 28261 |
| 651 | Ga0496119_0008868 | 3300048922 | Bacteria | 8749 |
| 652 | Ga0496121_0000239 | 3300048924 | Bacteria | 118051 |
| 653 | Ga0496122_0010146 | 3300048925 | Bacteria | 9761 |
| 654 | Ga0496122_0023409 | 3300048925 | Bacteria | 5447 |
| 655 | Ga0496123_0000433 | 3300048926 | Bacteria | 75427 |
| 656 | Ga0496123_0045546 | 3300048926 | Bacteria | 2987 |
| 657 | Ga0496123_0155976 | 3300048926 | Bacteria | 1224 |
| 658 | Ga0496124_0073085 | 3300048927 | Bacteria | 2838 |
| 659 | Ga0496125_0000145 | 3300048928 | Bacteria | 156267 |
| 660 | Ga0496125_0000471 | 3300048928 | Bacteria | 71765 |
| 661 | Ga0496125_0007428 | 3300048928 | Bacteria | 11659 |
| 662 | Ga0496125_0010847 | 3300048928 | Bacteria | 9172 |
| 663 | Ga0501031_0013786 | 3300049568 | Bacteria | 5269 |
| 664 | Ga0501032_0002871 | 3300049569 | Bacteria | 13397 |
| 665 | Ga0501032_0167929 | 3300049569 | Bacteria | 1439 |
| 666 | Ga0501032_0180722 | 3300049569 | Bacteria | 1381 |
| 667 | Ga0501033_0002505 | 3300049570 | Bacteria | 15563 |
| 668 | Ga0501033_0010498 | 3300049570 | Bacteria | 7103 |
| 669 | Ga0501033_0050127 | 3300049570 | Bacteria | 3098 |
| 670 | Ga0501033_0101516 | 3300049570 | Bacteria | 2098 |
| 671 | Ga0501033_0236793 | 3300049570 | Bacteria | 1295 |
| 672 | Ga0501034_0031160 | 3300049571 | Bacteria | 5419 |
| 673 | Ga0501034_0055207 | 3300049571 | Bacteria | 3998 |
| 674 | Ga0501034_0225363 | 3300049571 | Bacteria | 1825 |
| 675 | Ga0501034_0332749 | 3300049571 | Bacteria | 1450 |
| 676 | Ga0501036_0012812 | 3300049572 | Bacteria | 6957 |
| 677 | Ga0501036_0173751 | 3300049572 | Bacteria | 1815 |
| 678 | Ga0501037_0000107 | 3300049573 | Bacteria | 78666 |
| 679 | Ga0501037_0033589 | 3300049573 | Bacteria | 3788 |
| 680 | Ga0501037_0102109 | 3300049573 | Bacteria | 2069 |
| 681 | Ga0501037_0144077 | 3300049573 | Bacteria | 1704 |
| 682 | Ga0501037_0201802 | 3300049573 | Bacteria | 1405 |
| 683 | Ga0501038_0027545 | 3300049574 | Bacteria | 5056 |
| 684 | Ga0501038_0098912 | 3300049574 | Bacteria | 2432 |
| 685 | Ga0501038_0236680 | 3300049574 | Bacteria | 1451 |
| 686 | Ga0501039_0201010 | 3300049575 | Bacteria | 1567 |
| 687 | Ga0501039_0245138 | 3300049575 | Bacteria | 1409 |
| 688 | Ga0501042_0178491 | 3300049578 | Bacteria | 1532 |
| 689 | Ga0501043_0000005 | 3300049579 | Bacteria | 254466 |
| 690 | Ga0501043_0002916 | 3300049579 | Bacteria | 14275 |
| 691 | Ga0501043_0042607 | 3300049579 | Bacteria | 3567 |
| 692 | Ga0501043_0212931 | 3300049579 | Bacteria | 1497 |
| 693 | Ga0501043_0221968 | 3300049579 | Bacteria | 1462 |
| 694 | Ga0501043_0250813 | 3300049579 | Bacteria | 1363 |
| 695 | Ga0501046_0002308 | 3300049580 | Bacteria | 17982 |
| 696 | Ga0501046_0182122 | 3300049580 | Bacteria | 1570 |
| 697 | Ga0501046_0269625 | 3300049580 | Bacteria | 1249 |
| 698 | Ga0501047_0024036 | 3300049581 | Bacteria | 5852 |
| 699 | Ga0501047_0024292 | 3300049581 | Bacteria | 5819 |
| 700 | Ga0501047_0025195 | 3300049581 | Bacteria | 5715 |
| 701 | Ga0501047_0026236 | 3300049581 | Bacteria | 5605 |
| 702 | Ga0501047_0046794 | 3300049581 | Bacteria | 4180 |
| 703 | Ga0501047_0061392 | 3300049581 | Bacteria | 3627 |
| 704 | Ga0501047_0091859 | 3300049581 | Bacteria | 2914 |
| 705 | Ga0501047_0406122 | 3300049581 | Bacteria | 1195 |
| 706 | Ga0501067_0240352 | 3300049583 | Bacteria | 1008 |
| 707 | Ga0501068_0007123 | 3300049584 | Bacteria | 6188 |
| 708 | Ga0501068_0317673 | 3300049584 | Bacteria | 998 |
| 709 | Ga0501069_0000033 | 3300049585 | Bacteria | 92477 |
| 710 | Ga0501069_0001322 | 3300049585 | Bacteria | 12147 |
| 711 | Ga0501069_0059776 | 3300049585 | Bacteria | 2127 |
| 712 | Ga0501069_0242466 | 3300049585 | Bacteria | 1050 |
| 713 | Ga0501070_0000739 | 3300049586 | Bacteria | 29890 |
| 714 | Ga0501070_0000913 | 3300049586 | Bacteria | 26864 |
| 715 | Ga0501070_0002192 | 3300049586 | Bacteria | 17163 |
| 716 | Ga0501070_0004818 | 3300049586 | Bacteria | 11531 |
| 717 | Ga0501070_0048714 | 3300049586 | Bacteria | 3519 |
| 718 | Ga0501070_0052204 | 3300049586 | Bacteria | 3393 |
| 719 | Ga0501070_0062213 | 3300049586 | Bacteria | 3092 |
| 720 | Ga0501070_0087003 | 3300049586 | Bacteria | 2587 |
| 721 | Ga0501070_0181903 | 3300049586 | Bacteria | 1730 |
| 722 | Ga0501070_0207899 | 3300049586 | Bacteria | 1607 |
| 723 | Ga0501071_0217626 | 3300049587 | Bacteria | 1437 |
| 724 | Ga0501072_0175271 | 3300049588 | Bacteria | 1711 |
| 725 | Ga0501073_0001103 | 3300049589 | Bacteria | 19577 |
| 726 | Ga0501073_0041167 | 3300049589 | Bacteria | 3265 |
| 727 | Ga0501073_0060391 | 3300049589 | Bacteria | 2646 |
| 728 | Ga0501073_0093108 | 3300049589 | Bacteria | 2094 |
| 729 | Ga0501073_0122498 | 3300049589 | Bacteria | 1802 |
| 730 | Ga0501074_0000571 | 3300049590 | Bacteria | 22782 |
| 731 | Ga0501074_0001626 | 3300049590 | Bacteria | 15235 |
| 732 | Ga0501074_0064696 | 3300049590 | Bacteria | 2633 |
| 733 | Ga0501074_0076350 | 3300049590 | Bacteria | 2405 |
| 734 | Ga0501074_0191368 | 3300049590 | Bacteria | 1459 |
| 735 | Ga0501075_0217699 | 3300049591 | Bacteria | 1457 |
| 736 | Ga0501076_0300308 | 3300049592 | Bacteria | 1316 |
| 737 | Ga0501077_0114122 | 3300049593 | Bacteria | 1713 |
| 738 | Ga0501079_0018396 | 3300049741 | Bacteria | 5340 |
| 739 | Ga0501080_0001237 | 3300049742 | Bacteria | 21233 |
| 740 | Ga0501080_0001592 | 3300049742 | Bacteria | 19267 |
| 741 | Ga0501080_0017171 | 3300049742 | Bacteria | 6685 |
| 742 | Ga0501080_0048231 | 3300049742 | Bacteria | 3964 |
| 743 | Ga0501080_0053387 | 3300049742 | Bacteria | 3762 |
| 744 | Ga0501080_0068537 | 3300049742 | Bacteria | 3300 |
| 745 | Ga0501080_0145255 | 3300049742 | Bacteria | 2193 |
| 746 | Ga0501081_0408593 | 3300049743 | Bacteria | 1006 |
| 747 | Ga0501083_0000355 | 3300049744 | Bacteria | 29001 |
| 748 | Ga0501083_0006285 | 3300049744 | Bacteria | 8428 |
| 749 | Ga0501083_0028777 | 3300049744 | Bacteria | 3827 |
| 750 | Ga0501035_0000086 | 3300049822 | Bacteria | 115822 |
| 751 | Ga0501035_0000933 | 3300049822 | Bacteria | 30964 |
| 752 | Ga0501035_0006474 | 3300049822 | Bacteria | 11001 |
| 753 | Ga0501035_0009526 | 3300049822 | Bacteria | 9032 |
| 754 | Ga0501035_0083516 | 3300049822 | Bacteria | 2818 |
| 755 | Ga0501035_0098834 | 3300049822 | Bacteria | 2562 |
| 756 | Ga0501035_0141374 | 3300049822 | Bacteria | 2092 |
| 757 | Ga0501035_0169890 | 3300049822 | Bacteria | 1884 |
| 758 | Ga0501044_0000223 | 3300049823 | Bacteria | 71752 |
| 759 | Ga0501044_0010628 | 3300049823 | Bacteria | 9986 |
| 760 | Ga0501044_0014960 | 3300049823 | Bacteria | 8365 |
| 761 | Ga0501044_0015139 | 3300049823 | Bacteria | 8312 |
| 762 | Ga0501044_0018664 | 3300049823 | Bacteria | 7429 |
| 763 | Ga0501044_0031354 | 3300049823 | Bacteria | 5595 |
| 764 | Ga0501044_0046382 | 3300049823 | Bacteria | 4499 |
| 765 | Ga0501044_0069128 | 3300049823 | Bacteria | 3596 |
| 766 | Ga0501044_0114589 | 3300049823 | Bacteria | 2701 |
| 767 | Ga0501044_0134722 | 3300049823 | Bacteria | 2462 |
| 768 | Ga0501044_0153181 | 3300049823 | Bacteria | 2286 |
| 769 | Ga0501044_0177481 | 3300049823 | Bacteria | 2098 |
| 770 | Ga0501044_0267514 | 3300049823 | Bacteria | 1646 |
| 771 | Ga0501044_0375135 | 3300049823 | Bacteria | 1338 |
| 772 | Ga0501045_0224309 | 3300049824 | Bacteria | 1399 |
| 773 | nmdc:mga03683_117211_c1 | 3300050489 | Bacteria | 1181 |
| 774 | nmdc:mga00v17_14_c1 | 3300050491 | Bacteria | 126589 |
| 775 | nmdc:mga0k408_215773_c1 | 3300050493 | Bacteria | 1146 |
| 776 | nmdc:mga06z11_20882_c2 | 3300050494 | Bacteria | 2155 |
| 777 | nmdc:mga07m45_2012_c1 | 3300050496 | Bacteria | 9421 |
| 778 | nmdc:mga07m45_62540_c1 | 3300050496 | Bacteria | 2110 |
| 779 | nmdc:mga05p37_379666_c1 | 3300050507 | Bacteria | 1656 |
| 780 | nmdc:mga05p37_40366_c1 | 3300050507 | Bacteria | 5731 |
| 781 | nmdc:mga0qj67_107510_c1 | 3300050509 | Bacteria | 2250 |
| 782 | nmdc:mga0qj67_77679_c1 | 3300050509 | Bacteria | 2656 |
| 783 | nmdc:mga06r32_22751_c1 | 3300050510 | Bacteria | 5797 |
| 784 | nmdc:mga08y16_1044_c1 | 3300050511 | Bacteria | 27165 |
| 785 | nmdc:mga08y16_192047_c1 | 3300050511 | Bacteria | 2118 |
| 786 | nmdc:mga08y16_676473_c1 | 3300050511 | Bacteria | 1034 |
| 787 | nmdc:mga08y16_699023_c1 | 3300050511 | Bacteria | 1014 |
| 788 | nmdc:mga08y16_76334_c1 | 3300050511 | Bacteria | 3493 |
| 789 | nmdc:mga0a205_134935_c1 | 3300050515 | Bacteria | 2368 |
| 790 | nmdc:mga0a205_377792_c1 | 3300050515 | Bacteria | 1282 |
| 791 | nmdc:mga0sz30_18177_c1 | 3300050516 | Bacteria | 2811 |
| 792 | Ga0500578_0000442 | 3300053086 | Bacteria | 50642 |
| 793 | Ga0500643_044588 | 3300053087 | Bacteria | 1288 |
| 794 | Ga0500594_0052345 | 3300053118 | Bacteria | 1153 |
| 795 | Ga0500642_0001036 | 3300053130 | Bacteria | 8013 |
| 796 | Ga0500658_0002498 | 3300053134 | Bacteria | 7116 |
| 797 | Ga0500658_0007229 | 3300053134 | Bacteria | 4101 |
| 798 | Ga0500559_0000014 | 3300053136 | Bacteria | 160139 |
| 799 | Ga0500568_0000436 | 3300053139 | Bacteria | 31383 |
| 800 | Ga0500568_0016368 | 3300053139 | Bacteria | 3299 |
| 801 | Ga0500588_0017792 | 3300053146 | Bacteria | 1862 |
| 802 | Ga0500588_0029486 | 3300053146 | Bacteria | 1565 |
| 803 | Ga0500590_021314 | 3300053148 | Bacteria | 3364 |
| 804 | Ga0500604_0010562 | 3300053151 | Bacteria | 2472 |
| 805 | Ga0500616_0000472 | 3300053153 | Bacteria | 52191 |
| 806 | Ga0500616_0038335 | 3300053153 | Bacteria | 2589 |
| 807 | Ga0500622_0006682 | 3300053156 | Bacteria | 6647 |
| 808 | Ga0500634_0000507 | 3300053161 | Bacteria | 12661 |
| 809 | Ga0500645_007944 | 3300053730 | Bacteria | 3658 |
| 810 | Ga0501084_0138069 | 3300054114 | Bacteria | 2052 |
| 811 | Ga0590071_013079 | 3300059421 | Bacteria | 1945 |
| 812 | Ga0501082_0032114 | 3300060353 | Bacteria | 4529 |
| 813 | Ga0501082_0034523 | 3300060353 | Bacteria | 4360 |
| 814 | Ga0501082_0083700 | 3300060353 | Bacteria | 2752 |
| 815 | Ga0501082_0084199 | 3300060353 | Bacteria | 2743 |
| 816 | Ga0530510_0023194 | 3300061734 | Bacteria | 4420 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047443 | Ga0495687_033923 | Ga0495687_033923_819_1718 | 277 |
| 2 | iso_pu_bacteria | 2970489779 | 2970495186 | 279 |
| 3 | 3300031730 | Ga0307516_10143542 | Ga0307516_101435422 | 282 |
| 4 | 3300053118 | Ga0500594_0052345 | Ga0500594_0052345_18_869 | 282 |
| 5 | iso_pu_bacteria | 2979742915 | 2979750770 | 282 |
| 6 | 3300009545 | Ga0105237_10264298 | Ga0105237_102642982 | 283 |
| 7 | 3300026023 | Ga0207677_10394827 | Ga0207677_103948272 | 283 |
| 8 | 3300053139 | Ga0500568_0000436 | Ga0500568_0000436_8078_8929 | 283 |
| 9 | 3300046539 | Ga0495621_0022362 | Ga0495621_0022362_301_1200 | 284 |
| 10 | 3300049591 | Ga0501075_0217699 | Ga0501075_0217699_194_1141 | 288 |
| 11 | 3300009765 | Ga0123341_1077652 | Ga0123341_10776522 | 289 |
| 12 | 3300010375 | Ga0105239_10101033 | Ga0105239_101010335 | 289 |
| 13 | 3300050507 | nmdc:mga05p37_379666_c1 | nmdc:mga05p37_379666_c1_17_889 | 289 |
| 14 | iso_pu_bacteria | 2839094727 | 2839096587 | 289 |
| 15 | 3300039447 | Ga0436361_0069918 | Ga0436361_0069918_548_1498 | 290 |
| 16 | 3300039453 | Ga0436362_0758258 | Ga0436362_0758258_952_1902 | 290 |
| 17 | 3300053148 | Ga0500590_021314 | Ga0500590_021314_493_1476 | 290 |
| 18 | iso_pu_bacteria | 2842264693 | 2842265264 | 290 |
| 19 | iso_pu_bacteria | 2842428310 | 2842428683 | 290 |
| 20 | iso_pu_bacteria | 2842434925 | 2842435296 | 290 |
| 21 | iso_pu_bacteria | 2842441272 | 2842441841 | 290 |
| 22 | iso_pu_bacteria | 2842462802 | 2842463107 | 290 |
| 23 | iso_pu_bacteria | 2842469257 | 2842469627 | 290 |
| 24 | 3300005438 | Ga0070701_10013615 | Ga0070701_100136152 | 291 |
| 25 | 3300014325 | Ga0163163_10116193 | Ga0163163_101161932 | 291 |
| 26 | 3300021327 | Ga0214543_1000005 | Ga0214543_1000005277 | 291 |
| 27 | iso_pu_bacteria | 2844533157 | 2844535281 | 291 |
| 28 | 3300003763 | Ga0055529_1001031 | Ga0055529_10010314 | 292 |
| 29 | 3300025242 | Ga0209258_102714 | Ga0209258_1027142 | 292 |
| 30 | 3300025272 | Ga0209455_1000841 | Ga0209455_10008414 | 292 |
| 31 | 3300031456 | Ga0307513_10023595 | Ga0307513_100235953 | 293 |
| 32 | 3300039438 | Ga0436360_0865156 | Ga0436360_0865156_932_1882 | 293 |
| 33 | 3300009093 | Ga0105240_10015015 | Ga0105240_1001501510 | 294 |
| 34 | iso_pu_bacteria | 2511231003 | 2511252191 | 294 |
| 35 | iso_pu_bacteria | 2511231026 | 2511383673 | 294 |
| 36 | iso_pu_bacteria | 2521172590 | 2521559296 | 294 |
| 37 | iso_pu_bacteria | 2548876994 | 2550696175 | 294 |
| 38 | iso_pu_bacteria | 2551306416 | 2553004095 | 294 |
| 39 | iso_pu_bacteria | 2739367655 | 2739612867 | 294 |
| 40 | iso_pu_bacteria | 2765235838 | 2765568534 | 294 |
| 41 | iso_pu_bacteria | 2808606386 | 2808981267 | 294 |
| 42 | iso_pu_bacteria | 2808606415 | 2809128850 | 294 |
| 43 | iso_pu_bacteria | 2808606419 | 2809148471 | 294 |
| 44 | iso_pu_bacteria | 2818991445 | 2819595493 | 294 |
| 45 | iso_pu_bacteria | 2818991449 | 2819615810 | 294 |
| 46 | iso_pu_bacteria | 2852618963 | 2852621004 | 294 |
| 47 | iso_pu_bacteria | 2881927736 | 2881928157 | 294 |
| 48 | iso_pu_bacteria | 2884811622 | 2884817056 | 294 |
| 49 | iso_pu_bacteria | 2884836552 | 2884836739 | 294 |
| 50 | iso_pu_bacteria | 2884852848 | 2884853030 | 294 |
| 51 | iso_pu_bacteria | 2887375801 | 2887376940 | 294 |
| 52 | iso_pu_bacteria | 2896154374 | 2896155852 | 294 |
| 53 | iso_pu_bacteria | 2904439833 | 2904443705 | 294 |
| 54 | iso_pu_bacteria | 2904530477 | 2904532602 | 294 |
| 55 | iso_pu_bacteria | 2904584206 | 2904585100 | 294 |
| 56 | iso_pu_bacteria | 2904589729 | 2904593449 | 294 |
| 57 | iso_pu_bacteria | 2904601388 | 2904605629 | 294 |
| 58 | iso_pu_bacteria | 2919046199 | 2919048092 | 294 |
| 59 | iso_pu_bacteria | 2919079590 | 2919081424 | 294 |
| 60 | iso_pu_bacteria | 2923510766 | 2923512969 | 294 |
| 61 | iso_pu_bacteria | 2928130867 | 2928133808 | 294 |
| 62 | 3300047472 | Ga0495686_0038269 | Ga0495686_0038269_1338_2225 | 295 |
| 63 | iso_pu_bacteria | 2585428058 | 2587733828 | 296 |
| 64 | iso_pu_bacteria | 2588253510 | 2588291635 | 296 |
| 65 | iso_pu_bacteria | 2643221654 | 2644302448 | 296 |
| 66 | 3300005471 | Ga0070698_100379075 | Ga0070698_1003790752 | 297 |
| 67 | iso_pu_bacteria | 2643221592 | 2643972532 | 297 |
| 68 | iso_pu_bacteria | 2643221625 | 2644138460 | 297 |
| 69 | iso_pu_bacteria | 2643221648 | 2644273040 | 297 |
| 70 | 3300002705 | JGI25156J39149_1000675 | JGI25156J39149_100067518 | 298 |
| 71 | 3300002741 | JGI25157J39369_1001106 | JGI25157J39369_10011068 | 298 |
| 72 | 3300003187 | JGI25151J46595_10009780 | JGI25151J46595_100097802 | 298 |
| 73 | 3300003751 | Ga0055538_1000054 | Ga0055538_100005498 | 298 |
| 74 | 3300003752 | Ga0055539_1000066 | Ga0055539_100006698 | 298 |
| 75 | 3300003756 | Ga0055533_1000076 | Ga0055533_100007698 | 298 |
| 76 | 3300003758 | Ga0055532_1000157 | Ga0055532_100015733 | 298 |
| 77 | 3300003759 | Ga0055525_1000098 | Ga0055525_100009898 | 298 |
| 78 | 3300003761 | Ga0055535_1006969 | Ga0055535_10069692 | 298 |
| 79 | 3300003771 | Ga0055526_1006049 | Ga0055526_10060493 | 298 |
| 80 | 3300003775 | Ga0055524_1001068 | Ga0055524_10010688 | 298 |
| 81 | 3300003784 | Ga0055534_1003753 | Ga0055534_10037534 | 298 |
| 82 | 3300003841 | Ga0055541_1000056 | Ga0055541_100005698 | 298 |
| 83 | 3300005293 | Ga0065715_10193679 | Ga0065715_101936791 | 298 |
| 84 | 3300005329 | Ga0070683_100232746 | Ga0070683_1002327462 | 298 |
| 85 | 3300005331 | Ga0070670_100234155 | Ga0070670_1002341551 | 298 |
| 86 | 3300005333 | Ga0070677_10074465 | Ga0070677_100744651 | 298 |
| 87 | 3300005335 | Ga0070666_10116012 | Ga0070666_101160121 | 298 |
| 88 | 3300005365 | Ga0070688_100017786 | Ga0070688_1000177864 | 298 |
| 89 | 3300005367 | Ga0070667_100298841 | Ga0070667_1002988412 | 298 |
| 90 | 3300005438 | Ga0070701_10009247 | Ga0070701_100092472 | 298 |
| 91 | 3300005441 | Ga0070700_100013467 | Ga0070700_1000134672 | 298 |
| 92 | 3300005456 | Ga0070678_100185348 | Ga0070678_1001853482 | 298 |
| 93 | 3300005539 | Ga0068853_100020351 | Ga0068853_1000203513 | 298 |
| 94 | 3300005539 | Ga0068853_100369417 | Ga0068853_1003694172 | 298 |
| 95 | 3300005548 | Ga0070665_100013700 | Ga0070665_1000137003 | 298 |
| 96 | 3300005549 | Ga0070704_100074861 | Ga0070704_1000748612 | 298 |
| 97 | 3300005563 | Ga0068855_100000791 | Ga0068855_1000007913 | 298 |
| 98 | 3300005564 | Ga0070664_100062640 | Ga0070664_1000626403 | 298 |
| 99 | 3300005578 | Ga0068854_100001709 | Ga0068854_10000170912 | 298 |
| 100 | 3300005578 | Ga0068854_100162153 | Ga0068854_1001621533 | 298 |
| 101 | 3300005615 | Ga0070702_100007399 | Ga0070702_1000073993 | 298 |
| 102 | 3300005618 | Ga0068864_100589867 | Ga0068864_1005898671 | 298 |
| 103 | 3300005718 | Ga0068866_10196355 | Ga0068866_101963552 | 298 |
| 104 | 3300005841 | Ga0068863_100052015 | Ga0068863_1000520153 | 298 |
| 105 | 3300005843 | Ga0068860_100033901 | Ga0068860_1000339013 | 298 |
| 106 | 3300006237 | Ga0097621_100103634 | Ga0097621_1001036342 | 298 |
| 107 | 3300006881 | Ga0068865_100029089 | Ga0068865_1000290892 | 298 |
| 108 | 3300006881 | Ga0068865_100044124 | Ga0068865_1000441242 | 298 |
| 109 | 3300006946 | Ga0079104_1004787 | Ga0079104_10047872 | 298 |
| 110 | 3300007265 | Ga0099794_10016591 | Ga0099794_100165914 | 298 |
| 111 | 3300009011 | Ga0105251_10025196 | Ga0105251_100251963 | 298 |
| 112 | 3300009093 | Ga0105240_10002015 | Ga0105240_100020158 | 298 |
| 113 | 3300009093 | Ga0105240_10044364 | Ga0105240_100443642 | 298 |
| 114 | 3300009094 | Ga0111539_10016103 | Ga0111539_100161035 | 298 |
| 115 | 3300009098 | Ga0105245_10117457 | Ga0105245_101174572 | 298 |
| 116 | 3300009148 | Ga0105243_10051108 | Ga0105243_100511082 | 298 |
| 117 | 3300009148 | Ga0105243_10131794 | Ga0105243_101317942 | 298 |
| 118 | 3300009176 | Ga0105242_10010144 | Ga0105242_100101446 | 298 |
| 119 | 3300009176 | Ga0105242_10222304 | Ga0105242_102223042 | 298 |
| 120 | 3300009177 | Ga0105248_10135127 | Ga0105248_101351272 | 298 |
| 121 | 3300009545 | Ga0105237_10031873 | Ga0105237_100318733 | 298 |
| 122 | 3300009551 | Ga0105238_10000632 | Ga0105238_100006325 | 298 |
| 123 | 3300009551 | Ga0105238_10007883 | Ga0105238_100078835 | 298 |
| 124 | 3300009766 | Ga0123342_1021599 | Ga0123342_10215992 | 298 |
| 125 | 3300010375 | Ga0105239_10058642 | Ga0105239_100586421 | 298 |
| 126 | 3300011119 | Ga0105246_10297245 | Ga0105246_102972452 | 298 |
| 127 | 3300013104 | Ga0157370_10382074 | Ga0157370_103820742 | 298 |
| 128 | 3300013297 | Ga0157378_10025128 | Ga0157378_100251285 | 298 |
| 129 | 3300013297 | Ga0157378_10227349 | Ga0157378_102273492 | 298 |
| 130 | 3300014325 | Ga0163163_10712870 | Ga0163163_107128701 | 298 |
| 131 | 3300014326 | Ga0157380_10074057 | Ga0157380_100740573 | 298 |
| 132 | 3300014968 | Ga0157379_10073386 | Ga0157379_100733863 | 298 |
| 133 | 3300014968 | Ga0157379_10075283 | Ga0157379_100752832 | 298 |
| 134 | 3300015261 | Ga0182006_1005634 | Ga0182006_10056347 | 298 |
| 135 | 3300017792 | Ga0163161_10093925 | Ga0163161_100939251 | 298 |
| 136 | 3300025206 | Ga0209435_100085 | Ga0209435_10008521 | 298 |
| 137 | 3300025206 | Ga0209435_100486 | Ga0209435_1004867 | 298 |
| 138 | 3300025224 | Ga0209784_100002 | Ga0209784_1000021586 | 298 |
| 139 | 3300025225 | Ga0209566_100003 | Ga0209566_1000031586 | 298 |
| 140 | 3300025226 | Ga0209674_100004 | Ga0209674_1000041586 | 298 |
| 141 | 3300025229 | Ga0209147_100217 | Ga0209147_10021734 | 298 |
| 142 | 3300025230 | Ga0209563_100006 | Ga0209563_1000061586 | 298 |
| 143 | 3300025242 | Ga0209258_100390 | Ga0209258_10039021 | 298 |
| 144 | 3300025246 | Ga0209646_1000204 | Ga0209646_100020411 | 298 |
| 145 | 3300025246 | Ga0209646_1000227 | Ga0209646_100022721 | 298 |
| 146 | 3300025250 | Ga0209026_1000340 | Ga0209026_100034020 | 298 |
| 147 | 3300025253 | Ga0209677_100003 | Ga0209677_1000031586 | 298 |
| 148 | 3300025256 | Ga0209759_1000298 | Ga0209759_100029811 | 298 |
| 149 | 3300025256 | Ga0209759_1000561 | Ga0209759_100056121 | 298 |
| 150 | 3300025263 | Ga0209565_1000021 | Ga0209565_1000021101 | 298 |
| 151 | 3300025291 | Ga0209675_1003321 | Ga0209675_10033212 | 298 |
| 152 | 3300025292 | Ga0209676_1001620 | Ga0209676_10016208 | 298 |
| 153 | 3300025294 | Ga0209025_1008454 | Ga0209025_10084542 | 298 |
| 154 | 3300025295 | Ga0209564_1000218 | Ga0209564_100021812 | 298 |
| 155 | 3300025295 | Ga0209564_1000452 | Ga0209564_100045227 | 298 |
| 156 | 3300025298 | Ga0209050_1003004 | Ga0209050_10030048 | 298 |
| 157 | 3300025299 | Ga0209256_1001569 | Ga0209256_100156910 | 298 |
| 158 | 3300025299 | Ga0209256_1003336 | Ga0209256_10033362 | 298 |
| 159 | 3300025303 | Ga0209051_1004860 | Ga0209051_10048606 | 298 |
| 160 | 3300025304 | Ga0209257_1002116 | Ga0209257_100211617 | 298 |
| 161 | 3300025315 | Ga0207697_10009556 | Ga0207697_100095565 | 298 |
| 162 | 3300025893 | Ga0207682_10001921 | Ga0207682_100019217 | 298 |
| 163 | 3300025907 | Ga0207645_10002683 | Ga0207645_100026833 | 298 |
| 164 | 3300025908 | Ga0207643_10000796 | Ga0207643_100007964 | 298 |
| 165 | 3300025913 | Ga0207695_10001105 | Ga0207695_1000110521 | 298 |
| 166 | 3300025913 | Ga0207695_10018728 | Ga0207695_100187282 | 298 |
| 167 | 3300025918 | Ga0207662_10151178 | Ga0207662_101511782 | 298 |
| 168 | 3300025924 | Ga0207694_10000171 | Ga0207694_1000017154 | 298 |
| 169 | 3300025925 | Ga0207650_10382634 | Ga0207650_103826341 | 298 |
| 170 | 3300025926 | Ga0207659_10047076 | Ga0207659_100470762 | 298 |
| 171 | 3300025934 | Ga0207686_10136773 | Ga0207686_101367732 | 298 |
| 172 | 3300025935 | Ga0207709_10071435 | Ga0207709_100714353 | 298 |
| 173 | 3300025935 | Ga0207709_10079160 | Ga0207709_100791602 | 298 |
| 174 | 3300025942 | Ga0207689_10003617 | Ga0207689_100036177 | 298 |
| 175 | 3300025949 | Ga0207667_10000191 | Ga0207667_100001913 | 298 |
| 176 | 3300025949 | Ga0207667_10003921 | Ga0207667_1000392115 | 298 |
| 177 | 3300025949 | Ga0207667_10020526 | Ga0207667_100205263 | 298 |
| 178 | 3300026041 | Ga0207639_10014797 | Ga0207639_100147973 | 298 |
| 179 | 3300026075 | Ga0207708_10004853 | Ga0207708_100048532 | 298 |
| 180 | 3300026089 | Ga0207648_10003800 | Ga0207648_100038008 | 298 |
| 181 | 3300026089 | Ga0207648_10014008 | Ga0207648_100140088 | 298 |
| 182 | 3300026116 | Ga0207674_10371125 | Ga0207674_103711252 | 298 |
| 183 | 3300026118 | Ga0207675_100003993 | Ga0207675_10000399310 | 298 |
| 184 | 3300026121 | Ga0207683_10016849 | Ga0207683_100168496 | 298 |
| 185 | 3300027111 | Ga0209281_1006414 | Ga0209281_10064142 | 298 |
| 186 | 3300027907 | Ga0207428_10076537 | Ga0207428_100765372 | 298 |
| 187 | 3300028786 | Ga0307517_10006989 | Ga0307517_100069899 | 298 |
| 188 | 3300030522 | Ga0307512_10111845 | Ga0307512_101118452 | 298 |
| 189 | 3300031507 | Ga0307509_10005306 | Ga0307509_1000530613 | 298 |
| 190 | 3300031824 | Ga0307413_10093966 | Ga0307413_100939661 | 298 |
| 191 | 3300031852 | Ga0307410_10051802 | Ga0307410_100518023 | 298 |
| 192 | 3300032002 | Ga0307416_100141755 | Ga0307416_1001417552 | 298 |
| 193 | 3300032126 | Ga0307415_100004225 | Ga0307415_1000042256 | 298 |
| 194 | 3300033180 | Ga0307510_10015777 | Ga0307510_100157772 | 298 |
| 195 | 3300033180 | Ga0307510_10092443 | Ga0307510_100924432 | 298 |
| 196 | 3300037466 | Ga0395898_0167942 | Ga0395898_0167942_398_1297 | 298 |
| 197 | 3300037853 | Ga0436364_0295982 | Ga0436364_0295982_58_960 | 298 |
| 198 | 3300038443 | Ga0395901_0187809 | Ga0395901_0187809_38_937 | 298 |
| 199 | 3300039447 | Ga0436361_0532183 | Ga0436361_0532183_2033_2932 | 298 |
| 200 | 3300046512 | Ga0495610_0032117 | Ga0495610_0032117_598_1497 | 298 |
| 201 | 3300047317 | Ga0495604_0104577 | Ga0495604_0104577_525_1484 | 298 |
| 202 | 3300048919 | Ga0496116_0014781 | Ga0496116_0014781_105_1004 | 298 |
| 203 | 3300048926 | Ga0496123_0000433 | Ga0496123_0000433_8229_9128 | 298 |
| 204 | 3300048928 | Ga0496125_0007428 | Ga0496125_0007428_925_1824 | 298 |
| 205 | 3300050511 | nmdc:mga08y16_192047_c1 | nmdc:mga08y16_192047_c1_519_1418 | 298 |
| 206 | 3300050511 | nmdc:mga08y16_699023_c1 | nmdc:mga08y16_699023_c1_44_943 | 298 |
| 207 | 3300053136 | Ga0500559_0000014 | Ga0500559_0000014_147705_148604 | 298 |
| 208 | 3300053156 | Ga0500622_0006682 | Ga0500622_0006682_2276_3175 | 298 |
| 209 | 3300005290 | Ga0065712_10009354 | Ga0065712_100093543 | 299 |
| 210 | 3300005293 | Ga0065715_10037650 | Ga0065715_100376502 | 299 |
| 211 | 3300005330 | Ga0070690_100000104 | Ga0070690_10000010413 | 299 |
| 212 | 3300005331 | Ga0070670_100000403 | Ga0070670_10000040322 | 299 |
| 213 | 3300005333 | Ga0070677_10002422 | Ga0070677_100024223 | 299 |
| 214 | 3300005334 | Ga0068869_100001111 | Ga0068869_10000111112 | 299 |
| 215 | 3300005337 | Ga0070682_100069986 | Ga0070682_1000699862 | 299 |
| 216 | 3300005338 | Ga0068868_100295442 | Ga0068868_1002954422 | 299 |
| 217 | 3300005340 | Ga0070689_100010513 | Ga0070689_1000105134 | 299 |
| 218 | 3300005341 | Ga0070691_10036418 | Ga0070691_100364182 | 299 |
| 219 | 3300005345 | Ga0070692_10001690 | Ga0070692_100016904 | 299 |
| 220 | 3300005354 | Ga0070675_100015525 | Ga0070675_1000155253 | 299 |
| 221 | 3300005355 | Ga0070671_100014895 | Ga0070671_1000148954 | 299 |
| 222 | 3300005356 | Ga0070674_100175461 | Ga0070674_1001754612 | 299 |
| 223 | 3300005438 | Ga0070701_10000947 | Ga0070701_1000094710 | 299 |
| 224 | 3300005440 | Ga0070705_100030887 | Ga0070705_1000308872 | 299 |
| 225 | 3300005441 | Ga0070700_100001391 | Ga0070700_1000013913 | 299 |
| 226 | 3300005456 | Ga0070678_100013439 | Ga0070678_1000134393 | 299 |
| 227 | 3300005456 | Ga0070678_100067388 | Ga0070678_1000673883 | 299 |
| 228 | 3300005543 | Ga0070672_100001817 | Ga0070672_10000181713 | 299 |
| 229 | 3300005544 | Ga0070686_100001046 | Ga0070686_1000010467 | 299 |
| 230 | 3300005545 | Ga0070695_100005269 | Ga0070695_1000052694 | 299 |
| 231 | 3300005547 | Ga0070693_100014082 | Ga0070693_1000140822 | 299 |
| 232 | 3300005548 | Ga0070665_100230392 | Ga0070665_1002303922 | 299 |
| 233 | 3300005615 | Ga0070702_100000641 | Ga0070702_10000064112 | 299 |
| 234 | 3300005617 | Ga0068859_100082410 | Ga0068859_1000824102 | 299 |
| 235 | 3300005718 | Ga0068866_10003238 | Ga0068866_100032383 | 299 |
| 236 | 3300005840 | Ga0068870_10010548 | Ga0068870_100105483 | 299 |
| 237 | 3300005842 | Ga0068858_100000679 | Ga0068858_1000006793 | 299 |
| 238 | 3300005843 | Ga0068860_100114734 | Ga0068860_1001147342 | 299 |
| 239 | 3300006195 | Ga0075366_10052539 | Ga0075366_100525392 | 299 |
| 240 | 3300006195 | Ga0075366_10119205 | Ga0075366_101192051 | 299 |
| 241 | 3300006237 | Ga0097621_100017693 | Ga0097621_1000176931 | 299 |
| 242 | 3300006358 | Ga0068871_100006781 | Ga0068871_1000067813 | 299 |
| 243 | 3300006931 | Ga0097620_100082414 | Ga0097620_1000824142 | 299 |
| 244 | 3300009098 | Ga0105245_10004092 | Ga0105245_1000409212 | 299 |
| 245 | 3300009148 | Ga0105243_10035348 | Ga0105243_100353483 | 299 |
| 246 | 3300009176 | Ga0105242_10008454 | Ga0105242_100084543 | 299 |
| 247 | 3300013297 | Ga0157378_10003424 | Ga0157378_1000342412 | 299 |
| 248 | 3300014326 | Ga0157380_10003649 | Ga0157380_100036498 | 299 |
| 249 | 3300014968 | Ga0157379_10106342 | Ga0157379_101063422 | 299 |
| 250 | 3300025893 | Ga0207682_10001129 | Ga0207682_1000112912 | 299 |
| 251 | 3300025899 | Ga0207642_10000792 | Ga0207642_100007925 | 299 |
| 252 | 3300025925 | Ga0207650_10000408 | Ga0207650_1000040814 | 299 |
| 253 | 3300025926 | Ga0207659_10000256 | Ga0207659_100002569 | 299 |
| 254 | 3300025927 | Ga0207687_10003861 | Ga0207687_100038612 | 299 |
| 255 | 3300025934 | Ga0207686_10001479 | Ga0207686_1000147912 | 299 |
| 256 | 3300025934 | Ga0207686_10149679 | Ga0207686_101496791 | 299 |
| 257 | 3300025935 | Ga0207709_10007010 | Ga0207709_100070107 | 299 |
| 258 | 3300025936 | Ga0207670_10003899 | Ga0207670_100038993 | 299 |
| 259 | 3300025937 | Ga0207669_10019594 | Ga0207669_100195943 | 299 |
| 260 | 3300025937 | Ga0207669_10164210 | Ga0207669_101642101 | 299 |
| 261 | 3300025938 | Ga0207704_10236774 | Ga0207704_102367742 | 299 |
| 262 | 3300025940 | Ga0207691_10000360 | Ga0207691_1000036022 | 299 |
| 263 | 3300025942 | Ga0207689_10000392 | Ga0207689_1000039213 | 299 |
| 264 | 3300025960 | Ga0207651_10013533 | Ga0207651_100135333 | 299 |
| 265 | 3300026035 | Ga0207703_10008734 | Ga0207703_100087343 | 299 |
| 266 | 3300026075 | Ga0207708_10002193 | Ga0207708_1000219312 | 299 |
| 267 | 3300026089 | Ga0207648_10003985 | Ga0207648_1000398515 | 299 |
| 268 | 3300026089 | Ga0207648_10006481 | Ga0207648_100064811 | 299 |
| 269 | 3300026089 | Ga0207648_10103380 | Ga0207648_101033801 | 299 |
| 270 | 3300026118 | Ga0207675_100004949 | Ga0207675_1000049493 | 299 |
| 271 | 3300026121 | Ga0207683_10003821 | Ga0207683_100038213 | 299 |
| 272 | 3300026121 | Ga0207683_10027137 | Ga0207683_100271373 | 299 |
| 273 | 3300028380 | Ga0268265_10083585 | Ga0268265_100835851 | 299 |
| 274 | 3300028794 | Ga0307515_10006043 | Ga0307515_1000604317 | 299 |
| 275 | 3300031548 | Ga0307408_100065328 | Ga0307408_1000653282 | 299 |
| 276 | 3300031911 | Ga0307412_10011920 | Ga0307412_100119202 | 299 |
| 277 | 3300032004 | Ga0307414_10014216 | Ga0307414_100142163 | 299 |
| 278 | 3300032005 | Ga0307411_10015181 | Ga0307411_100151812 | 299 |
| 279 | 3300042115 | Ga0450911_000152 | Ga0450911_000152_13413_14312 | 299 |
| 280 | 3300050493 | nmdc:mga0k408_215773_c1 | nmdc:mga0k408_215773_c1_148_1047 | 299 |
| 281 | 3300002773 | JGI25152J39213_1002959 | JGI25152J39213_10029594 | 300 |
| 282 | 3300003215 | JGI25153J46596_10009620 | JGI25153J46596_100096204 | 300 |
| 283 | 3300003771 | Ga0055526_1007227 | Ga0055526_10072275 | 300 |
| 284 | 3300005456 | Ga0070678_100176079 | Ga0070678_1001760792 | 300 |
| 285 | 3300005548 | Ga0070665_100030832 | Ga0070665_1000308325 | 300 |
| 286 | 3300006195 | Ga0075366_10023241 | Ga0075366_100232413 | 300 |
| 287 | 3300006353 | Ga0075370_10138890 | Ga0075370_101388902 | 300 |
| 288 | 3300025245 | Ga0207425_1000448 | Ga0207425_100044813 | 300 |
| 289 | 3300025258 | Ga0209129_1000124 | Ga0209129_100012452 | 300 |
| 290 | 3300025263 | Ga0209565_1006164 | Ga0209565_10061642 | 300 |
| 291 | 3300025273 | Ga0209673_1004568 | Ga0209673_10045683 | 300 |
| 292 | 3300025295 | Ga0209564_1000057 | Ga0209564_100005769 | 300 |
| 293 | 3300025297 | Ga0209758_1000214 | Ga0209758_100021439 | 300 |
| 294 | 3300027665 | Ga0209983_1004868 | Ga0209983_10048683 | 300 |
| 295 | 3300027876 | Ga0209974_10006207 | Ga0209974_100062072 | 300 |
| 296 | 3300028563 | Ga0265319_1000177 | Ga0265319_100017734 | 300 |
| 297 | 3300028577 | Ga0265318_10000258 | Ga0265318_1000025830 | 300 |
| 298 | 3300031235 | Ga0265330_10000359 | Ga0265330_1000035915 | 300 |
| 299 | 3300031238 | Ga0265332_10000138 | Ga0265332_1000013845 | 300 |
| 300 | 3300031239 | Ga0265328_10032042 | Ga0265328_100320422 | 300 |
| 301 | 3300031240 | Ga0265320_10000284 | Ga0265320_100002843 | 300 |
| 302 | 3300031241 | Ga0265325_10081223 | Ga0265325_100812232 | 300 |
| 303 | 3300031242 | Ga0265329_10000076 | Ga0265329_1000007616 | 300 |
| 304 | 3300031247 | Ga0265340_10000688 | Ga0265340_1000068812 | 300 |
| 305 | 3300031249 | Ga0265339_10082625 | Ga0265339_100826252 | 300 |
| 306 | 3300031250 | Ga0265331_10001134 | Ga0265331_100011349 | 300 |
| 307 | 3300031344 | Ga0265316_10000843 | Ga0265316_100008439 | 300 |
| 308 | 3300031507 | Ga0307509_10139564 | Ga0307509_101395642 | 300 |
| 309 | 3300031595 | Ga0265313_10000089 | Ga0265313_1000008970 | 300 |
| 310 | 3300031711 | Ga0265314_10000211 | Ga0265314_1000021168 | 300 |
| 311 | 3300031712 | Ga0265342_10000390 | Ga0265342_1000039028 | 300 |
| 312 | 3300033179 | Ga0307507_10026219 | Ga0307507_100262193 | 300 |
| 313 | 3300053086 | Ga0500578_0000442 | Ga0500578_0000442_14079_14984 | 300 |
| 314 | 3300005327 | Ga0070658_10158696 | Ga0070658_101586962 | 301 |
| 315 | 3300005329 | Ga0070683_100252189 | Ga0070683_1002521892 | 301 |
| 316 | 3300005335 | Ga0070666_10229207 | Ga0070666_102292071 | 301 |
| 317 | 3300005336 | Ga0070680_100009735 | Ga0070680_1000097353 | 301 |
| 318 | 3300005339 | Ga0070660_100341222 | Ga0070660_1003412221 | 301 |
| 319 | 3300005344 | Ga0070661_100004818 | Ga0070661_1000048187 | 301 |
| 320 | 3300005355 | Ga0070671_100065045 | Ga0070671_1000650452 | 301 |
| 321 | 3300005355 | Ga0070671_100101194 | Ga0070671_1001011942 | 301 |
| 322 | 3300005355 | Ga0070671_100169477 | Ga0070671_1001694772 | 301 |
| 323 | 3300005364 | Ga0070673_100081833 | Ga0070673_1000818332 | 301 |
| 324 | 3300005455 | Ga0070663_100071282 | Ga0070663_1000712823 | 301 |
| 325 | 3300005455 | Ga0070663_100172481 | Ga0070663_1001724812 | 301 |
| 326 | 3300005456 | Ga0070678_100039073 | Ga0070678_1000390733 | 301 |
| 327 | 3300005457 | Ga0070662_100004864 | Ga0070662_1000048647 | 301 |
| 328 | 3300005530 | Ga0070679_100002199 | Ga0070679_1000021995 | 301 |
| 329 | 3300005547 | Ga0070693_100035112 | Ga0070693_1000351122 | 301 |
| 330 | 3300005564 | Ga0070664_100004354 | Ga0070664_10000435410 | 301 |
| 331 | 3300005564 | Ga0070664_100020289 | Ga0070664_1000202894 | 301 |
| 332 | 3300005578 | Ga0068854_100035336 | Ga0068854_1000353363 | 301 |
| 333 | 3300005614 | Ga0068856_100041781 | Ga0068856_1000417814 | 301 |
| 334 | 3300005616 | Ga0068852_100018994 | Ga0068852_1000189944 | 301 |
| 335 | 3300005616 | Ga0068852_100048697 | Ga0068852_1000486973 | 301 |
| 336 | 3300005618 | Ga0068864_100092466 | Ga0068864_1000924662 | 301 |
| 337 | 3300005834 | Ga0068851_10016960 | Ga0068851_100169602 | 301 |
| 338 | 3300009545 | Ga0105237_10332075 | Ga0105237_103320752 | 301 |
| 339 | 3300009551 | Ga0105238_10006338 | Ga0105238_100063383 | 301 |
| 340 | 3300013102 | Ga0157371_10117900 | Ga0157371_101179002 | 301 |
| 341 | 3300013105 | Ga0157369_10008064 | Ga0157369_100080643 | 301 |
| 342 | 3300013308 | Ga0157375_10123740 | Ga0157375_101237402 | 301 |
| 343 | 3300025297 | Ga0209758_1000232 | Ga0209758_100023236 | 301 |
| 344 | 3300025321 | Ga0207656_10036968 | Ga0207656_100369683 | 301 |
| 345 | 3300025900 | Ga0207710_10014855 | Ga0207710_100148552 | 301 |
| 346 | 3300025903 | Ga0207680_10034211 | Ga0207680_100342113 | 301 |
| 347 | 3300025917 | Ga0207660_10010630 | Ga0207660_100106303 | 301 |
| 348 | 3300025920 | Ga0207649_10013416 | Ga0207649_100134162 | 301 |
| 349 | 3300025931 | Ga0207644_10061939 | Ga0207644_100619392 | 301 |
| 350 | 3300025932 | Ga0207690_10008231 | Ga0207690_100082312 | 301 |
| 351 | 3300025945 | Ga0207679_10088713 | Ga0207679_100887132 | 301 |
| 352 | 3300025960 | Ga0207651_10008778 | Ga0207651_100087783 | 301 |
| 353 | 3300025981 | Ga0207640_10024716 | Ga0207640_100247163 | 301 |
| 354 | 3300026023 | Ga0207677_10151862 | Ga0207677_101518622 | 301 |
| 355 | 3300026067 | Ga0207678_10065216 | Ga0207678_100652162 | 301 |
| 356 | 3300026078 | Ga0207702_10008513 | Ga0207702_1000851310 | 301 |
| 357 | 3300026095 | Ga0207676_10357518 | Ga0207676_103575181 | 301 |
| 358 | 3300026142 | Ga0207698_10057249 | Ga0207698_100572493 | 301 |
| 359 | 3300026142 | Ga0207698_10086278 | Ga0207698_100862782 | 301 |
| 360 | 3300002737 | JGI25162J39368_1001832 | JGI25162J39368_10018328 | 302 |
| 361 | 3300005293 | Ga0065715_10097689 | Ga0065715_100976892 | 302 |
| 362 | 3300005331 | Ga0070670_100016185 | Ga0070670_1000161852 | 302 |
| 363 | 3300005331 | Ga0070670_100168655 | Ga0070670_1001686552 | 302 |
| 364 | 3300005334 | Ga0068869_100000970 | Ga0068869_1000009708 | 302 |
| 365 | 3300005343 | Ga0070687_100172920 | Ga0070687_1001729201 | 302 |
| 366 | 3300005347 | Ga0070668_100029428 | Ga0070668_1000294284 | 302 |
| 367 | 3300005367 | Ga0070667_100003805 | Ga0070667_10000380511 | 302 |
| 368 | 3300005548 | Ga0070665_100069602 | Ga0070665_1000696025 | 302 |
| 369 | 3300005563 | Ga0068855_100106657 | Ga0068855_1001066573 | 302 |
| 370 | 3300005577 | Ga0068857_100000949 | Ga0068857_1000009493 | 302 |
| 371 | 3300005578 | Ga0068854_100146515 | Ga0068854_1001465152 | 302 |
| 372 | 3300005616 | Ga0068852_100006348 | Ga0068852_1000063487 | 302 |
| 373 | 3300005617 | Ga0068859_100000096 | Ga0068859_10000009673 | 302 |
| 374 | 3300005618 | Ga0068864_100006259 | Ga0068864_1000062592 | 302 |
| 375 | 3300005719 | Ga0068861_100008612 | Ga0068861_1000086127 | 302 |
| 376 | 3300005840 | Ga0068870_10081068 | Ga0068870_100810682 | 302 |
| 377 | 3300005841 | Ga0068863_100249931 | Ga0068863_1002499312 | 302 |
| 378 | 3300005842 | Ga0068858_100002939 | Ga0068858_1000029395 | 302 |
| 379 | 3300005843 | Ga0068860_100000990 | Ga0068860_10000099021 | 302 |
| 380 | 3300005844 | Ga0068862_100010857 | Ga0068862_1000108574 | 302 |
| 381 | 3300005844 | Ga0068862_100131143 | Ga0068862_1001311433 | 302 |
| 382 | 3300006931 | Ga0097620_100000096 | Ga0097620_10000009673 | 302 |
| 383 | 3300009093 | Ga0105240_10164525 | Ga0105240_101645253 | 302 |
| 384 | 3300009101 | Ga0105247_10005387 | Ga0105247_100053877 | 302 |
| 385 | 3300009177 | Ga0105248_10022473 | Ga0105248_100224732 | 302 |
| 386 | 3300010375 | Ga0105239_10661471 | Ga0105239_106614712 | 302 |
| 387 | 3300014325 | Ga0163163_10011828 | Ga0163163_100118287 | 302 |
| 388 | 3300014968 | Ga0157379_10003873 | Ga0157379_100038738 | 302 |
| 389 | 3300025233 | Ga0209437_100432 | Ga0209437_10043228 | 302 |
| 390 | 3300025908 | Ga0207643_10012951 | Ga0207643_100129514 | 302 |
| 391 | 3300025913 | Ga0207695_10001995 | Ga0207695_100019959 | 302 |
| 392 | 3300025918 | Ga0207662_10216086 | Ga0207662_102160862 | 302 |
| 393 | 3300025923 | Ga0207681_10102095 | Ga0207681_101020952 | 302 |
| 394 | 3300025924 | Ga0207694_10162317 | Ga0207694_101623172 | 302 |
| 395 | 3300025925 | Ga0207650_10075606 | Ga0207650_100756062 | 302 |
| 396 | 3300025931 | Ga0207644_10135086 | Ga0207644_101350863 | 302 |
| 397 | 3300025935 | Ga0207709_10277474 | Ga0207709_102774742 | 302 |
| 398 | 3300025941 | Ga0207711_10008363 | Ga0207711_100083632 | 302 |
| 399 | 3300025942 | Ga0207689_10001083 | Ga0207689_100010838 | 302 |
| 400 | 3300025949 | Ga0207667_10316662 | Ga0207667_103166622 | 302 |
| 401 | 3300025960 | Ga0207651_10002638 | Ga0207651_100026385 | 302 |
| 402 | 3300025972 | Ga0207668_10040301 | Ga0207668_100403014 | 302 |
| 403 | 3300025981 | Ga0207640_10070453 | Ga0207640_100704533 | 302 |
| 404 | 3300025986 | Ga0207658_10006579 | Ga0207658_100065795 | 302 |
| 405 | 3300026035 | Ga0207703_10000206 | Ga0207703_1000020610 | 302 |
| 406 | 3300026088 | Ga0207641_10018478 | Ga0207641_100184783 | 302 |
| 407 | 3300026089 | Ga0207648_10021649 | Ga0207648_100216492 | 302 |
| 408 | 3300026095 | Ga0207676_10004246 | Ga0207676_100042462 | 302 |
| 409 | 3300026116 | Ga0207674_10005154 | Ga0207674_100051545 | 302 |
| 410 | 3300026118 | Ga0207675_100001654 | Ga0207675_10000165415 | 302 |
| 411 | 3300028380 | Ga0268265_10028054 | Ga0268265_100280544 | 302 |
| 412 | 3300028380 | Ga0268265_10035938 | Ga0268265_100359383 | 302 |
| 413 | 3300028381 | Ga0268264_10000570 | Ga0268264_100005707 | 302 |
| 414 | 3300028381 | Ga0268264_10025112 | Ga0268264_100251122 | 302 |
| 415 | 3300031852 | Ga0307410_10000433 | Ga0307410_100004335 | 302 |
| 416 | 3300031903 | Ga0307407_10000903 | Ga0307407_100009031 | 302 |
| 417 | 3300031995 | Ga0307409_100063242 | Ga0307409_1000632424 | 302 |
| 418 | 3300032002 | Ga0307416_100007289 | Ga0307416_1000072893 | 302 |
| 419 | 3300032005 | Ga0307411_10017969 | Ga0307411_100179691 | 302 |
| 420 | 3300032126 | Ga0307415_100062302 | Ga0307415_1000623024 | 302 |
| 421 | 3300048905 | Ga0496102_0041195 | Ga0496102_0041195_929_1849 | 302 |
| 422 | 3300048912 | Ga0496109_0144804 | Ga0496109_0144804_1001_1921 | 302 |
| 423 | 3300048914 | Ga0496111_0112707 | Ga0496111_0112707_861_1823 | 302 |
| 424 | 3300003187 | JGI25151J46595_10001193 | JGI25151J46595_100011938 | 303 |
| 425 | 3300003771 | Ga0055526_1001852 | Ga0055526_10018529 | 303 |
| 426 | 3300003781 | Ga0055536_1000219 | Ga0055536_10002192 | 303 |
| 427 | 3300025284 | Ga0209130_1015385 | Ga0209130_10153852 | 303 |
| 428 | 3300025291 | Ga0209675_1000040 | Ga0209675_100004088 | 303 |
| 429 | 3300025292 | Ga0209676_1000014 | Ga0209676_1000014566 | 303 |
| 430 | 3300025294 | Ga0209025_1000092 | Ga0209025_100009288 | 303 |
| 431 | 3300025295 | Ga0209564_1000159 | Ga0209564_100015958 | 303 |
| 432 | 3300031730 | Ga0307516_10115698 | Ga0307516_101156982 | 303 |
| 433 | 3300038443 | Ga0395901_0591232 | Ga0395901_0591232_62_994 | 303 |
| 434 | 3300049571 | Ga0501034_0332749 | Ga0501034_0332749_394_1335 | 303 |
| 435 | 3300049579 | Ga0501043_0221968 | Ga0501043_0221968_509_1450 | 303 |
| 436 | 3300049581 | Ga0501047_0024036 | Ga0501047_0024036_472_1413 | 303 |
| 437 | 3300049586 | Ga0501070_0004818 | Ga0501070_0004818_2102_3043 | 303 |
| 438 | 3300049586 | Ga0501070_0181903 | Ga0501070_0181903_370_1317 | 303 |
| 439 | 3300049822 | Ga0501035_0000933 | Ga0501035_0000933_28542_29483 | 303 |
| 440 | 3300049823 | Ga0501044_0046382 | Ga0501044_0046382_2828_3769 | 303 |
| 441 | 3300049823 | Ga0501044_0134722 | Ga0501044_0134722_213_1160 | 303 |
| 442 | 3300005367 | Ga0070667_100208707 | Ga0070667_1002087072 | 304 |
| 443 | 3300005563 | Ga0068855_100007145 | Ga0068855_1000071454 | 304 |
| 444 | 3300006353 | Ga0075370_10014589 | Ga0075370_100145892 | 304 |
| 445 | 3300009093 | Ga0105240_10009479 | Ga0105240_100094797 | 304 |
| 446 | 3300021361 | Ga0213872_10040241 | Ga0213872_100402412 | 304 |
| 447 | 3300025913 | Ga0207695_10049214 | Ga0207695_100492143 | 304 |
| 448 | 3300025924 | Ga0207694_10040036 | Ga0207694_100400363 | 304 |
| 449 | 3300025949 | Ga0207667_10041636 | Ga0207667_100416362 | 304 |
| 450 | 3300031251 | Ga0265327_10026162 | Ga0265327_100261623 | 304 |
| 451 | 3300031730 | Ga0307516_10008188 | Ga0307516_1000818810 | 304 |
| 452 | 3300037471 | Ga0395905_0036652 | Ga0395905_0036652_317_1264 | 304 |
| 453 | 3300039447 | Ga0436361_1085109 | Ga0436361_1085109_2493_3443 | 304 |
| 454 | 3300046454 | Ga0495592_0000142 | Ga0495592_0000142_24999_25940 | 304 |
| 455 | 3300046512 | Ga0495610_0012550 | Ga0495610_0012550_4034_4966 | 304 |
| 456 | 3300046515 | Ga0495620_0045866 | Ga0495620_0045866_594_1526 | 304 |
| 457 | 3300046519 | Ga0495632_0008357 | Ga0495632_0008357_1402_2334 | 304 |
| 458 | 3300046528 | Ga0495642_0040094 | Ga0495642_0040094_479_1426 | 304 |
| 459 | 3300046660 | Ga0495625_0035602 | Ga0495625_0035602_2528_3460 | 304 |
| 460 | 3300046665 | Ga0495661_0113359 | Ga0495661_0113359_62_1009 | 304 |
| 461 | 3300046810 | Ga0495660_0156147 | Ga0495660_0156147_180_1112 | 304 |
| 462 | 3300047443 | Ga0495687_018568 | Ga0495687_018568_429_1376 | 304 |
| 463 | 3300049581 | Ga0501047_0026236 | Ga0501047_0026236_1553_2503 | 304 |
| 464 | 3300049585 | Ga0501069_0242466 | Ga0501069_0242466_67_1017 | 304 |
| 465 | 3300049742 | Ga0501080_0053387 | Ga0501080_0053387_1465_2415 | 304 |
| 466 | iso_pu_bacteria | 2519899620 | 2520381022 | 304 |
| 467 | iso_pu_bacteria | 2615840624 | 2616294744 | 304 |
| 468 | iso_pu_bacteria | 2718217882 | 2719184498 | 304 |
| 469 | iso_pu_bacteria | 2718218009 | 2719728518 | 304 |
| 470 | iso_pu_bacteria | 2718218363 | 2721144206 | 304 |
| 471 | iso_pu_bacteria | 2718218365 | 2721156304 | 304 |
| 472 | iso_pu_bacteria | 2718218366 | 2721161581 | 304 |
| 473 | iso_pu_bacteria | 2721755514 | 2722842726 | 304 |
| 474 | iso_pu_bacteria | 2721755810 | 2724041543 | 304 |
| 475 | iso_pu_bacteria | 2728369365 | 2730160614 | 304 |
| 476 | iso_pu_bacteria | 2728369397 | 2730295837 | 304 |
| 477 | iso_pu_bacteria | 2791355260 | 2793323111 | 304 |
| 478 | iso_pu_bacteria | 2791355261 | 2793329871 | 304 |
| 479 | iso_pu_bacteria | 2791355264 | 2793345378 | 304 |
| 480 | iso_pu_bacteria | 2791355265 | 2793354923 | 304 |
| 481 | iso_pu_bacteria | 2802429605 | 2805927143 | 304 |
| 482 | iso_pu_bacteria | 2802429606 | 2805934431 | 304 |
| 483 | iso_pu_bacteria | 2838022645 | 2838028329 | 304 |
| 484 | iso_pu_bacteria | 2838668709 | 2838669553 | 304 |
| 485 | iso_pu_bacteria | 2838701080 | 2838701925 | 304 |
| 486 | iso_pu_bacteria | 2842192696 | 2842198538 | 304 |
| 487 | iso_pu_bacteria | 2842198810 | 2842204305 | 304 |
| 488 | iso_pu_bacteria | 2842250916 | 2842251652 | 304 |
| 489 | iso_pu_bacteria | 2842317721 | 2842323362 | 304 |
| 490 | iso_pu_bacteria | 2842489311 | 2842489629 | 304 |
| 491 | iso_pu_bacteria | 2842495871 | 2842500461 | 304 |
| 492 | iso_pu_bacteria | 2996893221 | 2996894490 | 304 |
| 493 | iso_pu_bacteria | 3002141150 | 3002141962 | 304 |
| 494 | iso_pu_bacteria | 3005445848 | 3005452050 | 304 |
| 495 | iso_pu_bacteria | 8005382845 | 8005383404 | 304 |
| 496 | iso_pu_bacteria | 8005395548 | 8005398998 | 304 |
| 497 | iso_pu_bacteria | 8018127388 | 8018131904 | 304 |
| 498 | iso_pu_bacteria | 8024501048 | 8024507169 | 304 |
| 499 | iso_pu_bacteria | 8056382006 | 8056382490 | 304 |
| 500 | 3300002987 | JGI25159J45721_1008482 | JGI25159J45721_10084822 | 305 |
| 501 | 3300003187 | JGI25151J46595_10000458 | JGI25151J46595_1000045813 | 305 |
| 502 | 3300003354 | JGI25160J50197_1003716 | JGI25160J50197_10037163 | 305 |
| 503 | 3300005937 | Ga0081455_10241886 | Ga0081455_102418862 | 305 |
| 504 | 3300009553 | Ga0105249_10575860 | Ga0105249_105758601 | 305 |
| 505 | 3300025284 | Ga0209130_1000467 | Ga0209130_10004672 | 305 |
| 506 | 3300025294 | Ga0209025_1000099 | Ga0209025_100009925 | 305 |
| 507 | 3300025297 | Ga0209758_1001602 | Ga0209758_100160217 | 305 |
| 508 | 3300025302 | Ga0207426_1000065 | Ga0207426_1000065149 | 305 |
| 509 | 3300041997 | Ga0439431_0005666 | Ga0439431_0005666_1348_2292 | 305 |
| 510 | 3300049574 | Ga0501038_0027545 | Ga0501038_0027545_3380_4318 | 305 |
| 511 | 3300049581 | Ga0501047_0406122 | Ga0501047_0406122_97_1035 | 305 |
| 512 | 3300049586 | Ga0501070_0207899 | Ga0501070_0207899_120_1058 | 305 |
| 513 | 3300049589 | Ga0501073_0122498 | Ga0501073_0122498_186_1124 | 305 |
| 514 | 3300049592 | Ga0501076_0300308 | Ga0501076_0300308_268_1209 | 305 |
| 515 | 3300049823 | Ga0501044_0010628 | Ga0501044_0010628_684_1622 | 305 |
| 516 | 3300049823 | Ga0501044_0267514 | Ga0501044_0267514_44_982 | 305 |
| 517 | iso_pu_bacteria | 2503198000 | 2503200952 | 305 |
| 518 | iso_pu_bacteria | 2508501127 | 2509144700 | 305 |
| 519 | iso_pu_bacteria | 2509276018 | 2509369536 | 305 |
| 520 | iso_pu_bacteria | 2509276022 | 2509395733 | 305 |
| 521 | iso_pu_bacteria | 2510065059 | 2510319292 | 305 |
| 522 | iso_pu_bacteria | 2512875026 | 2512969744 | 305 |
| 523 | iso_pu_bacteria | 2513237089 | 2513603100 | 305 |
| 524 | iso_pu_bacteria | 2513237090 | 2513611659 | 305 |
| 525 | iso_pu_bacteria | 2513237156 | 2513985826 | 305 |
| 526 | iso_pu_bacteria | 2513237160 | 2514004529 | 305 |
| 527 | iso_pu_bacteria | 2513237305 | 2514423071 | 305 |
| 528 | iso_pu_bacteria | 2517487022 | 2517565377 | 305 |
| 529 | iso_pu_bacteria | 2597489875 | 2597814607 | 305 |
| 530 | iso_pu_bacteria | 2643221595 | 2643987170 | 305 |
| 531 | iso_pu_bacteria | 2643221627 | 2644155720 | 305 |
| 532 | iso_pu_bacteria | 2687453392 | 2688597245 | 305 |
| 533 | iso_pu_bacteria | 2693429783 | 2694629540 | 305 |
| 534 | iso_pu_bacteria | 2693429784 | 2694639196 | 305 |
| 535 | iso_pu_bacteria | 2713897090 | 2715501878 | 305 |
| 536 | iso_pu_bacteria | 2721755686 | 2723577072 | 305 |
| 537 | iso_pu_bacteria | 2802428858 | 2802716170 | 305 |
| 538 | iso_pu_bacteria | 2802428859 | 2802722792 | 305 |
| 539 | iso_pu_bacteria | 2802428860 | 2802729063 | 305 |
| 540 | iso_pu_bacteria | 2802428861 | 2802735457 | 305 |
| 541 | iso_pu_bacteria | 2802428862 | 2802741967 | 305 |
| 542 | iso_pu_bacteria | 2802428863 | 2802748417 | 305 |
| 543 | iso_pu_bacteria | 2841734538 | 2841740582 | 305 |
| 544 | iso_pu_bacteria | 2844009547 | 2844012628 | 305 |
| 545 | iso_pu_bacteria | 2847670302 | 2847671437 | 305 |
| 546 | iso_pu_bacteria | 2847686936 | 2847687591 | 305 |
| 547 | iso_pu_bacteria | 2856314179 | 2856315396 | 305 |
| 548 | iso_pu_bacteria | 2856328259 | 2856334867 | 305 |
| 549 | iso_pu_bacteria | 2856334872 | 2856341582 | 305 |
| 550 | iso_pu_bacteria | 2856342000 | 2856347705 | 305 |
| 551 | iso_pu_bacteria | 2856349417 | 2856353000 | 305 |
| 552 | iso_pu_bacteria | 2856356410 | 2856362011 | 305 |
| 553 | iso_pu_bacteria | 2869162929 | 2869166736 | 305 |
| 554 | iso_pu_bacteria | 2869169390 | 2869171174 | 305 |
| 555 | iso_pu_bacteria | 2869234852 | 2869238808 | 305 |
| 556 | iso_pu_bacteria | 2869249662 | 2869251559 | 305 |
| 557 | iso_pu_bacteria | 2869256925 | 2869260094 | 305 |
| 558 | iso_pu_bacteria | 2869264136 | 2869271067 | 305 |
| 559 | iso_pu_bacteria | 2869271264 | 2869277775 | 305 |
| 560 | iso_pu_bacteria | 2871435913 | 2871436914 | 305 |
| 561 | iso_pu_bacteria | 2871444079 | 2871448473 | 305 |
| 562 | iso_pu_bacteria | 2871451962 | 2871454631 | 305 |
| 563 | iso_pu_bacteria | 2871459585 | 2871465716 | 305 |
| 564 | iso_pu_bacteria | 2871474448 | 2871478199 | 305 |
| 565 | iso_pu_bacteria | 2871481445 | 2871487693 | 305 |
| 566 | iso_pu_bacteria | 2871488783 | 2871493617 | 305 |
| 567 | iso_pu_bacteria | 2871495908 | 2871497150 | 305 |
| 568 | iso_pu_bacteria | 2874102143 | 2874103788 | 305 |
| 569 | iso_pu_bacteria | 2874109183 | 2874110345 | 305 |
| 570 | iso_pu_bacteria | 2874116593 | 2874122792 | 305 |
| 571 | iso_pu_bacteria | 2874123672 | 2874128309 | 305 |
| 572 | iso_pu_bacteria | 2874162495 | 2874167955 | 305 |
| 573 | iso_pu_bacteria | 2876369609 | 2876369641 | 305 |
| 574 | iso_pu_bacteria | 2876386047 | 2876389738 | 305 |
| 575 | iso_pu_bacteria | 2876392853 | 2876393334 | 305 |
| 576 | iso_pu_bacteria | 2876399893 | 2876402862 | 305 |
| 577 | iso_pu_bacteria | 2876406927 | 2876408478 | 305 |
| 578 | iso_pu_bacteria | 2876420981 | 2876427446 | 305 |
| 579 | iso_pu_bacteria | 2878035449 | 2878036541 | 305 |
| 580 | iso_pu_bacteria | 2878753008 | 2878756190 | 305 |
| 581 | iso_pu_bacteria | 2878760144 | 2878761371 | 305 |
| 582 | iso_pu_bacteria | 2878767105 | 2878768338 | 305 |
| 583 | iso_pu_bacteria | 2878774303 | 2878775067 | 305 |
| 584 | iso_pu_bacteria | 2878781027 | 2878783595 | 305 |
| 585 | iso_pu_bacteria | 2881147464 | 2881153238 | 305 |
| 586 | iso_pu_bacteria | 2881155292 | 2881156998 | 305 |
| 587 | iso_pu_bacteria | 2881161766 | 2881162432 | 305 |
| 588 | iso_pu_bacteria | 2881853255 | 2881860305 | 305 |
| 589 | iso_pu_bacteria | 2881861095 | 2881864926 | 305 |
| 590 | iso_pu_bacteria | 2882632389 | 2882633808 | 305 |
| 591 | iso_pu_bacteria | 2882912400 | 2882918126 | 305 |
| 592 | iso_pu_bacteria | 2885305155 | 2885311240 | 305 |
| 593 | iso_pu_bacteria | 2885312484 | 2885316899 | 305 |
| 594 | iso_pu_bacteria | 2885318864 | 2885321320 | 305 |
| 595 | iso_pu_bacteria | 2885326080 | 2885326412 | 305 |
| 596 | iso_pu_bacteria | 2885334103 | 2885334139 | 305 |
| 597 | iso_pu_bacteria | 2885342637 | 2885343951 | 305 |
| 598 | iso_pu_bacteria | 2885350715 | 2885352798 | 305 |
| 599 | iso_pu_bacteria | 2888343758 | 2888348046 | 305 |
| 600 | iso_pu_bacteria | 2888350351 | 2888356720 | 305 |
| 601 | iso_pu_bacteria | 2889016732 | 2889023298 | 305 |
| 602 | iso_pu_bacteria | 2903492973 | 2903502879 | 305 |
| 603 | iso_pu_bacteria | 2903513507 | 2903518434 | 305 |
| 604 | iso_pu_bacteria | 2903540706 | 2903541945 | 305 |
| 605 | iso_pu_bacteria | 2904659560 | 2904659840 | 305 |
| 606 | iso_pu_bacteria | 2906328253 | 2906332394 | 305 |
| 607 | iso_pu_bacteria | 2906354277 | 2906363077 | 305 |
| 608 | iso_pu_bacteria | 2906363423 | 2906364669 | 305 |
| 609 | iso_pu_bacteria | 2906370794 | 2906376935 | 305 |
| 610 | iso_pu_bacteria | 2906401398 | 2906401781 | 305 |
| 611 | iso_pu_bacteria | 2906408224 | 2906411358 | 305 |
| 612 | iso_pu_bacteria | 2906414383 | 2906415391 | 305 |
| 613 | iso_pu_bacteria | 2906427513 | 2906428634 | 305 |
| 614 | iso_pu_bacteria | 2915980308 | 2915983868 | 305 |
| 615 | iso_pu_bacteria | 2916061851 | 2916068473 | 305 |
| 616 | iso_pu_bacteria | 2921250672 | 2921256178 | 305 |
| 617 | iso_pu_bacteria | 2922130491 | 2922135487 | 305 |
| 618 | iso_pu_bacteria | 2922151315 | 2922155929 | 305 |
| 619 | iso_pu_bacteria | 2922158528 | 2922164775 | 305 |
| 620 | iso_pu_bacteria | 2922172374 | 2922177626 | 305 |
| 621 | iso_pu_bacteria | 2922185730 | 2922192519 | 305 |
| 622 | iso_pu_bacteria | 2923556063 | 2923560130 | 305 |
| 623 | iso_pu_bacteria | 2924726620 | 2924731900 | 305 |
| 624 | iso_pu_bacteria | 2924733363 | 2924737864 | 305 |
| 625 | iso_pu_bacteria | 2924741084 | 2924742682 | 305 |
| 626 | iso_pu_bacteria | 2924748358 | 2924749426 | 305 |
| 627 | iso_pu_bacteria | 2924754689 | 2924757663 | 305 |
| 628 | iso_pu_bacteria | 2924762789 | 2924765983 | 305 |
| 629 | iso_pu_bacteria | 2924784321 | 2924787760 | 305 |
| 630 | iso_pu_bacteria | 2937029754 | 2937032373 | 305 |
| 631 | iso_pu_bacteria | 2937036028 | 2937038359 | 305 |
| 632 | iso_pu_bacteria | 2937078374 | 2937081836 | 305 |
| 633 | iso_pu_bacteria | 2937084907 | 2937090310 | 305 |
| 634 | iso_pu_bacteria | 2937836603 | 2937839864 | 305 |
| 635 | iso_pu_bacteria | 2937843397 | 2937847157 | 305 |
| 636 | iso_pu_bacteria | 2937861824 | 2937862655 | 305 |
| 637 | iso_pu_bacteria | 2937891427 | 2937895313 | 305 |
| 638 | iso_pu_bacteria | 2937980651 | 2937981211 | 305 |
| 639 | iso_pu_bacteria | 2937994558 | 2937995801 | 305 |
| 640 | iso_pu_bacteria | 2957375807 | 2957381041 | 305 |
| 641 | iso_pu_bacteria | 2957437181 | 2957442761 | 305 |
| 642 | iso_pu_bacteria | 2958071322 | 2958075137 | 305 |
| 643 | iso_pu_bacteria | 2958100919 | 2958105500 | 305 |
| 644 | iso_pu_bacteria | 2958108152 | 2958115081 | 305 |
| 645 | iso_pu_bacteria | 2958115193 | 2958117427 | 305 |
| 646 | iso_pu_bacteria | 2958122699 | 2958129825 | 305 |
| 647 | iso_pu_bacteria | 2958158011 | 2958158294 | 305 |
| 648 | iso_pu_bacteria | 2958165035 | 2958166273 | 305 |
| 649 | iso_pu_bacteria | 2958172287 | 2958178764 | 305 |
| 650 | iso_pu_bacteria | 2960591022 | 2960596659 | 305 |
| 651 | iso_pu_bacteria | 2960631154 | 2960634555 | 305 |
| 652 | iso_pu_bacteria | 2960680706 | 2960685750 | 305 |
| 653 | iso_pu_bacteria | 2960693952 | 2960694977 | 305 |
| 654 | iso_pu_bacteria | 2961114664 | 2961115165 | 305 |
| 655 | iso_pu_bacteria | 2961127735 | 2961129929 | 305 |
| 656 | iso_pu_bacteria | 2961163497 | 2961164735 | 305 |
| 657 | iso_pu_bacteria | 2961170736 | 2961172478 | 305 |
| 658 | iso_pu_bacteria | 2965018300 | 2965019561 | 305 |
| 659 | iso_pu_bacteria | 2965025482 | 2965027622 | 305 |
| 660 | iso_pu_bacteria | 2965032056 | 2965036222 | 305 |
| 661 | iso_pu_bacteria | 2965040258 | 2965043331 | 305 |
| 662 | iso_pu_bacteria | 2965047637 | 2965049653 | 305 |
| 663 | iso_pu_bacteria | 2965062239 | 2965069431 | 305 |
| 664 | iso_pu_bacteria | 2965089291 | 2965090547 | 305 |
| 665 | iso_pu_bacteria | 2965102966 | 2965107375 | 305 |
| 666 | iso_pu_bacteria | 2965110997 | 2965111227 | 305 |
| 667 | iso_pu_bacteria | 2967686174 | 2967692657 | 305 |
| 668 | iso_pu_bacteria | 2967728569 | 2967731780 | 305 |
| 669 | iso_pu_bacteria | 2967996073 | 2967997694 | 305 |
| 670 | iso_pu_bacteria | 2968003550 | 2968008345 | 305 |
| 671 | iso_pu_bacteria | 2968091066 | 2968092941 | 305 |
| 672 | iso_pu_bacteria | 2968097103 | 2968099463 | 305 |
| 673 | iso_pu_bacteria | 2968110612 | 2968110897 | 305 |
| 674 | iso_pu_bacteria | 2968128360 | 2968133098 | 305 |
| 675 | iso_pu_bacteria | 2968138860 | 2968141127 | 305 |
| 676 | iso_pu_bacteria | 2968171901 | 2968173137 | 305 |
| 677 | iso_pu_bacteria | 2970026789 | 2970028495 | 305 |
| 678 | iso_pu_bacteria | 2970122695 | 2970124998 | 305 |
| 679 | iso_pu_bacteria | 2970143518 | 2970147095 | 305 |
| 680 | iso_pu_bacteria | 2970503327 | 2970505072 | 305 |
| 681 | iso_pu_bacteria | 2970510686 | 2970512376 | 305 |
| 682 | iso_pu_bacteria | 2970524798 | 2970531948 | 305 |
| 683 | iso_pu_bacteria | 2970547951 | 2970552323 | 305 |
| 684 | iso_pu_bacteria | 2970554993 | 2970556227 | 305 |
| 685 | iso_pu_bacteria | 2970619444 | 2970626596 | 305 |
| 686 | iso_pu_bacteria | 2970627176 | 2970627860 | 305 |
| 687 | iso_pu_bacteria | 2977530762 | 2977533169 | 305 |
| 688 | iso_pu_bacteria | 2977544691 | 2977546241 | 305 |
| 689 | iso_pu_bacteria | 2977821940 | 2977825371 | 305 |
| 690 | iso_pu_bacteria | 2977828996 | 2977832681 | 305 |
| 691 | iso_pu_bacteria | 2977851361 | 2977852028 | 305 |
| 692 | iso_pu_bacteria | 2977858184 | 2977864399 | 305 |
| 693 | iso_pu_bacteria | 2977864932 | 2977872198 | 305 |
| 694 | iso_pu_bacteria | 2977872689 | 2977873862 | 305 |
| 695 | iso_pu_bacteria | 2977898635 | 2977905079 | 305 |
| 696 | iso_pu_bacteria | 2977915119 | 2977916507 | 305 |
| 697 | iso_pu_bacteria | 2977935797 | 2977941667 | 305 |
| 698 | iso_pu_bacteria | 2977950692 | 2977951033 | 305 |
| 699 | iso_pu_bacteria | 2977957713 | 2977960463 | 305 |
| 700 | iso_pu_bacteria | 2977971508 | 2977974931 | 305 |
| 701 | iso_pu_bacteria | 2979710463 | 2979716027 | 305 |
| 702 | iso_pu_bacteria | 2979764755 | 2979769649 | 305 |
| 703 | iso_pu_bacteria | 2979779861 | 2979785685 | 305 |
| 704 | iso_pu_bacteria | 2979793036 | 2979797188 | 305 |
| 705 | iso_pu_bacteria | 2979808191 | 2979809793 | 305 |
| 706 | iso_pu_bacteria | 2987645492 | 2987648177 | 305 |
| 707 | iso_pu_bacteria | 2987659509 | 2987660744 | 305 |
| 708 | iso_pu_bacteria | 2987666974 | 2987668501 | 305 |
| 709 | iso_pu_bacteria | 2987673487 | 2987680947 | 305 |
| 710 | iso_pu_bacteria | 2996341866 | 2996342926 | 305 |
| 711 | iso_pu_bacteria | 2996386984 | 2996390032 | 305 |
| 712 | iso_pu_bacteria | 3004188549 | 3004189792 | 305 |
| 713 | iso_pu_bacteria | 3004232784 | 3004235874 | 305 |
| 714 | iso_pu_bacteria | 3004239961 | 3004243287 | 305 |
| 715 | iso_pu_bacteria | 3004268573 | 3004273895 | 305 |
| 716 | iso_pu_bacteria | 649633066 | 649871798 | 305 |
| 717 | iso_pu_bacteria | 8003999396 | 8004003859 | 305 |
| 718 | iso_pu_bacteria | 8004312739 | 8004312761 | 305 |
| 719 | iso_pu_bacteria | 8004361976 | 8004365153 | 305 |
| 720 | iso_pu_bacteria | 8004374579 | 8004377779 | 305 |
| 721 | iso_pu_bacteria | 8004395343 | 8004397840 | 305 |
| 722 | iso_pu_bacteria | 8004445564 | 8004448316 | 305 |
| 723 | iso_pu_bacteria | 8004633249 | 8004634517 | 305 |
| 724 | iso_pu_bacteria | 8004695233 | 8004702368 | 305 |
| 725 | iso_pu_bacteria | 8004703790 | 8004711312 | 305 |
| 726 | iso_pu_bacteria | 8004727605 | 8004731569 | 305 |
| 727 | iso_pu_bacteria | 8055617313 | 8055622157 | 305 |
| 728 | 3300005577 | Ga0068857_100097381 | Ga0068857_1000973812 | 306 |
| 729 | 3300006353 | Ga0075370_10045211 | Ga0075370_100452112 | 306 |
| 730 | 3300009093 | Ga0105240_10151407 | Ga0105240_101514072 | 306 |
| 731 | 3300025292 | Ga0209676_1011806 | Ga0209676_10118062 | 306 |
| 732 | 3300025913 | Ga0207695_10134260 | Ga0207695_101342602 | 306 |
| 733 | 3300025933 | Ga0207706_10011643 | Ga0207706_100116433 | 306 |
| 734 | 3300026116 | Ga0207674_10011720 | Ga0207674_1001172010 | 306 |
| 735 | 3300049569 | Ga0501032_0002871 | Ga0501032_0002871_8036_8974 | 306 |
| 736 | 3300049570 | Ga0501033_0002505 | Ga0501033_0002505_12285_13223 | 306 |
| 737 | 3300049571 | Ga0501034_0031160 | Ga0501034_0031160_4384_5322 | 306 |
| 738 | 3300049572 | Ga0501036_0012812 | Ga0501036_0012812_97_1035 | 306 |
| 739 | 3300049573 | Ga0501037_0033589 | Ga0501037_0033589_2754_3692 | 306 |
| 740 | 3300049575 | Ga0501039_0245138 | Ga0501039_0245138_415_1341 | 306 |
| 741 | 3300049578 | Ga0501042_0178491 | Ga0501042_0178491_134_1072 | 306 |
| 742 | 3300049579 | Ga0501043_0002916 | Ga0501043_0002916_13313_14251 | 306 |
| 743 | 3300049579 | Ga0501043_0250813 | Ga0501043_0250813_56_997 | 306 |
| 744 | 3300049580 | Ga0501046_0002308 | Ga0501046_0002308_8554_9492 | 306 |
| 745 | 3300049581 | Ga0501047_0046794 | Ga0501047_0046794_2755_3693 | 306 |
| 746 | 3300049584 | Ga0501068_0317673 | Ga0501068_0317673_12_953 | 306 |
| 747 | 3300049585 | Ga0501069_0001322 | Ga0501069_0001322_11010_11948 | 306 |
| 748 | 3300049586 | Ga0501070_0002192 | Ga0501070_0002192_8573_9511 | 306 |
| 749 | 3300049589 | Ga0501073_0001103 | Ga0501073_0001103_7761_8699 | 306 |
| 750 | 3300049590 | Ga0501074_0001626 | Ga0501074_0001626_8036_8974 | 306 |
| 751 | 3300049742 | Ga0501080_0001592 | Ga0501080_0001592_12929_13867 | 306 |
| 752 | 3300049742 | Ga0501080_0068537 | Ga0501080_0068537_1601_2542 | 306 |
| 753 | 3300049822 | Ga0501035_0006474 | Ga0501035_0006474_1066_2004 | 306 |
| 754 | 3300049823 | Ga0501044_0018664 | Ga0501044_0018664_2625_3563 | 306 |
| 755 | 3300049823 | Ga0501044_0069128 | Ga0501044_0069128_2401_3342 | 306 |
| 756 | 3300050496 | nmdc:mga07m45_2012_c1 | nmdc:mga07m45_2012_c1_6817_7758 | 306 |
| 757 | 3300053139 | Ga0500568_0016368 | Ga0500568_0016368_1920_2861 | 306 |
| 758 | 3300054114 | Ga0501084_0138069 | Ga0501084_0138069_965_1906 | 306 |
| 759 | 3300060353 | Ga0501082_0083700 | Ga0501082_0083700_126_1067 | 306 |
| 760 | iso_pu_bacteria | 2508501122 | 2509110550 | 306 |
| 761 | iso_pu_bacteria | 2509276019 | 2509377204 | 306 |
| 762 | iso_pu_bacteria | 2509276021 | 2509385618 | 306 |
| 763 | iso_pu_bacteria | 2509276033 | 2509448334 | 306 |
| 764 | iso_pu_bacteria | 2510065019 | 2510136430 | 306 |
| 765 | iso_pu_bacteria | 2510065057 | 2510307816 | 306 |
| 766 | iso_pu_bacteria | 2510461076 | 2510892309 | 306 |
| 767 | iso_pu_bacteria | 2510917028 | 2511185823 | 306 |
| 768 | iso_pu_bacteria | 2510917030 | 2511198101 | 306 |
| 769 | iso_pu_bacteria | 2511231027 | 2511392104 | 306 |
| 770 | iso_pu_bacteria | 2511231052 | 2511497571 | 306 |
| 771 | iso_pu_bacteria | 2512047086 | 2512530013 | 306 |
| 772 | iso_pu_bacteria | 2513237084 | 2513568059 | 306 |
| 773 | iso_pu_bacteria | 2513237085 | 2513578387 | 306 |
| 774 | iso_pu_bacteria | 2513237086 | 2513581826 | 306 |
| 775 | iso_pu_bacteria | 2513237091 | 2513619290 | 306 |
| 776 | iso_pu_bacteria | 2513237093 | 2513631000 | 306 |
| 777 | iso_pu_bacteria | 2513237103 | 2513711080 | 306 |
| 778 | iso_pu_bacteria | 2513237138 | 2513871129 | 306 |
| 779 | iso_pu_bacteria | 2513237140 | 2513887194 | 306 |
| 780 | iso_pu_bacteria | 2513237143 | 2513901446 | 306 |
| 781 | iso_pu_bacteria | 2513237159 | 2513999350 | 306 |
| 782 | iso_pu_bacteria | 2513237162 | 2514021106 | 306 |
| 783 | iso_pu_bacteria | 2515075009 | 2515108614 | 306 |
| 784 | iso_pu_bacteria | 2515154107 | 2515609860 | 306 |
| 785 | iso_pu_bacteria | 2515154113 | 2515632216 | 306 |
| 786 | iso_pu_bacteria | 2515154114 | 2515643532 | 306 |
| 787 | iso_pu_bacteria | 2515154116 | 2515658331 | 306 |
| 788 | iso_pu_bacteria | 2515154134 | 2515738117 | 306 |
| 789 | iso_pu_bacteria | 2516143018 | 2516207740 | 306 |
| 790 | iso_pu_bacteria | 2516653046 | 2516896770 | 306 |
| 791 | iso_pu_bacteria | 2516653077 | 2517041201 | 306 |
| 792 | iso_pu_bacteria | 2516653085 | 2517080173 | 306 |
| 793 | iso_pu_bacteria | 2517093000 | 2517098174 | 306 |
| 794 | iso_pu_bacteria | 2517287029 | 2517410063 | 306 |
| 795 | iso_pu_bacteria | 2524023207 | 2524451443 | 306 |
| 796 | iso_pu_bacteria | 2529292951 | 2530644671 | 306 |
| 797 | iso_pu_bacteria | 2551306084 | 2551677225 | 306 |
| 798 | iso_pu_bacteria | 2551306085 | 2551688377 | 306 |
| 799 | iso_pu_bacteria | 2551306086 | 2551697043 | 306 |
| 800 | iso_pu_bacteria | 2551306087 | 2551700604 | 306 |
| 801 | iso_pu_bacteria | 2551306089 | 2551715081 | 306 |
| 802 | iso_pu_bacteria | 2551306090 | 2551721344 | 306 |
| 803 | iso_pu_bacteria | 2551306090 | 2551722702 | 306 |
| 804 | iso_pu_bacteria | 2551306091 | 2551729428 | 306 |
| 805 | iso_pu_bacteria | 2551306092 | 2551738397 | 306 |
| 806 | iso_pu_bacteria | 2551306093 | 2551743855 | 306 |
| 807 | iso_pu_bacteria | 2558860100 | 2558862270 | 306 |
| 808 | iso_pu_bacteria | 2582581306 | 2585268517 | 306 |
| 809 | iso_pu_bacteria | 2582581866 | 2585394049 | 306 |
| 810 | iso_pu_bacteria | 2582581867 | 2585404966 | 306 |
| 811 | iso_pu_bacteria | 2585427526 | 2585525579 | 306 |
| 812 | iso_pu_bacteria | 2585427528 | 2585538690 | 306 |
| 813 | iso_pu_bacteria | 2585427590 | 2585820340 | 306 |
| 814 | iso_pu_bacteria | 2585427593 | 2585836643 | 306 |
| 815 | iso_pu_bacteria | 2599185352 | 2600196385 | 306 |
| 816 | iso_pu_bacteria | 2643221723 | 2644673521 | 306 |
| 817 | iso_pu_bacteria | 2657244999 | 2657683509 | 306 |
| 818 | iso_pu_bacteria | 2690316117 | 2692319273 | 306 |
| 819 | iso_pu_bacteria | 2718217927 | 2719388582 | 306 |
| 820 | iso_pu_bacteria | 2718217997 | 2719668391 | 306 |
| 821 | iso_pu_bacteria | 2718218199 | 2720489084 | 306 |
| 822 | iso_pu_bacteria | 2718218232 | 2720609776 | 306 |
| 823 | iso_pu_bacteria | 2718218233 | 2720617208 | 306 |
| 824 | iso_pu_bacteria | 2718218235 | 2720628349 | 306 |
| 825 | iso_pu_bacteria | 2718218269 | 2720772303 | 306 |
| 826 | iso_pu_bacteria | 2718218423 | 2721403207 | 306 |
| 827 | iso_pu_bacteria | 2721755556 | 2723029724 | 306 |
| 828 | iso_pu_bacteria | 2721755684 | 2723564093 | 306 |
| 829 | iso_pu_bacteria | 2721755685 | 2723570213 | 306 |
| 830 | iso_pu_bacteria | 2721755809 | 2724035564 | 306 |
| 831 | iso_pu_bacteria | 2721755819 | 2724092332 | 306 |
| 832 | iso_pu_bacteria | 2721755822 | 2724101760 | 306 |
| 833 | iso_pu_bacteria | 2721755823 | 2724112708 | 306 |
| 834 | iso_pu_bacteria | 2724679232 | 2725947835 | 306 |
| 835 | iso_pu_bacteria | 2728369352 | 2730110257 | 306 |
| 836 | iso_pu_bacteria | 2738541333 | 2739034113 | 306 |
| 837 | iso_pu_bacteria | 2751185821 | 2753458946 | 306 |
| 838 | iso_pu_bacteria | 2765235802 | 2765465966 | 306 |
| 839 | iso_pu_bacteria | 2765235942 | 2766065112 | 306 |
| 840 | iso_pu_bacteria | 2767802442 | 2770196602 | 306 |
| 841 | iso_pu_bacteria | 2775506902 | 2776269288 | 306 |
| 842 | iso_pu_bacteria | 2775506904 | 2776283573 | 306 |
| 843 | iso_pu_bacteria | 2791355082 | 2792584702 | 306 |
| 844 | iso_pu_bacteria | 2791355091 | 2792621517 | 306 |
| 845 | iso_pu_bacteria | 2791355092 | 2792627795 | 306 |
| 846 | iso_pu_bacteria | 2791355094 | 2792640235 | 306 |
| 847 | iso_pu_bacteria | 2791355256 | 2793297446 | 306 |
| 848 | iso_pu_bacteria | 2791355259 | 2793317317 | 306 |
| 849 | iso_pu_bacteria | 2791355262 | 2793336603 | 306 |
| 850 | iso_pu_bacteria | 2791355263 | 2793344512 | 306 |
| 851 | iso_pu_bacteria | 2791355266 | 2793358162 | 306 |
| 852 | iso_pu_bacteria | 2791355267 | 2793369828 | 306 |
| 853 | iso_pu_bacteria | 2802429268 | 2804754546 | 306 |
| 854 | iso_pu_bacteria | 2802429633 | 2806042910 | 306 |
| 855 | iso_pu_bacteria | 2802429634 | 2806050863 | 306 |
| 856 | iso_pu_bacteria | 2802429635 | 2806057969 | 306 |
| 857 | iso_pu_bacteria | 2802429636 | 2806065318 | 306 |
| 858 | iso_pu_bacteria | 2802429637 | 2806076801 | 306 |
| 859 | iso_pu_bacteria | 2838016132 | 2838016392 | 306 |
| 860 | iso_pu_bacteria | 2838042994 | 2838045838 | 306 |
| 861 | iso_pu_bacteria | 2838048938 | 2838049497 | 306 |
| 862 | iso_pu_bacteria | 2838061910 | 2838065226 | 306 |
| 863 | iso_pu_bacteria | 2838068647 | 2838068928 | 306 |
| 864 | iso_pu_bacteria | 2838074704 | 2838075652 | 306 |
| 865 | iso_pu_bacteria | 2838680041 | 2838686243 | 306 |
| 866 | iso_pu_bacteria | 2838686498 | 2838687470 | 306 |
| 867 | iso_pu_bacteria | 2838707686 | 2838713952 | 306 |
| 868 | iso_pu_bacteria | 2838729681 | 2838734118 | 306 |
| 869 | iso_pu_bacteria | 2838742623 | 2838746570 | 306 |
| 870 | iso_pu_bacteria | 2839993093 | 2839993599 | 306 |
| 871 | iso_pu_bacteria | 2840764183 | 2840766620 | 306 |
| 872 | iso_pu_bacteria | 2841851746 | 2841854020 | 306 |
| 873 | iso_pu_bacteria | 2841864319 | 2841869338 | 306 |
| 874 | iso_pu_bacteria | 2842077413 | 2842083350 | 306 |
| 875 | iso_pu_bacteria | 2842110456 | 2842116731 | 306 |
| 876 | iso_pu_bacteria | 2842118031 | 2842124297 | 306 |
| 877 | iso_pu_bacteria | 2842156927 | 2842159613 | 306 |
| 878 | iso_pu_bacteria | 2842163707 | 2842164062 | 306 |
| 879 | iso_pu_bacteria | 2842180545 | 2842182817 | 306 |
| 880 | iso_pu_bacteria | 2842205361 | 2842209370 | 306 |
| 881 | iso_pu_bacteria | 2842217011 | 2842221592 | 306 |
| 882 | iso_pu_bacteria | 2842229732 | 2842232528 | 306 |
| 883 | iso_pu_bacteria | 2842237096 | 2842243367 | 306 |
| 884 | iso_pu_bacteria | 2842243621 | 2842247229 | 306 |
| 885 | iso_pu_bacteria | 2842257432 | 2842259084 | 306 |
| 886 | iso_pu_bacteria | 2842271015 | 2842272496 | 306 |
| 887 | iso_pu_bacteria | 2842278818 | 2842282586 | 306 |
| 888 | iso_pu_bacteria | 2842291075 | 2842297549 | 306 |
| 889 | iso_pu_bacteria | 2842304105 | 2842309830 | 306 |
| 890 | iso_pu_bacteria | 2842311132 | 2842313405 | 306 |
| 891 | iso_pu_bacteria | 2842341865 | 2842344114 | 306 |
| 892 | iso_pu_bacteria | 2842363717 | 2842369247 | 306 |
| 893 | iso_pu_bacteria | 2842370503 | 2842376580 | 306 |
| 894 | iso_pu_bacteria | 2842377471 | 2842383833 | 306 |
| 895 | iso_pu_bacteria | 2842384541 | 2842390974 | 306 |
| 896 | iso_pu_bacteria | 2842395702 | 2842396474 | 306 |
| 897 | iso_pu_bacteria | 2842402390 | 2842405725 | 306 |
| 898 | iso_pu_bacteria | 2842409023 | 2842412309 | 306 |
| 899 | iso_pu_bacteria | 2842415677 | 2842418955 | 306 |
| 900 | iso_pu_bacteria | 2842422224 | 2842423074 | 306 |
| 901 | iso_pu_bacteria | 2842447887 | 2842448113 | 306 |
| 902 | iso_pu_bacteria | 2842521101 | 2842525142 | 306 |
| 903 | iso_pu_bacteria | 2842871566 | 2842874921 | 306 |
| 904 | iso_pu_bacteria | 2844454524 | 2844460466 | 306 |
| 905 | iso_pu_bacteria | 2847417321 | 2847422218 | 306 |
| 906 | iso_pu_bacteria | 2848992105 | 2848998283 | 306 |
| 907 | iso_pu_bacteria | 2850079185 | 2850085342 | 306 |
| 908 | iso_pu_bacteria | 2854896431 | 2854899957 | 306 |
| 909 | iso_pu_bacteria | 2855825444 | 2855828403 | 306 |
| 910 | iso_pu_bacteria | 2855839649 | 2855843515 | 306 |
| 911 | iso_pu_bacteria | 2855872281 | 2855875661 | 306 |
| 912 | iso_pu_bacteria | 2857516855 | 2857518031 | 306 |
| 913 | iso_pu_bacteria | 2858800743 | 2858807223 | 306 |
| 914 | iso_pu_bacteria | 2894652903 | 2894653442 | 306 |
| 915 | iso_pu_bacteria | 2896384573 | 2896388160 | 306 |
| 916 | iso_pu_bacteria | 2904578770 | 2904579703 | 306 |
| 917 | iso_pu_bacteria | 2913295892 | 2913296625 | 306 |
| 918 | iso_pu_bacteria | 2915986958 | 2915988998 | 306 |
| 919 | iso_pu_bacteria | 2915993759 | 2916000143 | 306 |
| 920 | iso_pu_bacteria | 2916000859 | 2916004805 | 306 |
| 921 | iso_pu_bacteria | 2916007675 | 2916013135 | 306 |
| 922 | iso_pu_bacteria | 2916014648 | 2916020228 | 306 |
| 923 | iso_pu_bacteria | 2916021584 | 2916027048 | 306 |
| 924 | iso_pu_bacteria | 2916028427 | 2916029956 | 306 |
| 925 | iso_pu_bacteria | 2916035215 | 2916041099 | 306 |
| 926 | iso_pu_bacteria | 2916041962 | 2916048577 | 306 |
| 927 | iso_pu_bacteria | 2916048683 | 2916052115 | 306 |
| 928 | iso_pu_bacteria | 2916055098 | 2916058735 | 306 |
| 929 | iso_pu_bacteria | 2916068649 | 2916075187 | 306 |
| 930 | iso_pu_bacteria | 2916076590 | 2916083036 | 306 |
| 931 | iso_pu_bacteria | 2919100787 | 2919102788 | 306 |
| 932 | iso_pu_bacteria | 2919119836 | 2919120630 | 306 |
| 933 | iso_pu_bacteria | 2920760137 | 2920764268 | 306 |
| 934 | iso_pu_bacteria | 2921201388 | 2921203076 | 306 |
| 935 | iso_pu_bacteria | 2921208531 | 2921210190 | 306 |
| 936 | iso_pu_bacteria | 2921237296 | 2921238613 | 306 |
| 937 | iso_pu_bacteria | 2921244191 | 2921247670 | 306 |
| 938 | iso_pu_bacteria | 2921257292 | 2921263499 | 306 |
| 939 | iso_pu_bacteria | 2921263974 | 2921265385 | 306 |
| 940 | iso_pu_bacteria | 2921282425 | 2921283176 | 306 |
| 941 | iso_pu_bacteria | 2921289301 | 2921296030 | 306 |
| 942 | iso_pu_bacteria | 2921296804 | 2921302015 | 306 |
| 943 | iso_pu_bacteria | 2924144063 | 2924148975 | 306 |
| 944 | iso_pu_bacteria | 2924150972 | 2924155391 | 306 |
| 945 | iso_pu_bacteria | 2924158325 | 2924158643 | 306 |
| 946 | iso_pu_bacteria | 2924165586 | 2924167298 | 306 |
| 947 | iso_pu_bacteria | 2924172951 | 2924175842 | 306 |
| 948 | iso_pu_bacteria | 2924179722 | 2924183893 | 306 |
| 949 | iso_pu_bacteria | 2924186466 | 2924193439 | 306 |
| 950 | iso_pu_bacteria | 2924193448 | 2924198812 | 306 |
| 951 | iso_pu_bacteria | 2924200457 | 2924204686 | 306 |
| 952 | iso_pu_bacteria | 2924207177 | 2924212270 | 306 |
| 953 | iso_pu_bacteria | 2924221636 | 2924222437 | 306 |
| 954 | iso_pu_bacteria | 2924228884 | 2924232556 | 306 |
| 955 | iso_pu_bacteria | 2928521798 | 2928522502 | 306 |
| 956 | iso_pu_bacteria | 2933570622 | 2933576272 | 306 |
| 957 | iso_pu_bacteria | 2933586486 | 2933592947 | 306 |
| 958 | iso_pu_bacteria | 2933599457 | 2933599596 | 306 |
| 959 | iso_pu_bacteria | 2935894831 | 2935900992 | 306 |
| 960 | iso_pu_bacteria | 2935901341 | 2935903163 | 306 |
| 961 | iso_pu_bacteria | 2936367885 | 2936374398 | 306 |
| 962 | iso_pu_bacteria | 2936375103 | 2936378760 | 306 |
| 963 | iso_pu_bacteria | 2936381700 | 2936386550 | 306 |
| 964 | iso_pu_bacteria | 2936996657 | 2936996673 | 306 |
| 965 | iso_pu_bacteria | 2937002841 | 2937008420 | 306 |
| 966 | iso_pu_bacteria | 2937009748 | 2937015607 | 306 |
| 967 | iso_pu_bacteria | 2937016420 | 2937020116 | 306 |
| 968 | iso_pu_bacteria | 2937023124 | 2937026374 | 306 |
| 969 | iso_pu_bacteria | 2937042894 | 2937043472 | 306 |
| 970 | iso_pu_bacteria | 2937049772 | 2937050472 | 306 |
| 971 | iso_pu_bacteria | 2937056579 | 2937057125 | 306 |
| 972 | iso_pu_bacteria | 2937063883 | 2937069051 | 306 |
| 973 | iso_pu_bacteria | 2937071275 | 2937076752 | 306 |
| 974 | iso_pu_bacteria | 2937091812 | 2937093341 | 306 |
| 975 | iso_pu_bacteria | 2937098957 | 2937099163 | 306 |
| 976 | iso_pu_bacteria | 2937106411 | 2937106759 | 306 |
| 977 | iso_pu_bacteria | 2937113482 | 2937116907 | 306 |
| 978 | iso_pu_bacteria | 2937119839 | 2937125302 | 306 |
| 979 | iso_pu_bacteria | 2937126314 | 2937131840 | 306 |
| 980 | iso_pu_bacteria | 2939669807 | 2939671540 | 306 |
| 981 | iso_pu_bacteria | 2954011201 | 2954014102 | 306 |
| 982 | iso_pu_bacteria | 2957382221 | 2957387240 | 306 |
| 983 | iso_pu_bacteria | 2957388812 | 2957394314 | 306 |
| 984 | iso_pu_bacteria | 2957402308 | 2957408160 | 306 |
| 985 | iso_pu_bacteria | 2957408893 | 2957412364 | 306 |
| 986 | iso_pu_bacteria | 2957415311 | 2957417886 | 306 |
| 987 | iso_pu_bacteria | 2957430029 | 2957437062 | 306 |
| 988 | iso_pu_bacteria | 2957443900 | 2957444073 | 306 |
| 989 | iso_pu_bacteria | 2957450854 | 2957455007 | 306 |
| 990 | iso_pu_bacteria | 2957457609 | 2957460768 | 306 |
| 991 | iso_pu_bacteria | 2957464669 | 2957470746 | 306 |
| 992 | iso_pu_bacteria | 2957471148 | 2957472808 | 306 |
| 993 | iso_pu_bacteria | 2957478035 | 2957479284 | 306 |
| 994 | iso_pu_bacteria | 2957484790 | 2957487216 | 306 |
| 995 | iso_pu_bacteria | 2957491536 | 2957497400 | 306 |
| 996 | iso_pu_bacteria | 2957498199 | 2957505431 | 306 |
| 997 | iso_pu_bacteria | 2957505466 | 2957506374 | 306 |
| 998 | iso_pu_bacteria | 2960584000 | 2960589895 | 306 |
| 999 | iso_pu_bacteria | 2960597568 | 2960603229 | 306 |
| 1000 | iso_pu_bacteria | 2960603979 | 2960607533 | 306 |
| 1001 | iso_pu_bacteria | 2960610863 | 2960616405 | 306 |
| 1002 | iso_pu_bacteria | 2960617483 | 2960619239 | 306 |
| 1003 | iso_pu_bacteria | 2960624210 | 2960624698 | 306 |
| 1004 | iso_pu_bacteria | 2960637947 | 2960642942 | 306 |
| 1005 | iso_pu_bacteria | 2960645483 | 2960645955 | 306 |
| 1006 | iso_pu_bacteria | 2960652885 | 2960653485 | 306 |
| 1007 | iso_pu_bacteria | 2960660292 | 2960662606 | 306 |
| 1008 | iso_pu_bacteria | 2960667422 | 2960673008 | 306 |
| 1009 | iso_pu_bacteria | 2960674078 | 2960678372 | 306 |
| 1010 | iso_pu_bacteria | 2960687367 | 2960692356 | 306 |
| 1011 | iso_pu_bacteria | 2964607997 | 2964608273 | 306 |
| 1012 | iso_pu_bacteria | 2964615318 | 2964621289 | 306 |
| 1013 | iso_pu_bacteria | 2964621998 | 2964622287 | 306 |
| 1014 | iso_pu_bacteria | 2964628898 | 2964632213 | 306 |
| 1015 | iso_pu_bacteria | 2964636051 | 2964639387 | 306 |
| 1016 | iso_pu_bacteria | 2964643177 | 2964647662 | 306 |
| 1017 | iso_pu_bacteria | 2964649959 | 2964653469 | 306 |
| 1018 | iso_pu_bacteria | 2964656573 | 2964658572 | 306 |
| 1019 | iso_pu_bacteria | 2964663802 | 2964670475 | 306 |
| 1020 | iso_pu_bacteria | 2964670856 | 2964675982 | 306 |
| 1021 | iso_pu_bacteria | 2964678106 | 2964681500 | 306 |
| 1022 | iso_pu_bacteria | 2964685014 | 2964685562 | 306 |
| 1023 | iso_pu_bacteria | 2964691889 | 2964692307 | 306 |
| 1024 | iso_pu_bacteria | 2964698721 | 2964699242 | 306 |
| 1025 | iso_pu_bacteria | 2964705432 | 2964708823 | 306 |
| 1026 | iso_pu_bacteria | 2964719344 | 2964720170 | 306 |
| 1027 | iso_pu_bacteria | 2967664464 | 2967666374 | 306 |
| 1028 | iso_pu_bacteria | 2967671571 | 2967672556 | 306 |
| 1029 | iso_pu_bacteria | 2967678726 | 2967679621 | 306 |
| 1030 | iso_pu_bacteria | 2967693043 | 2967696545 | 306 |
| 1031 | iso_pu_bacteria | 2967699805 | 2967701073 | 306 |
| 1032 | iso_pu_bacteria | 2967706974 | 2967707744 | 306 |
| 1033 | iso_pu_bacteria | 2967714385 | 2967717113 | 306 |
| 1034 | iso_pu_bacteria | 2967721400 | 2967728515 | 306 |
| 1035 | iso_pu_bacteria | 2967735183 | 2967741647 | 306 |
| 1036 | iso_pu_bacteria | 2967742019 | 2967743059 | 306 |
| 1037 | iso_pu_bacteria | 2967748971 | 2967753949 | 306 |
| 1038 | iso_pu_bacteria | 2967755722 | 2967761878 | 306 |
| 1039 | iso_pu_bacteria | 2967762386 | 2967766173 | 306 |
| 1040 | iso_pu_bacteria | 2967769361 | 2967771858 | 306 |
| 1041 | iso_pu_bacteria | 2967775926 | 2967777299 | 306 |
| 1042 | iso_pu_bacteria | 2970019648 | 2970023846 | 306 |
| 1043 | iso_pu_bacteria | 2970033650 | 2970040777 | 306 |
| 1044 | iso_pu_bacteria | 2970040964 | 2970047530 | 306 |
| 1045 | iso_pu_bacteria | 2970047711 | 2970054122 | 306 |
| 1046 | iso_pu_bacteria | 2970054988 | 2970055272 | 306 |
| 1047 | iso_pu_bacteria | 2970061556 | 2970063376 | 306 |
| 1048 | iso_pu_bacteria | 2970068827 | 2970075946 | 306 |
| 1049 | iso_pu_bacteria | 2970076120 | 2970081916 | 306 |
| 1050 | iso_pu_bacteria | 2970082768 | 2970085822 | 306 |
| 1051 | iso_pu_bacteria | 2970088815 | 2970092338 | 306 |
| 1052 | iso_pu_bacteria | 2970095765 | 2970096231 | 306 |
| 1053 | iso_pu_bacteria | 2970102677 | 2970107897 | 306 |
| 1054 | iso_pu_bacteria | 2970109326 | 2970109643 | 306 |
| 1055 | iso_pu_bacteria | 2970116247 | 2970122222 | 306 |
| 1056 | iso_pu_bacteria | 2970129317 | 2970132521 | 306 |
| 1057 | iso_pu_bacteria | 2970136068 | 2970136903 | 306 |
| 1058 | iso_pu_bacteria | 2970149975 | 2970156076 | 306 |
| 1059 | iso_pu_bacteria | 2970156795 | 2970157607 | 306 |
| 1060 | iso_pu_bacteria | 2970164137 | 2970169439 | 306 |
| 1061 | iso_pu_bacteria | 2970170962 | 2970176499 | 306 |
| 1062 | iso_pu_bacteria | 2970177841 | 2970182851 | 306 |
| 1063 | iso_pu_bacteria | 2970184632 | 2970188970 | 306 |
| 1064 | iso_pu_bacteria | 2970191845 | 2970198620 | 306 |
| 1065 | iso_pu_bacteria | 2977516862 | 2977520423 | 306 |
| 1066 | iso_pu_bacteria | 2977523885 | 2977526837 | 306 |
| 1067 | iso_pu_bacteria | 2977537788 | 2977538340 | 306 |
| 1068 | iso_pu_bacteria | 2977551784 | 2977555670 | 306 |
| 1069 | iso_pu_bacteria | 2977558990 | 2977562918 | 306 |
| 1070 | iso_pu_bacteria | 2977565890 | 2977569642 | 306 |
| 1071 | iso_pu_bacteria | 2977572785 | 2977572954 | 306 |
| 1072 | iso_pu_bacteria | 2977579622 | 2977583107 | 306 |
| 1073 | iso_pu_bacteria | 2996310559 | 2996316206 | 306 |
| 1074 | iso_pu_bacteria | 3003930520 | 3003934209 | 306 |
| 1075 | iso_pu_bacteria | 643692032 | 643823876 | 306 |
| 1076 | iso_pu_bacteria | 648276728 | 648740341 | 306 |
| 1077 | iso_pu_bacteria | 8003992118 | 8003996094 | 306 |
| 1078 | iso_pu_bacteria | 8005275841 | 8005277298 | 306 |
| 1079 | iso_pu_bacteria | 8005282627 | 8005287612 | 306 |
| 1080 | iso_pu_bacteria | 8005289223 | 8005295519 | 306 |
| 1081 | iso_pu_bacteria | 8005301065 | 8005306311 | 306 |
| 1082 | iso_pu_bacteria | 8005307578 | 8005307932 | 306 |
| 1083 | iso_pu_bacteria | 8005376324 | 8005379799 | 306 |
| 1084 | iso_pu_bacteria | 8005430974 | 8005431768 | 306 |
| 1085 | iso_pu_bacteria | 8005460587 | 8005467212 | 306 |
| 1086 | iso_pu_bacteria | 8005497431 | 8005502599 | 306 |
| 1087 | iso_pu_bacteria | 8005556819 | 8005562359 | 306 |
| 1088 | iso_pu_bacteria | 8005563573 | 8005565521 | 306 |
| 1089 | iso_pu_bacteria | 8005570704 | 8005575763 | 306 |
| 1090 | iso_pu_bacteria | 8005619151 | 8005623806 | 306 |
| 1091 | iso_pu_bacteria | 8005626139 | 8005626365 | 306 |
| 1092 | iso_pu_bacteria | 8005668836 | 8005674028 | 306 |
| 1093 | iso_pu_bacteria | 8005688590 | 8005693993 | 306 |
| 1094 | iso_pu_bacteria | 8005695170 | 8005701815 | 306 |
| 1095 | iso_pu_bacteria | 8018163183 | 8018165503 | 306 |
| 1096 | iso_pu_bacteria | 8018176218 | 8018182374 | 306 |
| 1097 | iso_pu_bacteria | 8023680758 | 8023688084 | 306 |
| 1098 | iso_pu_bacteria | 8024479707 | 8024485039 | 306 |
| 1099 | iso_pu_bacteria | 8045864390 | 8045867007 | 306 |
| 1100 | iso_pu_bacteria | 8049293176 | 8049296778 | 306 |
| 1101 | iso_pu_bacteria | 8054558443 | 8054559313 | 306 |
| 1102 | iso_pu_bacteria | 8056375014 | 8056375042 | 306 |
| 1103 | iso_pu_bacteria | 8057874678 | 8057878014 | 306 |
| 1104 | 3300006048 | Ga0075363_100156153 | Ga0075363_1001561531 | 307 |
| 1105 | 3300031456 | Ga0307513_10028483 | Ga0307513_100284833 | 307 |
| 1106 | 3300031728 | Ga0316578_10129310 | Ga0316578_101293102 | 307 |
| 1107 | 3300033179 | Ga0307507_10047478 | Ga0307507_100474783 | 307 |
| 1108 | 3300037466 | Ga0395898_0161500 | Ga0395898_0161500_500_1438 | 307 |
| 1109 | 3300042876 | Ga0451577_0016723 | Ga0451577_0016723_5143_6093 | 307 |
| 1110 | 3300049570 | Ga0501033_0101516 | Ga0501033_0101516_762_1769 | 307 |
| 1111 | 3300049573 | Ga0501037_0144077 | Ga0501037_0144077_587_1525 | 307 |
| 1112 | 3300049583 | Ga0501067_0240352 | Ga0501067_0240352_37_975 | 307 |
| 1113 | 3300049584 | Ga0501068_0007123 | Ga0501068_0007123_5023_6030 | 307 |
| 1114 | 3300049586 | Ga0501070_0048714 | Ga0501070_0048714_2337_3275 | 307 |
| 1115 | 3300049588 | Ga0501072_0175271 | Ga0501072_0175271_166_1104 | 307 |
| 1116 | 3300049589 | Ga0501073_0041167 | Ga0501073_0041167_843_1781 | 307 |
| 1117 | 3300049742 | Ga0501080_0048231 | Ga0501080_0048231_2846_3784 | 307 |
| 1118 | 3300049822 | Ga0501035_0141374 | Ga0501035_0141374_756_1763 | 307 |
| 1119 | 3300049823 | Ga0501044_0153181 | Ga0501044_0153181_762_1700 | 307 |
| 1120 | 3300049823 | Ga0501044_0177481 | Ga0501044_0177481_762_1769 | 307 |
| 1121 | 3300053087 | Ga0500643_044588 | Ga0500643_044588_192_1133 | 307 |
| 1122 | iso_pu_bacteria | 2508501050 | 2508728167 | 307 |
| 1123 | iso_pu_bacteria | 2510917022 | 2511136356 | 307 |
| 1124 | iso_pu_bacteria | 2513237146 | 2513927215 | 307 |
| 1125 | iso_pu_bacteria | 2524023209 | 2524462978 | 307 |
| 1126 | iso_pu_bacteria | 2582581307 | 2585274723 | 307 |
| 1127 | iso_pu_bacteria | 2585427531 | 2585562089 | 307 |
| 1128 | iso_pu_bacteria | 2585427608 | 2585902392 | 307 |
| 1129 | iso_pu_bacteria | 2585427609 | 2585907835 | 307 |
| 1130 | iso_pu_bacteria | 2585428125 | 2587983255 | 307 |
| 1131 | iso_pu_bacteria | 2599185170 | 2599415344 | 307 |
| 1132 | iso_pu_bacteria | 2667528174 | 2671113071 | 307 |
| 1133 | iso_pu_bacteria | 2818991448 | 2819612348 | 307 |
| 1134 | iso_pu_bacteria | 2835312727 | 2835316040 | 307 |
| 1135 | iso_pu_bacteria | 2838029111 | 2838031592 | 307 |
| 1136 | iso_pu_bacteria | 2838035591 | 2838038931 | 307 |
| 1137 | iso_pu_bacteria | 2838661181 | 2838664479 | 307 |
| 1138 | iso_pu_bacteria | 2842298080 | 2842303873 | 307 |
| 1139 | iso_pu_bacteria | 2842357229 | 2842362696 | 307 |
| 1140 | iso_pu_bacteria | 2842475841 | 2842478324 | 307 |
| 1141 | iso_pu_bacteria | 2842502639 | 2842505730 | 307 |
| 1142 | iso_pu_bacteria | 2894232714 | 2894237775 | 307 |
| 1143 | iso_pu_bacteria | 2909042592 | 2909047803 | 307 |
| 1144 | iso_pu_bacteria | 2919408235 | 2919412858 | 307 |
| 1145 | iso_pu_bacteria | 2933016740 | 2933022950 | 307 |
| 1146 | iso_pu_bacteria | 2996336353 | 2996339820 | 307 |
| 1147 | iso_pu_bacteria | 3005409236 | 3005413506 | 307 |
| 1148 | iso_pu_bacteria | 3005416602 | 3005419787 | 307 |
| 1149 | iso_pu_bacteria | 8005314921 | 8005317789 | 307 |
| 1150 | iso_pu_bacteria | 8005484373 | 8005486760 | 307 |
| 1151 | iso_pu_bacteria | 8005645114 | 8005645609 | 307 |
| 1152 | iso_pu_bacteria | 8005682033 | 8005686801 | 307 |
| 1153 | 3300003215 | JGI25153J46596_10000042 | JGI25153J46596_10000042116 | 308 |
| 1154 | 3300003215 | JGI25153J46596_10000087 | JGI25153J46596_1000008710 | 308 |
| 1155 | 3300005455 | Ga0070663_100023155 | Ga0070663_1000231554 | 308 |
| 1156 | 3300005844 | Ga0068862_100004384 | Ga0068862_1000043847 | 308 |
| 1157 | 3300005985 | Ga0081539_10064645 | Ga0081539_100646452 | 308 |
| 1158 | 3300006186 | Ga0075369_10002677 | Ga0075369_100026778 | 308 |
| 1159 | 3300025297 | Ga0209758_1000110 | Ga0209758_100011088 | 308 |
| 1160 | 3300025297 | Ga0209758_1030022 | Ga0209758_10300222 | 308 |
| 1161 | 3300025298 | Ga0209050_1023735 | Ga0209050_10237352 | 308 |
| 1162 | 3300025304 | Ga0209257_1000376 | Ga0209257_100037631 | 308 |
| 1163 | 3300026067 | Ga0207678_10041294 | Ga0207678_100412944 | 308 |
| 1164 | 3300028380 | Ga0268265_10055740 | Ga0268265_100557402 | 308 |
| 1165 | 3300031730 | Ga0307516_10058949 | Ga0307516_100589493 | 308 |
| 1166 | 3300046460 | Ga0495638_0053901 | Ga0495638_0053901_752_1699 | 308 |
| 1167 | 3300046660 | Ga0495625_0014315 | Ga0495625_0014315_1611_2582 | 308 |
| 1168 | 3300046660 | Ga0495625_0240517 | Ga0495625_0240517_14_961 | 308 |
| 1169 | 3300046691 | Ga0495670_0080575 | Ga0495670_0080575_670_1596 | 308 |
| 1170 | 3300046694 | Ga0495649_0006612 | Ga0495649_0006612_3353_4324 | 308 |
| 1171 | 3300046810 | Ga0495660_0026540 | Ga0495660_0026540_226_1197 | 308 |
| 1172 | 3300047443 | Ga0495687_018940 | Ga0495687_018940_700_1671 | 308 |
| 1173 | 3300049575 | Ga0501039_0201010 | Ga0501039_0201010_118_1065 | 308 |
| 1174 | 3300050496 | nmdc:mga07m45_62540_c1 | nmdc:mga07m45_62540_c1_581_1537 | 308 |
| 1175 | 3300050516 | nmdc:mga0sz30_18177_c1 | nmdc:mga0sz30_18177_c1_1019_1975 | 308 |
| 1176 | 3300053130 | Ga0500642_0001036 | Ga0500642_0001036_708_1655 | 308 |
| 1177 | 3300053134 | Ga0500658_0007229 | Ga0500658_0007229_2939_3910 | 308 |
| 1178 | 3300053146 | Ga0500588_0029486 | Ga0500588_0029486_10_957 | 308 |
| 1179 | 3300053151 | Ga0500604_0010562 | Ga0500604_0010562_383_1330 | 308 |
| 1180 | iso_pu_bacteria | 2513237087 | 2513591256 | 308 |
| 1181 | iso_pu_bacteria | 2643221558 | 2643814632 | 308 |
| 1182 | iso_pu_bacteria | 2837678835 | 2837682159 | 308 |
| 1183 | iso_pu_bacteria | 2842694124 | 2842695718 | 308 |
| 1184 | iso_pu_bacteria | 2855020534 | 2855022100 | 308 |
| 1185 | iso_pu_bacteria | 639633055 | 639644989 | 308 |
| 1186 | iso_pu_bacteria | 8018150411 | 8018150445 | 308 |
| 1187 | 3300003792 | Ga0055540_1009900 | Ga0055540_10099002 | 309 |
| 1188 | 3300003794 | Ga0055531_10000192 | Ga0055531_1000019268 | 309 |
| 1189 | 3300005338 | Ga0068868_100238094 | Ga0068868_1002380942 | 309 |
| 1190 | 3300005344 | Ga0070661_100133299 | Ga0070661_1001332992 | 309 |
| 1191 | 3300005356 | Ga0070674_100193148 | Ga0070674_1001931482 | 309 |
| 1192 | 3300005441 | Ga0070700_100040608 | Ga0070700_1000406082 | 309 |
| 1193 | 3300005458 | Ga0070681_10397484 | Ga0070681_103974842 | 309 |
| 1194 | 3300005539 | Ga0068853_100095778 | Ga0068853_1000957781 | 309 |
| 1195 | 3300005577 | Ga0068857_100290409 | Ga0068857_1002904092 | 309 |
| 1196 | 3300005718 | Ga0068866_10134408 | Ga0068866_101344082 | 309 |
| 1197 | 3300005981 | Ga0081538_10112765 | Ga0081538_101127651 | 309 |
| 1198 | 3300006058 | Ga0075432_10016468 | Ga0075432_100164682 | 309 |
| 1199 | 3300006178 | Ga0075367_10048271 | Ga0075367_100482711 | 309 |
| 1200 | 3300006195 | Ga0075366_10193510 | Ga0075366_101935102 | 309 |
| 1201 | 3300006846 | Ga0075430_100057231 | Ga0075430_1000572312 | 309 |
| 1202 | 3300006847 | Ga0075431_100014362 | Ga0075431_1000143622 | 309 |
| 1203 | 3300006946 | Ga0079104_1006482 | Ga0079104_10064824 | 309 |
| 1204 | 3300006946 | Ga0079104_1006593 | Ga0079104_10065932 | 309 |
| 1205 | 3300006948 | Ga0099826_10179734 | Ga0099826_101797341 | 309 |
| 1206 | 3300009147 | Ga0114129_10002208 | Ga0114129_100022086 | 309 |
| 1207 | 3300009174 | Ga0105241_10170531 | Ga0105241_101705311 | 309 |
| 1208 | 3300009545 | Ga0105237_10111587 | Ga0105237_101115872 | 309 |
| 1209 | 3300010375 | Ga0105239_10112133 | Ga0105239_101121333 | 309 |
| 1210 | 3300011119 | Ga0105246_10221040 | Ga0105246_102210401 | 309 |
| 1211 | 3300013296 | Ga0157374_10359312 | Ga0157374_103593122 | 309 |
| 1212 | 3300013308 | Ga0157375_10210215 | Ga0157375_102102152 | 309 |
| 1213 | 3300014326 | Ga0157380_10007607 | Ga0157380_100076073 | 309 |
| 1214 | 3300021377 | Ga0213874_10027685 | Ga0213874_100276852 | 309 |
| 1215 | 3300022739 | Ga0228711_1000045 | Ga0228711_100004510 | 309 |
| 1216 | 3300022740 | Ga0228710_1000036 | Ga0228710_100003692 | 309 |
| 1217 | 3300025273 | Ga0209673_1009563 | Ga0209673_10095634 | 309 |
| 1218 | 3300025297 | Ga0209758_1034835 | Ga0209758_10348352 | 309 |
| 1219 | 3300025303 | Ga0209051_1000281 | Ga0209051_100028184 | 309 |
| 1220 | 3300025304 | Ga0209257_1000039 | Ga0209257_100003998 | 309 |
| 1221 | 3300025899 | Ga0207642_10138412 | Ga0207642_101384121 | 309 |
| 1222 | 3300025914 | Ga0207671_10065756 | Ga0207671_100657563 | 309 |
| 1223 | 3300025920 | Ga0207649_10112774 | Ga0207649_101127742 | 309 |
| 1224 | 3300025926 | Ga0207659_10047482 | Ga0207659_100474822 | 309 |
| 1225 | 3300025944 | Ga0207661_10187473 | Ga0207661_101874732 | 309 |
| 1226 | 3300025945 | Ga0207679_10143879 | Ga0207679_101438792 | 309 |
| 1227 | 3300025949 | Ga0207667_10048606 | Ga0207667_100486064 | 309 |
| 1228 | 3300025972 | Ga0207668_10077168 | Ga0207668_100771682 | 309 |
| 1229 | 3300026041 | Ga0207639_10016794 | Ga0207639_100167945 | 309 |
| 1230 | 3300026075 | Ga0207708_10058747 | Ga0207708_100587472 | 309 |
| 1231 | 3300026116 | Ga0207674_10257878 | Ga0207674_102578781 | 309 |
| 1232 | 3300027111 | Ga0209281_1000178 | Ga0209281_100017827 | 309 |
| 1233 | 3300027111 | Ga0209281_1000417 | Ga0209281_100041763 | 309 |
| 1234 | 3300027666 | Ga0209282_1000023 | Ga0209282_100002353 | 309 |
| 1235 | 3300027907 | Ga0207428_10074571 | Ga0207428_100745712 | 309 |
| 1236 | 3300031548 | Ga0307408_100217199 | Ga0307408_1002171992 | 309 |
| 1237 | 3300031730 | Ga0307516_10307254 | Ga0307516_103072541 | 309 |
| 1238 | 3300031731 | Ga0307405_10105597 | Ga0307405_101055972 | 309 |
| 1239 | 3300031852 | Ga0307410_10126557 | Ga0307410_101265572 | 309 |
| 1240 | 3300031852 | Ga0307410_10414393 | Ga0307410_104143931 | 309 |
| 1241 | 3300031903 | Ga0307407_10161473 | Ga0307407_101614732 | 309 |
| 1242 | 3300031967 | Ga0315914_1000016 | Ga0315914_100001610 | 309 |
| 1243 | 3300031995 | Ga0307409_100376629 | Ga0307409_1003766292 | 309 |
| 1244 | 3300031995 | Ga0307409_100509822 | Ga0307409_1005098222 | 309 |
| 1245 | 3300032002 | Ga0307416_100353900 | Ga0307416_1003539002 | 309 |
| 1246 | 3300032004 | Ga0307414_10107416 | Ga0307414_101074162 | 309 |
| 1247 | 3300032005 | Ga0307411_10031050 | Ga0307411_100310502 | 309 |
| 1248 | 3300033430 | Ga0315913_1000027 | Ga0315913_100002784 | 309 |
| 1249 | 3300033464 | Ga0315915_1000007 | Ga0315915_100000788 | 309 |
| 1250 | 3300035410 | Ga0373924_0112174 | Ga0373924_0112174_49_1008 | 309 |
| 1251 | 3300037471 | Ga0395905_0000377 | Ga0395905_0000377_38444_39403 | 309 |
| 1252 | 3300037471 | Ga0395905_0014555 | Ga0395905_0014555_1560_2504 | 309 |
| 1253 | 3300037853 | Ga0436364_0780289 | Ga0436364_0780289_175_1125 | 309 |
| 1254 | 3300037853 | Ga0436364_1376234 | Ga0436364_1376234_89_1039 | 309 |
| 1255 | 3300039447 | Ga0436361_0589976 | Ga0436361_0589976_121_1071 | 309 |
| 1256 | 3300039450 | Ga0436363_0629987 | Ga0436363_0629987_2599_3549 | 309 |
| 1257 | 3300044901 | Ga0466960_0066206 | Ga0466960_0066206_152_1096 | 309 |
| 1258 | 3300048905 | Ga0496102_0148052 | Ga0496102_0148052_885_1844 | 309 |
| 1259 | 3300048922 | Ga0496119_0008868 | Ga0496119_0008868_33_986 | 309 |
| 1260 | 3300048925 | Ga0496122_0023409 | Ga0496122_0023409_2474_3427 | 309 |
| 1261 | 3300048928 | Ga0496125_0000471 | Ga0496125_0000471_36023_36976 | 309 |
| 1262 | 3300049743 | Ga0501081_0408593 | Ga0501081_0408593_11_949 | 309 |
| 1263 | 3300050507 | nmdc:mga05p37_40366_c1 | nmdc:mga05p37_40366_c1_729_1670 | 309 |
| 1264 | 3300050509 | nmdc:mga0qj67_77679_c1 | nmdc:mga0qj67_77679_c1_969_1910 | 309 |
| 1265 | 3300050510 | nmdc:mga06r32_22751_c1 | nmdc:mga06r32_22751_c1_2849_3790 | 309 |
| 1266 | iso_pu_bacteria | 2751185800 | 2753361092 | 309 |
| 1267 | iso_pu_bacteria | 2821443989 | 2821450963 | 309 |
| 1268 | iso_pu_bacteria | 2828305725 | 2828310328 | 309 |
| 1269 | 3300002739 | JGI25158J39367_1000448 | JGI25158J39367_10004481 | 310 |
| 1270 | 3300002773 | JGI25152J39213_1005931 | JGI25152J39213_10059314 | 310 |
| 1271 | 3300002987 | JGI25159J45721_1000071 | JGI25159J45721_100007134 | 310 |
| 1272 | 3300002987 | JGI25159J45721_1000191 | JGI25159J45721_100019118 | 310 |
| 1273 | 3300002987 | JGI25159J45721_1013545 | JGI25159J45721_10135451 | 310 |
| 1274 | 3300003187 | JGI25151J46595_10000508 | JGI25151J46595_1000050827 | 310 |
| 1275 | 3300003215 | JGI25153J46596_10002535 | JGI25153J46596_1000253512 | 310 |
| 1276 | 3300003215 | JGI25153J46596_10010647 | JGI25153J46596_100106472 | 310 |
| 1277 | 3300003215 | JGI25153J46596_10014909 | JGI25153J46596_100149092 | 310 |
| 1278 | 3300003323 | rootH1_10191308 | rootH1_101913082 | 310 |
| 1279 | 3300003354 | JGI25160J50197_1000162 | JGI25160J50197_100016229 | 310 |
| 1280 | 3300003354 | JGI25160J50197_1001578 | JGI25160J50197_100157812 | 310 |
| 1281 | 3300003374 | JGI25161J50226_1000075 | JGI25161J50226_100007555 | 310 |
| 1282 | 3300003374 | JGI25161J50226_1006294 | JGI25161J50226_10062941 | 310 |
| 1283 | 3300003771 | Ga0055526_1001457 | Ga0055526_10014574 | 310 |
| 1284 | 3300003771 | Ga0055526_1004947 | Ga0055526_10049478 | 310 |
| 1285 | 3300003771 | Ga0055526_1005597 | Ga0055526_10055972 | 310 |
| 1286 | 3300003775 | Ga0055524_1006553 | Ga0055524_10065533 | 310 |
| 1287 | 3300003781 | Ga0055536_1000667 | Ga0055536_100066711 | 310 |
| 1288 | 3300003784 | Ga0055534_1002873 | Ga0055534_10028735 | 310 |
| 1289 | 3300003790 | Ga0055528_1000054 | Ga0055528_100005461 | 310 |
| 1290 | 3300003790 | Ga0055528_1002349 | Ga0055528_10023493 | 310 |
| 1291 | 3300003790 | Ga0055528_1009718 | Ga0055528_10097183 | 310 |
| 1292 | 3300003790 | Ga0055528_1023104 | Ga0055528_10231042 | 310 |
| 1293 | 3300003792 | Ga0055540_1000255 | Ga0055540_100025522 | 310 |
| 1294 | 3300003794 | Ga0055531_10016286 | Ga0055531_100162862 | 310 |
| 1295 | 3300004625 | Ga0055543_1000096 | Ga0055543_100009643 | 310 |
| 1296 | 3300004625 | Ga0055543_1000578 | Ga0055543_10005783 | 310 |
| 1297 | 3300004625 | Ga0055543_1001124 | Ga0055543_10011246 | 310 |
| 1298 | 3300005262 | Ga0065165_1000535 | Ga0065165_100053529 | 310 |
| 1299 | 3300005262 | Ga0065165_1007353 | Ga0065165_10073533 | 310 |
| 1300 | 3300005262 | Ga0065165_1011236 | Ga0065165_10112365 | 310 |
| 1301 | 3300005353 | Ga0070669_100244746 | Ga0070669_1002447462 | 310 |
| 1302 | 3300005467 | Ga0070706_100196043 | Ga0070706_1001960432 | 310 |
| 1303 | 3300005577 | Ga0068857_100543437 | Ga0068857_1005434371 | 310 |
| 1304 | 3300005937 | Ga0081455_10232284 | Ga0081455_102322842 | 310 |
| 1305 | 3300005981 | Ga0081538_10036106 | Ga0081538_100361062 | 310 |
| 1306 | 3300006038 | Ga0075365_10013860 | Ga0075365_100138603 | 310 |
| 1307 | 3300006038 | Ga0075365_10016988 | Ga0075365_100169882 | 310 |
| 1308 | 3300006038 | Ga0075365_10111174 | Ga0075365_101111742 | 310 |
| 1309 | 3300006048 | Ga0075363_100053961 | Ga0075363_1000539612 | 310 |
| 1310 | 3300006177 | Ga0075362_10006876 | Ga0075362_100068762 | 310 |
| 1311 | 3300006186 | Ga0075369_10039559 | Ga0075369_100395592 | 310 |
| 1312 | 3300006195 | Ga0075366_10021996 | Ga0075366_100219962 | 310 |
| 1313 | 3300006847 | Ga0075431_100219742 | Ga0075431_1002197422 | 310 |
| 1314 | 3300006852 | Ga0075433_10129370 | Ga0075433_101293702 | 310 |
| 1315 | 3300009094 | Ga0111539_10000285 | Ga0111539_1000028538 | 310 |
| 1316 | 3300009765 | Ga0123341_1000012 | Ga0123341_100001247 | 310 |
| 1317 | 3300013104 | Ga0157370_10149843 | Ga0157370_101498432 | 310 |
| 1318 | 3300015265 | Ga0182005_1006788 | Ga0182005_10067883 | 310 |
| 1319 | 3300021320 | Ga0214544_1001716 | Ga0214544_100171633 | 310 |
| 1320 | 3300021321 | Ga0214542_1000082 | Ga0214542_100008212 | 310 |
| 1321 | 3300021327 | Ga0214543_1000075 | Ga0214543_100007512 | 310 |
| 1322 | 3300025208 | Ga0209436_100035 | Ga0209436_10003514 | 310 |
| 1323 | 3300025245 | Ga0207425_1002132 | Ga0207425_10021325 | 310 |
| 1324 | 3300025258 | Ga0209129_1003154 | Ga0209129_10031544 | 310 |
| 1325 | 3300025273 | Ga0209673_1000067 | Ga0209673_1000067171 | 310 |
| 1326 | 3300025273 | Ga0209673_1000750 | Ga0209673_100075023 | 310 |
| 1327 | 3300025273 | Ga0209673_1001376 | Ga0209673_100137623 | 310 |
| 1328 | 3300025273 | Ga0209673_1004094 | Ga0209673_10040947 | 310 |
| 1329 | 3300025273 | Ga0209673_1014607 | Ga0209673_10146072 | 310 |
| 1330 | 3300025284 | Ga0209130_1000031 | Ga0209130_1000031190 | 310 |
| 1331 | 3300025284 | Ga0209130_1000147 | Ga0209130_100014738 | 310 |
| 1332 | 3300025284 | Ga0209130_1005106 | Ga0209130_10051063 | 310 |
| 1333 | 3300025291 | Ga0209675_1001148 | Ga0209675_100114815 | 310 |
| 1334 | 3300025292 | Ga0209676_1006751 | Ga0209676_10067512 | 310 |
| 1335 | 3300025294 | Ga0209025_1000240 | Ga0209025_100024049 | 310 |
| 1336 | 3300025294 | Ga0209025_1000397 | Ga0209025_100039773 | 310 |
| 1337 | 3300025294 | Ga0209025_1040334 | Ga0209025_10403342 | 310 |
| 1338 | 3300025294 | Ga0209025_1049135 | Ga0209025_10491352 | 310 |
| 1339 | 3300025295 | Ga0209564_1000092 | Ga0209564_1000092171 | 310 |
| 1340 | 3300025295 | Ga0209564_1000511 | Ga0209564_10005118 | 310 |
| 1341 | 3300025295 | Ga0209564_1000925 | Ga0209564_10009257 | 310 |
| 1342 | 3300025295 | Ga0209564_1001127 | Ga0209564_100112719 | 310 |
| 1343 | 3300025297 | Ga0209758_1000504 | Ga0209758_100050439 | 310 |
| 1344 | 3300025297 | Ga0209758_1000585 | Ga0209758_100058512 | 310 |
| 1345 | 3300025297 | Ga0209758_1005532 | Ga0209758_10055329 | 310 |
| 1346 | 3300025297 | Ga0209758_1050320 | Ga0209758_10503202 | 310 |
| 1347 | 3300025298 | Ga0209050_1004942 | Ga0209050_10049426 | 310 |
| 1348 | 3300025298 | Ga0209050_1021600 | Ga0209050_10216002 | 310 |
| 1349 | 3300025299 | Ga0209256_1000170 | Ga0209256_1000170111 | 310 |
| 1350 | 3300025299 | Ga0209256_1004342 | Ga0209256_10043427 | 310 |
| 1351 | 3300025299 | Ga0209256_1007078 | Ga0209256_10070785 | 310 |
| 1352 | 3300025299 | Ga0209256_1015056 | Ga0209256_10150562 | 310 |
| 1353 | 3300025302 | Ga0207426_1000042 | Ga0207426_1000042220 | 310 |
| 1354 | 3300025302 | Ga0207426_1000267 | Ga0207426_100026781 | 310 |
| 1355 | 3300025302 | Ga0207426_1000355 | Ga0207426_100035564 | 310 |
| 1356 | 3300025303 | Ga0209051_1000062 | Ga0209051_100006265 | 310 |
| 1357 | 3300025303 | Ga0209051_1009790 | Ga0209051_10097902 | 310 |
| 1358 | 3300025303 | Ga0209051_1039794 | Ga0209051_10397942 | 310 |
| 1359 | 3300025304 | Ga0209257_1000970 | Ga0209257_100097018 | 310 |
| 1360 | 3300025304 | Ga0209257_1007196 | Ga0209257_10071964 | 310 |
| 1361 | 3300025304 | Ga0209257_1049783 | Ga0209257_10497832 | 310 |
| 1362 | 3300025904 | Ga0207647_10195773 | Ga0207647_101957732 | 310 |
| 1363 | 3300025910 | Ga0207684_10106293 | Ga0207684_101062932 | 310 |
| 1364 | 3300025923 | Ga0207681_10172367 | Ga0207681_101723672 | 310 |
| 1365 | 3300025932 | Ga0207690_10208126 | Ga0207690_102081262 | 310 |
| 1366 | 3300025981 | Ga0207640_10233545 | Ga0207640_102335452 | 310 |
| 1367 | 3300026118 | Ga0207675_100270391 | Ga0207675_1002703912 | 310 |
| 1368 | 3300027907 | Ga0207428_10000339 | Ga0207428_1000033938 | 310 |
| 1369 | 3300028380 | Ga0268265_10317874 | Ga0268265_103178742 | 310 |
| 1370 | 3300028794 | Ga0307515_10000145 | Ga0307515_10000145124 | 310 |
| 1371 | 3300028794 | Ga0307515_10024560 | Ga0307515_100245604 | 310 |
| 1372 | 3300031548 | Ga0307408_100041302 | Ga0307408_1000413023 | 310 |
| 1373 | 3300031730 | Ga0307516_10138472 | Ga0307516_101384722 | 310 |
| 1374 | 3300031901 | Ga0307406_10158956 | Ga0307406_101589562 | 310 |
| 1375 | 3300038443 | Ga0395901_0269656 | Ga0395901_0269656_721_1674 | 310 |
| 1376 | 3300041509 | Ga0451843_0757209 | Ga0451843_0757209_362_1294 | 310 |
| 1377 | 3300041512 | Ga0451853_2198736 | Ga0451853_2198736_667_1599 | 310 |
| 1378 | 3300041512 | Ga0451853_2516453 | Ga0451853_2516453_36_968 | 310 |
| 1379 | 3300046460 | Ga0495638_0000475 | Ga0495638_0000475_4622_5554 | 310 |
| 1380 | 3300046522 | Ga0495643_0059573 | Ga0495643_0059573_676_1608 | 310 |
| 1381 | 3300046542 | Ga0495597_0018419 | Ga0495597_0018419_1531_2463 | 310 |
| 1382 | 3300048919 | Ga0496116_0009436 | Ga0496116_0009436_5547_6479 | 310 |
| 1383 | 3300048921 | Ga0496118_0002068 | Ga0496118_0002068_6891_7823 | 310 |
| 1384 | 3300048924 | Ga0496121_0000239 | Ga0496121_0000239_112750_113682 | 310 |
| 1385 | 3300048926 | Ga0496123_0045546 | Ga0496123_0045546_1049_1981 | 310 |
| 1386 | 3300048927 | Ga0496124_0073085 | Ga0496124_0073085_894_1826 | 310 |
| 1387 | 3300048928 | Ga0496125_0010847 | Ga0496125_0010847_4855_5787 | 310 |
| 1388 | 3300049568 | Ga0501031_0013786 | Ga0501031_0013786_1049_2002 | 310 |
| 1389 | 3300049569 | Ga0501032_0167929 | Ga0501032_0167929_64_1017 | 310 |
| 1390 | 3300049569 | Ga0501032_0180722 | Ga0501032_0180722_437_1369 | 310 |
| 1391 | 3300049570 | Ga0501033_0010498 | Ga0501033_0010498_5056_6009 | 310 |
| 1392 | 3300049570 | Ga0501033_0050127 | Ga0501033_0050127_1526_2479 | 310 |
| 1393 | 3300049570 | Ga0501033_0236793 | Ga0501033_0236793_152_1084 | 310 |
| 1394 | 3300049571 | Ga0501034_0055207 | Ga0501034_0055207_2920_3873 | 310 |
| 1395 | 3300049571 | Ga0501034_0225363 | Ga0501034_0225363_236_1168 | 310 |
| 1396 | 3300049572 | Ga0501036_0173751 | Ga0501036_0173751_569_1501 | 310 |
| 1397 | 3300049573 | Ga0501037_0000107 | Ga0501037_0000107_24096_25049 | 310 |
| 1398 | 3300049573 | Ga0501037_0102109 | Ga0501037_0102109_85_1017 | 310 |
| 1399 | 3300049573 | Ga0501037_0201802 | Ga0501037_0201802_425_1378 | 310 |
| 1400 | 3300049574 | Ga0501038_0098912 | Ga0501038_0098912_1242_2174 | 310 |
| 1401 | 3300049574 | Ga0501038_0236680 | Ga0501038_0236680_405_1358 | 310 |
| 1402 | 3300049579 | Ga0501043_0000005 | Ga0501043_0000005_245701_246654 | 310 |
| 1403 | 3300049579 | Ga0501043_0042607 | Ga0501043_0042607_231_1163 | 310 |
| 1404 | 3300049579 | Ga0501043_0212931 | Ga0501043_0212931_514_1467 | 310 |
| 1405 | 3300049580 | Ga0501046_0182122 | Ga0501046_0182122_544_1497 | 310 |
| 1406 | 3300049580 | Ga0501046_0269625 | Ga0501046_0269625_239_1183 | 310 |
| 1407 | 3300049581 | Ga0501047_0024292 | Ga0501047_0024292_4047_5000 | 310 |
| 1408 | 3300049581 | Ga0501047_0025195 | Ga0501047_0025195_723_1676 | 310 |
| 1409 | 3300049581 | Ga0501047_0061392 | Ga0501047_0061392_765_1697 | 310 |
| 1410 | 3300049581 | Ga0501047_0091859 | Ga0501047_0091859_652_1605 | 310 |
| 1411 | 3300049585 | Ga0501069_0000033 | Ga0501069_0000033_83667_84620 | 310 |
| 1412 | 3300049585 | Ga0501069_0059776 | Ga0501069_0059776_640_1593 | 310 |
| 1413 | 3300049586 | Ga0501070_0000739 | Ga0501070_0000739_18097_19050 | 310 |
| 1414 | 3300049586 | Ga0501070_0000913 | Ga0501070_0000913_475_1428 | 310 |
| 1415 | 3300049586 | Ga0501070_0052204 | Ga0501070_0052204_1268_2221 | 310 |
| 1416 | 3300049586 | Ga0501070_0062213 | Ga0501070_0062213_1840_2793 | 310 |
| 1417 | 3300049587 | Ga0501071_0217626 | Ga0501071_0217626_447_1400 | 310 |
| 1418 | 3300049589 | Ga0501073_0060391 | Ga0501073_0060391_768_1721 | 310 |
| 1419 | 3300049589 | Ga0501073_0093108 | Ga0501073_0093108_62_1015 | 310 |
| 1420 | 3300049590 | Ga0501074_0000571 | Ga0501074_0000571_14016_14969 | 310 |
| 1421 | 3300049590 | Ga0501074_0076350 | Ga0501074_0076350_1043_1996 | 310 |
| 1422 | 3300049742 | Ga0501080_0001237 | Ga0501080_0001237_16206_17159 | 310 |
| 1423 | 3300049742 | Ga0501080_0017171 | Ga0501080_0017171_5168_6121 | 310 |
| 1424 | 3300049742 | Ga0501080_0145255 | Ga0501080_0145255_701_1654 | 310 |
| 1425 | 3300049744 | Ga0501083_0000355 | Ga0501083_0000355_3425_4378 | 310 |
| 1426 | 3300049744 | Ga0501083_0028777 | Ga0501083_0028777_1598_2530 | 310 |
| 1427 | 3300049822 | Ga0501035_0000086 | Ga0501035_0000086_107012_107965 | 310 |
| 1428 | 3300049822 | Ga0501035_0009526 | Ga0501035_0009526_4455_5408 | 310 |
| 1429 | 3300049822 | Ga0501035_0083516 | Ga0501035_0083516_306_1259 | 310 |
| 1430 | 3300049822 | Ga0501035_0098834 | Ga0501035_0098834_1545_2498 | 310 |
| 1431 | 3300049822 | Ga0501035_0169890 | Ga0501035_0169890_812_1744 | 310 |
| 1432 | 3300049823 | Ga0501044_0000223 | Ga0501044_0000223_37969_38922 | 310 |
| 1433 | 3300049823 | Ga0501044_0014960 | Ga0501044_0014960_3194_4147 | 310 |
| 1434 | 3300049823 | Ga0501044_0015139 | Ga0501044_0015139_1907_2860 | 310 |
| 1435 | 3300049823 | Ga0501044_0031354 | Ga0501044_0031354_1769_2722 | 310 |
| 1436 | 3300049823 | Ga0501044_0114589 | Ga0501044_0114589_387_1319 | 310 |
| 1437 | 3300049823 | Ga0501044_0375135 | Ga0501044_0375135_284_1237 | 310 |
| 1438 | 3300050489 | nmdc:mga03683_117211_c1 | nmdc:mga03683_117211_c1_171_1130 | 310 |
| 1439 | 3300050491 | nmdc:mga00v17_14_c1 | nmdc:mga00v17_14_c1_104153_105085 | 310 |
| 1440 | 3300050494 | nmdc:mga06z11_20882_c2 | nmdc:mga06z11_20882_c2_982_1944 | 310 |
| 1441 | 3300050511 | nmdc:mga08y16_1044_c1 | nmdc:mga08y16_1044_c1_11719_12663 | 310 |
| 1442 | 3300050515 | nmdc:mga0a205_377792_c1 | nmdc:mga0a205_377792_c1_300_1244 | 310 |
| 1443 | 3300053134 | Ga0500658_0002498 | Ga0500658_0002498_6146_7078 | 310 |
| 1444 | 3300053146 | Ga0500588_0017792 | Ga0500588_0017792_336_1286 | 310 |
| 1445 | 3300053153 | Ga0500616_0000472 | Ga0500616_0000472_8461_9393 | 310 |
| 1446 | 3300053161 | Ga0500634_0000507 | Ga0500634_0000507_10255_11187 | 310 |
| 1447 | 3300053730 | Ga0500645_007944 | Ga0500645_007944_2093_3067 | 310 |
| 1448 | 3300059421 | Ga0590071_013079 | Ga0590071_013079_48_992 | 310 |
| 1449 | 3300060353 | Ga0501082_0034523 | Ga0501082_0034523_2978_3910 | 310 |
| 1450 | iso_pu_bacteria | 2738543013 | 2739248455 | 310 |
| 1451 | iso_pu_bacteria | 2758568016 | 2758637828 | 310 |
| 1452 | iso_pu_bacteria | 2894817345 | 2894822087 | 310 |
| 1453 | iso_pu_bacteria | 8054563764 | 8054567186 | 310 |
| 1454 | 3300001979 | JGI24740J21852_10000111 | JGI24740J21852_1000011121 | 311 |
| 1455 | 3300002737 | JGI25162J39368_1000794 | JGI25162J39368_10007943 | 311 |
| 1456 | 3300003214 | JGI25165J46597_1000018 | JGI25165J46597_1000018152 | 311 |
| 1457 | 3300003856 | Ga0058692_1020804 | Ga0058692_10208041 | 311 |
| 1458 | 3300005336 | Ga0070680_100450075 | Ga0070680_1004500751 | 311 |
| 1459 | 3300005549 | Ga0070704_100528500 | Ga0070704_1005285001 | 311 |
| 1460 | 3300005614 | Ga0068856_100002246 | Ga0068856_10000224614 | 311 |
| 1461 | 3300006353 | Ga0075370_10009575 | Ga0075370_100095754 | 311 |
| 1462 | 3300006847 | Ga0075431_100015726 | Ga0075431_1000157264 | 311 |
| 1463 | 3300009094 | Ga0111539_10104109 | Ga0111539_101041092 | 311 |
| 1464 | 3300009147 | Ga0114129_10604603 | Ga0114129_106046031 | 311 |
| 1465 | 3300013308 | Ga0157375_10296110 | Ga0157375_102961102 | 311 |
| 1466 | 3300025233 | Ga0209437_100022 | Ga0209437_100022213 | 311 |
| 1467 | 3300025261 | Ga0209233_1000031 | Ga0209233_1000031213 | 311 |
| 1468 | 3300027312 | Ga0209371_1004784 | Ga0209371_10047844 | 311 |
| 1469 | 3300030500 | Ga0268256_1004561 | Ga0268256_10045614 | 311 |
| 1470 | 3300042004 | Ga0439445_0025023 | Ga0439445_0025023_314_1249 | 311 |
| 1471 | 3300044656 | Ga0466969_0071730 | Ga0466969_0071730_414_1373 | 311 |
| 1472 | 3300045051 | Ga0451576_0007753 | Ga0451576_0007753_2601_3548 | 311 |
| 1473 | 3300045836 | Ga0466958_0082323 | Ga0466958_0082323_558_1517 | 311 |
| 1474 | 3300045976 | Ga0466967_0144164 | Ga0466967_0144164_335_1270 | 311 |
| 1475 | 3300048903 | Ga0496100_0194589 | Ga0496100_0194589_277_1287 | 311 |
| 1476 | 3300048918 | Ga0496115_0131086 | Ga0496115_0131086_932_1888 | 311 |
| 1477 | 3300048925 | Ga0496122_0010146 | Ga0496122_0010146_880_1839 | 311 |
| 1478 | 3300048926 | Ga0496123_0155976 | Ga0496123_0155976_126_1085 | 311 |
| 1479 | 3300048928 | Ga0496125_0000145 | Ga0496125_0000145_61490_62449 | 311 |
| 1480 | 3300049586 | Ga0501070_0087003 | Ga0501070_0087003_303_1247 | 311 |
| 1481 | 3300049590 | Ga0501074_0064696 | Ga0501074_0064696_359_1306 | 311 |
| 1482 | 3300049590 | Ga0501074_0191368 | Ga0501074_0191368_482_1426 | 311 |
| 1483 | 3300049593 | Ga0501077_0114122 | Ga0501077_0114122_423_1370 | 311 |
| 1484 | 3300049741 | Ga0501079_0018396 | Ga0501079_0018396_3171_4118 | 311 |
| 1485 | 3300049744 | Ga0501083_0006285 | Ga0501083_0006285_713_1657 | 311 |
| 1486 | 3300049824 | Ga0501045_0224309 | Ga0501045_0224309_195_1142 | 311 |
| 1487 | 3300050509 | nmdc:mga0qj67_107510_c1 | nmdc:mga0qj67_107510_c1_1031_1981 | 311 |
| 1488 | 3300050511 | nmdc:mga08y16_676473_c1 | nmdc:mga08y16_676473_c1_65_1021 | 311 |
| 1489 | 3300050511 | nmdc:mga08y16_76334_c1 | nmdc:mga08y16_76334_c1_2070_3083 | 311 |
| 1490 | 3300050515 | nmdc:mga0a205_134935_c1 | nmdc:mga0a205_134935_c1_230_1186 | 311 |
| 1491 | 3300053153 | Ga0500616_0038335 | Ga0500616_0038335_116_1069 | 311 |
| 1492 | 3300060353 | Ga0501082_0032114 | Ga0501082_0032114_852_1796 | 311 |
| 1493 | 3300060353 | Ga0501082_0084199 | Ga0501082_0084199_621_1568 | 311 |
| 1494 | 3300061734 | Ga0530510_0023194 | Ga0530510_0023194_2544_3491 | 311 |
| 1495 | iso_pu_bacteria | 2842333319 | 2842337383 | 311 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
127
338
0.9
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cad-assembly1.cif.gz_A | mycobacterium smegmatis sugabc complex | 0.8036 | 22 | 298 |
| 7cad-assembly1.cif.gz_A | mycobacterium smegmatis sugabc complex | 0.7854 | 22 | 298 |
| 8hpl-assembly1.cif.gz_A | lpqy-sugabc in state 1 | 0.7798 | 22 | 299 |
| 4xtc-assembly1.cif.gz_M | crystal structure of bacterial alginate abc transporter in complex with alginate pentasaccharide-bound periplasmic protein | 0.775 | 24 | 302 |
| 4tqv-assembly4.cif.gz_M | crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate | 0.7734 | 14 | 304 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71896_49_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8149 | 62 | 303 | 1.10.3720.10 |
| af_O53484_49_294_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8114 | 62 | 305 | 1.10.3720.10 |
| af_P71896_49_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8055 | 62 | 303 | 1.10.3720.10 |
| af_O53484_49_294_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8026 | 62 | 305 | 1.10.3720.10 |
| af_I6XFF3_60_302_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7993 | 62 | 302 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6X1C5-F1-model_v4 | Sugar ABC transporter permease | 0.8543 | 22 | 239 |
GO:0005886
GO:0055085 |
| AF-A0A4Q3MWV4-F1-model_v4 | deleted | 0.8525 | 14 | 231 |
|
| AF-A0A4Q3MWV4-F1-model_v4 | deleted | 0.8421 | 14 | 231 |
|
| AF-A0A7C5CYE7-F1-model_v4 | Sugar ABC transporter permease | 0.8407 | 20 | 303 |
GO:0005886
GO:0055085 |
| AF-A0A7J3WCB2-F1-model_v4 | Sugar ABC transporter permease | 0.8395 | 18 | 309 |
GO:0005886
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar