F494358
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1494 | 660 | 1292 | 310 |
Family's Representative Sequence
| Representative Sequence | 3300006173|Ga0070716_100093962|Ga0070716_1000939623 |
| Length | 358 |
| Sequence | MTDASFAHENVITRPGPNRIAGNKPLLRLITSPKAQSRAEGEFVMSDHDHHDEGNGISRRRVLECMTWAGTGVLWTVTGGVPHSLGMVGSAQAAEATGMTFLQISDSHVGFDKPANPNALGTLEEAINKVRAMPAKPSFMIHTGDITHLSKAQEFDDAERIISQAKLDVHYVPGEHDIIDEEIKLYKERYGRGTKGGGWYSFDAGGVHFVGLVNVANLKGGGLGSLGNDQLEWLEDDLKGKSKSTPVVLFAHIPLWTVYPQWGWGTEDGARALDYVKGFGSVTVLNGHIHQVMQKVEGNVTFHTARSTAFPQPAPGTAXXXGPMKVEDAKLRSLLGVASINFKQNNQPLAIIDTPLQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 10 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 11 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 12 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 13 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 14 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 15 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 16 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 17 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 18 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 19 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 20 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 21 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 22 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 23 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 24 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 25 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 26 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 27 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 28 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 29 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 30 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 31 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 32 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 33 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 34 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 35 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 36 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 37 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 38 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 39 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 40 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 41 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 42 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 43 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 44 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 45 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 46 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 47 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 48 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 49 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 50 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 51 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 52 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 53 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 54 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 55 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 56 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 57 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 58 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 59 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 60 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 61 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 62 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 63 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 64 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 65 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 66 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 67 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 68 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 69 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 70 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 71 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 72 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 73 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 74 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 75 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 76 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 77 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 78 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 79 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 80 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 81 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 82 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 83 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 84 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 85 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 86 | 2904699407 | |||
| 87 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 88 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 89 | 2906610324 | |||
| 90 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 91 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 92 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 93 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 94 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 95 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 96 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 97 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 98 | 2922368715 | |||
| 99 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 100 | 2922425934 | |||
| 101 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 102 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 103 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 104 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 105 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 106 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 107 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 108 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 109 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 110 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 111 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 112 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 113 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 114 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 115 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 116 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 117 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 118 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 119 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 120 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 121 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 122 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 123 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 124 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 125 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 126 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 127 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 128 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 129 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 130 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 131 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 132 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 133 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 134 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 135 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 136 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 137 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 138 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 139 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 140 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 141 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 142 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 143 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 144 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 145 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 146 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 147 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 148 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 149 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 150 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 151 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 152 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 153 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 154 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 155 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 156 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 157 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 158 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 159 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 160 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 161 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 162 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 163 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 164 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 165 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 166 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 167 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 168 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 169 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 170 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 171 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 172 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 173 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 174 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 175 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 176 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 177 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 178 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 180 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 181 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 183 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 184 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 185 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 186 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 188 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 189 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 195 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 198 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 200 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 201 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 202 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 209 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 210 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 211 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 212 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 214 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 215 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 216 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 217 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 221 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 223 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 224 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 225 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 227 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 228 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 229 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 230 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 231 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 232 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 233 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 234 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 235 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 236 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 237 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 238 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 239 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 240 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 241 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 242 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 243 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 244 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 245 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 246 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 247 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 248 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 249 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 250 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 251 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 252 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 253 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 254 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 255 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 256 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 257 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 259 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 260 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 261 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 262 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 263 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 265 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 266 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 268 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 269 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 270 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 271 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 272 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 273 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 274 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 275 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 276 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 277 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 278 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 279 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 280 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 281 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 282 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 283 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 284 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 285 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 286 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 287 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 288 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 289 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 290 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 291 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 292 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 293 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 294 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 295 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 296 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 297 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 298 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 299 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 300 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 301 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 302 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 360 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 361 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 362 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 363 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 366 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 367 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 371 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 372 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 373 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 374 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 375 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 376 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 377 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 378 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 379 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 380 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 382 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 383 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 384 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 385 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 386 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 387 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 388 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 389 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 390 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 391 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 392 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 393 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 394 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 395 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 396 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 397 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 398 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 399 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 400 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 401 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 402 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 403 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 404 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 405 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 406 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 407 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 408 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 409 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 410 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 411 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 412 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 413 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 414 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 415 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 416 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 417 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 418 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 419 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 420 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 421 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 422 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 423 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 424 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 425 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 426 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 427 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 428 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 429 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 430 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 431 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 432 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 433 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 434 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 435 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 436 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 437 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 438 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 439 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 440 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 441 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 442 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 443 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 444 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 445 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 446 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 447 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 448 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 449 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 450 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 451 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 530 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 531 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 532 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 533 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 534 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 535 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 536 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 537 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 538 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 539 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 540 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 541 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 542 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 543 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 544 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 545 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 546 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 547 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 548 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 549 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 550 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 551 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 552 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 553 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 554 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 555 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 557 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 558 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 559 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 560 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 561 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 562 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 563 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 564 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 565 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 566 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 567 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 568 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 569 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 570 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 571 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 572 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 573 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 574 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 575 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 576 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 577 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 578 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 579 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 580 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 581 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 582 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 583 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 584 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 585 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 586 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 587 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 590 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 593 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 594 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 595 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 596 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 597 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 598 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 599 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 600 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 601 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 602 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 603 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 604 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 605 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 606 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 607 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 608 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 609 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 610 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 611 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 612 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 613 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 614 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 615 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 616 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 617 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 618 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 619 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 620 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 621 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 622 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 623 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 624 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 625 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 626 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 627 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 628 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 629 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 630 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 631 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 632 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 633 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 634 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 635 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 636 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 637 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 638 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 639 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 640 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 641 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 642 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 643 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 644 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 645 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 646 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 647 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 648 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 649 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 650 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 651 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 652 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 653 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 654 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 655 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 656 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 657 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 658 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 659 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 660 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.58 |
| Metatranscriptomes | 0.13 |
| Isolates | 13.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.11 |
| Nodule | 10.98 |
| Rhizoplane | 8.23 |
| Rhizosphere | 62.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10012885 | 3300002077 | Bacteria | 1689 |
| 2 | JGI25406J46586_10000034 | 3300003203 | Bacteria | 64645 |
| 3 | JGI25165J46597_1005127 | 3300003214 | Bacteria | 2597 |
| 4 | JGI25153J46596_10001825 | 3300003215 | Bacteria | 12626 |
| 5 | JGI25153J46596_10003306 | 3300003215 | Bacteria | 9060 |
| 6 | JGI25153J46596_10003323 | 3300003215 | Bacteria | 9041 |
| 7 | JGI25153J46596_10017828 | 3300003215 | Bacteria | 2780 |
| 8 | JGI25160J50197_1001067 | 3300003354 | Bacteria | 14062 |
| 9 | JGI25160J50197_1003948 | 3300003354 | Bacteria | 6482 |
| 10 | Ga0055524_1038225 | 3300003775 | Bacteria | 1259 |
| 11 | Ga0055531_10007248 | 3300003794 | Bacteria | 6093 |
| 12 | Ga0065165_1001751 | 3300005262 | Bacteria | 21612 |
| 13 | Ga0065165_1002727 | 3300005262 | Bacteria | 14113 |
| 14 | Ga0065165_1007687 | 3300005262 | Bacteria | 5226 |
| 15 | Ga0065712_10090736 | 3300005290 | Bacteria | 2406 |
| 16 | Ga0070658_10006356 | 3300005327 | Bacteria | 9576 |
| 17 | Ga0070683_100011551 | 3300005329 | Bacteria | 7642 |
| 18 | Ga0070683_100151988 | 3300005329 | Bacteria | 2195 |
| 19 | Ga0070683_100179425 | 3300005329 | Bacteria | 2010 |
| 20 | Ga0070690_100067718 | 3300005330 | Bacteria | 2314 |
| 21 | Ga0070690_100230714 | 3300005330 | Bacteria | 1301 |
| 22 | Ga0070670_100019180 | 3300005331 | Bacteria | 5865 |
| 23 | Ga0068869_100040310 | 3300005334 | Bacteria | 3339 |
| 24 | Ga0070680_100003194 | 3300005336 | Bacteria | 12183 |
| 25 | Ga0070680_100026227 | 3300005336 | Bacteria | 4660 |
| 26 | Ga0070682_100192145 | 3300005337 | Bacteria | 1434 |
| 27 | Ga0068868_100003369 | 3300005338 | Bacteria | 11116 |
| 28 | Ga0068868_100323848 | 3300005338 | Bacteria | 1313 |
| 29 | Ga0070660_100119547 | 3300005339 | Bacteria | 2102 |
| 30 | Ga0070689_100228857 | 3300005340 | Bacteria | 1527 |
| 31 | Ga0070691_10055502 | 3300005341 | Bacteria | 1898 |
| 32 | Ga0070691_10152793 | 3300005341 | Bacteria | 1185 |
| 33 | Ga0070661_100126323 | 3300005344 | Bacteria | 1919 |
| 34 | Ga0070668_100048502 | 3300005347 | Bacteria | 3266 |
| 35 | Ga0070668_100335271 | 3300005347 | Bacteria | 1276 |
| 36 | Ga0070671_100001331 | 3300005355 | Bacteria | 18540 |
| 37 | Ga0070671_100108912 | 3300005355 | Bacteria | 2326 |
| 38 | Ga0070671_100123457 | 3300005355 | Bacteria | 2180 |
| 39 | Ga0070671_100231660 | 3300005355 | Bacteria | 1567 |
| 40 | Ga0070674_100418330 | 3300005356 | Bacteria | 1099 |
| 41 | Ga0070673_100001163 | 3300005364 | Bacteria | 15102 |
| 42 | Ga0070688_100009486 | 3300005365 | Bacteria | 5325 |
| 43 | Ga0070659_100035456 | 3300005366 | Bacteria | 3885 |
| 44 | Ga0070659_100171629 | 3300005366 | Bacteria | 1777 |
| 45 | Ga0070667_100224514 | 3300005367 | Bacteria | 1673 |
| 46 | Ga0070709_10000980 | 3300005434 | Bacteria | 15831 |
| 47 | Ga0070709_10012949 | 3300005434 | Bacteria | 4678 |
| 48 | Ga0070709_10023800 | 3300005434 | Bacteria | 3601 |
| 49 | Ga0070709_10285123 | 3300005434 | Bacteria | 1202 |
| 50 | Ga0070714_100009105 | 3300005435 | Bacteria | 7789 |
| 51 | Ga0070714_100028817 | 3300005435 | Bacteria | 4610 |
| 52 | Ga0070714_100074625 | 3300005435 | Bacteria | 2941 |
| 53 | Ga0070714_100168229 | 3300005435 | Bacteria | 1988 |
| 54 | Ga0070714_100204543 | 3300005435 | Bacteria | 1807 |
| 55 | Ga0070714_100430093 | 3300005435 | Bacteria | 1251 |
| 56 | Ga0070713_100016044 | 3300005436 | Bacteria | 5624 |
| 57 | Ga0070713_100019667 | 3300005436 | Bacteria | 5164 |
| 58 | Ga0070713_100104854 | 3300005436 | Bacteria | 2455 |
| 59 | Ga0070713_100437403 | 3300005436 | Bacteria | 1226 |
| 60 | Ga0070710_10001038 | 3300005437 | Bacteria | 13188 |
| 61 | Ga0070710_10336147 | 3300005437 | Bacteria | 996 |
| 62 | Ga0070701_10041569 | 3300005438 | Bacteria | 2343 |
| 63 | Ga0070701_10097009 | 3300005438 | Bacteria | 1626 |
| 64 | Ga0070711_100031068 | 3300005439 | Bacteria | 3542 |
| 65 | Ga0070711_100210234 | 3300005439 | Bacteria | 1506 |
| 66 | Ga0070711_100342022 | 3300005439 | Bacteria | 1201 |
| 67 | Ga0070705_100160119 | 3300005440 | Bacteria | 1504 |
| 68 | Ga0070708_100430775 | 3300005445 | Bacteria | 1244 |
| 69 | Ga0070663_100007575 | 3300005455 | Bacteria | 6620 |
| 70 | Ga0070663_100071340 | 3300005455 | Bacteria | 2527 |
| 71 | Ga0070663_100108146 | 3300005455 | Bacteria | 2085 |
| 72 | Ga0070663_100274661 | 3300005455 | Bacteria | 1341 |
| 73 | Ga0070678_100034207 | 3300005456 | Bacteria | 3537 |
| 74 | Ga0070678_100075509 | 3300005456 | Bacteria | 2536 |
| 75 | Ga0070662_100014566 | 3300005457 | Bacteria | 5257 |
| 76 | Ga0070681_10076110 | 3300005458 | Bacteria | 3315 |
| 77 | Ga0070681_10141744 | 3300005458 | Bacteria | 2333 |
| 78 | Ga0070685_10079820 | 3300005466 | Bacteria | 1959 |
| 79 | Ga0070706_100093672 | 3300005467 | Bacteria | 2787 |
| 80 | Ga0070706_100422434 | 3300005467 | Bacteria | 1241 |
| 81 | Ga0070706_100504310 | 3300005467 | Bacteria | 1126 |
| 82 | Ga0070706_100519681 | 3300005467 | Bacteria | 1107 |
| 83 | Ga0070698_100117349 | 3300005471 | Bacteria | 2623 |
| 84 | Ga0070698_100378137 | 3300005471 | Bacteria | 1349 |
| 85 | Ga0070699_100020399 | 3300005518 | Bacteria | 5716 |
| 86 | Ga0070699_100115865 | 3300005518 | Bacteria | 2355 |
| 87 | Ga0070679_100003933 | 3300005530 | Bacteria | 13668 |
| 88 | Ga0070679_100005873 | 3300005530 | Bacteria | 11399 |
| 89 | Ga0070679_100030562 | 3300005530 | Bacteria | 5317 |
| 90 | Ga0070679_100512987 | 3300005530 | Bacteria | 1143 |
| 91 | Ga0070684_100004390 | 3300005535 | Bacteria | 10725 |
| 92 | Ga0070684_100102059 | 3300005535 | Bacteria | 2564 |
| 93 | Ga0068853_100061235 | 3300005539 | Bacteria | 3255 |
| 94 | Ga0068853_100097378 | 3300005539 | Bacteria | 2597 |
| 95 | Ga0068853_100308793 | 3300005539 | Bacteria | 1464 |
| 96 | Ga0068853_100568835 | 3300005539 | Bacteria | 1075 |
| 97 | Ga0070686_100120031 | 3300005544 | Bacteria | 1804 |
| 98 | Ga0070686_100121701 | 3300005544 | Bacteria | 1793 |
| 99 | Ga0070696_100104082 | 3300005546 | Bacteria | 2038 |
| 100 | Ga0070693_100092290 | 3300005547 | Bacteria | 1828 |
| 101 | Ga0070693_100224641 | 3300005547 | Bacteria | 1232 |
| 102 | Ga0070665_100018182 | 3300005548 | Bacteria | 7051 |
| 103 | Ga0070665_100089220 | 3300005548 | Bacteria | 3089 |
| 104 | Ga0068855_100040685 | 3300005563 | Bacteria | 5515 |
| 105 | Ga0068855_100109595 | 3300005563 | Bacteria | 3170 |
| 106 | Ga0068855_100151421 | 3300005563 | Bacteria | 2637 |
| 107 | Ga0068855_100153219 | 3300005563 | Bacteria | 2620 |
| 108 | Ga0068855_100492094 | 3300005563 | Bacteria | 1334 |
| 109 | Ga0068855_100514364 | 3300005563 | Bacteria | 1299 |
| 110 | Ga0070664_100067330 | 3300005564 | Bacteria | 3061 |
| 111 | Ga0070664_100112833 | 3300005564 | Bacteria | 2374 |
| 112 | Ga0070664_100174708 | 3300005564 | Bacteria | 1907 |
| 113 | Ga0070664_100402500 | 3300005564 | Bacteria | 1252 |
| 114 | Ga0068857_100004623 | 3300005577 | Bacteria | 11662 |
| 115 | Ga0068857_100183234 | 3300005577 | Bacteria | 1906 |
| 116 | Ga0068857_100285856 | 3300005577 | Bacteria | 1518 |
| 117 | Ga0068857_100340982 | 3300005577 | Bacteria | 1386 |
| 118 | Ga0068854_100356583 | 3300005578 | Bacteria | 1199 |
| 119 | Ga0068856_100000061 | 3300005614 | Bacteria | 100823 |
| 120 | Ga0068856_100164062 | 3300005614 | Bacteria | 2233 |
| 121 | Ga0068856_100385102 | 3300005614 | Bacteria | 1422 |
| 122 | Ga0070702_100145231 | 3300005615 | Bacteria | 1516 |
| 123 | Ga0068852_100057914 | 3300005616 | Bacteria | 3354 |
| 124 | Ga0068852_100062101 | 3300005616 | Bacteria | 3248 |
| 125 | Ga0068852_100154357 | 3300005616 | Bacteria | 2137 |
| 126 | Ga0068864_100032645 | 3300005618 | Bacteria | 4424 |
| 127 | Ga0068864_100052894 | 3300005618 | Bacteria | 3501 |
| 128 | Ga0068861_100080957 | 3300005719 | Bacteria | 2541 |
| 129 | Ga0068851_10013394 | 3300005834 | Bacteria | 3882 |
| 130 | Ga0068863_100209360 | 3300005841 | Bacteria | 1877 |
| 131 | Ga0068858_100129319 | 3300005842 | Bacteria | 2367 |
| 132 | Ga0068860_100000081 | 3300005843 | Bacteria | 170066 |
| 133 | Ga0068862_100320378 | 3300005844 | Bacteria | 1431 |
| 134 | Ga0081455_10007949 | 3300005937 | Bacteria | 11092 |
| 135 | Ga0081455_10009007 | 3300005937 | Bacteria | 10306 |
| 136 | Ga0081455_10044794 | 3300005937 | Bacteria | 3855 |
| 137 | Ga0081540_1002071 | 3300005983 | Bacteria | 16719 |
| 138 | Ga0081540_1005540 | 3300005983 | Bacteria | 9406 |
| 139 | Ga0081540_1011941 | 3300005983 | Bacteria | 5763 |
| 140 | Ga0081540_1016188 | 3300005983 | Bacteria | 4681 |
| 141 | Ga0081540_1051986 | 3300005983 | Bacteria | 2021 |
| 142 | Ga0081539_10000113 | 3300005985 | Bacteria | 189418 |
| 143 | Ga0081539_10041150 | 3300005985 | Bacteria | 2705 |
| 144 | Ga0070717_10000208 | 3300006028 | Bacteria | 41212 |
| 145 | Ga0070717_10066392 | 3300006028 | Bacteria | 3000 |
| 146 | Ga0070717_10068036 | 3300006028 | Bacteria | 2964 |
| 147 | Ga0075365_10004575 | 3300006038 | Bacteria | 7356 |
| 148 | Ga0075365_10014013 | 3300006038 | Bacteria | 4814 |
| 149 | Ga0075365_10021525 | 3300006038 | Bacteria | 4024 |
| 150 | Ga0075365_10024117 | 3300006038 | Bacteria | 3833 |
| 151 | Ga0075365_10049600 | 3300006038 | Bacteria | 2766 |
| 152 | Ga0075365_10054563 | 3300006038 | Bacteria | 2650 |
| 153 | Ga0075365_10152188 | 3300006038 | Bacteria | 1609 |
| 154 | Ga0075365_10208039 | 3300006038 | Bacteria | 1371 |
| 155 | Ga0075363_100003841 | 3300006048 | Bacteria | 6476 |
| 156 | Ga0075363_100055194 | 3300006048 | Bacteria | 2127 |
| 157 | Ga0075363_100133035 | 3300006048 | Bacteria | 1396 |
| 158 | Ga0075364_10019920 | 3300006051 | Bacteria | 4215 |
| 159 | Ga0075364_10034720 | 3300006051 | Bacteria | 3256 |
| 160 | Ga0075364_10039910 | 3300006051 | Bacteria | 3044 |
| 161 | Ga0075364_10158324 | 3300006051 | Bacteria | 1528 |
| 162 | Ga0075364_10173534 | 3300006051 | Bacteria | 1457 |
| 163 | Ga0070715_10065594 | 3300006163 | Bacteria | 1607 |
| 164 | Ga0070715_10172285 | 3300006163 | Bacteria | 1079 |
| 165 | Ga0070716_100093962 | 3300006173 | Bacteria | 1822 |
| 166 | Ga0070716_100099943 | 3300006173 | Bacteria | 1776 |
| 167 | Ga0070716_100103910 | 3300006173 | Bacteria | 1748 |
| 168 | Ga0070716_100123649 | 3300006173 | Bacteria | 1624 |
| 169 | Ga0070712_100135046 | 3300006175 | Bacteria | 1875 |
| 170 | Ga0070712_100151972 | 3300006175 | Bacteria | 1778 |
| 171 | Ga0070712_100180661 | 3300006175 | Bacteria | 1644 |
| 172 | Ga0070712_100256228 | 3300006175 | Bacteria | 1400 |
| 173 | Ga0070712_100333482 | 3300006175 | Bacteria | 1237 |
| 174 | Ga0075362_10039864 | 3300006177 | Bacteria | 2067 |
| 175 | Ga0075367_10005056 | 3300006178 | Bacteria | 6505 |
| 176 | Ga0075367_10059371 | 3300006178 | Bacteria | 2277 |
| 177 | Ga0075367_10157837 | 3300006178 | Bacteria | 1410 |
| 178 | Ga0075369_10022794 | 3300006186 | Bacteria | 2585 |
| 179 | Ga0075369_10037577 | 3300006186 | Bacteria | 2063 |
| 180 | Ga0075369_10087865 | 3300006186 | Bacteria | 1385 |
| 181 | Ga0075366_10022697 | 3300006195 | Bacteria | 3653 |
| 182 | Ga0075370_10021974 | 3300006353 | Bacteria | 3498 |
| 183 | Ga0075370_10105120 | 3300006353 | Bacteria | 1636 |
| 184 | Ga0068871_100244303 | 3300006358 | Bacteria | 1562 |
| 185 | Ga0068871_100252316 | 3300006358 | Bacteria | 1537 |
| 186 | Ga0068871_100394270 | 3300006358 | Bacteria | 1232 |
| 187 | Ga0075428_100022167 | 3300006844 | Bacteria | 7031 |
| 188 | Ga0075428_100026465 | 3300006844 | Bacteria | 6421 |
| 189 | Ga0075428_100079610 | 3300006844 | Bacteria | 3576 |
| 190 | Ga0075428_100267586 | 3300006844 | Bacteria | 1839 |
| 191 | Ga0075430_100004132 | 3300006846 | Bacteria | 12251 |
| 192 | Ga0075431_100080863 | 3300006847 | Bacteria | 3355 |
| 193 | Ga0075431_100264386 | 3300006847 | Bacteria | 1745 |
| 194 | Ga0075433_10154365 | 3300006852 | Bacteria | 2042 |
| 195 | Ga0075434_100001874 | 3300006871 | Bacteria | 18197 |
| 196 | Ga0075434_100054546 | 3300006871 | Bacteria | 3970 |
| 197 | Ga0075434_100103424 | 3300006871 | Bacteria | 2856 |
| 198 | Ga0075434_100104565 | 3300006871 | Bacteria | 2841 |
| 199 | Ga0075434_100170360 | 3300006871 | Bacteria | 2197 |
| 200 | Ga0075434_100170865 | 3300006871 | Bacteria | 2194 |
| 201 | Ga0075429_100007719 | 3300006880 | Bacteria | 9338 |
| 202 | Ga0075429_100103107 | 3300006880 | Bacteria | 2491 |
| 203 | Ga0075436_100005587 | 3300006914 | Bacteria | 8632 |
| 204 | Ga0097620_100348056 | 3300006931 | Bacteria | 1577 |
| 205 | Ga0099824_1008208 | 3300006942 | Bacteria | 13453 |
| 206 | Ga0099824_1029023 | 3300006942 | Bacteria | 2417 |
| 207 | Ga0099822_1019170 | 3300006943 | Bacteria | 7010 |
| 208 | Ga0075435_100075883 | 3300007076 | Bacteria | 2754 |
| 209 | Ga0075435_100200593 | 3300007076 | Bacteria | 1690 |
| 210 | Ga0099795_10011722 | 3300007788 | Bacteria | 2633 |
| 211 | Ga0099795_10044907 | 3300007788 | Bacteria | 1587 |
| 212 | Ga0099795_10069235 | 3300007788 | Bacteria | 1328 |
| 213 | Ga0105240_10006945 | 3300009093 | Bacteria | 16535 |
| 214 | Ga0105240_10074116 | 3300009093 | Bacteria | 4202 |
| 215 | Ga0105240_10322270 | 3300009093 | Bacteria | 1761 |
| 216 | Ga0105240_10630473 | 3300009093 | Bacteria | 1177 |
| 217 | Ga0111539_10019857 | 3300009094 | Bacteria | 8279 |
| 218 | Ga0111539_10048617 | 3300009094 | Bacteria | 5063 |
| 219 | Ga0111539_10131557 | 3300009094 | Bacteria | 2930 |
| 220 | Ga0111539_10182131 | 3300009094 | Bacteria | 2453 |
| 221 | Ga0111539_10198631 | 3300009094 | Bacteria | 2339 |
| 222 | Ga0105245_10041292 | 3300009098 | Bacteria | 4112 |
| 223 | Ga0105245_10042042 | 3300009098 | Bacteria | 4076 |
| 224 | Ga0105245_10061269 | 3300009098 | Bacteria | 3391 |
| 225 | Ga0105245_10374432 | 3300009098 | Bacteria | 1416 |
| 226 | Ga0105245_10583035 | 3300009098 | Bacteria | 1143 |
| 227 | Ga0105247_10059860 | 3300009101 | Bacteria | 2359 |
| 228 | Ga0114129_10008567 | 3300009147 | Bacteria | 14580 |
| 229 | Ga0114129_10042174 | 3300009147 | Bacteria | 6426 |
| 230 | Ga0114129_10042454 | 3300009147 | Bacteria | 6404 |
| 231 | Ga0114129_10185593 | 3300009147 | Bacteria | 2827 |
| 232 | Ga0114129_10265232 | 3300009147 | Bacteria | 2300 |
| 233 | Ga0114129_10346200 | 3300009147 | Bacteria | 1970 |
| 234 | Ga0105242_10203400 | 3300009176 | Bacteria | 1760 |
| 235 | Ga0105242_10313825 | 3300009176 | Bacteria | 1435 |
| 236 | Ga0105248_10026351 | 3300009177 | Bacteria | 6466 |
| 237 | Ga0105248_10038782 | 3300009177 | Bacteria | 5333 |
| 238 | Ga0105248_10194247 | 3300009177 | Bacteria | 2287 |
| 239 | Ga0105237_10008888 | 3300009545 | Bacteria | 10825 |
| 240 | Ga0105237_10017912 | 3300009545 | Bacteria | 7341 |
| 241 | Ga0105237_10059562 | 3300009545 | Bacteria | 3820 |
| 242 | Ga0105237_10090951 | 3300009545 | Bacteria | 3041 |
| 243 | Ga0105237_10207419 | 3300009545 | Bacteria | 1960 |
| 244 | Ga0105238_10005132 | 3300009551 | Bacteria | 12943 |
| 245 | Ga0105238_10009886 | 3300009551 | Bacteria | 9562 |
| 246 | Ga0105238_10254680 | 3300009551 | Bacteria | 1734 |
| 247 | Ga0105249_10390340 | 3300009553 | Bacteria | 1420 |
| 248 | Ga0099796_10002743 | 3300010159 | Bacteria | 3945 |
| 249 | Ga0099796_10032738 | 3300010159 | Bacteria | 1706 |
| 250 | Ga0099796_10044171 | 3300010159 | Bacteria | 1521 |
| 251 | Ga0099796_10083612 | 3300010159 | Bacteria | 1175 |
| 252 | Ga0105239_10012274 | 3300010375 | Bacteria | 9542 |
| 253 | Ga0105239_10028563 | 3300010375 | Bacteria | 6132 |
| 254 | Ga0105246_10021797 | 3300011119 | Bacteria | 4127 |
| 255 | Ga0105246_10132191 | 3300011119 | Bacteria | 1865 |
| 256 | Ga0105246_10146800 | 3300011119 | Bacteria | 1781 |
| 257 | Ga0157370_10008947 | 3300013104 | Bacteria | 10757 |
| 258 | Ga0157370_10181189 | 3300013104 | Bacteria | 1957 |
| 259 | Ga0157369_10007421 | 3300013105 | Bacteria | 12626 |
| 260 | Ga0157369_10049936 | 3300013105 | Bacteria | 4532 |
| 261 | Ga0157369_10104121 | 3300013105 | Bacteria | 3023 |
| 262 | Ga0157369_10120105 | 3300013105 | Bacteria | 2789 |
| 263 | Ga0157378_10009553 | 3300013297 | Bacteria | 8447 |
| 264 | Ga0157378_10043596 | 3300013297 | Bacteria | 3984 |
| 265 | Ga0157378_10054478 | 3300013297 | Bacteria | 3561 |
| 266 | Ga0157378_10228615 | 3300013297 | Bacteria | 1771 |
| 267 | Ga0163162_10068601 | 3300013306 | Bacteria | 3598 |
| 268 | Ga0163162_10137069 | 3300013306 | Bacteria | 2559 |
| 269 | Ga0163162_10149195 | 3300013306 | Bacteria | 2455 |
| 270 | Ga0163162_10206620 | 3300013306 | Bacteria | 2093 |
| 271 | Ga0163162_10223672 | 3300013306 | Bacteria | 2012 |
| 272 | Ga0163162_10658319 | 3300013306 | Bacteria | 1171 |
| 273 | Ga0157372_10065655 | 3300013307 | Bacteria | 4075 |
| 274 | Ga0157372_10144333 | 3300013307 | Bacteria | 2745 |
| 275 | Ga0157372_10167444 | 3300013307 | Bacteria | 2542 |
| 276 | Ga0157372_10366476 | 3300013307 | Bacteria | 1679 |
| 277 | Ga0157375_10117297 | 3300013308 | Bacteria | 2767 |
| 278 | Ga0157375_10264780 | 3300013308 | Bacteria | 1880 |
| 279 | Ga0157375_10358192 | 3300013308 | Bacteria | 1625 |
| 280 | Ga0157375_10381399 | 3300013308 | Bacteria | 1576 |
| 281 | Ga0163163_10004545 | 3300014325 | Bacteria | 11850 |
| 282 | Ga0163163_10013378 | 3300014325 | Bacteria | 7511 |
| 283 | Ga0163163_10020333 | 3300014325 | Bacteria | 6250 |
| 284 | Ga0163163_10037933 | 3300014325 | Bacteria | 4691 |
| 285 | Ga0163163_10496919 | 3300014325 | Bacteria | 1282 |
| 286 | Ga0157380_10106128 | 3300014326 | Bacteria | 2350 |
| 287 | Ga0182008_10015082 | 3300014497 | Bacteria | 4040 |
| 288 | Ga0157376_10105040 | 3300014969 | Bacteria | 2476 |
| 289 | Ga0157376_10194684 | 3300014969 | Bacteria | 1861 |
| 290 | Ga0157376_10275313 | 3300014969 | Bacteria | 1583 |
| 291 | Ga0182006_1090949 | 3300015261 | Bacteria | 1098 |
| 292 | Ga0206354_10772337 | 3300020081 | Bacteria | 1107 |
| 293 | Ga0213872_10068362 | 3300021361 | Bacteria | 1603 |
| 294 | Ga0213874_10003010 | 3300021377 | Bacteria | 3695 |
| 295 | Ga0213874_10010728 | 3300021377 | Bacteria | 2301 |
| 296 | Ga0213876_10001034 | 3300021384 | Bacteria | 17966 |
| 297 | Ga0213876_10001237 | 3300021384 | Bacteria | 16109 |
| 298 | Ga0213876_10003065 | 3300021384 | Bacteria | 9662 |
| 299 | Ga0213875_10000053 | 3300021388 | Bacteria | 141791 |
| 300 | Ga0213875_10000902 | 3300021388 | Bacteria | 21584 |
| 301 | Ga0213875_10010291 | 3300021388 | Bacteria | 4686 |
| 302 | Ga0213875_10037778 | 3300021388 | Bacteria | 2275 |
| 303 | Ga0209563_102501 | 3300025230 | Bacteria | 4134 |
| 304 | Ga0207425_1030064 | 3300025245 | Bacteria | 1091 |
| 305 | Ga0209677_100210 | 3300025253 | Bacteria | 44738 |
| 306 | Ga0209677_105160 | 3300025253 | Bacteria | 3496 |
| 307 | Ga0209148_1000180 | 3300025254 | Bacteria | 124830 |
| 308 | Ga0209148_1000530 | 3300025254 | Bacteria | 37591 |
| 309 | Ga0209233_1001530 | 3300025261 | Bacteria | 9065 |
| 310 | Ga0209455_1000326 | 3300025272 | Bacteria | 46230 |
| 311 | Ga0209455_1008006 | 3300025272 | Bacteria | 2921 |
| 312 | Ga0209564_1009757 | 3300025295 | Bacteria | 4516 |
| 313 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 314 | Ga0209758_1001429 | 3300025297 | Bacteria | 28224 |
| 315 | Ga0209758_1001880 | 3300025297 | Bacteria | 22994 |
| 316 | Ga0209758_1004591 | 3300025297 | Bacteria | 11369 |
| 317 | Ga0209758_1011390 | 3300025297 | Bacteria | 5158 |
| 318 | Ga0209758_1013435 | 3300025297 | Bacteria | 4463 |
| 319 | Ga0209256_1006181 | 3300025299 | Bacteria | 6463 |
| 320 | Ga0209256_1032783 | 3300025299 | Bacteria | 1405 |
| 321 | Ga0207426_1000429 | 3300025302 | Bacteria | 68612 |
| 322 | Ga0207426_1000620 | 3300025302 | Bacteria | 45305 |
| 323 | Ga0207426_1019649 | 3300025302 | Bacteria | 2358 |
| 324 | Ga0209257_1002014 | 3300025304 | Bacteria | 21724 |
| 325 | Ga0209257_1040647 | 3300025304 | Bacteria | 1386 |
| 326 | Ga0207653_10037063 | 3300025885 | Bacteria | 1590 |
| 327 | Ga0207692_10001278 | 3300025898 | Bacteria | 9337 |
| 328 | Ga0207692_10030503 | 3300025898 | Bacteria | 2572 |
| 329 | Ga0207642_10030124 | 3300025899 | Bacteria | 2256 |
| 330 | Ga0207710_10086027 | 3300025900 | Bacteria | 1465 |
| 331 | Ga0207688_10084804 | 3300025901 | Bacteria | 1814 |
| 332 | Ga0207647_10008887 | 3300025904 | Bacteria | 7164 |
| 333 | Ga0207647_10099068 | 3300025904 | Bacteria | 1731 |
| 334 | Ga0207685_10002938 | 3300025905 | Bacteria | 4033 |
| 335 | Ga0207685_10041009 | 3300025905 | Bacteria | 1729 |
| 336 | Ga0207699_10011463 | 3300025906 | Bacteria | 4478 |
| 337 | Ga0207699_10021454 | 3300025906 | Bacteria | 3481 |
| 338 | Ga0207699_10022022 | 3300025906 | Bacteria | 3447 |
| 339 | Ga0207699_10034223 | 3300025906 | Bacteria | 2879 |
| 340 | Ga0207699_10051062 | 3300025906 | Bacteria | 2442 |
| 341 | Ga0207705_10022855 | 3300025909 | Bacteria | 4458 |
| 342 | Ga0207705_10037077 | 3300025909 | Bacteria | 3489 |
| 343 | Ga0207705_10086970 | 3300025909 | Bacteria | 2285 |
| 344 | Ga0207684_10168751 | 3300025910 | Bacteria | 1886 |
| 345 | Ga0207654_10164089 | 3300025911 | Bacteria | 1437 |
| 346 | Ga0207654_10289648 | 3300025911 | Bacteria | 1110 |
| 347 | Ga0207707_10001229 | 3300025912 | Bacteria | 24021 |
| 348 | Ga0207707_10048060 | 3300025912 | Bacteria | 3717 |
| 349 | Ga0207707_10142145 | 3300025912 | Bacteria | 2098 |
| 350 | Ga0207707_10287256 | 3300025912 | Bacteria | 1423 |
| 351 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 352 | Ga0207695_10025044 | 3300025913 | Bacteria | 6692 |
| 353 | Ga0207695_10029844 | 3300025913 | Bacteria | 6016 |
| 354 | Ga0207695_10054668 | 3300025913 | Bacteria | 4167 |
| 355 | Ga0207695_10106569 | 3300025913 | Bacteria | 2789 |
| 356 | Ga0207671_10008749 | 3300025914 | Bacteria | 8531 |
| 357 | Ga0207671_10020103 | 3300025914 | Bacteria | 5091 |
| 358 | Ga0207671_10132031 | 3300025914 | Bacteria | 1917 |
| 359 | Ga0207693_10006620 | 3300025915 | Bacteria | 9572 |
| 360 | Ga0207693_10013341 | 3300025915 | Bacteria | 6624 |
| 361 | Ga0207693_10054488 | 3300025915 | Bacteria | 3137 |
| 362 | Ga0207693_10088878 | 3300025915 | Bacteria | 2421 |
| 363 | Ga0207693_10097479 | 3300025915 | Bacteria | 2305 |
| 364 | Ga0207693_10131365 | 3300025915 | Bacteria | 1969 |
| 365 | Ga0207693_10223237 | 3300025915 | Bacteria | 1480 |
| 366 | Ga0207663_10033274 | 3300025916 | Bacteria | 3069 |
| 367 | Ga0207663_10047065 | 3300025916 | Bacteria | 2661 |
| 368 | Ga0207663_10200181 | 3300025916 | Bacteria | 1440 |
| 369 | Ga0207663_10294988 | 3300025916 | Bacteria | 1209 |
| 370 | Ga0207660_10044712 | 3300025917 | Bacteria | 3116 |
| 371 | Ga0207657_10000658 | 3300025919 | Bacteria | 36762 |
| 372 | Ga0207657_10041142 | 3300025919 | Bacteria | 4088 |
| 373 | Ga0207657_10138605 | 3300025919 | Bacteria | 1989 |
| 374 | Ga0207652_10003041 | 3300025921 | Bacteria | 13986 |
| 375 | Ga0207681_10037411 | 3300025923 | Bacteria | 3207 |
| 376 | Ga0207681_10351236 | 3300025923 | Bacteria | 1180 |
| 377 | Ga0207694_10058318 | 3300025924 | Bacteria | 3003 |
| 378 | Ga0207694_10164711 | 3300025924 | Bacteria | 1792 |
| 379 | Ga0207694_10195723 | 3300025924 | Bacteria | 1643 |
| 380 | Ga0207650_10019497 | 3300025925 | Bacteria | 4767 |
| 381 | Ga0207650_10048647 | 3300025925 | Bacteria | 3128 |
| 382 | Ga0207650_10050330 | 3300025925 | Bacteria | 3080 |
| 383 | Ga0207650_10131962 | 3300025925 | Bacteria | 1956 |
| 384 | Ga0207687_10008249 | 3300025927 | Bacteria | 6815 |
| 385 | Ga0207687_10034015 | 3300025927 | Bacteria | 3459 |
| 386 | Ga0207687_10163940 | 3300025927 | Bacteria | 1708 |
| 387 | Ga0207700_10002188 | 3300025928 | Bacteria | 11212 |
| 388 | Ga0207700_10003970 | 3300025928 | Bacteria | 8655 |
| 389 | Ga0207700_10022181 | 3300025928 | Bacteria | 4351 |
| 390 | Ga0207700_10026454 | 3300025928 | Bacteria | 4045 |
| 391 | Ga0207700_10055560 | 3300025928 | Bacteria | 2977 |
| 392 | Ga0207700_10078191 | 3300025928 | Bacteria | 2573 |
| 393 | Ga0207700_10118403 | 3300025928 | Bacteria | 2143 |
| 394 | Ga0207700_10185390 | 3300025928 | Bacteria | 1745 |
| 395 | Ga0207664_10004931 | 3300025929 | Bacteria | 9075 |
| 396 | Ga0207664_10043388 | 3300025929 | Bacteria | 3516 |
| 397 | Ga0207664_10062949 | 3300025929 | Bacteria | 2964 |
| 398 | Ga0207664_10067320 | 3300025929 | Bacteria | 2874 |
| 399 | Ga0207664_10256089 | 3300025929 | Bacteria | 1529 |
| 400 | Ga0207664_10377598 | 3300025929 | Bacteria | 1258 |
| 401 | Ga0207644_10000779 | 3300025931 | Bacteria | 20223 |
| 402 | Ga0207644_10045790 | 3300025931 | Bacteria | 3113 |
| 403 | Ga0207690_10089000 | 3300025932 | Bacteria | 2176 |
| 404 | Ga0207690_10095851 | 3300025932 | Bacteria | 2108 |
| 405 | Ga0207690_10240626 | 3300025932 | Bacteria | 1394 |
| 406 | Ga0207690_10305323 | 3300025932 | Bacteria | 1246 |
| 407 | Ga0207706_10027569 | 3300025933 | Bacteria | 5078 |
| 408 | Ga0207706_10044372 | 3300025933 | Bacteria | 3940 |
| 409 | Ga0207706_10060204 | 3300025933 | Bacteria | 3344 |
| 410 | Ga0207686_10069432 | 3300025934 | Bacteria | 2260 |
| 411 | Ga0207686_10190464 | 3300025934 | Bacteria | 1462 |
| 412 | Ga0207709_10041045 | 3300025935 | Bacteria | 2774 |
| 413 | Ga0207670_10021834 | 3300025936 | Bacteria | 3956 |
| 414 | Ga0207669_10120499 | 3300025937 | Bacteria | 1780 |
| 415 | Ga0207704_10016603 | 3300025938 | Bacteria | 3788 |
| 416 | Ga0207665_10017817 | 3300025939 | Bacteria | 4668 |
| 417 | Ga0207665_10028857 | 3300025939 | Bacteria | 3668 |
| 418 | Ga0207665_10057788 | 3300025939 | Bacteria | 2621 |
| 419 | Ga0207665_10087106 | 3300025939 | Bacteria | 2158 |
| 420 | Ga0207665_10096918 | 3300025939 | Bacteria | 2052 |
| 421 | Ga0207691_10103559 | 3300025940 | Bacteria | 2538 |
| 422 | Ga0207691_10295307 | 3300025940 | Bacteria | 1393 |
| 423 | Ga0207711_10088461 | 3300025941 | Bacteria | 2719 |
| 424 | Ga0207711_10163587 | 3300025941 | Bacteria | 2016 |
| 425 | Ga0207711_10290566 | 3300025941 | Bacteria | 1507 |
| 426 | Ga0207711_10316412 | 3300025941 | Bacteria | 1441 |
| 427 | Ga0207689_10045378 | 3300025942 | Bacteria | 3634 |
| 428 | Ga0207661_10002064 | 3300025944 | Bacteria | 13826 |
| 429 | Ga0207661_10002496 | 3300025944 | Bacteria | 12664 |
| 430 | Ga0207661_10032605 | 3300025944 | Bacteria | 4037 |
| 431 | Ga0207661_10139786 | 3300025944 | Bacteria | 2083 |
| 432 | Ga0207661_10149598 | 3300025944 | Bacteria | 2017 |
| 433 | Ga0207661_10201337 | 3300025944 | Bacteria | 1751 |
| 434 | Ga0207679_10073592 | 3300025945 | Bacteria | 2586 |
| 435 | Ga0207667_10018061 | 3300025949 | Bacteria | 7921 |
| 436 | Ga0207667_10076602 | 3300025949 | Bacteria | 3470 |
| 437 | Ga0207667_10112938 | 3300025949 | Bacteria | 2801 |
| 438 | Ga0207651_10008556 | 3300025960 | Bacteria | 5534 |
| 439 | Ga0207651_10161943 | 3300025960 | Bacteria | 1755 |
| 440 | Ga0207651_10262647 | 3300025960 | Bacteria | 1418 |
| 441 | Ga0207651_10338732 | 3300025960 | Bacteria | 1263 |
| 442 | Ga0207712_10133922 | 3300025961 | Bacteria | 1893 |
| 443 | Ga0207668_10075709 | 3300025972 | Bacteria | 2420 |
| 444 | Ga0207658_10080461 | 3300025986 | Bacteria | 2496 |
| 445 | Ga0207658_10137296 | 3300025986 | Bacteria | 1974 |
| 446 | Ga0207677_10028736 | 3300026023 | Bacteria | 3523 |
| 447 | Ga0207677_10055826 | 3300026023 | Bacteria | 2703 |
| 448 | Ga0207703_10034858 | 3300026035 | Bacteria | 3996 |
| 449 | Ga0207703_10083894 | 3300026035 | Bacteria | 2663 |
| 450 | Ga0207703_10087184 | 3300026035 | Bacteria | 2617 |
| 451 | Ga0207639_10185542 | 3300026041 | Bacteria | 1773 |
| 452 | Ga0207678_10048395 | 3300026067 | Bacteria | 3675 |
| 453 | Ga0207678_10055777 | 3300026067 | Bacteria | 3403 |
| 454 | Ga0207678_10068174 | 3300026067 | Bacteria | 3053 |
| 455 | Ga0207678_10177795 | 3300026067 | Bacteria | 1817 |
| 456 | Ga0207708_10097594 | 3300026075 | Bacteria | 2271 |
| 457 | Ga0207702_10000674 | 3300026078 | Bacteria | 37110 |
| 458 | Ga0207702_10221582 | 3300026078 | Bacteria | 1763 |
| 459 | Ga0207641_10102640 | 3300026088 | Bacteria | 2522 |
| 460 | Ga0207641_10359235 | 3300026088 | Bacteria | 1390 |
| 461 | Ga0207648_10277847 | 3300026089 | Bacteria | 1497 |
| 462 | Ga0207648_10310033 | 3300026089 | Bacteria | 1417 |
| 463 | Ga0207676_10073278 | 3300026095 | Bacteria | 2755 |
| 464 | Ga0207676_10320361 | 3300026095 | Bacteria | 1423 |
| 465 | Ga0207676_10639524 | 3300026095 | Bacteria | 1025 |
| 466 | Ga0207674_10052044 | 3300026116 | Bacteria | 4177 |
| 467 | Ga0207674_10434963 | 3300026116 | Bacteria | 1268 |
| 468 | Ga0207675_100028015 | 3300026118 | Bacteria | 5245 |
| 469 | Ga0207675_100053074 | 3300026118 | Bacteria | 3783 |
| 470 | Ga0207675_100261455 | 3300026118 | Bacteria | 1677 |
| 471 | Ga0207683_10021252 | 3300026121 | Bacteria | 5554 |
| 472 | Ga0207683_10080288 | 3300026121 | Bacteria | 2893 |
| 473 | Ga0207683_10312436 | 3300026121 | Bacteria | 1439 |
| 474 | Ga0207683_10407319 | 3300026121 | Bacteria | 1251 |
| 475 | Ga0207683_10409288 | 3300026121 | Bacteria | 1248 |
| 476 | Ga0207698_10070805 | 3300026142 | Bacteria | 2764 |
| 477 | Ga0207698_10247337 | 3300026142 | Bacteria | 1629 |
| 478 | Ga0207698_10404606 | 3300026142 | Bacteria | 1305 |
| 479 | Ga0209389_1000001 | 3300027296 | Bacteria | 463799 |
| 480 | Ga0209389_1000134 | 3300027296 | Bacteria | 65168 |
| 481 | Ga0209589_1000014 | 3300027357 | Bacteria | 227996 |
| 482 | Ga0209589_1000033 | 3300027357 | Bacteria | 140561 |
| 483 | Ga0209489_100014 | 3300027361 | Bacteria | 227996 |
| 484 | Ga0209489_100040 | 3300027361 | Bacteria | 164986 |
| 485 | Ga0209700_100007 | 3300027363 | Bacteria | 454608 |
| 486 | Ga0209700_100024 | 3300027363 | Bacteria | 227996 |
| 487 | Ga0209179_1001581 | 3300027512 | Bacteria | 2838 |
| 488 | Ga0209179_1001865 | 3300027512 | Bacteria | 2712 |
| 489 | Ga0209179_1004953 | 3300027512 | Bacteria | 2050 |
| 490 | Ga0209588_1000977 | 3300027671 | Bacteria | 7339 |
| 491 | Ga0207428_10000141 | 3300027907 | Bacteria | 97064 |
| 492 | Ga0207428_10111008 | 3300027907 | Bacteria | 2110 |
| 493 | Ga0207428_10119708 | 3300027907 | Bacteria | 2020 |
| 494 | Ga0207428_10146560 | 3300027907 | Bacteria | 1799 |
| 495 | Ga0265357_1001321 | 3300028023 | Bacteria | 1790 |
| 496 | Ga0268266_10003344 | 3300028379 | Bacteria | 16058 |
| 497 | Ga0268266_10054100 | 3300028379 | Bacteria | 3450 |
| 498 | Ga0268266_10070883 | 3300028379 | Bacteria | 3020 |
| 499 | Ga0268266_10079189 | 3300028379 | Bacteria | 2860 |
| 500 | Ga0268265_10383608 | 3300028380 | Bacteria | 1293 |
| 501 | Ga0268264_10000048 | 3300028381 | Bacteria | 334457 |
| 502 | Ga0268264_10764044 | 3300028381 | Bacteria | 964 |
| 503 | Ga0265337_1000412 | 3300028556 | Bacteria | 22867 |
| 504 | Ga0265337_1012788 | 3300028556 | Bacteria | 2839 |
| 505 | Ga0265326_10003400 | 3300028558 | Bacteria | 5215 |
| 506 | Ga0265319_1014589 | 3300028563 | Bacteria | 3078 |
| 507 | Ga0265334_10004112 | 3300028573 | Bacteria | 6519 |
| 508 | Ga0265318_10076934 | 3300028577 | Bacteria | 1234 |
| 509 | Ga0265323_10004703 | 3300028653 | Bacteria | 5853 |
| 510 | Ga0265336_10001567 | 3300028666 | Bacteria | 10262 |
| 511 | Ga0307517_10104672 | 3300028786 | Bacteria | 2202 |
| 512 | Ga0265338_10000034 | 3300028800 | Bacteria | 244623 |
| 513 | Ga0265338_10011933 | 3300028800 | Bacteria | 9965 |
| 514 | Ga0265338_10073271 | 3300028800 | Bacteria | 2920 |
| 515 | Ga0265324_10006370 | 3300029957 | Bacteria | 4930 |
| 516 | Ga0265760_10020199 | 3300031090 | Bacteria | 1922 |
| 517 | Ga0265330_10031043 | 3300031235 | Bacteria | 2395 |
| 518 | Ga0265332_10001857 | 3300031238 | Bacteria | 11220 |
| 519 | Ga0265332_10046951 | 3300031238 | Bacteria | 1859 |
| 520 | Ga0265328_10000014 | 3300031239 | Bacteria | 151076 |
| 521 | Ga0265328_10011006 | 3300031239 | Bacteria | 3626 |
| 522 | Ga0265325_10010015 | 3300031241 | Bacteria | 5507 |
| 523 | Ga0265325_10011514 | 3300031241 | Bacteria | 5080 |
| 524 | Ga0265325_10013213 | 3300031241 | Bacteria | 4705 |
| 525 | Ga0265325_10013606 | 3300031241 | Bacteria | 4625 |
| 526 | Ga0265325_10022776 | 3300031241 | Bacteria | 3427 |
| 527 | Ga0265329_10007587 | 3300031242 | Bacteria | 4183 |
| 528 | Ga0265340_10006014 | 3300031247 | Bacteria | 6702 |
| 529 | Ga0265340_10029731 | 3300031247 | Bacteria | 2744 |
| 530 | Ga0265340_10080349 | 3300031247 | Bacteria | 1536 |
| 531 | Ga0265339_10000205 | 3300031249 | Bacteria | 48438 |
| 532 | Ga0265339_10003091 | 3300031249 | Bacteria | 11711 |
| 533 | Ga0265339_10005140 | 3300031249 | Bacteria | 8777 |
| 534 | Ga0265339_10063362 | 3300031249 | Bacteria | 1985 |
| 535 | Ga0265331_10003191 | 3300031250 | Bacteria | 10704 |
| 536 | Ga0265331_10007501 | 3300031250 | Bacteria | 6306 |
| 537 | Ga0265331_10024905 | 3300031250 | Bacteria | 3023 |
| 538 | Ga0265316_10249737 | 3300031344 | Bacteria | 1303 |
| 539 | Ga0307509_10363690 | 3300031507 | Bacteria | 1165 |
| 540 | Ga0265313_10000353 | 3300031595 | Bacteria | 50100 |
| 541 | Ga0265313_10008687 | 3300031595 | Bacteria | 6716 |
| 542 | Ga0307508_10000032 | 3300031616 | Bacteria | 163293 |
| 543 | Ga0307508_10211078 | 3300031616 | Bacteria | 1542 |
| 544 | Ga0265314_10003716 | 3300031711 | Bacteria | 14613 |
| 545 | Ga0265314_10005447 | 3300031711 | Bacteria | 11490 |
| 546 | Ga0265314_10111227 | 3300031711 | Bacteria | 1740 |
| 547 | Ga0265342_10000092 | 3300031712 | Bacteria | 99040 |
| 548 | Ga0265342_10000417 | 3300031712 | Bacteria | 46743 |
| 549 | Ga0307516_10024278 | 3300031730 | Bacteria | 6194 |
| 550 | Ga0307516_10059573 | 3300031730 | Bacteria | 3713 |
| 551 | Ga0307412_10199216 | 3300031911 | Bacteria | 1519 |
| 552 | Ga0307507_10048107 | 3300033179 | Bacteria | 4154 |
| 553 | Ga0307510_10003449 | 3300033180 | Bacteria | 18439 |
| 554 | Ga0307510_10019865 | 3300033180 | Bacteria | 7868 |
| 555 | Ga0307510_10094526 | 3300033180 | Bacteria | 2814 |
| 556 | Ga0373948_0026685 | 3300034817 | Bacteria | 1140 |
| 557 | Ga0373959_0011219 | 3300034820 | Bacteria | 1579 |
| 558 | Ga0373926_0046762 | 3300035083 | Bacteria | 1553 |
| 559 | Ga0373929_0005008 | 3300035085 | Bacteria | 2379 |
| 560 | Ga0373934_0013184 | 3300035086 | Bacteria | 3122 |
| 561 | Ga0373934_0017217 | 3300035086 | Bacteria | 2756 |
| 562 | Ga0373934_0062699 | 3300035086 | Bacteria | 1482 |
| 563 | Ga0373944_0009808 | 3300035089 | Bacteria | 2603 |
| 564 | Ga0373944_0025007 | 3300035089 | Bacteria | 1755 |
| 565 | Ga0373951_0048896 | 3300035091 | Bacteria | 1037 |
| 566 | Ga0373923_0006563 | 3300035111 | Bacteria | 4030 |
| 567 | Ga0373923_0019915 | 3300035111 | Bacteria | 2602 |
| 568 | Ga0373932_0010303 | 3300035112 | Bacteria | 2260 |
| 569 | Ga0373936_0015788 | 3300035113 | Bacteria | 2897 |
| 570 | Ga0373936_0016211 | 3300035113 | Bacteria | 2865 |
| 571 | Ga0373936_0019424 | 3300035113 | Bacteria | 2633 |
| 572 | Ga0373945_0024554 | 3300035116 | Bacteria | 2089 |
| 573 | Ga0373945_0030588 | 3300035116 | Bacteria | 1898 |
| 574 | Ga0373945_0031487 | 3300035116 | Bacteria | 1874 |
| 575 | Ga0373945_0051348 | 3300035116 | Bacteria | 1517 |
| 576 | Ga0373953_0094954 | 3300035117 | Bacteria | 1250 |
| 577 | Ga0373954_0002403 | 3300035118 | Bacteria | 7844 |
| 578 | Ga0373954_0040850 | 3300035118 | Bacteria | 2162 |
| 579 | Ga0373956_0016342 | 3300035119 | Bacteria | 3116 |
| 580 | Ga0373956_0032843 | 3300035119 | Bacteria | 2279 |
| 581 | Ga0373956_0111027 | 3300035119 | Bacteria | 1276 |
| 582 | Ga0373957_0004788 | 3300035120 | Bacteria | 4145 |
| 583 | Ga0373943_0003753 | 3300035170 | Bacteria | 6905 |
| 584 | Ga0373943_0008120 | 3300035170 | Bacteria | 4708 |
| 585 | Ga0373943_0011869 | 3300035170 | Bacteria | 3920 |
| 586 | Ga0373943_0072054 | 3300035170 | Bacteria | 1752 |
| 587 | Ga0373943_0082205 | 3300035170 | Bacteria | 1653 |
| 588 | Ga0373946_0003292 | 3300035171 | Bacteria | 5739 |
| 589 | Ga0373946_0009193 | 3300035171 | Bacteria | 3635 |
| 590 | Ga0373946_0085654 | 3300035171 | Bacteria | 1387 |
| 591 | Ga0373946_0095151 | 3300035171 | Bacteria | 1326 |
| 592 | Ga0373955_0011024 | 3300035172 | Bacteria | 4292 |
| 593 | Ga0373955_0014829 | 3300035172 | Bacteria | 3802 |
| 594 | Ga0373955_0035254 | 3300035172 | Bacteria | 2649 |
| 595 | Ga0373955_0066836 | 3300035172 | Bacteria | 1999 |
| 596 | Ga0373955_0147015 | 3300035172 | Bacteria | 1385 |
| 597 | Ga0373955_0269791 | 3300035172 | Bacteria | 1022 |
| 598 | Ga0373942_0025301 | 3300035207 | Bacteria | 1529 |
| 599 | Ga0373962_0045692 | 3300035242 | Bacteria | 1248 |
| 600 | Ga0373931_0006221 | 3300035691 | Bacteria | 5566 |
| 601 | Ga0373931_0120592 | 3300035691 | Bacteria | 1498 |
| 602 | Ga0373935_0007483 | 3300035692 | Bacteria | 6537 |
| 603 | Ga0373935_0014513 | 3300035692 | Bacteria | 4754 |
| 604 | Ga0373935_0022558 | 3300035692 | Bacteria | 3862 |
| 605 | Ga0373935_0024166 | 3300035692 | Bacteria | 3738 |
| 606 | Ga0373935_0031087 | 3300035692 | Bacteria | 3311 |
| 607 | Ga0373927_0000121 | 3300035695 | Bacteria | 59449 |
| 608 | Ga0373927_0017851 | 3300035695 | Bacteria | 4666 |
| 609 | Ga0373927_0018115 | 3300035695 | Bacteria | 4631 |
| 610 | Ga0373927_0028965 | 3300035695 | Bacteria | 3610 |
| 611 | Ga0373927_0033452 | 3300035695 | Bacteria | 3348 |
| 612 | Ga0373927_0061505 | 3300035695 | Bacteria | 2429 |
| 613 | Ga0373927_0130957 | 3300035695 | Bacteria | 1638 |
| 614 | Ga0373933_0000406 | 3300035724 | Bacteria | 27321 |
| 615 | Ga0373933_0006291 | 3300035724 | Bacteria | 6462 |
| 616 | Ga0373933_0016314 | 3300035724 | Bacteria | 4150 |
| 617 | Ga0373933_0026628 | 3300035724 | Bacteria | 3322 |
| 618 | Ga0373933_0041100 | 3300035724 | Bacteria | 2728 |
| 619 | Ga0373933_0281862 | 3300035724 | Bacteria | 1074 |
| 620 | Ga0373947_0002018 | 3300035725 | Bacteria | 12396 |
| 621 | Ga0373947_0012161 | 3300035725 | Bacteria | 4928 |
| 622 | Ga0373947_0061898 | 3300035725 | Bacteria | 2275 |
| 623 | Ga0373947_0081521 | 3300035725 | Bacteria | 2004 |
| 624 | Ga0373937_0007295 | 3300036401 | Bacteria | 9568 |
| 625 | Ga0373937_0015887 | 3300036401 | Bacteria | 6676 |
| 626 | Ga0373937_0035287 | 3300036401 | Bacteria | 4551 |
| 627 | Ga0373937_0039454 | 3300036401 | Bacteria | 4303 |
| 628 | Ga0373937_0061008 | 3300036401 | Bacteria | 3466 |
| 629 | Ga0373937_0068978 | 3300036401 | Bacteria | 3259 |
| 630 | Ga0373937_0101871 | 3300036401 | Bacteria | 2665 |
| 631 | Ga0373937_0174380 | 3300036401 | Bacteria | 2018 |
| 632 | Ga0373937_0184857 | 3300036401 | Bacteria | 1957 |
| 633 | Ga0373925_0002194 | 3300037068 | Bacteria | 15853 |
| 634 | Ga0373925_0009548 | 3300037068 | Bacteria | 7065 |
| 635 | Ga0373925_0040305 | 3300037068 | Bacteria | 3458 |
| 636 | Ga0373925_0120437 | 3300037068 | Bacteria | 2037 |
| 637 | Ga0373925_0120850 | 3300037068 | Bacteria | 2033 |
| 638 | Ga0373925_0161670 | 3300037068 | Bacteria | 1764 |
| 639 | Ga0373925_0162551 | 3300037068 | Bacteria | 1759 |
| 640 | Ga0373925_0192515 | 3300037068 | Bacteria | 1618 |
| 641 | Ga0373925_0414047 | 3300037068 | Bacteria | 1100 |
| 642 | Ga0395899_0015112 | 3300037312 | Bacteria | 5885 |
| 643 | Ga0395900_0000948 | 3300037418 | Bacteria | 37848 |
| 644 | Ga0395900_0023638 | 3300037418 | Bacteria | 6287 |
| 645 | Ga0395900_0159914 | 3300037418 | Bacteria | 2298 |
| 646 | Ga0395898_0045341 | 3300037466 | Bacteria | 4322 |
| 647 | Ga0395898_0060604 | 3300037466 | Bacteria | 3677 |
| 648 | Ga0395898_0070357 | 3300037466 | Bacteria | 3383 |
| 649 | Ga0395898_0078195 | 3300037466 | Bacteria | 3192 |
| 650 | Ga0395898_0081007 | 3300037466 | Bacteria | 3131 |
| 651 | Ga0395898_0191145 | 3300037466 | Bacteria | 1956 |
| 652 | Ga0395905_0004515 | 3300037471 | Bacteria | 14421 |
| 653 | Ga0436364_0158121 | 3300037853 | Bacteria | 2458 |
| 654 | Ga0436364_0231907 | 3300037853 | Bacteria | 3238 |
| 655 | Ga0436364_0288952 | 3300037853 | Bacteria | 32031 |
| 656 | Ga0436364_0335801 | 3300037853 | Bacteria | 1942 |
| 657 | Ga0436364_0346238 | 3300037853 | Bacteria | 35487 |
| 658 | Ga0436364_0806163 | 3300037853 | Bacteria | 3078 |
| 659 | Ga0436364_1223619 | 3300037853 | Bacteria | 3719 |
| 660 | Ga0436364_1517684 | 3300037853 | Bacteria | 3958 |
| 661 | Ga0395901_0011040 | 3300038443 | Bacteria | 9150 |
| 662 | Ga0395901_0020520 | 3300038443 | Bacteria | 6763 |
| 663 | Ga0395901_0109506 | 3300038443 | Bacteria | 2900 |
| 664 | Ga0395901_0239807 | 3300038443 | Bacteria | 1891 |
| 665 | Ga0395901_0312242 | 3300038443 | Bacteria | 1628 |
| 666 | Ga0395901_0528257 | 3300038443 | Bacteria | 1198 |
| 667 | Ga0436365_0947948 | 3300039437 | Bacteria | 2470 |
| 668 | Ga0436365_1308689 | 3300039437 | Bacteria | 1808 |
| 669 | Ga0436365_1382071 | 3300039437 | Bacteria | 38509 |
| 670 | Ga0436365_1685276 | 3300039437 | Bacteria | 10594 |
| 671 | Ga0436365_1835761 | 3300039437 | Bacteria | 36188 |
| 672 | Ga0436360_0904398 | 3300039438 | Bacteria | 1992 |
| 673 | Ga0436361_0458971 | 3300039447 | Bacteria | 1418 |
| 674 | Ga0436361_0774027 | 3300039447 | Bacteria | 8719 |
| 675 | Ga0436363_0276330 | 3300039450 | Bacteria | 1201 |
| 676 | Ga0436363_0362302 | 3300039450 | Bacteria | 4805 |
| 677 | Ga0436363_0688960 | 3300039450 | Bacteria | 1128 |
| 678 | Ga0436363_1051136 | 3300039450 | Bacteria | 2439 |
| 679 | Ga0436362_1193065 | 3300039453 | Bacteria | 3700 |
| 680 | Ga0451802_2171387 | 3300041460 | Bacteria | 1891 |
| 681 | Ga0451849_0905512 | 3300041505 | Bacteria | 1074 |
| 682 | Ga0451853_0987069 | 3300041512 | Bacteria | 1291 |
| 683 | Ga0439458_0035939 | 3300042157 | Bacteria | 1192 |
| 684 | Ga0466969_0015817 | 3300044656 | Bacteria | 3955 |
| 685 | Ga0466972_0001899 | 3300044658 | Bacteria | 10263 |
| 686 | Ga0466972_0010445 | 3300044658 | Bacteria | 4663 |
| 687 | Ga0466961_0000050 | 3300044693 | Bacteria | 71289 |
| 688 | Ga0466963_0010492 | 3300044694 | Bacteria | 5609 |
| 689 | Ga0466964_0073312 | 3300044706 | Bacteria | 1453 |
| 690 | Ga0466968_0033968 | 3300044735 | Bacteria | 2127 |
| 691 | Ga0466957_0098530 | 3300044842 | Bacteria | 1840 |
| 692 | Ga0466960_0088853 | 3300044901 | Bacteria | 1571 |
| 693 | Ga0466959_0005557 | 3300045049 | Bacteria | 8654 |
| 694 | Ga0466959_0368468 | 3300045049 | Bacteria | 978 |
| 695 | Ga0466967_0006446 | 3300045976 | Bacteria | 8303 |
| 696 | Ga0466967_0398633 | 3300045976 | Bacteria | 1338 |
| 697 | Ga0466967_0816272 | 3300045976 | Bacteria | 926 |
| 698 | Ga0495627_052975 | 3300046453 | Bacteria | 1216 |
| 699 | Ga0495592_0016464 | 3300046454 | Bacteria | 5610 |
| 700 | Ga0495592_0044107 | 3300046454 | Bacteria | 3333 |
| 701 | Ga0495592_0051867 | 3300046454 | Bacteria | 3047 |
| 702 | Ga0495592_0079743 | 3300046454 | Bacteria | 2369 |
| 703 | Ga0495592_0192931 | 3300046454 | Bacteria | 1379 |
| 704 | Ga0495603_0001782 | 3300046455 | Bacteria | 12698 |
| 705 | Ga0495603_0027225 | 3300046455 | Bacteria | 3450 |
| 706 | Ga0495603_0027453 | 3300046455 | Bacteria | 3436 |
| 707 | Ga0495603_0089164 | 3300046455 | Bacteria | 1804 |
| 708 | Ga0495603_0119435 | 3300046455 | Bacteria | 1536 |
| 709 | Ga0495603_0179421 | 3300046455 | Bacteria | 1225 |
| 710 | Ga0495603_0204880 | 3300046455 | Bacteria | 1140 |
| 711 | Ga0495603_0244089 | 3300046455 | Bacteria | 1034 |
| 712 | Ga0495629_0000242 | 3300046459 | Bacteria | 47556 |
| 713 | Ga0495629_0001610 | 3300046459 | Bacteria | 17737 |
| 714 | Ga0495629_0003645 | 3300046459 | Bacteria | 11646 |
| 715 | Ga0495629_0004164 | 3300046459 | Bacteria | 10856 |
| 716 | Ga0495629_0016212 | 3300046459 | Bacteria | 5349 |
| 717 | Ga0495629_0042588 | 3300046459 | Bacteria | 3190 |
| 718 | Ga0495629_0044721 | 3300046459 | Bacteria | 3107 |
| 719 | Ga0495638_0022384 | 3300046460 | Bacteria | 4149 |
| 720 | Ga0495638_0032269 | 3300046460 | Bacteria | 3359 |
| 721 | Ga0495641_0000994 | 3300046461 | Bacteria | 24305 |
| 722 | Ga0495641_0020070 | 3300046461 | Bacteria | 3399 |
| 723 | Ga0495641_0047082 | 3300046461 | Bacteria | 1980 |
| 724 | Ga0495651_0001287 | 3300046462 | Bacteria | 19450 |
| 725 | Ga0495651_0003779 | 3300046462 | Bacteria | 11580 |
| 726 | Ga0495651_0033843 | 3300046462 | Bacteria | 3985 |
| 727 | Ga0495651_0052110 | 3300046462 | Bacteria | 3152 |
| 728 | Ga0495651_0055504 | 3300046462 | Bacteria | 3043 |
| 729 | Ga0495653_0002060 | 3300046463 | Bacteria | 15803 |
| 730 | Ga0495653_0008912 | 3300046463 | Bacteria | 8203 |
| 731 | Ga0495653_0040572 | 3300046463 | Bacteria | 3637 |
| 732 | Ga0495580_0004514 | 3300046472 | Bacteria | 11688 |
| 733 | Ga0495580_0009026 | 3300046472 | Bacteria | 7872 |
| 734 | Ga0495580_0015783 | 3300046472 | Bacteria | 5690 |
| 735 | Ga0495582_0000268 | 3300046473 | Bacteria | 29098 |
| 736 | Ga0495582_0036962 | 3300046473 | Bacteria | 2686 |
| 737 | Ga0495582_0045575 | 3300046473 | Bacteria | 2415 |
| 738 | Ga0495582_0052564 | 3300046473 | Bacteria | 2246 |
| 739 | Ga0495582_0055744 | 3300046473 | Bacteria | 2178 |
| 740 | Ga0495639_0000157 | 3300046475 | Bacteria | 35000 |
| 741 | Ga0495639_0004971 | 3300046475 | Bacteria | 5703 |
| 742 | Ga0495639_0017148 | 3300046475 | Bacteria | 3145 |
| 743 | Ga0495639_0075581 | 3300046475 | Bacteria | 1562 |
| 744 | Ga0495662_0004509 | 3300046476 | Bacteria | 6984 |
| 745 | Ga0495662_0007644 | 3300046476 | Bacteria | 5332 |
| 746 | Ga0495662_0034815 | 3300046476 | Bacteria | 2431 |
| 747 | Ga0495662_0060984 | 3300046476 | Bacteria | 1822 |
| 748 | Ga0495664_0013015 | 3300046477 | Bacteria | 4716 |
| 749 | Ga0495664_0019517 | 3300046477 | Bacteria | 3898 |
| 750 | Ga0495664_0107218 | 3300046477 | Bacteria | 1685 |
| 751 | Ga0495664_0199603 | 3300046477 | Bacteria | 1212 |
| 752 | Ga0495584_0005529 | 3300046491 | Bacteria | 6690 |
| 753 | Ga0495584_0015148 | 3300046491 | Bacteria | 3927 |
| 754 | Ga0495584_0016934 | 3300046491 | Bacteria | 3714 |
| 755 | Ga0495584_0053845 | 3300046491 | Bacteria | 2025 |
| 756 | Ga0495584_0166798 | 3300046491 | Bacteria | 1119 |
| 757 | Ga0495584_0184903 | 3300046491 | Bacteria | 1059 |
| 758 | Ga0495585_0026524 | 3300046492 | Bacteria | 3310 |
| 759 | Ga0495585_0030890 | 3300046492 | Bacteria | 3045 |
| 760 | Ga0495585_0056176 | 3300046492 | Bacteria | 2175 |
| 761 | Ga0495585_0091017 | 3300046492 | Bacteria | 1643 |
| 762 | Ga0495594_0068333 | 3300046499 | Bacteria | 1973 |
| 763 | Ga0495596_0047198 | 3300046500 | Bacteria | 1690 |
| 764 | Ga0495607_0056662 | 3300046501 | Bacteria | 2249 |
| 765 | Ga0495607_0129517 | 3300046501 | Bacteria | 1315 |
| 766 | Ga0495606_0031897 | 3300046507 | Bacteria | 3657 |
| 767 | Ga0495606_0162853 | 3300046507 | Bacteria | 1300 |
| 768 | Ga0495606_0164021 | 3300046507 | Bacteria | 1294 |
| 769 | Ga0495608_0001118 | 3300046511 | Bacteria | 19026 |
| 770 | Ga0495608_0014419 | 3300046511 | Bacteria | 5483 |
| 771 | Ga0495608_0017348 | 3300046511 | Bacteria | 4980 |
| 772 | Ga0495608_0148244 | 3300046511 | Bacteria | 1496 |
| 773 | Ga0495610_0132880 | 3300046512 | Bacteria | 1079 |
| 774 | Ga0495616_0022264 | 3300046513 | Bacteria | 3423 |
| 775 | Ga0495618_0003470 | 3300046514 | Bacteria | 9794 |
| 776 | Ga0495618_0044691 | 3300046514 | Bacteria | 2794 |
| 777 | Ga0495618_0314335 | 3300046514 | Bacteria | 971 |
| 778 | Ga0495628_0042849 | 3300046516 | Bacteria | 3608 |
| 779 | Ga0495628_0056590 | 3300046516 | Bacteria | 3086 |
| 780 | Ga0495628_0065041 | 3300046516 | Bacteria | 2854 |
| 781 | Ga0495628_0108961 | 3300046516 | Bacteria | 2132 |
| 782 | Ga0495628_0130860 | 3300046516 | Bacteria | 1919 |
| 783 | Ga0495628_0302491 | 3300046516 | Bacteria | 1183 |
| 784 | Ga0495630_0001544 | 3300046517 | Bacteria | 15994 |
| 785 | Ga0495630_0067130 | 3300046517 | Bacteria | 2695 |
| 786 | Ga0495630_0123739 | 3300046517 | Bacteria | 1962 |
| 787 | Ga0495630_0153722 | 3300046517 | Bacteria | 1751 |
| 788 | Ga0495632_0033563 | 3300046519 | Bacteria | 2633 |
| 789 | Ga0495643_0054647 | 3300046522 | Bacteria | 2137 |
| 790 | Ga0495644_0023731 | 3300046523 | Bacteria | 2334 |
| 791 | Ga0495644_0094647 | 3300046523 | Bacteria | 1128 |
| 792 | Ga0495648_0012980 | 3300046524 | Bacteria | 6183 |
| 793 | Ga0495648_0026326 | 3300046524 | Bacteria | 3917 |
| 794 | Ga0495648_0062681 | 3300046524 | Bacteria | 2200 |
| 795 | Ga0495648_0137062 | 3300046524 | Bacteria | 1293 |
| 796 | Ga0495666_0107946 | 3300046526 | Bacteria | 1309 |
| 797 | Ga0495652_0021349 | 3300046529 | Bacteria | 5758 |
| 798 | Ga0495652_0023483 | 3300046529 | Bacteria | 5466 |
| 799 | Ga0495652_0080346 | 3300046529 | Bacteria | 2693 |
| 800 | Ga0495652_0130580 | 3300046529 | Bacteria | 1989 |
| 801 | Ga0495652_0199919 | 3300046529 | Bacteria | 1517 |
| 802 | Ga0495652_0262573 | 3300046529 | Bacteria | 1274 |
| 803 | Ga0495665_0000656 | 3300046531 | Bacteria | 17748 |
| 804 | Ga0495665_0119526 | 3300046531 | Bacteria | 1380 |
| 805 | Ga0495640_0014016 | 3300046533 | Bacteria | 6082 |
| 806 | Ga0495640_0029778 | 3300046533 | Bacteria | 3914 |
| 807 | Ga0495640_0031288 | 3300046533 | Bacteria | 3799 |
| 808 | Ga0495640_0040839 | 3300046533 | Bacteria | 3246 |
| 809 | Ga0495640_0067651 | 3300046533 | Bacteria | 2405 |
| 810 | Ga0495640_0070785 | 3300046533 | Bacteria | 2342 |
| 811 | Ga0495640_0090022 | 3300046533 | Bacteria | 2026 |
| 812 | Ga0495640_0150375 | 3300046533 | Bacteria | 1496 |
| 813 | Ga0495586_0039863 | 3300046535 | Bacteria | 2526 |
| 814 | Ga0495587_0000663 | 3300046536 | Bacteria | 23065 |
| 815 | Ga0495587_0033298 | 3300046536 | Bacteria | 3111 |
| 816 | Ga0495587_0044655 | 3300046536 | Bacteria | 2635 |
| 817 | Ga0495587_0085585 | 3300046536 | Bacteria | 1825 |
| 818 | Ga0495587_0089431 | 3300046536 | Bacteria | 1780 |
| 819 | Ga0495598_0001524 | 3300046537 | Bacteria | 4627 |
| 820 | Ga0495598_0085668 | 3300046537 | Bacteria | 1019 |
| 821 | Ga0495609_0110258 | 3300046538 | Bacteria | 1188 |
| 822 | Ga0495621_0045437 | 3300046539 | Bacteria | 1556 |
| 823 | Ga0495597_0071126 | 3300046542 | Bacteria | 1499 |
| 824 | Ga0495645_0031198 | 3300046543 | Bacteria | 3883 |
| 825 | Ga0495645_0032568 | 3300046543 | Bacteria | 3803 |
| 826 | Ga0495645_0134405 | 3300046543 | Bacteria | 1731 |
| 827 | Ga0495645_0218043 | 3300046543 | Bacteria | 1285 |
| 828 | Ga0495622_0002769 | 3300046557 | Bacteria | 8377 |
| 829 | Ga0495622_0146030 | 3300046557 | Bacteria | 1072 |
| 830 | Ga0495667_0001079 | 3300046559 | Bacteria | 17670 |
| 831 | Ga0495667_0020988 | 3300046559 | Bacteria | 4405 |
| 832 | Ga0495667_0023276 | 3300046559 | Bacteria | 4173 |
| 833 | Ga0495667_0034221 | 3300046559 | Bacteria | 3397 |
| 834 | Ga0495667_0096335 | 3300046559 | Bacteria | 1915 |
| 835 | Ga0495667_0223037 | 3300046559 | Bacteria | 1203 |
| 836 | Ga0495656_0004934 | 3300046615 | Bacteria | 4593 |
| 837 | Ga0495656_0010606 | 3300046615 | Bacteria | 3355 |
| 838 | Ga0495656_0106485 | 3300046615 | Bacteria | 1305 |
| 839 | Ga0495668_0055283 | 3300046616 | Bacteria | 2192 |
| 840 | Ga0495634_0000206 | 3300046642 | Bacteria | 55145 |
| 841 | Ga0495634_0016827 | 3300046642 | Bacteria | 5224 |
| 842 | Ga0495634_0028186 | 3300046642 | Bacteria | 3900 |
| 843 | Ga0495634_0062601 | 3300046642 | Bacteria | 2470 |
| 844 | Ga0495634_0073645 | 3300046642 | Bacteria | 2245 |
| 845 | Ga0495634_0135855 | 3300046642 | Bacteria | 1564 |
| 846 | Ga0495611_0117885 | 3300046648 | Bacteria | 1237 |
| 847 | Ga0495611_0126704 | 3300046648 | Bacteria | 1191 |
| 848 | Ga0495625_0100157 | 3300046660 | Bacteria | 1992 |
| 849 | Ga0495635_0000723 | 3300046663 | Bacteria | 21319 |
| 850 | Ga0495635_0001219 | 3300046663 | Bacteria | 17201 |
| 851 | Ga0495635_0001519 | 3300046663 | Bacteria | 15542 |
| 852 | Ga0495635_0001990 | 3300046663 | Bacteria | 13876 |
| 853 | Ga0495635_0013355 | 3300046663 | Bacteria | 5749 |
| 854 | Ga0495635_0141557 | 3300046663 | Bacteria | 1638 |
| 855 | Ga0495635_0225741 | 3300046663 | Bacteria | 1266 |
| 856 | Ga0495661_0018009 | 3300046665 | Bacteria | 4653 |
| 857 | Ga0495661_0084017 | 3300046665 | Bacteria | 1829 |
| 858 | Ga0495588_0007010 | 3300046674 | Bacteria | 5109 |
| 859 | Ga0495588_0016581 | 3300046674 | Bacteria | 3562 |
| 860 | Ga0495588_0023587 | 3300046674 | Bacteria | 3048 |
| 861 | Ga0495588_0068183 | 3300046674 | Bacteria | 1847 |
| 862 | Ga0495588_0070600 | 3300046674 | Bacteria | 1815 |
| 863 | Ga0495588_0120757 | 3300046674 | Bacteria | 1381 |
| 864 | Ga0495588_0134831 | 3300046674 | Bacteria | 1303 |
| 865 | Ga0495657_0008675 | 3300046675 | Bacteria | 7759 |
| 866 | Ga0495657_0010180 | 3300046675 | Bacteria | 7084 |
| 867 | Ga0495657_0042701 | 3300046675 | Bacteria | 3094 |
| 868 | Ga0495657_0044184 | 3300046675 | Bacteria | 3032 |
| 869 | Ga0495599_0041117 | 3300046678 | Bacteria | 2903 |
| 870 | Ga0495599_0044999 | 3300046678 | Bacteria | 2767 |
| 871 | Ga0495599_0070256 | 3300046678 | Bacteria | 2185 |
| 872 | Ga0495623_0011265 | 3300046679 | Bacteria | 5783 |
| 873 | Ga0495623_0012766 | 3300046679 | Bacteria | 5438 |
| 874 | Ga0495623_0029832 | 3300046679 | Bacteria | 3509 |
| 875 | Ga0495623_0072950 | 3300046679 | Bacteria | 2134 |
| 876 | Ga0495623_0181432 | 3300046679 | Bacteria | 1223 |
| 877 | Ga0495646_0008739 | 3300046680 | Bacteria | 6434 |
| 878 | Ga0495646_0015182 | 3300046680 | Bacteria | 4892 |
| 879 | Ga0495646_0068838 | 3300046680 | Bacteria | 2089 |
| 880 | Ga0495646_0070746 | 3300046680 | Bacteria | 2054 |
| 881 | Ga0495646_0085362 | 3300046680 | Bacteria | 1832 |
| 882 | Ga0495647_0001229 | 3300046681 | Bacteria | 7899 |
| 883 | Ga0495647_0020275 | 3300046681 | Bacteria | 2384 |
| 884 | Ga0495658_0000188 | 3300046683 | Bacteria | 35609 |
| 885 | Ga0495658_0028537 | 3300046683 | Bacteria | 3013 |
| 886 | Ga0495658_0093002 | 3300046683 | Bacteria | 1788 |
| 887 | Ga0495613_0013006 | 3300046689 | Bacteria | 6184 |
| 888 | Ga0495613_0020761 | 3300046689 | Bacteria | 4896 |
| 889 | Ga0495613_0060722 | 3300046689 | Bacteria | 2768 |
| 890 | Ga0495613_0063093 | 3300046689 | Bacteria | 2711 |
| 891 | Ga0495613_0188337 | 3300046689 | Bacteria | 1459 |
| 892 | Ga0495624_0007942 | 3300046690 | Bacteria | 7441 |
| 893 | Ga0495624_0034608 | 3300046690 | Bacteria | 3266 |
| 894 | Ga0495624_0039263 | 3300046690 | Bacteria | 3035 |
| 895 | Ga0495624_0050701 | 3300046690 | Bacteria | 2628 |
| 896 | Ga0495670_0050592 | 3300046691 | Bacteria | 2080 |
| 897 | Ga0495670_0112324 | 3300046691 | Bacteria | 1411 |
| 898 | Ga0495670_0139497 | 3300046691 | Bacteria | 1267 |
| 899 | Ga0495670_0252675 | 3300046691 | Bacteria | 940 |
| 900 | Ga0495671_0018194 | 3300046692 | Bacteria | 3731 |
| 901 | Ga0495671_0081679 | 3300046692 | Bacteria | 1584 |
| 902 | Ga0495649_0116099 | 3300046694 | Bacteria | 1417 |
| 903 | Ga0495600_0000483 | 3300046809 | Bacteria | 20562 |
| 904 | Ga0495600_0007773 | 3300046809 | Bacteria | 6563 |
| 905 | Ga0495600_0011323 | 3300046809 | Bacteria | 5557 |
| 906 | Ga0495600_0011929 | 3300046809 | Bacteria | 5425 |
| 907 | Ga0495600_0203879 | 3300046809 | Bacteria | 1269 |
| 908 | Ga0495600_0241579 | 3300046809 | Bacteria | 1151 |
| 909 | Ga0495581_0000166 | 3300047315 | Bacteria | 29591 |
| 910 | Ga0495581_0029409 | 3300047315 | Bacteria | 3185 |
| 911 | Ga0495581_0080467 | 3300047315 | Bacteria | 1886 |
| 912 | Ga0495604_0000907 | 3300047317 | Bacteria | 24618 |
| 913 | Ga0495604_0017915 | 3300047317 | Bacteria | 5666 |
| 914 | Ga0495604_0031834 | 3300047317 | Bacteria | 4182 |
| 915 | Ga0495604_0058327 | 3300047317 | Bacteria | 2964 |
| 916 | Ga0495604_0138976 | 3300047317 | Bacteria | 1737 |
| 917 | Ga0495604_0161565 | 3300047317 | Bacteria | 1582 |
| 918 | Ga0495674_0009028 | 3300047319 | Bacteria | 9475 |
| 919 | Ga0495674_0014830 | 3300047319 | Bacteria | 7291 |
| 920 | Ga0495674_0018702 | 3300047319 | Bacteria | 6447 |
| 921 | Ga0495674_0040498 | 3300047319 | Bacteria | 4167 |
| 922 | Ga0495674_0083972 | 3300047319 | Bacteria | 2730 |
| 923 | Ga0495674_0111784 | 3300047319 | Bacteria | 2315 |
| 924 | Ga0495672_0045473 | 3300047320 | Bacteria | 2626 |
| 925 | Ga0495672_0128453 | 3300047320 | Bacteria | 1337 |
| 926 | Ga0495676_0034215 | 3300047321 | Bacteria | 4266 |
| 927 | Ga0495676_0063501 | 3300047321 | Bacteria | 2878 |
| 928 | Ga0495676_0069500 | 3300047321 | Bacteria | 2717 |
| 929 | Ga0495676_0085664 | 3300047321 | Bacteria | 2373 |
| 930 | Ga0495676_0222726 | 3300047321 | Bacteria | 1299 |
| 931 | Ga0495680_0005555 | 3300047322 | Bacteria | 11839 |
| 932 | Ga0495680_0005583 | 3300047322 | Bacteria | 11795 |
| 933 | Ga0495680_0017386 | 3300047322 | Bacteria | 6143 |
| 934 | Ga0495680_0044358 | 3300047322 | Bacteria | 3516 |
| 935 | Ga0495680_0126487 | 3300047322 | Bacteria | 1882 |
| 936 | Ga0495683_0041815 | 3300047323 | Bacteria | 2312 |
| 937 | Ga0495683_0065575 | 3300047323 | Bacteria | 1791 |
| 938 | Ga0495675_0013918 | 3300047444 | Bacteria | 5087 |
| 939 | Ga0495675_0076330 | 3300047444 | Bacteria | 2112 |
| 940 | Ga0495675_0105156 | 3300047444 | Bacteria | 1764 |
| 941 | Ga0495675_0207036 | 3300047444 | Bacteria | 1192 |
| 942 | Ga0495677_0034301 | 3300047445 | Bacteria | 1851 |
| 943 | Ga0495679_031312 | 3300047446 | Bacteria | 1717 |
| 944 | Ga0495673_0058648 | 3300047469 | Bacteria | 1658 |
| 945 | Ga0495673_0118071 | 3300047469 | Bacteria | 1053 |
| 946 | Ga0495684_0007107 | 3300047471 | Bacteria | 8689 |
| 947 | Ga0495684_0012905 | 3300047471 | Bacteria | 6449 |
| 948 | Ga0495684_0224593 | 3300047471 | Bacteria | 1375 |
| 949 | Ga0495686_0033809 | 3300047472 | Bacteria | 3298 |
| 950 | Ga0495686_0124056 | 3300047472 | Bacteria | 1537 |
| 951 | Ga0495593_0000033 | 3300047673 | Bacteria | 58363 |
| 952 | Ga0495593_0013832 | 3300047673 | Bacteria | 4597 |
| 953 | Ga0495593_0043771 | 3300047673 | Bacteria | 2397 |
| 954 | Ga0495593_0093590 | 3300047673 | Bacteria | 1546 |
| 955 | Ga0495602_0005125 | 3300048088 | Bacteria | 13727 |
| 956 | Ga0495602_0028813 | 3300048088 | Bacteria | 5305 |
| 957 | Ga0495602_0033120 | 3300048088 | Bacteria | 4853 |
| 958 | Ga0495602_0061823 | 3300048088 | Bacteria | 3253 |
| 959 | Ga0495602_0193942 | 3300048088 | Bacteria | 1555 |
| 960 | Ga0495602_0224989 | 3300048088 | Bacteria | 1413 |
| 961 | Ga0495626_0023088 | 3300048091 | Bacteria | 3067 |
| 962 | Ga0496100_0004573 | 3300048903 | Bacteria | 7355 |
| 963 | Ga0496100_0022125 | 3300048903 | Bacteria | 3842 |
| 964 | Ga0496100_0028425 | 3300048903 | Bacteria | 3449 |
| 965 | Ga0496100_0117942 | 3300048903 | Bacteria | 1853 |
| 966 | Ga0496100_0165525 | 3300048903 | Bacteria | 1588 |
| 967 | Ga0496100_0322190 | 3300048903 | Bacteria | 1161 |
| 968 | Ga0496101_0008538 | 3300048904 | Bacteria | 6695 |
| 969 | Ga0496101_0066146 | 3300048904 | Bacteria | 2636 |
| 970 | Ga0496101_0074262 | 3300048904 | Bacteria | 2500 |
| 971 | Ga0496101_0079431 | 3300048904 | Bacteria | 2422 |
| 972 | Ga0496101_0339580 | 3300048904 | Bacteria | 1179 |
| 973 | Ga0496102_0022051 | 3300048905 | Bacteria | 5640 |
| 974 | Ga0496102_0111497 | 3300048905 | Bacteria | 2550 |
| 975 | Ga0496102_0193234 | 3300048905 | Bacteria | 1918 |
| 976 | Ga0496102_0229022 | 3300048905 | Bacteria | 1752 |
| 977 | Ga0496102_0401079 | 3300048905 | Bacteria | 1289 |
| 978 | Ga0496103_0020025 | 3300048906 | Bacteria | 4017 |
| 979 | Ga0496103_0137969 | 3300048906 | Bacteria | 1559 |
| 980 | Ga0496103_0145741 | 3300048906 | Bacteria | 1516 |
| 981 | Ga0496104_0005685 | 3300048907 | Bacteria | 10915 |
| 982 | Ga0496104_0014292 | 3300048907 | Bacteria | 7168 |
| 983 | Ga0496104_0018839 | 3300048907 | Bacteria | 6305 |
| 984 | Ga0496104_0020301 | 3300048907 | Bacteria | 6088 |
| 985 | Ga0496104_0023859 | 3300048907 | Bacteria | 5625 |
| 986 | Ga0496104_0024862 | 3300048907 | Bacteria | 5515 |
| 987 | Ga0496104_0091277 | 3300048907 | Bacteria | 2911 |
| 988 | Ga0496104_0098246 | 3300048907 | Bacteria | 2803 |
| 989 | Ga0496105_0008654 | 3300048908 | Bacteria | 7914 |
| 990 | Ga0496105_0016130 | 3300048908 | Bacteria | 5958 |
| 991 | Ga0496105_0032948 | 3300048908 | Bacteria | 4253 |
| 992 | Ga0496105_0051704 | 3300048908 | Bacteria | 3394 |
| 993 | Ga0496105_0063602 | 3300048908 | Bacteria | 3044 |
| 994 | Ga0496105_0068948 | 3300048908 | Bacteria | 2922 |
| 995 | Ga0496105_0071435 | 3300048908 | Bacteria | 2868 |
| 996 | Ga0496105_0168437 | 3300048908 | Bacteria | 1796 |
| 997 | Ga0496105_0275916 | 3300048908 | Bacteria | 1357 |
| 998 | Ga0496105_0341835 | 3300048908 | Bacteria | 1196 |
| 999 | Ga0496106_0000240 | 3300048909 | Bacteria | 38188 |
| 1000 | Ga0496106_0003104 | 3300048909 | Bacteria | 12404 |
| 1001 | Ga0496106_0006834 | 3300048909 | Bacteria | 8446 |
| 1002 | Ga0496106_0044470 | 3300048909 | Bacteria | 3333 |
| 1003 | Ga0496106_0135536 | 3300048909 | Bacteria | 1934 |
| 1004 | Ga0496106_0149332 | 3300048909 | Bacteria | 1843 |
| 1005 | Ga0496107_0016125 | 3300048910 | Bacteria | 5242 |
| 1006 | Ga0496107_0037814 | 3300048910 | Bacteria | 3464 |
| 1007 | Ga0496107_0060779 | 3300048910 | Bacteria | 2735 |
| 1008 | Ga0496107_0113202 | 3300048910 | Bacteria | 1995 |
| 1009 | Ga0496108_0002539 | 3300048911 | Bacteria | 14611 |
| 1010 | Ga0496108_0011304 | 3300048911 | Bacteria | 7252 |
| 1011 | Ga0496108_0011769 | 3300048911 | Bacteria | 7116 |
| 1012 | Ga0496108_0018897 | 3300048911 | Bacteria | 5651 |
| 1013 | Ga0496108_0036158 | 3300048911 | Bacteria | 4108 |
| 1014 | Ga0496108_0041472 | 3300048911 | Bacteria | 3842 |
| 1015 | Ga0496108_0096940 | 3300048911 | Bacteria | 2512 |
| 1016 | Ga0496108_0218756 | 3300048911 | Bacteria | 1655 |
| 1017 | Ga0496108_0406977 | 3300048911 | Bacteria | 1188 |
| 1018 | Ga0496109_0000377 | 3300048912 | Bacteria | 40679 |
| 1019 | Ga0496109_0001620 | 3300048912 | Bacteria | 18810 |
| 1020 | Ga0496109_0005500 | 3300048912 | Bacteria | 10606 |
| 1021 | Ga0496109_0012367 | 3300048912 | Bacteria | 7369 |
| 1022 | Ga0496109_0033408 | 3300048912 | Bacteria | 4628 |
| 1023 | Ga0496109_0136395 | 3300048912 | Bacteria | 2293 |
| 1024 | Ga0496109_0330830 | 3300048912 | Bacteria | 1438 |
| 1025 | Ga0496110_0004983 | 3300048913 | Bacteria | 10368 |
| 1026 | Ga0496110_0014112 | 3300048913 | Bacteria | 6624 |
| 1027 | Ga0496110_0024066 | 3300048913 | Bacteria | 5189 |
| 1028 | Ga0496110_0034780 | 3300048913 | Bacteria | 4367 |
| 1029 | Ga0496110_0047732 | 3300048913 | Bacteria | 3751 |
| 1030 | Ga0496111_0009981 | 3300048914 | Bacteria | 6351 |
| 1031 | Ga0496111_0013193 | 3300048914 | Bacteria | 5619 |
| 1032 | Ga0496111_0020473 | 3300048914 | Bacteria | 4606 |
| 1033 | Ga0496111_0056594 | 3300048914 | Bacteria | 2837 |
| 1034 | Ga0496111_0083525 | 3300048914 | Bacteria | 2334 |
| 1035 | Ga0496111_0256964 | 3300048914 | Bacteria | 1296 |
| 1036 | Ga0496111_0269072 | 3300048914 | Bacteria | 1264 |
| 1037 | Ga0496111_0401545 | 3300048914 | Bacteria | 1013 |
| 1038 | Ga0496112_0000017 | 3300048915 | Bacteria | 191284 |
| 1039 | Ga0496112_0001811 | 3300048915 | Bacteria | 16811 |
| 1040 | Ga0496112_0004764 | 3300048915 | Bacteria | 11568 |
| 1041 | Ga0496112_0005098 | 3300048915 | Bacteria | 11287 |
| 1042 | Ga0496112_0006587 | 3300048915 | Bacteria | 10221 |
| 1043 | Ga0496112_0009154 | 3300048915 | Bacteria | 8894 |
| 1044 | Ga0496112_0031464 | 3300048915 | Bacteria | 5147 |
| 1045 | Ga0496112_0079018 | 3300048915 | Bacteria | 3253 |
| 1046 | Ga0496112_0079947 | 3300048915 | Bacteria | 3233 |
| 1047 | Ga0496112_0083809 | 3300048915 | Bacteria | 3153 |
| 1048 | Ga0496112_0124964 | 3300048915 | Bacteria | 2543 |
| 1049 | Ga0496112_0172063 | 3300048915 | Bacteria | 2131 |
| 1050 | Ga0496112_0203110 | 3300048915 | Bacteria | 1940 |
| 1051 | Ga0496112_0390556 | 3300048915 | Bacteria | 1332 |
| 1052 | Ga0496112_0396390 | 3300048915 | Bacteria | 1320 |
| 1053 | Ga0496113_0001469 | 3300048916 | Bacteria | 13151 |
| 1054 | Ga0496113_0005360 | 3300048916 | Bacteria | 7994 |
| 1055 | Ga0496113_0008097 | 3300048916 | Bacteria | 6825 |
| 1056 | Ga0496113_0010973 | 3300048916 | Bacteria | 6019 |
| 1057 | Ga0496113_0020026 | 3300048916 | Bacteria | 4694 |
| 1058 | Ga0496113_0044236 | 3300048916 | Bacteria | 3298 |
| 1059 | Ga0496113_0083058 | 3300048916 | Bacteria | 2457 |
| 1060 | Ga0496113_0089336 | 3300048916 | Bacteria | 2371 |
| 1061 | Ga0496113_0119535 | 3300048916 | Bacteria | 2059 |
| 1062 | Ga0496113_0124227 | 3300048916 | Bacteria | 2020 |
| 1063 | Ga0496113_0384140 | 3300048916 | Bacteria | 1127 |
| 1064 | Ga0496113_0408091 | 3300048916 | Bacteria | 1091 |
| 1065 | Ga0496114_0021241 | 3300048917 | Bacteria | 5279 |
| 1066 | Ga0496114_0119721 | 3300048917 | Bacteria | 2263 |
| 1067 | Ga0496114_0136841 | 3300048917 | Bacteria | 2118 |
| 1068 | Ga0496114_0183601 | 3300048917 | Bacteria | 1827 |
| 1069 | Ga0496114_0499580 | 3300048917 | Bacteria | 1076 |
| 1070 | Ga0496115_0004354 | 3300048918 | Bacteria | 10246 |
| 1071 | Ga0496115_0016709 | 3300048918 | Bacteria | 5592 |
| 1072 | Ga0496115_0032733 | 3300048918 | Bacteria | 4103 |
| 1073 | Ga0496115_0056716 | 3300048918 | Bacteria | 3148 |
| 1074 | Ga0496115_0056752 | 3300048918 | Bacteria | 3147 |
| 1075 | Ga0496115_0068565 | 3300048918 | Bacteria | 2872 |
| 1076 | Ga0496115_0079065 | 3300048918 | Bacteria | 2676 |
| 1077 | Ga0496115_0145172 | 3300048918 | Bacteria | 1958 |
| 1078 | Ga0496115_0145934 | 3300048918 | Bacteria | 1953 |
| 1079 | Ga0496115_0174202 | 3300048918 | Bacteria | 1779 |
| 1080 | Ga0496115_0200483 | 3300048918 | Bacteria | 1649 |
| 1081 | Ga0496115_0333045 | 3300048918 | Bacteria | 1240 |
| 1082 | Ga0496116_0001913 | 3300048919 | Bacteria | 22414 |
| 1083 | Ga0496116_0049951 | 3300048919 | Bacteria | 2791 |
| 1084 | Ga0496118_0069374 | 3300048921 | Bacteria | 2553 |
| 1085 | Ga0496119_0007401 | 3300048922 | Bacteria | 9897 |
| 1086 | Ga0496120_0150319 | 3300048923 | Bacteria | 1171 |
| 1087 | Ga0496121_0000230 | 3300048924 | Bacteria | 120616 |
| 1088 | Ga0496121_0004398 | 3300048924 | Bacteria | 19000 |
| 1089 | Ga0496121_0009774 | 3300048924 | Bacteria | 10965 |
| 1090 | Ga0496121_0029407 | 3300048924 | Bacteria | 5081 |
| 1091 | Ga0496121_0043862 | 3300048924 | Bacteria | 3866 |
| 1092 | Ga0496121_0067206 | 3300048924 | Bacteria | 2906 |
| 1093 | Ga0496121_0070273 | 3300048924 | Bacteria | 2821 |
| 1094 | Ga0496121_0072871 | 3300048924 | Bacteria | 2755 |
| 1095 | Ga0496121_0077850 | 3300048924 | Bacteria | 2639 |
| 1096 | Ga0496121_0131444 | 3300048924 | Bacteria | 1872 |
| 1097 | Ga0496122_0009319 | 3300048925 | Bacteria | 10374 |
| 1098 | Ga0496122_0016804 | 3300048925 | Bacteria | 6891 |
| 1099 | Ga0496122_0075240 | 3300048925 | Bacteria | 2384 |
| 1100 | Ga0496123_0006663 | 3300048926 | Bacteria | 11130 |
| 1101 | Ga0496123_0031624 | 3300048926 | Bacteria | 3847 |
| 1102 | Ga0496124_0010351 | 3300048927 | Bacteria | 9456 |
| 1103 | Ga0496124_0049528 | 3300048927 | Bacteria | 3584 |
| 1104 | Ga0496125_0000040 | 3300048928 | Bacteria | 314478 |
| 1105 | Ga0496125_0003264 | 3300048928 | Bacteria | 19969 |
| 1106 | Ga0496125_0010916 | 3300048928 | Bacteria | 9134 |
| 1107 | Ga0496125_0038188 | 3300048928 | Bacteria | 4161 |
| 1108 | Ga0496125_0072594 | 3300048928 | Bacteria | 2681 |
| 1109 | Ga0496126_0005072 | 3300048929 | Bacteria | 15276 |
| 1110 | Ga0496126_0005800 | 3300048929 | Bacteria | 13963 |
| 1111 | Ga0496126_0007510 | 3300048929 | Bacteria | 11940 |
| 1112 | Ga0496126_0019129 | 3300048929 | Bacteria | 6755 |
| 1113 | Ga0496126_0029901 | 3300048929 | Bacteria | 5170 |
| 1114 | Ga0496126_0072340 | 3300048929 | Bacteria | 3067 |
| 1115 | Ga0496126_0087675 | 3300048929 | Bacteria | 2743 |
| 1116 | Ga0496126_0091048 | 3300048929 | Bacteria | 2683 |
| 1117 | Ga0496126_0113251 | 3300048929 | Bacteria | 2361 |
| 1118 | Ga0496126_0130655 | 3300048929 | Bacteria | 2170 |
| 1119 | Ga0496126_0260151 | 3300048929 | Bacteria | 1443 |
| 1120 | Ga0495682_0058567 | 3300049460 | Bacteria | 1393 |
| 1121 | Ga0501034_0284032 | 3300049571 | Bacteria | 1594 |
| 1122 | Ga0501034_0857228 | 3300049571 | Bacteria | 798 |
| 1123 | Ga0501037_0039808 | 3300049573 | Bacteria | 3459 |
| 1124 | Ga0501046_0069104 | 3300049580 | Bacteria | 2749 |
| 1125 | Ga0501047_0033590 | 3300049581 | Bacteria | 4951 |
| 1126 | Ga0501047_0047317 | 3300049581 | Bacteria | 4156 |
| 1127 | Ga0501067_0027796 | 3300049583 | Bacteria | 3134 |
| 1128 | Ga0501069_0037162 | 3300049585 | Bacteria | 2687 |
| 1129 | Ga0501070_0003190 | 3300049586 | Bacteria | 14262 |
| 1130 | Ga0501070_0011105 | 3300049586 | Bacteria | 7603 |
| 1131 | Ga0501070_0035395 | 3300049586 | Bacteria | 4172 |
| 1132 | Ga0501072_0063369 | 3300049588 | Bacteria | 2916 |
| 1133 | Ga0501072_0142676 | 3300049588 | Bacteria | 1910 |
| 1134 | Ga0501073_0027417 | 3300049589 | Bacteria | 4073 |
| 1135 | Ga0501074_0115382 | 3300049590 | Bacteria | 1921 |
| 1136 | Ga0501077_0041562 | 3300049593 | Bacteria | 2926 |
| 1137 | Ga0501080_0056270 | 3300049742 | Bacteria | 3663 |
| 1138 | Ga0501080_0059524 | 3300049742 | Bacteria | 3554 |
| 1139 | Ga0501080_0117963 | 3300049742 | Bacteria | 2460 |
| 1140 | Ga0501035_0000197 | 3300049822 | Bacteria | 73618 |
| 1141 | Ga0501035_0110892 | 3300049822 | Bacteria | 2405 |
| 1142 | Ga0501035_0440342 | 3300049822 | Bacteria | 1079 |
| 1143 | Ga0501044_0048264 | 3300049823 | Bacteria | 4399 |
| 1144 | Ga0501044_0098289 | 3300049823 | Bacteria | 2947 |
| 1145 | nmdc:mga03683_10234_c2 | 3300050489 | Bacteria | 1864 |
| 1146 | nmdc:mga03n38_23182_c1 | 3300050490 | Bacteria | 2522 |
| 1147 | nmdc:mga03n38_24684_c1 | 3300050490 | Bacteria | 2460 |
| 1148 | nmdc:mga03n38_2872_c1 | 3300050490 | Bacteria | 5425 |
| 1149 | nmdc:mga03n38_61621_c1 | 3300050490 | Bacteria | 1709 |
| 1150 | nmdc:mga00v17_18761_c1 | 3300050491 | Bacteria | 3545 |
| 1151 | nmdc:mga00v17_50057_c1 | 3300050491 | Bacteria | 2537 |
| 1152 | nmdc:mga00v17_7665_c1 | 3300050491 | Bacteria | 5775 |
| 1153 | nmdc:mga00v17_78206_c1 | 3300050491 | Bacteria | 2061 |
| 1154 | nmdc:mga0yw44_11581_c1 | 3300050492 | Bacteria | 4562 |
| 1155 | nmdc:mga0yw44_1289_c1 | 3300050492 | Bacteria | 9898 |
| 1156 | nmdc:mga0yw44_13355_c1 | 3300050492 | Bacteria | 4322 |
| 1157 | nmdc:mga0yw44_196826_c1 | 3300050492 | Bacteria | 1330 |
| 1158 | nmdc:mga0yw44_2368_c1 | 3300050492 | Bacteria | 8005 |
| 1159 | nmdc:mga0yw44_6230_c2 | 3300050492 | Bacteria | 2972 |
| 1160 | nmdc:mga0yw44_71559_c1 | 3300050492 | Bacteria | 2153 |
| 1161 | nmdc:mga0yw44_99914_c1 | 3300050492 | Bacteria | 1847 |
| 1162 | nmdc:mga06z11_131701_c1 | 3300050494 | Bacteria | 1405 |
| 1163 | nmdc:mga06z11_304611_c1 | 3300050494 | Bacteria | 948 |
| 1164 | nmdc:mga06z11_46757_c1 | 3300050494 | Bacteria | 2195 |
| 1165 | nmdc:mga04h51_137402_c1 | 3300050495 | Bacteria | 924 |
| 1166 | nmdc:mga07m45_1086_c1 | 3300050496 | Bacteria | 12118 |
| 1167 | nmdc:mga07m45_140468_c1 | 3300050496 | Bacteria | 1399 |
| 1168 | nmdc:mga07m45_262798_c1 | 3300050496 | Bacteria | 1004 |
| 1169 | nmdc:mga07m45_77756_c1 | 3300050496 | Bacteria | 1893 |
| 1170 | nmdc:mga05p37_115695_c1 | 3300050507 | Bacteria | 3296 |
| 1171 | nmdc:mga05p37_15774_c1 | 3300050507 | Bacteria | 9086 |
| 1172 | nmdc:mga05p37_190261_c1 | 3300050507 | Bacteria | 2492 |
| 1173 | nmdc:mga05p37_190426_c1 | 3300050507 | Bacteria | 2491 |
| 1174 | nmdc:mga05p37_214122_c1 | 3300050507 | Bacteria | 2328 |
| 1175 | nmdc:mga05p37_268632_c1 | 3300050507 | Bacteria | 2039 |
| 1176 | nmdc:mga05p37_287153_c1 | 3300050507 | Bacteria | 1959 |
| 1177 | nmdc:mga05p37_786377_c1 | 3300050507 | Bacteria | 1043 |
| 1178 | nmdc:mga09592_110359_c1 | 3300050508 | Bacteria | 2360 |
| 1179 | nmdc:mga09592_270300_c1 | 3300050508 | Bacteria | 1474 |
| 1180 | nmdc:mga0qj67_121416_c1 | 3300050509 | Bacteria | 2114 |
| 1181 | nmdc:mga0qj67_19636_c1 | 3300050509 | Bacteria | 5166 |
| 1182 | nmdc:mga06r32_21123_c1 | 3300050510 | Bacteria | 6007 |
| 1183 | nmdc:mga06r32_9316_c1 | 3300050510 | Bacteria | 8853 |
| 1184 | nmdc:mga08y16_112037_c1 | 3300050511 | Bacteria | 2840 |
| 1185 | nmdc:mga08y16_187406_c1 | 3300050511 | Bacteria | 2147 |
| 1186 | nmdc:mga08y16_244684_c1 | 3300050511 | Bacteria | 1854 |
| 1187 | nmdc:mga08y16_34714_c1 | 3300050511 | Bacteria | 5299 |
| 1188 | nmdc:mga08y16_53774_c1 | 3300050511 | Bacteria | 4208 |
| 1189 | nmdc:mga0n895_101084_c1 | 3300050512 | Bacteria | 2893 |
| 1190 | nmdc:mga0n895_170644_c1 | 3300050512 | Bacteria | 2207 |
| 1191 | nmdc:mga0n895_1857_c1 | 3300050512 | Bacteria | 16116 |
| 1192 | nmdc:mga0n895_240452_c1 | 3300050512 | Bacteria | 1837 |
| 1193 | nmdc:mga0n895_399571_c1 | 3300050512 | Bacteria | 1390 |
| 1194 | nmdc:mga0rr50_59482_c1 | 3300050513 | Bacteria | 2869 |
| 1195 | nmdc:mga0rr50_61233_c1 | 3300050513 | Bacteria | 2835 |
| 1196 | nmdc:mga08x19_17358_c1 | 3300050514 | Bacteria | 4403 |
| 1197 | nmdc:mga0a205_502602_c1 | 3300050515 | Bacteria | 1069 |
| 1198 | nmdc:mga0a205_96584_c1 | 3300050515 | Bacteria | 2854 |
| 1199 | nmdc:mga0sz30_18017_c1 | 3300050516 | Bacteria | 2822 |
| 1200 | nmdc:mga0sz30_20147_c1 | 3300050516 | Bacteria | 2688 |
| 1201 | nmdc:mga0sz30_58797_c1 | 3300050516 | Bacteria | 1639 |
| 1202 | Ga0495601_0002639 | 3300053077 | Bacteria | 10177 |
| 1203 | Ga0495601_0003107 | 3300053077 | Bacteria | 9484 |
| 1204 | Ga0495601_0006299 | 3300053077 | Bacteria | 6932 |
| 1205 | Ga0495601_0019700 | 3300053077 | Bacteria | 4117 |
| 1206 | Ga0495601_0025844 | 3300053077 | Bacteria | 3622 |
| 1207 | Ga0495601_0038407 | 3300053077 | Bacteria | 2995 |
| 1208 | Ga0495601_0044171 | 3300053077 | Bacteria | 2801 |
| 1209 | Ga0495601_0092862 | 3300053077 | Bacteria | 1944 |
| 1210 | Ga0495601_0112481 | 3300053077 | Bacteria | 1764 |
| 1211 | Ga0495612_0001997 | 3300053078 | Bacteria | 8403 |
| 1212 | Ga0495612_0008658 | 3300053078 | Bacteria | 4126 |
| 1213 | Ga0495612_0160290 | 3300053078 | Bacteria | 982 |
| 1214 | Ga0500635_0016196 | 3300053080 | Bacteria | 2213 |
| 1215 | Ga0500635_0038984 | 3300053080 | Bacteria | 1578 |
| 1216 | Ga0495595_0000216 | 3300053084 | Bacteria | 23117 |
| 1217 | Ga0495595_0000883 | 3300053084 | Bacteria | 11520 |
| 1218 | Ga0495595_0010987 | 3300053084 | Bacteria | 3778 |
| 1219 | Ga0495595_0011645 | 3300053084 | Bacteria | 3680 |
| 1220 | Ga0495595_0024819 | 3300053084 | Bacteria | 2650 |
| 1221 | Ga0495595_0029061 | 3300053084 | Bacteria | 2471 |
| 1222 | Ga0495595_0078396 | 3300053084 | Bacteria | 1570 |
| 1223 | Ga0495595_0138821 | 3300053084 | Bacteria | 1192 |
| 1224 | Ga0495619_0000557 | 3300053085 | Bacteria | 24670 |
| 1225 | Ga0495619_0000897 | 3300053085 | Bacteria | 19498 |
| 1226 | Ga0495619_0001136 | 3300053085 | Bacteria | 17480 |
| 1227 | Ga0495619_0010203 | 3300053085 | Bacteria | 5917 |
| 1228 | Ga0495619_0014586 | 3300053085 | Bacteria | 4963 |
| 1229 | Ga0495619_0015410 | 3300053085 | Bacteria | 4835 |
| 1230 | Ga0495619_0045284 | 3300053085 | Bacteria | 2890 |
| 1231 | Ga0495619_0046742 | 3300053085 | Bacteria | 2847 |
| 1232 | Ga0500578_0321589 | 3300053086 | Bacteria | 912 |
| 1233 | Ga0500643_000125 | 3300053087 | Bacteria | 79651 |
| 1234 | Ga0500643_007887 | 3300053087 | Bacteria | 4240 |
| 1235 | Ga0500643_016954 | 3300053087 | Bacteria | 2451 |
| 1236 | Ga0500644_0001722 | 3300053088 | Bacteria | 5685 |
| 1237 | Ga0500647_0053962 | 3300053091 | Bacteria | 1934 |
| 1238 | Ga0500583_0045525 | 3300053092 | Bacteria | 2015 |
| 1239 | Ga0500566_0000331 | 3300053094 | Bacteria | 25736 |
| 1240 | Ga0500566_0001048 | 3300053094 | Bacteria | 16009 |
| 1241 | Ga0500566_0001969 | 3300053094 | Bacteria | 12102 |
| 1242 | Ga0500566_0020614 | 3300053094 | Bacteria | 3875 |
| 1243 | Ga0500566_0021105 | 3300053094 | Bacteria | 3831 |
| 1244 | Ga0500566_0066768 | 3300053094 | Bacteria | 2026 |
| 1245 | Ga0500640_000214 | 3300053095 | Bacteria | 12549 |
| 1246 | Ga0500640_001983 | 3300053095 | Bacteria | 6567 |
| 1247 | Ga0500554_002627 | 3300053102 | Bacteria | 3568 |
| 1248 | Ga0500555_000626 | 3300053103 | Bacteria | 13668 |
| 1249 | Ga0500556_0000069 | 3300053104 | Bacteria | 101263 |
| 1250 | Ga0500556_0085971 | 3300053104 | Bacteria | 1195 |
| 1251 | Ga0500557_000040 | 3300053105 | Bacteria | 66268 |
| 1252 | Ga0500572_000175 | 3300053111 | Bacteria | 22657 |
| 1253 | Ga0500595_000001 | 3300053119 | Bacteria | 1088438 |
| 1254 | Ga0500595_000407 | 3300053119 | Bacteria | 27509 |
| 1255 | Ga0500595_000715 | 3300053119 | Bacteria | 19771 |
| 1256 | Ga0500595_007199 | 3300053119 | Bacteria | 4636 |
| 1257 | Ga0500608_006744 | 3300053122 | Bacteria | 4703 |
| 1258 | Ga0500608_039749 | 3300053122 | Bacteria | 2253 |
| 1259 | Ga0500614_001781 | 3300053123 | Bacteria | 4996 |
| 1260 | Ga0500642_0000032 | 3300053130 | Bacteria | 111097 |
| 1261 | Ga0500642_0000118 | 3300053130 | Bacteria | 36204 |
| 1262 | Ga0500642_0017555 | 3300053130 | Bacteria | 2746 |
| 1263 | Ga0500652_001281 | 3300053131 | Bacteria | 7967 |
| 1264 | Ga0500655_010216 | 3300053133 | Bacteria | 1694 |
| 1265 | Ga0500559_0001458 | 3300053136 | Bacteria | 13416 |
| 1266 | Ga0500564_007644 | 3300053138 | Bacteria | 4593 |
| 1267 | Ga0500586_020181 | 3300053145 | Bacteria | 2083 |
| 1268 | Ga0500589_076989 | 3300053147 | Bacteria | 1497 |
| 1269 | Ga0500603_000394 | 3300053150 | Bacteria | 11457 |
| 1270 | Ga0500603_002027 | 3300053150 | Bacteria | 4486 |
| 1271 | Ga0500603_021441 | 3300053150 | Bacteria | 1589 |
| 1272 | Ga0500604_0013468 | 3300053151 | Bacteria | 2216 |
| 1273 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 1274 | Ga0500616_0000461 | 3300053153 | Bacteria | 53095 |
| 1275 | Ga0500616_0036537 | 3300053153 | Bacteria | 2666 |
| 1276 | Ga0500622_0000602 | 3300053156 | Bacteria | 32636 |
| 1277 | Ga0500622_0010928 | 3300053156 | Bacteria | 4956 |
| 1278 | Ga0500638_001677 | 3300053162 | Bacteria | 7185 |
| 1279 | Ga0500638_005668 | 3300053162 | Bacteria | 5012 |
| 1280 | Ga0500638_081650 | 3300053162 | Bacteria | 1534 |
| 1281 | Ga0500639_000239 | 3300053163 | Bacteria | 27228 |
| 1282 | Ga0500636_0000102 | 3300053177 | Bacteria | 43520 |
| 1283 | Ga0500636_0007566 | 3300053177 | Bacteria | 6281 |
| 1284 | Ga0500636_0061804 | 3300053177 | Bacteria | 2185 |
| 1285 | Ga0500637_0000265 | 3300053178 | Bacteria | 19602 |
| 1286 | Ga0500637_0007251 | 3300053178 | Bacteria | 5532 |
| 1287 | Ga0500657_021837 | 3300053728 | Bacteria | 3032 |
| 1288 | Ga0500645_027102 | 3300053730 | Bacteria | 1739 |
| 1289 | Ga0500645_035738 | 3300053730 | Bacteria | 1479 |
| 1290 | Ga0500596_000367 | 3300053735 | Bacteria | 8162 |
| 1291 | Ga0500601_000568 | 3300053737 | Bacteria | 5399 |
| 1292 | Ga0501084_0357611 | 3300054114 | Bacteria | 1234 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300033180 | Ga0307510_10019865 | Ga0307510_100198654 | 243 |
| 2 | 3300049571 | Ga0501034_0857228 | Ga0501034_0857228_16_771 | 250 |
| 3 | 3300035091 | Ga0373951_0048896 | Ga0373951_0048896_229_1026 | 256 |
| 4 | 3300006175 | Ga0070712_100151972 | Ga0070712_1001519722 | 280 |
| 5 | 3300025915 | Ga0207693_10054488 | Ga0207693_100544883 | 280 |
| 6 | 3300039450 | Ga0436363_0688960 | Ga0436363_0688960_233_1111 | 283 |
| 7 | 3300006847 | Ga0075431_100264386 | Ga0075431_1002643861 | 285 |
| 8 | 3300009094 | Ga0111539_10198631 | Ga0111539_101986313 | 285 |
| 9 | 3300053086 | Ga0500578_0321589 | Ga0500578_0321589_26_895 | 286 |
| 10 | 3300038443 | Ga0395901_0312242 | Ga0395901_0312242_18_905 | 288 |
| 11 | 3300048907 | Ga0496104_0098246 | Ga0496104_0098246_50_931 | 288 |
| 12 | 3300048911 | Ga0496108_0218756 | Ga0496108_0218756_758_1645 | 288 |
| 13 | 3300031241 | Ga0265325_10013606 | Ga0265325_100136062 | 289 |
| 14 | iso_pu_bacteria | 8016575299 | 8016576465 | 289 |
| 15 | 3300006038 | Ga0075365_10014013 | Ga0075365_100140135 | 290 |
| 16 | 3300006051 | Ga0075364_10034720 | Ga0075364_100347204 | 290 |
| 17 | 3300006177 | Ga0075362_10039864 | Ga0075362_100398643 | 290 |
| 18 | 3300006844 | Ga0075428_100267586 | Ga0075428_1002675863 | 290 |
| 19 | 3300021377 | Ga0213874_10010728 | Ga0213874_100107284 | 290 |
| 20 | 3300037853 | Ga0436364_1223619 | Ga0436364_1223619_2684_3634 | 290 |
| 21 | 3300050489 | nmdc:mga03683_10234_c2 | nmdc:mga03683_10234_c2_32_970 | 290 |
| 22 | 3300050491 | nmdc:mga00v17_7665_c1 | nmdc:mga00v17_7665_c1_142_1080 | 290 |
| 23 | 3300050492 | nmdc:mga0yw44_1289_c1 | nmdc:mga0yw44_1289_c1_7798_8736 | 290 |
| 24 | 3300050507 | nmdc:mga05p37_287153_c1 | nmdc:mga05p37_287153_c1_185_1123 | 290 |
| 25 | 3300050509 | nmdc:mga0qj67_121416_c1 | nmdc:mga0qj67_121416_c1_1103_2041 | 290 |
| 26 | 3300050511 | nmdc:mga08y16_112037_c1 | nmdc:mga08y16_112037_c1_1439_2377 | 290 |
| 27 | 3300053077 | Ga0495601_0038407 | Ga0495601_0038407_203_1150 | 290 |
| 28 | 3300005530 | Ga0070679_100003933 | Ga0070679_10000393311 | 292 |
| 29 | 3300006173 | Ga0070716_100123649 | Ga0070716_1001236493 | 292 |
| 30 | 3300014497 | Ga0182008_10015082 | Ga0182008_100150825 | 292 |
| 31 | 3300035113 | Ga0373936_0019424 | Ga0373936_0019424_28_909 | 292 |
| 32 | 3300035119 | Ga0373956_0016342 | Ga0373956_0016342_46_927 | 292 |
| 33 | 3300035242 | Ga0373962_0045692 | Ga0373962_0045692_174_1055 | 292 |
| 34 | 3300037068 | Ga0373925_0120850 | Ga0373925_0120850_336_1289 | 292 |
| 35 | 3300039438 | Ga0436360_0904398 | Ga0436360_0904398_27_908 | 292 |
| 36 | 3300045976 | Ga0466967_0816272 | Ga0466967_0816272_28_909 | 292 |
| 37 | 3300046455 | Ga0495603_0204880 | Ga0495603_0204880_46_927 | 292 |
| 38 | 3300046455 | Ga0495603_0244089 | Ga0495603_0244089_46_999 | 292 |
| 39 | 3300046460 | Ga0495638_0022384 | Ga0495638_0022384_2262_3143 | 292 |
| 40 | 3300046475 | Ga0495639_0075581 | Ga0495639_0075581_441_1394 | 292 |
| 41 | 3300046477 | Ga0495664_0199603 | Ga0495664_0199603_257_1138 | 292 |
| 42 | 3300046501 | Ga0495607_0056662 | Ga0495607_0056662_998_1879 | 292 |
| 43 | 3300046513 | Ga0495616_0022264 | Ga0495616_0022264_1788_2669 | 292 |
| 44 | 3300046517 | Ga0495630_0153722 | Ga0495630_0153722_126_1079 | 292 |
| 45 | 3300046522 | Ga0495643_0054647 | Ga0495643_0054647_849_1730 | 292 |
| 46 | 3300046524 | Ga0495648_0137062 | Ga0495648_0137062_220_1101 | 292 |
| 47 | 3300046533 | Ga0495640_0040839 | Ga0495640_0040839_1759_2712 | 292 |
| 48 | 3300046542 | Ga0495597_0071126 | Ga0495597_0071126_471_1352 | 292 |
| 49 | 3300046559 | Ga0495667_0223037 | Ga0495667_0223037_168_1115 | 292 |
| 50 | 3300046642 | Ga0495634_0016827 | Ga0495634_0016827_1615_2568 | 292 |
| 51 | 3300046665 | Ga0495661_0018009 | Ga0495661_0018009_1938_2819 | 292 |
| 52 | 3300046689 | Ga0495613_0188337 | Ga0495613_0188337_40_993 | 292 |
| 53 | 3300046691 | Ga0495670_0112324 | Ga0495670_0112324_421_1302 | 292 |
| 54 | 3300046691 | Ga0495670_0252675 | Ga0495670_0252675_26_907 | 292 |
| 55 | 3300046692 | Ga0495671_0018194 | Ga0495671_0018194_1267_2148 | 292 |
| 56 | 3300047319 | Ga0495674_0083972 | Ga0495674_0083972_1642_2595 | 292 |
| 57 | 3300047321 | Ga0495676_0222726 | Ga0495676_0222726_82_1035 | 292 |
| 58 | 3300047469 | Ga0495673_0058648 | Ga0495673_0058648_36_917 | 292 |
| 59 | 3300047472 | Ga0495686_0033809 | Ga0495686_0033809_1811_2692 | 292 |
| 60 | 3300048909 | Ga0496106_0149332 | Ga0496106_0149332_751_1632 | 292 |
| 61 | 3300048911 | Ga0496108_0036158 | Ga0496108_0036158_17_898 | 292 |
| 62 | 3300048911 | Ga0496108_0406977 | Ga0496108_0406977_79_960 | 292 |
| 63 | 3300048918 | Ga0496115_0068565 | Ga0496115_0068565_587_1561 | 292 |
| 64 | 3300048918 | Ga0496115_0174202 | Ga0496115_0174202_190_1071 | 292 |
| 65 | 3300048919 | Ga0496116_0001913 | Ga0496116_0001913_3746_4627 | 292 |
| 66 | 3300048924 | Ga0496121_0043862 | Ga0496121_0043862_85_966 | 292 |
| 67 | 3300048925 | Ga0496122_0016804 | Ga0496122_0016804_5861_6742 | 292 |
| 68 | 3300048926 | Ga0496123_0031624 | Ga0496123_0031624_1258_2139 | 292 |
| 69 | 3300048927 | Ga0496124_0049528 | Ga0496124_0049528_1713_2594 | 292 |
| 70 | 3300048928 | Ga0496125_0010916 | Ga0496125_0010916_5353_6234 | 292 |
| 71 | 3300048928 | Ga0496125_0038188 | Ga0496125_0038188_1713_2594 | 292 |
| 72 | 3300048929 | Ga0496126_0130655 | Ga0496126_0130655_416_1297 | 292 |
| 73 | 3300050491 | nmdc:mga00v17_18761_c1 | nmdc:mga00v17_18761_c1_1805_2686 | 292 |
| 74 | 3300050492 | nmdc:mga0yw44_6230_c2 | nmdc:mga0yw44_6230_c2_188_1069 | 292 |
| 75 | 3300050492 | nmdc:mga0yw44_99914_c1 | nmdc:mga0yw44_99914_c1_107_988 | 292 |
| 76 | 3300050494 | nmdc:mga06z11_304611_c1 | nmdc:mga06z11_304611_c1_28_909 | 292 |
| 77 | 3300050507 | nmdc:mga05p37_786377_c1 | nmdc:mga05p37_786377_c1_138_1019 | 292 |
| 78 | 3300050512 | nmdc:mga0n895_170644_c1 | nmdc:mga0n895_170644_c1_279_1160 | 292 |
| 79 | 3300050515 | nmdc:mga0a205_502602_c1 | nmdc:mga0a205_502602_c1_177_1058 | 292 |
| 80 | 3300050516 | nmdc:mga0sz30_18017_c1 | nmdc:mga0sz30_18017_c1_1616_2497 | 292 |
| 81 | 3300053077 | Ga0495601_0002639 | Ga0495601_0002639_2086_3039 | 292 |
| 82 | 3300053078 | Ga0495612_0160290 | Ga0495612_0160290_47_928 | 292 |
| 83 | 3300053085 | Ga0495619_0015410 | Ga0495619_0015410_3822_4769 | 292 |
| 84 | 3300053087 | Ga0500643_016954 | Ga0500643_016954_714_1595 | 292 |
| 85 | 3300053104 | Ga0500556_0000069 | Ga0500556_0000069_54953_55834 | 292 |
| 86 | 3300053130 | Ga0500642_0000032 | Ga0500642_0000032_72062_72943 | 292 |
| 87 | 3300053131 | Ga0500652_001281 | Ga0500652_001281_6970_7851 | 292 |
| 88 | 3300053145 | Ga0500586_020181 | Ga0500586_020181_678_1559 | 292 |
| 89 | 3300053151 | Ga0500604_0013468 | Ga0500604_0013468_215_1096 | 292 |
| 90 | 3300053153 | Ga0500616_0000461 | Ga0500616_0000461_6678_7559 | 292 |
| 91 | 3300053156 | Ga0500622_0000602 | Ga0500622_0000602_2199_3080 | 292 |
| 92 | 3300006175 | Ga0070712_100135046 | Ga0070712_1001350461 | 293 |
| 93 | 3300021388 | Ga0213875_10000902 | Ga0213875_1000090210 | 293 |
| 94 | 3300025905 | Ga0207685_10002938 | Ga0207685_100029381 | 293 |
| 95 | 3300025915 | Ga0207693_10088878 | Ga0207693_100888782 | 293 |
| 96 | 3300037853 | Ga0436364_0346238 | Ga0436364_0346238_22041_22967 | 293 |
| 97 | 3300046491 | Ga0495584_0184903 | Ga0495584_0184903_23_904 | 293 |
| 98 | 3300046648 | Ga0495611_0117885 | Ga0495611_0117885_329_1210 | 293 |
| 99 | 3300047469 | Ga0495673_0118071 | Ga0495673_0118071_151_1032 | 293 |
| 100 | 3300048908 | Ga0496105_0275916 | Ga0496105_0275916_287_1231 | 293 |
| 101 | 3300048915 | Ga0496112_0396390 | Ga0496112_0396390_65_1009 | 293 |
| 102 | 3300048917 | Ga0496114_0499580 | Ga0496114_0499580_22_903 | 293 |
| 103 | 3300048925 | Ga0496122_0009319 | Ga0496122_0009319_6758_7705 | 293 |
| 104 | 3300048926 | Ga0496123_0006663 | Ga0496123_0006663_7774_8721 | 293 |
| 105 | 3300050495 | nmdc:mga04h51_137402_c1 | nmdc:mga04h51_137402_c1_13_894 | 293 |
| 106 | 3300053085 | Ga0495619_0010203 | Ga0495619_0010203_2835_3716 | 293 |
| 107 | 3300005341 | Ga0070691_10152793 | Ga0070691_101527932 | 294 |
| 108 | 3300005530 | Ga0070679_100512987 | Ga0070679_1005129872 | 294 |
| 109 | 3300005615 | Ga0070702_100145231 | Ga0070702_1001452312 | 294 |
| 110 | 3300013104 | Ga0157370_10181189 | Ga0157370_101811893 | 294 |
| 111 | 3300014325 | Ga0163163_10004545 | Ga0163163_1000454510 | 294 |
| 112 | 3300021361 | Ga0213872_10068362 | Ga0213872_100683623 | 294 |
| 113 | 3300037312 | Ga0395899_0015112 | Ga0395899_0015112_3749_4681 | 294 |
| 114 | 3300037418 | Ga0395900_0023638 | Ga0395900_0023638_4733_5665 | 294 |
| 115 | 3300037466 | Ga0395898_0045341 | Ga0395898_0045341_570_1502 | 294 |
| 116 | 3300038443 | Ga0395901_0011040 | Ga0395901_0011040_1694_2626 | 294 |
| 117 | 3300039437 | Ga0436365_1685276 | Ga0436365_1685276_71_967 | 294 |
| 118 | 3300007076 | Ga0075435_100200593 | Ga0075435_1002005932 | 295 |
| 119 | 3300010159 | Ga0099796_10044171 | Ga0099796_100441712 | 295 |
| 120 | 3300009545 | Ga0105237_10207419 | Ga0105237_102074192 | 296 |
| 121 | 3300046665 | Ga0495661_0084017 | Ga0495661_0084017_139_1068 | 296 |
| 122 | 3300006844 | Ga0075428_100026465 | Ga0075428_1000264652 | 297 |
| 123 | 3300006844 | Ga0075428_100079610 | Ga0075428_1000796103 | 297 |
| 124 | 3300006847 | Ga0075431_100080863 | Ga0075431_1000808632 | 297 |
| 125 | 3300006852 | Ga0075433_10154365 | Ga0075433_101543653 | 297 |
| 126 | 3300006871 | Ga0075434_100170360 | Ga0075434_1001703603 | 297 |
| 127 | 3300009176 | Ga0105242_10313825 | Ga0105242_103138252 | 297 |
| 128 | 3300009551 | Ga0105238_10009886 | Ga0105238_100098865 | 297 |
| 129 | 3300027907 | Ga0207428_10146560 | Ga0207428_101465602 | 297 |
| 130 | 3300031239 | Ga0265328_10011006 | Ga0265328_100110065 | 297 |
| 131 | 3300046674 | Ga0495588_0068183 | Ga0495588_0068183_892_1821 | 297 |
| 132 | 3300047319 | Ga0495674_0040498 | Ga0495674_0040498_329_1258 | 297 |
| 133 | 3300050507 | nmdc:mga05p37_115695_c1 | nmdc:mga05p37_115695_c1_850_1797 | 297 |
| 134 | 3300050507 | nmdc:mga05p37_214122_c1 | nmdc:mga05p37_214122_c1_524_1450 | 297 |
| 135 | 3300050508 | nmdc:mga09592_110359_c1 | nmdc:mga09592_110359_c1_532_1458 | 297 |
| 136 | 3300050510 | nmdc:mga06r32_21123_c1 | nmdc:mga06r32_21123_c1_4595_5521 | 297 |
| 137 | 3300050511 | nmdc:mga08y16_244684_c1 | nmdc:mga08y16_244684_c1_410_1336 | 297 |
| 138 | 3300050515 | nmdc:mga0a205_96584_c1 | nmdc:mga0a205_96584_c1_1597_2523 | 297 |
| 139 | 3300053077 | Ga0495601_0025844 | Ga0495601_0025844_2682_3611 | 297 |
| 140 | 3300005290 | Ga0065712_10090736 | Ga0065712_100907363 | 298 |
| 141 | 3300005329 | Ga0070683_100011551 | Ga0070683_1000115514 | 298 |
| 142 | 3300005336 | Ga0070680_100003194 | Ga0070680_1000031942 | 298 |
| 143 | 3300005344 | Ga0070661_100126323 | Ga0070661_1001263231 | 298 |
| 144 | 3300005355 | Ga0070671_100123457 | Ga0070671_1001234572 | 298 |
| 145 | 3300005434 | Ga0070709_10023800 | Ga0070709_100238003 | 298 |
| 146 | 3300005435 | Ga0070714_100204543 | Ga0070714_1002045433 | 298 |
| 147 | 3300005436 | Ga0070713_100104854 | Ga0070713_1001048544 | 298 |
| 148 | 3300005467 | Ga0070706_100093672 | Ga0070706_1000936723 | 298 |
| 149 | 3300005535 | Ga0070684_100004390 | Ga0070684_10000439010 | 298 |
| 150 | 3300005547 | Ga0070693_100224641 | Ga0070693_1002246412 | 298 |
| 151 | 3300005577 | Ga0068857_100004623 | Ga0068857_1000046233 | 298 |
| 152 | 3300005834 | Ga0068851_10013394 | Ga0068851_100133942 | 298 |
| 153 | 3300005937 | Ga0081455_10044794 | Ga0081455_100447943 | 298 |
| 154 | 3300006028 | Ga0070717_10066392 | Ga0070717_100663923 | 298 |
| 155 | 3300006038 | Ga0075365_10054563 | Ga0075365_100545634 | 298 |
| 156 | 3300006038 | Ga0075365_10152188 | Ga0075365_101521882 | 298 |
| 157 | 3300006051 | Ga0075364_10158324 | Ga0075364_101583242 | 298 |
| 158 | 3300006163 | Ga0070715_10065594 | Ga0070715_100655943 | 298 |
| 159 | 3300006178 | Ga0075367_10157837 | Ga0075367_101578372 | 298 |
| 160 | 3300006871 | Ga0075434_100054546 | Ga0075434_1000545462 | 298 |
| 161 | 3300009147 | Ga0114129_10265232 | Ga0114129_102652323 | 298 |
| 162 | 3300009545 | Ga0105237_10008888 | Ga0105237_100088882 | 298 |
| 163 | 3300009545 | Ga0105237_10059562 | Ga0105237_100595624 | 298 |
| 164 | 3300009551 | Ga0105238_10005132 | Ga0105238_100051323 | 298 |
| 165 | 3300013104 | Ga0157370_10008947 | Ga0157370_100089476 | 298 |
| 166 | 3300013105 | Ga0157369_10049936 | Ga0157369_100499365 | 298 |
| 167 | 3300013307 | Ga0157372_10167444 | Ga0157372_101674442 | 298 |
| 168 | 3300025898 | Ga0207692_10030503 | Ga0207692_100305033 | 298 |
| 169 | 3300025905 | Ga0207685_10041009 | Ga0207685_100410091 | 298 |
| 170 | 3300025906 | Ga0207699_10021454 | Ga0207699_100214545 | 298 |
| 171 | 3300025906 | Ga0207699_10051062 | Ga0207699_100510621 | 298 |
| 172 | 3300025909 | Ga0207705_10086970 | Ga0207705_100869703 | 298 |
| 173 | 3300025912 | Ga0207707_10001229 | Ga0207707_1000122911 | 298 |
| 174 | 3300025913 | Ga0207695_10106569 | Ga0207695_101065692 | 298 |
| 175 | 3300025914 | Ga0207671_10020103 | Ga0207671_100201036 | 298 |
| 176 | 3300025915 | Ga0207693_10097479 | Ga0207693_100974791 | 298 |
| 177 | 3300025916 | Ga0207663_10047065 | Ga0207663_100470652 | 298 |
| 178 | 3300025919 | Ga0207657_10000658 | Ga0207657_1000065827 | 298 |
| 179 | 3300025921 | Ga0207652_10003041 | Ga0207652_1000304113 | 298 |
| 180 | 3300025928 | Ga0207700_10078191 | Ga0207700_100781914 | 298 |
| 181 | 3300025928 | Ga0207700_10118403 | Ga0207700_101184033 | 298 |
| 182 | 3300025928 | Ga0207700_10185390 | Ga0207700_101853901 | 298 |
| 183 | 3300025929 | Ga0207664_10067320 | Ga0207664_100673204 | 298 |
| 184 | 3300025929 | Ga0207664_10256089 | Ga0207664_102560893 | 298 |
| 185 | 3300025932 | Ga0207690_10095851 | Ga0207690_100958511 | 298 |
| 186 | 3300025933 | Ga0207706_10060204 | Ga0207706_100602042 | 298 |
| 187 | 3300025939 | Ga0207665_10028857 | Ga0207665_100288573 | 298 |
| 188 | 3300025939 | Ga0207665_10096918 | Ga0207665_100969183 | 298 |
| 189 | 3300025944 | Ga0207661_10032605 | Ga0207661_100326053 | 298 |
| 190 | 3300025949 | Ga0207667_10112938 | Ga0207667_101129381 | 298 |
| 191 | 3300026116 | Ga0207674_10052044 | Ga0207674_100520443 | 298 |
| 192 | 3300037068 | Ga0373925_0120437 | Ga0373925_0120437_312_1253 | 298 |
| 193 | 3300039447 | Ga0436361_0774027 | Ga0436361_0774027_1566_2504 | 298 |
| 194 | 3300046460 | Ga0495638_0032269 | Ga0495638_0032269_1201_2136 | 298 |
| 195 | 3300046491 | Ga0495584_0005529 | Ga0495584_0005529_4687_5622 | 298 |
| 196 | 3300046491 | Ga0495584_0053845 | Ga0495584_0053845_273_1211 | 298 |
| 197 | 3300046492 | Ga0495585_0056176 | Ga0495585_0056176_785_1723 | 298 |
| 198 | 3300046501 | Ga0495607_0129517 | Ga0495607_0129517_289_1227 | 298 |
| 199 | 3300046557 | Ga0495622_0146030 | Ga0495622_0146030_60_998 | 298 |
| 200 | 3300046615 | Ga0495656_0010606 | Ga0495656_0010606_2249_3187 | 298 |
| 201 | 3300046691 | Ga0495670_0050592 | Ga0495670_0050592_624_1562 | 298 |
| 202 | 3300046692 | Ga0495671_0081679 | Ga0495671_0081679_266_1204 | 298 |
| 203 | 3300048904 | Ga0496101_0079431 | Ga0496101_0079431_1203_2141 | 298 |
| 204 | 3300048905 | Ga0496102_0229022 | Ga0496102_0229022_730_1668 | 298 |
| 205 | 3300048906 | Ga0496103_0145741 | Ga0496103_0145741_125_1069 | 298 |
| 206 | 3300048908 | Ga0496105_0068948 | Ga0496105_0068948_1746_2690 | 298 |
| 207 | 3300048909 | Ga0496106_0135536 | Ga0496106_0135536_104_1054 | 298 |
| 208 | 3300048910 | Ga0496107_0113202 | Ga0496107_0113202_979_1917 | 298 |
| 209 | 3300048914 | Ga0496111_0269072 | Ga0496111_0269072_84_1022 | 298 |
| 210 | 3300048916 | Ga0496113_0384140 | Ga0496113_0384140_111_1043 | 298 |
| 211 | 3300048917 | Ga0496114_0136841 | Ga0496114_0136841_897_1841 | 298 |
| 212 | 3300048917 | Ga0496114_0183601 | Ga0496114_0183601_575_1516 | 298 |
| 213 | 3300048918 | Ga0496115_0200483 | Ga0496115_0200483_343_1275 | 298 |
| 214 | 3300049571 | Ga0501034_0284032 | Ga0501034_0284032_29_958 | 298 |
| 215 | 3300049583 | Ga0501067_0027796 | Ga0501067_0027796_1140_2069 | 298 |
| 216 | 3300049586 | Ga0501070_0035395 | Ga0501070_0035395_1488_2417 | 298 |
| 217 | 3300049589 | Ga0501073_0027417 | Ga0501073_0027417_2971_3900 | 298 |
| 218 | 3300049590 | Ga0501074_0115382 | Ga0501074_0115382_434_1363 | 298 |
| 219 | 3300049742 | Ga0501080_0056270 | Ga0501080_0056270_436_1365 | 298 |
| 220 | 3300049823 | Ga0501044_0048264 | Ga0501044_0048264_236_1165 | 298 |
| 221 | 3300050507 | nmdc:mga05p37_190261_c1 | nmdc:mga05p37_190261_c1_608_1546 | 298 |
| 222 | 3300050508 | nmdc:mga09592_270300_c1 | nmdc:mga09592_270300_c1_139_1077 | 298 |
| 223 | 3300050512 | nmdc:mga0n895_399571_c1 | nmdc:mga0n895_399571_c1_24_962 | 298 |
| 224 | 3300053119 | Ga0500595_007199 | Ga0500595_007199_2335_3279 | 298 |
| 225 | 3300005340 | Ga0070689_100228857 | Ga0070689_1002288572 | 299 |
| 226 | 3300005355 | Ga0070671_100231660 | Ga0070671_1002316602 | 299 |
| 227 | 3300005438 | Ga0070701_10097009 | Ga0070701_100970092 | 299 |
| 228 | 3300005439 | Ga0070711_100210234 | Ga0070711_1002102342 | 299 |
| 229 | 3300005539 | Ga0068853_100308793 | Ga0068853_1003087931 | 299 |
| 230 | 3300005564 | Ga0070664_100112833 | Ga0070664_1001128333 | 299 |
| 231 | 3300005842 | Ga0068858_100129319 | Ga0068858_1001293194 | 299 |
| 232 | 3300006358 | Ga0068871_100394270 | Ga0068871_1003942702 | 299 |
| 233 | 3300009094 | Ga0111539_10048617 | Ga0111539_100486174 | 299 |
| 234 | 3300009147 | Ga0114129_10185593 | Ga0114129_101855934 | 299 |
| 235 | 3300009147 | Ga0114129_10346200 | Ga0114129_103462002 | 299 |
| 236 | 3300013306 | Ga0163162_10658319 | Ga0163162_106583192 | 299 |
| 237 | 3300025925 | Ga0207650_10048647 | Ga0207650_100486474 | 299 |
| 238 | 3300025937 | Ga0207669_10120499 | Ga0207669_101204992 | 299 |
| 239 | 3300026035 | Ga0207703_10087184 | Ga0207703_100871841 | 299 |
| 240 | 3300027907 | Ga0207428_10111008 | Ga0207428_101110082 | 299 |
| 241 | 3300035083 | Ga0373926_0046762 | Ga0373926_0046762_140_1078 | 299 |
| 242 | 3300035089 | Ga0373944_0025007 | Ga0373944_0025007_753_1691 | 299 |
| 243 | 3300035113 | Ga0373936_0015788 | Ga0373936_0015788_1315_2253 | 299 |
| 244 | 3300035116 | Ga0373945_0024554 | Ga0373945_0024554_675_1613 | 299 |
| 245 | 3300035170 | Ga0373943_0011869 | Ga0373943_0011869_950_1888 | 299 |
| 246 | 3300035171 | Ga0373946_0085654 | Ga0373946_0085654_160_1098 | 299 |
| 247 | 3300035172 | Ga0373955_0147015 | Ga0373955_0147015_71_1009 | 299 |
| 248 | 3300035692 | Ga0373935_0031087 | Ga0373935_0031087_1434_2372 | 299 |
| 249 | 3300035695 | Ga0373927_0130957 | Ga0373927_0130957_666_1604 | 299 |
| 250 | 3300035725 | Ga0373947_0061898 | Ga0373947_0061898_609_1547 | 299 |
| 251 | 3300035725 | Ga0373947_0081521 | Ga0373947_0081521_478_1422 | 299 |
| 252 | 3300037068 | Ga0373925_0192515 | Ga0373925_0192515_113_1051 | 299 |
| 253 | 3300046455 | Ga0495603_0027225 | Ga0495603_0027225_1566_2504 | 299 |
| 254 | 3300046459 | Ga0495629_0044721 | Ga0495629_0044721_347_1285 | 299 |
| 255 | 3300046461 | Ga0495641_0047082 | Ga0495641_0047082_567_1505 | 299 |
| 256 | 3300046472 | Ga0495580_0015783 | Ga0495580_0015783_1550_2488 | 299 |
| 257 | 3300046473 | Ga0495582_0036962 | Ga0495582_0036962_1281_2219 | 299 |
| 258 | 3300046475 | Ga0495639_0017148 | Ga0495639_0017148_944_1882 | 299 |
| 259 | 3300046476 | Ga0495662_0060984 | Ga0495662_0060984_496_1440 | 299 |
| 260 | 3300046491 | Ga0495584_0015148 | Ga0495584_0015148_2081_3019 | 299 |
| 261 | 3300046492 | Ga0495585_0026524 | Ga0495585_0026524_441_1379 | 299 |
| 262 | 3300046499 | Ga0495594_0068333 | Ga0495594_0068333_418_1356 | 299 |
| 263 | 3300046514 | Ga0495618_0314335 | Ga0495618_0314335_11_949 | 299 |
| 264 | 3300046523 | Ga0495644_0023731 | Ga0495644_0023731_1327_2265 | 299 |
| 265 | 3300046531 | Ga0495665_0119526 | Ga0495665_0119526_350_1288 | 299 |
| 266 | 3300046533 | Ga0495640_0070785 | Ga0495640_0070785_1316_2260 | 299 |
| 267 | 3300046537 | Ga0495598_0001524 | Ga0495598_0001524_1962_2900 | 299 |
| 268 | 3300046538 | Ga0495609_0110258 | Ga0495609_0110258_144_1082 | 299 |
| 269 | 3300046539 | Ga0495621_0045437 | Ga0495621_0045437_545_1483 | 299 |
| 270 | 3300046615 | Ga0495656_0004934 | Ga0495656_0004934_2048_2986 | 299 |
| 271 | 3300046663 | Ga0495635_0225741 | Ga0495635_0225741_289_1233 | 299 |
| 272 | 3300046674 | Ga0495588_0070600 | Ga0495588_0070600_461_1399 | 299 |
| 273 | 3300046681 | Ga0495647_0020275 | Ga0495647_0020275_1075_2013 | 299 |
| 274 | 3300046683 | Ga0495658_0093002 | Ga0495658_0093002_767_1705 | 299 |
| 275 | 3300046809 | Ga0495600_0241579 | Ga0495600_0241579_167_1105 | 299 |
| 276 | 3300047315 | Ga0495581_0029409 | Ga0495581_0029409_476_1414 | 299 |
| 277 | 3300047315 | Ga0495581_0080467 | Ga0495581_0080467_491_1435 | 299 |
| 278 | 3300047319 | Ga0495674_0111784 | Ga0495674_0111784_463_1401 | 299 |
| 279 | 3300047323 | Ga0495683_0065575 | Ga0495683_0065575_827_1765 | 299 |
| 280 | 3300047673 | Ga0495593_0093590 | Ga0495593_0093590_501_1439 | 299 |
| 281 | 3300048903 | Ga0496100_0117942 | Ga0496100_0117942_136_1080 | 299 |
| 282 | 3300048904 | Ga0496101_0074262 | Ga0496101_0074262_935_1873 | 299 |
| 283 | 3300048905 | Ga0496102_0111497 | Ga0496102_0111497_420_1358 | 299 |
| 284 | 3300048910 | Ga0496107_0060779 | Ga0496107_0060779_303_1241 | 299 |
| 285 | 3300048911 | Ga0496108_0041472 | Ga0496108_0041472_1983_2927 | 299 |
| 286 | 3300048912 | Ga0496109_0001620 | Ga0496109_0001620_15892_16836 | 299 |
| 287 | 3300048915 | Ga0496112_0083809 | Ga0496112_0083809_551_1495 | 299 |
| 288 | 3300048916 | Ga0496113_0020026 | Ga0496113_0020026_1746_2690 | 299 |
| 289 | 3300049588 | Ga0501072_0142676 | Ga0501072_0142676_659_1591 | 299 |
| 290 | 3300050507 | nmdc:mga05p37_190426_c1 | nmdc:mga05p37_190426_c1_1417_2361 | 299 |
| 291 | 3300050511 | nmdc:mga08y16_53774_c1 | nmdc:mga08y16_53774_c1_2908_3846 | 299 |
| 292 | 3300050512 | nmdc:mga0n895_240452_c1 | nmdc:mga0n895_240452_c1_275_1213 | 299 |
| 293 | 3300053085 | Ga0495619_0046742 | Ga0495619_0046742_245_1183 | 299 |
| 294 | 3300054114 | Ga0501084_0357611 | Ga0501084_0357611_60_992 | 299 |
| 295 | 3300005262 | Ga0065165_1002727 | Ga0065165_10027275 | 300 |
| 296 | 3300005331 | Ga0070670_100019180 | Ga0070670_1000191803 | 300 |
| 297 | 3300005445 | Ga0070708_100430775 | Ga0070708_1004307751 | 300 |
| 298 | 3300005467 | Ga0070706_100519681 | Ga0070706_1005196812 | 300 |
| 299 | 3300005471 | Ga0070698_100378137 | Ga0070698_1003781371 | 300 |
| 300 | 3300005614 | Ga0068856_100385102 | Ga0068856_1003851021 | 300 |
| 301 | 3300006038 | Ga0075365_10024117 | Ga0075365_100241174 | 300 |
| 302 | 3300007788 | Ga0099795_10011722 | Ga0099795_100117223 | 300 |
| 303 | 3300009094 | Ga0111539_10182131 | Ga0111539_101821312 | 300 |
| 304 | 3300009098 | Ga0105245_10374432 | Ga0105245_103744321 | 300 |
| 305 | 3300009553 | Ga0105249_10390340 | Ga0105249_103903401 | 300 |
| 306 | 3300010159 | Ga0099796_10083612 | Ga0099796_100836121 | 300 |
| 307 | 3300011119 | Ga0105246_10132191 | Ga0105246_101321912 | 300 |
| 308 | 3300013306 | Ga0163162_10068601 | Ga0163162_100686013 | 300 |
| 309 | 3300014325 | Ga0163163_10020333 | Ga0163163_100203335 | 300 |
| 310 | 3300021384 | Ga0213876_10001034 | Ga0213876_100010347 | 300 |
| 311 | 3300021388 | Ga0213875_10010291 | Ga0213875_100102912 | 300 |
| 312 | 3300025302 | Ga0207426_1000620 | Ga0207426_100062029 | 300 |
| 313 | 3300025915 | Ga0207693_10131365 | Ga0207693_101313652 | 300 |
| 314 | 3300025925 | Ga0207650_10131962 | Ga0207650_101319622 | 300 |
| 315 | 3300025932 | Ga0207690_10240626 | Ga0207690_102406262 | 300 |
| 316 | 3300025941 | Ga0207711_10316412 | Ga0207711_103164122 | 300 |
| 317 | 3300027512 | Ga0209179_1001865 | Ga0209179_10018653 | 300 |
| 318 | 3300028381 | Ga0268264_10764044 | Ga0268264_107640441 | 300 |
| 319 | 3300028800 | Ga0265338_10073271 | Ga0265338_100732713 | 300 |
| 320 | 3300031090 | Ga0265760_10020199 | Ga0265760_100201992 | 300 |
| 321 | 3300031235 | Ga0265330_10031043 | Ga0265330_100310432 | 300 |
| 322 | 3300031239 | Ga0265328_10000014 | Ga0265328_1000001496 | 300 |
| 323 | 3300031249 | Ga0265339_10063362 | Ga0265339_100633623 | 300 |
| 324 | 3300031250 | Ga0265331_10003191 | Ga0265331_100031919 | 300 |
| 325 | 3300035086 | Ga0373934_0062699 | Ga0373934_0062699_82_1011 | 300 |
| 326 | 3300035089 | Ga0373944_0009808 | Ga0373944_0009808_1218_2147 | 300 |
| 327 | 3300035111 | Ga0373923_0019915 | Ga0373923_0019915_1545_2474 | 300 |
| 328 | 3300035113 | Ga0373936_0016211 | Ga0373936_0016211_291_1220 | 300 |
| 329 | 3300035116 | Ga0373945_0030588 | Ga0373945_0030588_918_1847 | 300 |
| 330 | 3300035118 | Ga0373954_0040850 | Ga0373954_0040850_429_1358 | 300 |
| 331 | 3300035119 | Ga0373956_0032843 | Ga0373956_0032843_834_1769 | 300 |
| 332 | 3300035119 | Ga0373956_0111027 | Ga0373956_0111027_221_1150 | 300 |
| 333 | 3300035170 | Ga0373943_0082205 | Ga0373943_0082205_265_1203 | 300 |
| 334 | 3300035171 | Ga0373946_0009193 | Ga0373946_0009193_762_1691 | 300 |
| 335 | 3300035171 | Ga0373946_0095151 | Ga0373946_0095151_133_1071 | 300 |
| 336 | 3300035172 | Ga0373955_0035254 | Ga0373955_0035254_1275_2204 | 300 |
| 337 | 3300035692 | Ga0373935_0024166 | Ga0373935_0024166_1940_2869 | 300 |
| 338 | 3300035724 | Ga0373933_0041100 | Ga0373933_0041100_638_1567 | 300 |
| 339 | 3300036401 | Ga0373937_0101871 | Ga0373937_0101871_1269_2198 | 300 |
| 340 | 3300036401 | Ga0373937_0184857 | Ga0373937_0184857_541_1470 | 300 |
| 341 | 3300037068 | Ga0373925_0009548 | Ga0373925_0009548_4460_5389 | 300 |
| 342 | 3300037068 | Ga0373925_0162551 | Ga0373925_0162551_688_1626 | 300 |
| 343 | 3300037068 | Ga0373925_0414047 | Ga0373925_0414047_10_948 | 300 |
| 344 | 3300039447 | Ga0436361_0458971 | Ga0436361_0458971_212_1147 | 300 |
| 345 | 3300044694 | Ga0466963_0010492 | Ga0466963_0010492_3649_4581 | 300 |
| 346 | 3300045976 | Ga0466967_0006446 | Ga0466967_0006446_357_1289 | 300 |
| 347 | 3300046454 | Ga0495592_0192931 | Ga0495592_0192931_401_1330 | 300 |
| 348 | 3300046455 | Ga0495603_0119435 | Ga0495603_0119435_357_1295 | 300 |
| 349 | 3300046459 | Ga0495629_0003645 | Ga0495629_0003645_4572_5501 | 300 |
| 350 | 3300046461 | Ga0495641_0020070 | Ga0495641_0020070_1697_2626 | 300 |
| 351 | 3300046462 | Ga0495651_0033843 | Ga0495651_0033843_1079_2008 | 300 |
| 352 | 3300046463 | Ga0495653_0040572 | Ga0495653_0040572_2261_3190 | 300 |
| 353 | 3300046473 | Ga0495582_0052564 | Ga0495582_0052564_355_1293 | 300 |
| 354 | 3300046473 | Ga0495582_0055744 | Ga0495582_0055744_466_1395 | 300 |
| 355 | 3300046476 | Ga0495662_0004509 | Ga0495662_0004509_2134_3063 | 300 |
| 356 | 3300046491 | Ga0495584_0016934 | Ga0495584_0016934_48_986 | 300 |
| 357 | 3300046492 | Ga0495585_0030890 | Ga0495585_0030890_883_1821 | 300 |
| 358 | 3300046511 | Ga0495608_0014419 | Ga0495608_0014419_3360_4289 | 300 |
| 359 | 3300046514 | Ga0495618_0003470 | Ga0495618_0003470_8723_9652 | 300 |
| 360 | 3300046516 | Ga0495628_0056590 | Ga0495628_0056590_512_1441 | 300 |
| 361 | 3300046516 | Ga0495628_0108961 | Ga0495628_0108961_235_1170 | 300 |
| 362 | 3300046517 | Ga0495630_0067130 | Ga0495630_0067130_734_1663 | 300 |
| 363 | 3300046523 | Ga0495644_0094647 | Ga0495644_0094647_155_1084 | 300 |
| 364 | 3300046524 | Ga0495648_0026326 | Ga0495648_0026326_1184_2131 | 300 |
| 365 | 3300046529 | Ga0495652_0021349 | Ga0495652_0021349_4123_5052 | 300 |
| 366 | 3300046533 | Ga0495640_0067651 | Ga0495640_0067651_284_1213 | 300 |
| 367 | 3300046535 | Ga0495586_0039863 | Ga0495586_0039863_78_1007 | 300 |
| 368 | 3300046536 | Ga0495587_0044655 | Ga0495587_0044655_291_1220 | 300 |
| 369 | 3300046537 | Ga0495598_0085668 | Ga0495598_0085668_26_955 | 300 |
| 370 | 3300046543 | Ga0495645_0134405 | Ga0495645_0134405_142_1071 | 300 |
| 371 | 3300046559 | Ga0495667_0020988 | Ga0495667_0020988_2822_3751 | 300 |
| 372 | 3300046642 | Ga0495634_0073645 | Ga0495634_0073645_1033_1962 | 300 |
| 373 | 3300046663 | Ga0495635_0001519 | Ga0495635_0001519_3190_4119 | 300 |
| 374 | 3300046674 | Ga0495588_0016581 | Ga0495588_0016581_2167_3096 | 300 |
| 375 | 3300046674 | Ga0495588_0120757 | Ga0495588_0120757_341_1279 | 300 |
| 376 | 3300046675 | Ga0495657_0042701 | Ga0495657_0042701_260_1189 | 300 |
| 377 | 3300046678 | Ga0495599_0041117 | Ga0495599_0041117_1705_2634 | 300 |
| 378 | 3300046679 | Ga0495623_0072950 | Ga0495623_0072950_934_1863 | 300 |
| 379 | 3300046683 | Ga0495658_0028537 | Ga0495658_0028537_1809_2747 | 300 |
| 380 | 3300046689 | Ga0495613_0020761 | Ga0495613_0020761_3391_4320 | 300 |
| 381 | 3300046690 | Ga0495624_0050701 | Ga0495624_0050701_507_1436 | 300 |
| 382 | 3300046691 | Ga0495670_0139497 | Ga0495670_0139497_183_1112 | 300 |
| 383 | 3300046809 | Ga0495600_0011929 | Ga0495600_0011929_1024_1953 | 300 |
| 384 | 3300047317 | Ga0495604_0031834 | Ga0495604_0031834_1132_2061 | 300 |
| 385 | 3300047319 | Ga0495674_0014830 | Ga0495674_0014830_6220_7149 | 300 |
| 386 | 3300047321 | Ga0495676_0034215 | Ga0495676_0034215_2789_3727 | 300 |
| 387 | 3300047322 | Ga0495680_0005583 | Ga0495680_0005583_3692_4621 | 300 |
| 388 | 3300047444 | Ga0495675_0076330 | Ga0495675_0076330_1167_2096 | 300 |
| 389 | 3300047471 | Ga0495684_0012905 | Ga0495684_0012905_1058_1987 | 300 |
| 390 | 3300047673 | Ga0495593_0013832 | Ga0495593_0013832_1547_2476 | 300 |
| 391 | 3300048088 | Ga0495602_0193942 | Ga0495602_0193942_142_1071 | 300 |
| 392 | 3300048907 | Ga0496104_0023859 | Ga0496104_0023859_683_1621 | 300 |
| 393 | 3300048908 | Ga0496105_0051704 | Ga0496105_0051704_1111_2058 | 300 |
| 394 | 3300048908 | Ga0496105_0168437 | Ga0496105_0168437_418_1356 | 300 |
| 395 | 3300048911 | Ga0496108_0011304 | Ga0496108_0011304_5826_6764 | 300 |
| 396 | 3300048911 | Ga0496108_0011769 | Ga0496108_0011769_3733_4680 | 300 |
| 397 | 3300048912 | Ga0496109_0005500 | Ga0496109_0005500_506_1444 | 300 |
| 398 | 3300048913 | Ga0496110_0004983 | Ga0496110_0004983_3244_4182 | 300 |
| 399 | 3300048913 | Ga0496110_0024066 | Ga0496110_0024066_2044_2991 | 300 |
| 400 | 3300048914 | Ga0496111_0020473 | Ga0496111_0020473_2816_3754 | 300 |
| 401 | 3300048915 | Ga0496112_0005098 | Ga0496112_0005098_2765_3703 | 300 |
| 402 | 3300048915 | Ga0496112_0124964 | Ga0496112_0124964_115_1062 | 300 |
| 403 | 3300048916 | Ga0496113_0001469 | Ga0496113_0001469_7022_7960 | 300 |
| 404 | 3300048916 | Ga0496113_0089336 | Ga0496113_0089336_210_1157 | 300 |
| 405 | 3300049588 | Ga0501072_0063369 | Ga0501072_0063369_1837_2766 | 300 |
| 406 | 3300050492 | nmdc:mga0yw44_196826_c1 | nmdc:mga0yw44_196826_c1_178_1116 | 300 |
| 407 | 3300053077 | Ga0495601_0019700 | Ga0495601_0019700_2905_3834 | 300 |
| 408 | 3300053078 | Ga0495612_0008658 | Ga0495612_0008658_2394_3323 | 300 |
| 409 | 3300053084 | Ga0495595_0011645 | Ga0495595_0011645_1074_2003 | 300 |
| 410 | 3300053084 | Ga0495595_0024819 | Ga0495595_0024819_213_1148 | 300 |
| 411 | 3300053084 | Ga0495595_0138821 | Ga0495595_0138821_35_991 | 300 |
| 412 | 3300053085 | Ga0495619_0045284 | Ga0495619_0045284_1678_2607 | 300 |
| 413 | 3300053087 | Ga0500643_007887 | Ga0500643_007887_2135_3064 | 300 |
| 414 | 3300053094 | Ga0500566_0020614 | Ga0500566_0020614_1355_2284 | 300 |
| 415 | 3300053728 | Ga0500657_021837 | Ga0500657_021837_1763_2692 | 300 |
| 416 | 3300005356 | Ga0070674_100418330 | Ga0070674_1004183301 | 301 |
| 417 | 3300005365 | Ga0070688_100009486 | Ga0070688_1000094863 | 301 |
| 418 | 3300005455 | Ga0070663_100274661 | Ga0070663_1002746612 | 301 |
| 419 | 3300005456 | Ga0070678_100075509 | Ga0070678_1000755093 | 301 |
| 420 | 3300005457 | Ga0070662_100014566 | Ga0070662_1000145666 | 301 |
| 421 | 3300005466 | Ga0070685_10079820 | Ga0070685_100798203 | 301 |
| 422 | 3300005518 | Ga0070699_100020399 | Ga0070699_1000203996 | 301 |
| 423 | 3300005544 | Ga0070686_100120031 | Ga0070686_1001200311 | 301 |
| 424 | 3300005618 | Ga0068864_100032645 | Ga0068864_1000326455 | 301 |
| 425 | 3300006173 | Ga0070716_100103910 | Ga0070716_1001039102 | 301 |
| 426 | 3300009176 | Ga0105242_10203400 | Ga0105242_102034001 | 301 |
| 427 | 3300009177 | Ga0105248_10038782 | Ga0105248_100387826 | 301 |
| 428 | 3300009177 | Ga0105248_10194247 | Ga0105248_101942472 | 301 |
| 429 | 3300009551 | Ga0105238_10254680 | Ga0105238_102546802 | 301 |
| 430 | 3300011119 | Ga0105246_10146800 | Ga0105246_101468003 | 301 |
| 431 | 3300013308 | Ga0157375_10264780 | Ga0157375_102647801 | 301 |
| 432 | 3300014325 | Ga0163163_10496919 | Ga0163163_104969192 | 301 |
| 433 | 3300025899 | Ga0207642_10030124 | Ga0207642_100301242 | 301 |
| 434 | 3300025901 | Ga0207688_10084804 | Ga0207688_100848043 | 301 |
| 435 | 3300025923 | Ga0207681_10037411 | Ga0207681_100374113 | 301 |
| 436 | 3300025933 | Ga0207706_10027569 | Ga0207706_100275692 | 301 |
| 437 | 3300025934 | Ga0207686_10069432 | Ga0207686_100694323 | 301 |
| 438 | 3300025939 | Ga0207665_10057788 | Ga0207665_100577882 | 301 |
| 439 | 3300025941 | Ga0207711_10088461 | Ga0207711_100884613 | 301 |
| 440 | 3300025960 | Ga0207651_10262647 | Ga0207651_102626472 | 301 |
| 441 | 3300025986 | Ga0207658_10080461 | Ga0207658_100804613 | 301 |
| 442 | 3300026035 | Ga0207703_10083894 | Ga0207703_100838942 | 301 |
| 443 | 3300026095 | Ga0207676_10073278 | Ga0207676_100732784 | 301 |
| 444 | 3300026118 | Ga0207675_100261455 | Ga0207675_1002614553 | 301 |
| 445 | 3300026121 | Ga0207683_10080288 | Ga0207683_100802883 | 301 |
| 446 | 3300026142 | Ga0207698_10404606 | Ga0207698_104046062 | 301 |
| 447 | 3300028023 | Ga0265357_1001321 | Ga0265357_10013213 | 301 |
| 448 | 3300028556 | Ga0265337_1000412 | Ga0265337_100041222 | 301 |
| 449 | 3300031247 | Ga0265340_10029731 | Ga0265340_100297313 | 301 |
| 450 | 3300034817 | Ga0373948_0026685 | Ga0373948_0026685_123_1064 | 301 |
| 451 | 3300034820 | Ga0373959_0011219 | Ga0373959_0011219_415_1377 | 301 |
| 452 | 3300035085 | Ga0373929_0005008 | Ga0373929_0005008_46_987 | 301 |
| 453 | 3300035172 | Ga0373955_0066836 | Ga0373955_0066836_777_1706 | 301 |
| 454 | 3300035691 | Ga0373931_0120592 | Ga0373931_0120592_286_1227 | 301 |
| 455 | 3300035724 | Ga0373933_0026628 | Ga0373933_0026628_1436_2365 | 301 |
| 456 | 3300036401 | Ga0373937_0039454 | Ga0373937_0039454_2375_3304 | 301 |
| 457 | 3300037466 | Ga0395898_0081007 | Ga0395898_0081007_904_1848 | 301 |
| 458 | 3300046663 | Ga0495635_0141557 | Ga0495635_0141557_632_1561 | 301 |
| 459 | 3300047444 | Ga0495675_0207036 | Ga0495675_0207036_113_1042 | 301 |
| 460 | 3300048903 | Ga0496100_0004573 | Ga0496100_0004573_5062_6003 | 301 |
| 461 | 3300048903 | Ga0496100_0028425 | Ga0496100_0028425_1262_2197 | 301 |
| 462 | 3300048904 | Ga0496101_0008538 | Ga0496101_0008538_3237_4178 | 301 |
| 463 | 3300048905 | Ga0496102_0022051 | Ga0496102_0022051_3083_4024 | 301 |
| 464 | 3300048907 | Ga0496104_0005685 | Ga0496104_0005685_3406_4341 | 301 |
| 465 | 3300048907 | Ga0496104_0014292 | Ga0496104_0014292_1592_2533 | 301 |
| 466 | 3300048908 | Ga0496105_0008654 | Ga0496105_0008654_6894_7829 | 301 |
| 467 | 3300048908 | Ga0496105_0032948 | Ga0496105_0032948_261_1202 | 301 |
| 468 | 3300048910 | Ga0496107_0016125 | Ga0496107_0016125_3981_4922 | 301 |
| 469 | 3300048911 | Ga0496108_0018897 | Ga0496108_0018897_1138_2073 | 301 |
| 470 | 3300048912 | Ga0496109_0000377 | Ga0496109_0000377_2423_3358 | 301 |
| 471 | 3300048912 | Ga0496109_0033408 | Ga0496109_0033408_452_1393 | 301 |
| 472 | 3300048914 | Ga0496111_0009981 | Ga0496111_0009981_5171_6106 | 301 |
| 473 | 3300048914 | Ga0496111_0013193 | Ga0496111_0013193_2064_3005 | 301 |
| 474 | 3300048915 | Ga0496112_0009154 | Ga0496112_0009154_3406_4341 | 301 |
| 475 | 3300048915 | Ga0496112_0079947 | Ga0496112_0079947_2183_3124 | 301 |
| 476 | 3300048916 | Ga0496113_0008097 | Ga0496113_0008097_3086_4048 | 301 |
| 477 | 3300048916 | Ga0496113_0083058 | Ga0496113_0083058_404_1345 | 301 |
| 478 | 3300048917 | Ga0496114_0021241 | Ga0496114_0021241_2986_3927 | 301 |
| 479 | 3300048918 | Ga0496115_0056716 | Ga0496115_0056716_2049_2984 | 301 |
| 480 | 3300048918 | Ga0496115_0056752 | Ga0496115_0056752_314_1255 | 301 |
| 481 | 3300053084 | Ga0495595_0010987 | Ga0495595_0010987_913_1842 | 301 |
| 482 | 3300053085 | Ga0495619_0014586 | Ga0495619_0014586_1731_2660 | 301 |
| 483 | 3300005434 | Ga0070709_10000980 | Ga0070709_100009805 | 302 |
| 484 | 3300005436 | Ga0070713_100016044 | Ga0070713_1000160445 | 302 |
| 485 | 3300005437 | Ga0070710_10001038 | Ga0070710_100010388 | 302 |
| 486 | 3300005577 | Ga0068857_100285856 | Ga0068857_1002858562 | 302 |
| 487 | 3300006175 | Ga0070712_100180661 | Ga0070712_1001806612 | 302 |
| 488 | 3300006175 | Ga0070712_100256228 | Ga0070712_1002562281 | 302 |
| 489 | 3300006914 | Ga0075436_100005587 | Ga0075436_1000055878 | 302 |
| 490 | 3300007788 | Ga0099795_10069235 | Ga0099795_100692352 | 302 |
| 491 | 3300010159 | Ga0099796_10002743 | Ga0099796_100027434 | 302 |
| 492 | 3300025898 | Ga0207692_10001278 | Ga0207692_100012785 | 302 |
| 493 | 3300025906 | Ga0207699_10011463 | Ga0207699_100114635 | 302 |
| 494 | 3300025915 | Ga0207693_10006620 | Ga0207693_100066204 | 302 |
| 495 | 3300025928 | Ga0207700_10026454 | Ga0207700_100264545 | 302 |
| 496 | 3300025929 | Ga0207664_10004931 | Ga0207664_100049312 | 302 |
| 497 | 3300025939 | Ga0207665_10017817 | Ga0207665_100178175 | 302 |
| 498 | 3300027512 | Ga0209179_1001581 | Ga0209179_10015812 | 302 |
| 499 | 3300050514 | nmdc:mga08x19_17358_c1 | nmdc:mga08x19_17358_c1_2140_3114 | 302 |
| 500 | 3300053119 | Ga0500595_000001 | Ga0500595_000001_525053_525982 | 302 |
| 501 | 3300003203 | JGI25406J46586_10000034 | JGI25406J46586_1000003437 | 303 |
| 502 | 3300005985 | Ga0081539_10000113 | Ga0081539_1000011320 | 303 |
| 503 | 3300013306 | Ga0163162_10149195 | Ga0163162_101491952 | 303 |
| 504 | 3300021388 | Ga0213875_10000053 | Ga0213875_10000053128 | 303 |
| 505 | 3300035170 | Ga0373943_0072054 | Ga0373943_0072054_258_1202 | 303 |
| 506 | 3300037853 | Ga0436364_0288952 | Ga0436364_0288952_8882_9829 | 303 |
| 507 | 3300046476 | Ga0495662_0034815 | Ga0495662_0034815_456_1427 | 303 |
| 508 | 3300049585 | Ga0501069_0037162 | Ga0501069_0037162_1394_2329 | 303 |
| 509 | 3300049822 | Ga0501035_0000197 | Ga0501035_0000197_71384_72319 | 303 |
| 510 | 3300005435 | Ga0070714_100430093 | Ga0070714_1004300931 | 304 |
| 511 | 3300005458 | Ga0070681_10141744 | Ga0070681_101417445 | 304 |
| 512 | 3300005983 | Ga0081540_1051986 | Ga0081540_10519863 | 304 |
| 513 | 3300009093 | Ga0105240_10322270 | Ga0105240_103222701 | 304 |
| 514 | 3300009098 | Ga0105245_10042042 | Ga0105245_100420421 | 304 |
| 515 | 3300021384 | Ga0213876_10003065 | Ga0213876_100030654 | 304 |
| 516 | 3300025254 | Ga0209148_1000530 | Ga0209148_100053019 | 304 |
| 517 | 3300025272 | Ga0209455_1000326 | Ga0209455_100032613 | 304 |
| 518 | 3300039437 | Ga0436365_1835761 | Ga0436365_1835761_8373_9314 | 304 |
| 519 | 3300039450 | Ga0436363_1051136 | Ga0436363_1051136_639_1580 | 304 |
| 520 | 3300005435 | Ga0070714_100028817 | Ga0070714_1000288175 | 305 |
| 521 | 3300005535 | Ga0070684_100102059 | Ga0070684_1001020593 | 305 |
| 522 | 3300005983 | Ga0081540_1002071 | Ga0081540_100207112 | 305 |
| 523 | 3300006028 | Ga0070717_10068036 | Ga0070717_100680362 | 305 |
| 524 | 3300013307 | Ga0157372_10144333 | Ga0157372_101443332 | 305 |
| 525 | 3300025299 | Ga0209256_1032783 | Ga0209256_10327831 | 305 |
| 526 | 3300025924 | Ga0207694_10195723 | Ga0207694_101957232 | 305 |
| 527 | 3300025929 | Ga0207664_10062949 | Ga0207664_100629494 | 305 |
| 528 | 3300037466 | Ga0395898_0191145 | Ga0395898_0191145_257_1198 | 305 |
| 529 | 3300041512 | Ga0451853_0987069 | Ga0451853_0987069_128_1081 | 305 |
| 530 | 3300048918 | Ga0496115_0032733 | Ga0496115_0032733_1645_2574 | 305 |
| 531 | 3300048921 | Ga0496118_0069374 | Ga0496118_0069374_1288_2229 | 305 |
| 532 | 3300003214 | JGI25165J46597_1005127 | JGI25165J46597_10051273 | 306 |
| 533 | 3300003215 | JGI25153J46596_10001825 | JGI25153J46596_100018255 | 306 |
| 534 | 3300003215 | JGI25153J46596_10003323 | JGI25153J46596_100033235 | 306 |
| 535 | 3300003354 | JGI25160J50197_1001067 | JGI25160J50197_10010672 | 306 |
| 536 | 3300003354 | JGI25160J50197_1003948 | JGI25160J50197_10039483 | 306 |
| 537 | 3300005262 | Ga0065165_1007687 | Ga0065165_10076874 | 306 |
| 538 | 3300005336 | Ga0070680_100026227 | Ga0070680_1000262272 | 306 |
| 539 | 3300005355 | Ga0070671_100108912 | Ga0070671_1001089122 | 306 |
| 540 | 3300005434 | Ga0070709_10012949 | Ga0070709_100129492 | 306 |
| 541 | 3300005437 | Ga0070710_10336147 | Ga0070710_103361471 | 306 |
| 542 | 3300005455 | Ga0070663_100071340 | Ga0070663_1000713403 | 306 |
| 543 | 3300005458 | Ga0070681_10076110 | Ga0070681_100761103 | 306 |
| 544 | 3300005530 | Ga0070679_100005873 | Ga0070679_1000058731 | 306 |
| 545 | 3300005530 | Ga0070679_100030562 | Ga0070679_1000305621 | 306 |
| 546 | 3300005539 | Ga0068853_100097378 | Ga0068853_1000973782 | 306 |
| 547 | 3300005546 | Ga0070696_100104082 | Ga0070696_1001040822 | 306 |
| 548 | 3300005563 | Ga0068855_100040685 | Ga0068855_1000406854 | 306 |
| 549 | 3300005563 | Ga0068855_100153219 | Ga0068855_1001532193 | 306 |
| 550 | 3300005578 | Ga0068854_100356583 | Ga0068854_1003565832 | 306 |
| 551 | 3300006051 | Ga0075364_10173534 | Ga0075364_101735342 | 306 |
| 552 | 3300006178 | Ga0075367_10059371 | Ga0075367_100593712 | 306 |
| 553 | 3300006186 | Ga0075369_10087865 | Ga0075369_100878651 | 306 |
| 554 | 3300006353 | Ga0075370_10105120 | Ga0075370_101051202 | 306 |
| 555 | 3300006871 | Ga0075434_100103424 | Ga0075434_1001034243 | 306 |
| 556 | 3300006880 | Ga0075429_100007719 | Ga0075429_1000077199 | 306 |
| 557 | 3300009093 | Ga0105240_10006945 | Ga0105240_1000694510 | 306 |
| 558 | 3300009545 | Ga0105237_10017912 | Ga0105237_100179126 | 306 |
| 559 | 3300013105 | Ga0157369_10104121 | Ga0157369_101041212 | 306 |
| 560 | 3300014325 | Ga0163163_10037933 | Ga0163163_100379333 | 306 |
| 561 | 3300021384 | Ga0213876_10001237 | Ga0213876_1000123710 | 306 |
| 562 | 3300025230 | Ga0209563_102501 | Ga0209563_1025013 | 306 |
| 563 | 3300025254 | Ga0209148_1000180 | Ga0209148_100018032 | 306 |
| 564 | 3300025297 | Ga0209758_1001429 | Ga0209758_100142918 | 306 |
| 565 | 3300025297 | Ga0209758_1004591 | Ga0209758_10045913 | 306 |
| 566 | 3300025302 | Ga0207426_1000429 | Ga0207426_100042952 | 306 |
| 567 | 3300025302 | Ga0207426_1019649 | Ga0207426_10196492 | 306 |
| 568 | 3300025304 | Ga0209257_1040647 | Ga0209257_10406472 | 306 |
| 569 | 3300025904 | Ga0207647_10008887 | Ga0207647_100088873 | 306 |
| 570 | 3300025906 | Ga0207699_10034223 | Ga0207699_100342231 | 306 |
| 571 | 3300025911 | Ga0207654_10289648 | Ga0207654_102896481 | 306 |
| 572 | 3300025912 | Ga0207707_10142145 | Ga0207707_101421452 | 306 |
| 573 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008730 | 306 |
| 574 | 3300025913 | Ga0207695_10029844 | Ga0207695_100298443 | 306 |
| 575 | 3300025914 | Ga0207671_10008749 | Ga0207671_100087496 | 306 |
| 576 | 3300025925 | Ga0207650_10050330 | Ga0207650_100503304 | 306 |
| 577 | 3300025928 | Ga0207700_10055560 | Ga0207700_100555601 | 306 |
| 578 | 3300025931 | Ga0207644_10045790 | Ga0207644_100457902 | 306 |
| 579 | 3300025944 | Ga0207661_10002496 | Ga0207661_100024968 | 306 |
| 580 | 3300025949 | Ga0207667_10018061 | Ga0207667_100180616 | 306 |
| 581 | 3300025960 | Ga0207651_10338732 | Ga0207651_103387321 | 306 |
| 582 | 3300026041 | Ga0207639_10185542 | Ga0207639_101855423 | 306 |
| 583 | 3300026067 | Ga0207678_10055777 | Ga0207678_100557772 | 306 |
| 584 | 3300027296 | Ga0209389_1000001 | Ga0209389_1000001205 | 306 |
| 585 | 3300027296 | Ga0209389_1000134 | Ga0209389_10001346 | 306 |
| 586 | 3300027357 | Ga0209589_1000033 | Ga0209589_100003368 | 306 |
| 587 | 3300027361 | Ga0209489_100040 | Ga0209489_10004082 | 306 |
| 588 | 3300028563 | Ga0265319_1014589 | Ga0265319_10145894 | 306 |
| 589 | 3300035111 | Ga0373923_0006563 | Ga0373923_0006563_1627_2577 | 306 |
| 590 | 3300035116 | Ga0373945_0031487 | Ga0373945_0031487_610_1560 | 306 |
| 591 | 3300035170 | Ga0373943_0008120 | Ga0373943_0008120_1824_2774 | 306 |
| 592 | 3300035171 | Ga0373946_0003292 | Ga0373946_0003292_4411_5361 | 306 |
| 593 | 3300035692 | Ga0373935_0014513 | Ga0373935_0014513_603_1553 | 306 |
| 594 | 3300035695 | Ga0373927_0028965 | Ga0373927_0028965_1212_2162 | 306 |
| 595 | 3300035695 | Ga0373927_0033452 | Ga0373927_0033452_323_1273 | 306 |
| 596 | 3300035725 | Ga0373947_0012161 | Ga0373947_0012161_2285_3235 | 306 |
| 597 | 3300037418 | Ga0395900_0000948 | Ga0395900_0000948_24963_25901 | 306 |
| 598 | 3300037466 | Ga0395898_0060604 | Ga0395898_0060604_1116_2054 | 306 |
| 599 | 3300037471 | Ga0395905_0004515 | Ga0395905_0004515_3161_4105 | 306 |
| 600 | 3300038443 | Ga0395901_0020520 | Ga0395901_0020520_4257_5195 | 306 |
| 601 | 3300039437 | Ga0436365_0947948 | Ga0436365_0947948_1157_2098 | 306 |
| 602 | 3300039437 | Ga0436365_1382071 | Ga0436365_1382071_17578_18510 | 306 |
| 603 | 3300039453 | Ga0436362_1193065 | Ga0436362_1193065_2699_3649 | 306 |
| 604 | 3300041460 | Ga0451802_2171387 | Ga0451802_2171387_268_1212 | 306 |
| 605 | 3300044658 | Ga0466972_0001899 | Ga0466972_0001899_4280_5218 | 306 |
| 606 | 3300044658 | Ga0466972_0010445 | Ga0466972_0010445_2512_3456 | 306 |
| 607 | 3300044735 | Ga0466968_0033968 | Ga0466968_0033968_53_997 | 306 |
| 608 | 3300044901 | Ga0466960_0088853 | Ga0466960_0088853_88_1032 | 306 |
| 609 | 3300045976 | Ga0466967_0398633 | Ga0466967_0398633_346_1290 | 306 |
| 610 | 3300046454 | Ga0495592_0016464 | Ga0495592_0016464_4105_5055 | 306 |
| 611 | 3300046459 | Ga0495629_0042588 | Ga0495629_0042588_1030_1980 | 306 |
| 612 | 3300046472 | Ga0495580_0004514 | Ga0495580_0004514_1851_2801 | 306 |
| 613 | 3300046475 | Ga0495639_0004971 | Ga0495639_0004971_1995_2945 | 306 |
| 614 | 3300046477 | Ga0495664_0019517 | Ga0495664_0019517_158_1108 | 306 |
| 615 | 3300046511 | Ga0495608_0148244 | Ga0495608_0148244_263_1213 | 306 |
| 616 | 3300046516 | Ga0495628_0065041 | Ga0495628_0065041_107_1057 | 306 |
| 617 | 3300046517 | Ga0495630_0123739 | Ga0495630_0123739_723_1673 | 306 |
| 618 | 3300046533 | Ga0495640_0029778 | Ga0495640_0029778_118_1068 | 306 |
| 619 | 3300046642 | Ga0495634_0135855 | Ga0495634_0135855_476_1426 | 306 |
| 620 | 3300046680 | Ga0495646_0015182 | Ga0495646_0015182_1127_2077 | 306 |
| 621 | 3300046690 | Ga0495624_0034608 | Ga0495624_0034608_158_1108 | 306 |
| 622 | 3300047673 | Ga0495593_0043771 | Ga0495593_0043771_1084_2034 | 306 |
| 623 | 3300048908 | Ga0496105_0063602 | Ga0496105_0063602_564_1508 | 306 |
| 624 | 3300048912 | Ga0496109_0330830 | Ga0496109_0330830_476_1420 | 306 |
| 625 | 3300048915 | Ga0496112_0203110 | Ga0496112_0203110_206_1150 | 306 |
| 626 | 3300048916 | Ga0496113_0124227 | Ga0496113_0124227_309_1253 | 306 |
| 627 | 3300048923 | Ga0496120_0150319 | Ga0496120_0150319_12_956 | 306 |
| 628 | 3300050490 | nmdc:mga03n38_23182_c1 | nmdc:mga03n38_23182_c1_284_1228 | 306 |
| 629 | 3300050492 | nmdc:mga0yw44_13355_c1 | nmdc:mga0yw44_13355_c1_1716_2660 | 306 |
| 630 | 3300050496 | nmdc:mga07m45_140468_c1 | nmdc:mga07m45_140468_c1_67_1011 | 306 |
| 631 | 3300050496 | nmdc:mga07m45_77756_c1 | nmdc:mga07m45_77756_c1_540_1484 | 306 |
| 632 | 3300053077 | Ga0495601_0112481 | Ga0495601_0112481_125_1075 | 306 |
| 633 | 3300053087 | Ga0500643_000125 | Ga0500643_000125_59419_60363 | 306 |
| 634 | 3300053088 | Ga0500644_0001722 | Ga0500644_0001722_3416_4378 | 306 |
| 635 | 3300053092 | Ga0500583_0045525 | Ga0500583_0045525_1032_1976 | 306 |
| 636 | 3300053103 | Ga0500555_000626 | Ga0500555_000626_3285_4229 | 306 |
| 637 | 3300053105 | Ga0500557_000040 | Ga0500557_000040_43107_44051 | 306 |
| 638 | 3300053130 | Ga0500642_0000118 | Ga0500642_0000118_16649_17593 | 306 |
| 639 | 3300053130 | Ga0500642_0017555 | Ga0500642_0017555_820_1764 | 306 |
| 640 | 3300053133 | Ga0500655_010216 | Ga0500655_010216_577_1521 | 306 |
| 641 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_1459877_1460839 | 306 |
| 642 | 3300053153 | Ga0500616_0036537 | Ga0500616_0036537_1403_2347 | 306 |
| 643 | 3300053156 | Ga0500622_0010928 | Ga0500622_0010928_2471_3415 | 306 |
| 644 | 3300053177 | Ga0500636_0061804 | Ga0500636_0061804_1181_2125 | 306 |
| 645 | 3300053730 | Ga0500645_035738 | Ga0500645_035738_427_1371 | 306 |
| 646 | iso_pu_bacteria | 2528768022 | 2528849050 | 306 |
| 647 | iso_pu_bacteria | 2818991467 | 2819717643 | 306 |
| 648 | iso_pu_bacteria | 2824661429 | 2824668531 | 306 |
| 649 | iso_pu_bacteria | 2879099564 | 2879107068 | 306 |
| 650 | iso_pu_bacteria | 2922368715 | 2922372478 | 306 |
| 651 | iso_pu_bacteria | 2929615660 | 2929620957 | 306 |
| 652 | iso_pu_bacteria | 2929624759 | 2929626212 | 306 |
| 653 | iso_pu_bacteria | 2932784394 | 2932784909 | 306 |
| 654 | iso_pu_bacteria | 2932809354 | 2932809943 | 306 |
| 655 | iso_pu_bacteria | 2932818245 | 2932818314 | 306 |
| 656 | iso_pu_bacteria | 2932828146 | 2932828746 | 306 |
| 657 | iso_pu_bacteria | 2933577622 | 2933583173 | 306 |
| 658 | iso_pu_bacteria | 2935616580 | 2935619834 | 306 |
| 659 | iso_pu_bacteria | 2935638405 | 2935638816 | 306 |
| 660 | iso_pu_bacteria | 2935665750 | 2935666334 | 306 |
| 661 | iso_pu_bacteria | 2935684952 | 2935685004 | 306 |
| 662 | iso_pu_bacteria | 2935694250 | 2935694700 | 306 |
| 663 | iso_pu_bacteria | 2935703347 | 2935703821 | 306 |
| 664 | iso_pu_bacteria | 2935713505 | 2935713557 | 306 |
| 665 | iso_pu_bacteria | 2935722832 | 2935724177 | 306 |
| 666 | iso_pu_bacteria | 2935732158 | 2935733465 | 306 |
| 667 | iso_pu_bacteria | 2935741537 | 2935742844 | 306 |
| 668 | iso_pu_bacteria | 2935750917 | 2935750969 | 306 |
| 669 | iso_pu_bacteria | 2935760218 | 2935760502 | 306 |
| 670 | iso_pu_bacteria | 2935801545 | 2935801958 | 306 |
| 671 | iso_pu_bacteria | 2935810662 | 2935810727 | 306 |
| 672 | iso_pu_bacteria | 2935827899 | 2935828310 | 306 |
| 673 | iso_pu_bacteria | 2935837841 | 2935839725 | 306 |
| 674 | iso_pu_bacteria | 2935855204 | 2935857851 | 306 |
| 675 | iso_pu_bacteria | 2935864058 | 2935868807 | 306 |
| 676 | iso_pu_bacteria | 2935873716 | 2935874222 | 306 |
| 677 | iso_pu_bacteria | 2935992306 | 2935992853 | 306 |
| 678 | iso_pu_bacteria | 2936002035 | 2936002766 | 306 |
| 679 | iso_pu_bacteria | 2936037263 | 2936037853 | 306 |
| 680 | iso_pu_bacteria | 2940556831 | 2940558228 | 306 |
| 681 | iso_pu_bacteria | 2941538514 | 2941540934 | 306 |
| 682 | iso_pu_bacteria | 8016511872 | 8016520728 | 306 |
| 683 | iso_pu_bacteria | 8017057580 | 8017064855 | 306 |
| 684 | iso_pu_bacteria | 8019576017 | 8019584229 | 306 |
| 685 | iso_pu_bacteria | 8019586578 | 8019591996 | 306 |
| 686 | iso_pu_bacteria | 8019597564 | 8019599295 | 306 |
| 687 | iso_pu_bacteria | 8019608314 | 8019609064 | 306 |
| 688 | iso_pu_bacteria | 8019619141 | 8019619747 | 306 |
| 689 | iso_pu_bacteria | 8055742211 | 8055745180 | 306 |
| 690 | 3300005327 | Ga0070658_10006356 | Ga0070658_100063563 | 307 |
| 691 | 3300005329 | Ga0070683_100179425 | Ga0070683_1001794253 | 307 |
| 692 | 3300005338 | Ga0068868_100003369 | Ga0068868_1000033698 | 307 |
| 693 | 3300005366 | Ga0070659_100035456 | Ga0070659_1000354562 | 307 |
| 694 | 3300005366 | Ga0070659_100171629 | Ga0070659_1001716291 | 307 |
| 695 | 3300005367 | Ga0070667_100224514 | Ga0070667_1002245141 | 307 |
| 696 | 3300005539 | Ga0068853_100568835 | Ga0068853_1005688351 | 307 |
| 697 | 3300005548 | Ga0070665_100089220 | Ga0070665_1000892205 | 307 |
| 698 | 3300005563 | Ga0068855_100151421 | Ga0068855_1001514213 | 307 |
| 699 | 3300005577 | Ga0068857_100183234 | Ga0068857_1001832343 | 307 |
| 700 | 3300005577 | Ga0068857_100340982 | Ga0068857_1003409822 | 307 |
| 701 | 3300005616 | Ga0068852_100062101 | Ga0068852_1000621013 | 307 |
| 702 | 3300005616 | Ga0068852_100154357 | Ga0068852_1001543572 | 307 |
| 703 | 3300005937 | Ga0081455_10007949 | Ga0081455_100079495 | 307 |
| 704 | 3300005983 | Ga0081540_1005540 | Ga0081540_10055403 | 307 |
| 705 | 3300006163 | Ga0070715_10172285 | Ga0070715_101722851 | 307 |
| 706 | 3300006844 | Ga0075428_100022167 | Ga0075428_1000221672 | 307 |
| 707 | 3300006846 | Ga0075430_100004132 | Ga0075430_1000041327 | 307 |
| 708 | 3300006871 | Ga0075434_100001874 | Ga0075434_10000187411 | 307 |
| 709 | 3300006880 | Ga0075429_100103107 | Ga0075429_1001031073 | 307 |
| 710 | 3300006942 | Ga0099824_1008208 | Ga0099824_10082089 | 307 |
| 711 | 3300009093 | Ga0105240_10630473 | Ga0105240_106304731 | 307 |
| 712 | 3300009094 | Ga0111539_10019857 | Ga0111539_1001985712 | 307 |
| 713 | 3300009147 | Ga0114129_10008567 | Ga0114129_1000856714 | 307 |
| 714 | 3300013297 | Ga0157378_10009553 | Ga0157378_100095536 | 307 |
| 715 | 3300013297 | Ga0157378_10054478 | Ga0157378_100544782 | 307 |
| 716 | 3300013307 | Ga0157372_10366476 | Ga0157372_103664762 | 307 |
| 717 | 3300015261 | Ga0182006_1090949 | Ga0182006_10909492 | 307 |
| 718 | 3300021377 | Ga0213874_10003010 | Ga0213874_100030104 | 307 |
| 719 | 3300025909 | Ga0207705_10022855 | Ga0207705_100228552 | 307 |
| 720 | 3300025909 | Ga0207705_10037077 | Ga0207705_100370773 | 307 |
| 721 | 3300025912 | Ga0207707_10287256 | Ga0207707_102872561 | 307 |
| 722 | 3300025914 | Ga0207671_10132031 | Ga0207671_101320313 | 307 |
| 723 | 3300025916 | Ga0207663_10294988 | Ga0207663_102949882 | 307 |
| 724 | 3300025917 | Ga0207660_10044712 | Ga0207660_100447121 | 307 |
| 725 | 3300025919 | Ga0207657_10041142 | Ga0207657_100411424 | 307 |
| 726 | 3300025924 | Ga0207694_10058318 | Ga0207694_100583183 | 307 |
| 727 | 3300025929 | Ga0207664_10043388 | Ga0207664_100433885 | 307 |
| 728 | 3300025929 | Ga0207664_10377598 | Ga0207664_103775981 | 307 |
| 729 | 3300025932 | Ga0207690_10089000 | Ga0207690_100890003 | 307 |
| 730 | 3300025944 | Ga0207661_10149598 | Ga0207661_101495983 | 307 |
| 731 | 3300025986 | Ga0207658_10137296 | Ga0207658_101372962 | 307 |
| 732 | 3300026023 | Ga0207677_10028736 | Ga0207677_100287362 | 307 |
| 733 | 3300026116 | Ga0207674_10434963 | Ga0207674_104349632 | 307 |
| 734 | 3300026142 | Ga0207698_10070805 | Ga0207698_100708053 | 307 |
| 735 | 3300026142 | Ga0207698_10247337 | Ga0207698_102473372 | 307 |
| 736 | 3300027357 | Ga0209589_1000014 | Ga0209589_1000014135 | 307 |
| 737 | 3300027361 | Ga0209489_100014 | Ga0209489_100014135 | 307 |
| 738 | 3300027363 | Ga0209700_100024 | Ga0209700_100024135 | 307 |
| 739 | 3300027907 | Ga0207428_10000141 | Ga0207428_1000014111 | 307 |
| 740 | 3300028379 | Ga0268266_10070883 | Ga0268266_100708832 | 307 |
| 741 | 3300028577 | Ga0265318_10076934 | Ga0265318_100769342 | 307 |
| 742 | 3300031238 | Ga0265332_10001857 | Ga0265332_100018579 | 307 |
| 743 | 3300031241 | Ga0265325_10010015 | Ga0265325_100100154 | 307 |
| 744 | 3300031242 | Ga0265329_10007587 | Ga0265329_100075873 | 307 |
| 745 | 3300031247 | Ga0265340_10006014 | Ga0265340_100060143 | 307 |
| 746 | 3300031247 | Ga0265340_10080349 | Ga0265340_100803492 | 307 |
| 747 | 3300031249 | Ga0265339_10003091 | Ga0265339_100030912 | 307 |
| 748 | 3300031249 | Ga0265339_10005140 | Ga0265339_100051407 | 307 |
| 749 | 3300031250 | Ga0265331_10007501 | Ga0265331_100075016 | 307 |
| 750 | 3300031344 | Ga0265316_10249737 | Ga0265316_102497372 | 307 |
| 751 | 3300031595 | Ga0265313_10008687 | Ga0265313_100086876 | 307 |
| 752 | 3300031712 | Ga0265342_10000092 | Ga0265342_1000009278 | 307 |
| 753 | 3300031712 | Ga0265342_10000417 | Ga0265342_1000041721 | 307 |
| 754 | 3300037853 | Ga0436364_0231907 | Ga0436364_0231907_1449_2384 | 307 |
| 755 | 3300039437 | Ga0436365_1308689 | Ga0436365_1308689_621_1568 | 307 |
| 756 | 3300039450 | Ga0436363_0362302 | Ga0436363_0362302_1937_2893 | 307 |
| 757 | 3300046500 | Ga0495596_0047198 | Ga0495596_0047198_228_1166 | 307 |
| 758 | 3300046529 | Ga0495652_0080346 | Ga0495652_0080346_1376_2305 | 307 |
| 759 | 3300049581 | Ga0501047_0047317 | Ga0501047_0047317_2243_3181 | 307 |
| 760 | 3300049823 | Ga0501044_0098289 | Ga0501044_0098289_1454_2392 | 307 |
| 761 | 3300050492 | nmdc:mga0yw44_71559_c1 | nmdc:mga0yw44_71559_c1_1111_2049 | 307 |
| 762 | 3300050496 | nmdc:mga07m45_262798_c1 | nmdc:mga07m45_262798_c1_11_949 | 307 |
| 763 | 3300050509 | nmdc:mga0qj67_19636_c1 | nmdc:mga0qj67_19636_c1_4051_5109 | 307 |
| 764 | 3300050510 | nmdc:mga06r32_9316_c1 | nmdc:mga06r32_9316_c1_1705_2763 | 307 |
| 765 | 3300050511 | nmdc:mga08y16_187406_c1 | nmdc:mga08y16_187406_c1_904_1962 | 307 |
| 766 | 3300050512 | nmdc:mga0n895_1857_c1 | nmdc:mga0n895_1857_c1_2954_4012 | 307 |
| 767 | 3300050513 | nmdc:mga0rr50_61233_c1 | nmdc:mga0rr50_61233_c1_1289_2347 | 307 |
| 768 | iso_pu_bacteria | 2507262055 | 2507507724 | 307 |
| 769 | iso_pu_bacteria | 2508501009 | 2508541844 | 307 |
| 770 | iso_pu_bacteria | 2508501042 | 2508692613 | 307 |
| 771 | iso_pu_bacteria | 2508501128 | 2509149353 | 307 |
| 772 | iso_pu_bacteria | 2511231028 | 2511397122 | 307 |
| 773 | iso_pu_bacteria | 2513237092 | 2513622990 | 307 |
| 774 | iso_pu_bacteria | 2513237094 | 2513642911 | 307 |
| 775 | iso_pu_bacteria | 2513237095 | 2513647451 | 307 |
| 776 | iso_pu_bacteria | 2513237104 | 2513719427 | 307 |
| 777 | iso_pu_bacteria | 2513237139 | 2513878456 | 307 |
| 778 | iso_pu_bacteria | 2513237141 | 2513891310 | 307 |
| 779 | iso_pu_bacteria | 2513237161 | 2514009496 | 307 |
| 780 | iso_pu_bacteria | 2515154112 | 2515626020 | 307 |
| 781 | iso_pu_bacteria | 2517093001 | 2517104091 | 307 |
| 782 | iso_pu_bacteria | 2524023205 | 2524436347 | 307 |
| 783 | iso_pu_bacteria | 2617270735 | 2617346735 | 307 |
| 784 | iso_pu_bacteria | 2744054633 | 2745080699 | 307 |
| 785 | iso_pu_bacteria | 2791355196 | 2793064417 | 307 |
| 786 | iso_pu_bacteria | 2802429603 | 2805919120 | 307 |
| 787 | iso_pu_bacteria | 2816332527 | 2818236488 | 307 |
| 788 | iso_pu_bacteria | 2824600985 | 2824607106 | 307 |
| 789 | iso_pu_bacteria | 2824609381 | 2824612988 | 307 |
| 790 | iso_pu_bacteria | 2824653114 | 2824660197 | 307 |
| 791 | iso_pu_bacteria | 2824671348 | 2824674828 | 307 |
| 792 | iso_pu_bacteria | 2824679649 | 2824682955 | 307 |
| 793 | iso_pu_bacteria | 2824687955 | 2824693488 | 307 |
| 794 | iso_pu_bacteria | 2824696289 | 2824701981 | 307 |
| 795 | iso_pu_bacteria | 2824704595 | 2824712521 | 307 |
| 796 | iso_pu_bacteria | 2824753945 | 2824758485 | 307 |
| 797 | iso_pu_bacteria | 2824763712 | 2824770069 | 307 |
| 798 | iso_pu_bacteria | 2824773399 | 2824775192 | 307 |
| 799 | iso_pu_bacteria | 2838122688 | 2838128864 | 307 |
| 800 | iso_pu_bacteria | 2841941048 | 2841944990 | 307 |
| 801 | iso_pu_bacteria | 2841949485 | 2841953413 | 307 |
| 802 | iso_pu_bacteria | 2841957949 | 2841959759 | 307 |
| 803 | iso_pu_bacteria | 2841966195 | 2841972116 | 307 |
| 804 | iso_pu_bacteria | 2841974524 | 2841978138 | 307 |
| 805 | iso_pu_bacteria | 2841983080 | 2841986239 | 307 |
| 806 | iso_pu_bacteria | 2842038055 | 2842040588 | 307 |
| 807 | iso_pu_bacteria | 2842045827 | 2842046466 | 307 |
| 808 | iso_pu_bacteria | 2844315083 | 2844319953 | 307 |
| 809 | iso_pu_bacteria | 2847930680 | 2847937265 | 307 |
| 810 | iso_pu_bacteria | 2847939898 | 2847947675 | 307 |
| 811 | iso_pu_bacteria | 2849076700 | 2849078469 | 307 |
| 812 | iso_pu_bacteria | 2874590934 | 2874598832 | 307 |
| 813 | iso_pu_bacteria | 2874612657 | 2874614640 | 307 |
| 814 | iso_pu_bacteria | 2874620515 | 2874628015 | 307 |
| 815 | iso_pu_bacteria | 2874628541 | 2874635094 | 307 |
| 816 | iso_pu_bacteria | 2874645413 | 2874652288 | 307 |
| 817 | iso_pu_bacteria | 2876761206 | 2876766156 | 307 |
| 818 | iso_pu_bacteria | 2876771140 | 2876778871 | 307 |
| 819 | iso_pu_bacteria | 2876818435 | 2876824234 | 307 |
| 820 | iso_pu_bacteria | 2879074833 | 2879082664 | 307 |
| 821 | iso_pu_bacteria | 2879083081 | 2879086570 | 307 |
| 822 | iso_pu_bacteria | 2879127579 | 2879132176 | 307 |
| 823 | iso_pu_bacteria | 2879142872 | 2879148297 | 307 |
| 824 | iso_pu_bacteria | 2881364244 | 2881371524 | 307 |
| 825 | iso_pu_bacteria | 2881665667 | 2881673709 | 307 |
| 826 | iso_pu_bacteria | 2885409591 | 2885414640 | 307 |
| 827 | iso_pu_bacteria | 2888378607 | 2888385388 | 307 |
| 828 | iso_pu_bacteria | 2888388044 | 2888392861 | 307 |
| 829 | iso_pu_bacteria | 2888419890 | 2888425522 | 307 |
| 830 | iso_pu_bacteria | 2903727486 | 2903730374 | 307 |
| 831 | iso_pu_bacteria | 2904666416 | 2904674367 | 307 |
| 832 | iso_pu_bacteria | 2904711408 | 2904712048 | 307 |
| 833 | iso_pu_bacteria | 2906602504 | 2906604693 | 307 |
| 834 | iso_pu_bacteria | 2906626472 | 2906627407 | 307 |
| 835 | iso_pu_bacteria | 2906643746 | 2906643890 | 307 |
| 836 | iso_pu_bacteria | 2922393267 | 2922397131 | 307 |
| 837 | iso_pu_bacteria | 2932794094 | 2932795217 | 307 |
| 838 | iso_pu_bacteria | 2932801729 | 2932805747 | 307 |
| 839 | iso_pu_bacteria | 2935608549 | 2935609765 | 307 |
| 840 | iso_pu_bacteria | 2935648319 | 2935654185 | 307 |
| 841 | iso_pu_bacteria | 2935656913 | 2935663122 | 307 |
| 842 | iso_pu_bacteria | 2935675223 | 2935676620 | 307 |
| 843 | iso_pu_bacteria | 2935769743 | 2935772006 | 307 |
| 844 | iso_pu_bacteria | 2935777560 | 2935784276 | 307 |
| 845 | iso_pu_bacteria | 2935785616 | 2935787606 | 307 |
| 846 | iso_pu_bacteria | 2935793552 | 2935796238 | 307 |
| 847 | iso_pu_bacteria | 2935819856 | 2935822927 | 307 |
| 848 | iso_pu_bacteria | 2935847175 | 2935848509 | 307 |
| 849 | iso_pu_bacteria | 2935883170 | 2935883883 | 307 |
| 850 | iso_pu_bacteria | 2935908558 | 2935909686 | 307 |
| 851 | iso_pu_bacteria | 2935916978 | 2935917410 | 307 |
| 852 | iso_pu_bacteria | 2935926038 | 2935927167 | 307 |
| 853 | iso_pu_bacteria | 2935934488 | 2935936989 | 307 |
| 854 | iso_pu_bacteria | 2935942939 | 2935944708 | 307 |
| 855 | iso_pu_bacteria | 2935951376 | 2935953145 | 307 |
| 856 | iso_pu_bacteria | 2935959822 | 2935966657 | 307 |
| 857 | iso_pu_bacteria | 2935967501 | 2935969985 | 307 |
| 858 | iso_pu_bacteria | 2935975950 | 2935980270 | 307 |
| 859 | iso_pu_bacteria | 2935984226 | 2935986968 | 307 |
| 860 | iso_pu_bacteria | 2936011229 | 2936017278 | 307 |
| 861 | iso_pu_bacteria | 2936019824 | 2936025780 | 307 |
| 862 | iso_pu_bacteria | 2936028420 | 2936034565 | 307 |
| 863 | iso_pu_bacteria | 2936046547 | 2936052622 | 307 |
| 864 | iso_pu_bacteria | 2936055302 | 2936062095 | 307 |
| 865 | iso_pu_bacteria | 2941531003 | 2941531138 | 307 |
| 866 | iso_pu_bacteria | 3005594810 | 3005600237 | 307 |
| 867 | iso_pu_bacteria | 3005710791 | 3005715745 | 307 |
| 868 | iso_pu_bacteria | 3005718088 | 3005723093 | 307 |
| 869 | iso_pu_bacteria | 8016522445 | 8016528761 | 307 |
| 870 | iso_pu_bacteria | 8016530956 | 8016533940 | 307 |
| 871 | iso_pu_bacteria | 8016539877 | 8016547168 | 307 |
| 872 | iso_pu_bacteria | 8016548790 | 8016554960 | 307 |
| 873 | iso_pu_bacteria | 8016566248 | 8016572280 | 307 |
| 874 | iso_pu_bacteria | 8016583857 | 8016594245 | 307 |
| 875 | iso_pu_bacteria | 8016595262 | 8016601078 | 307 |
| 876 | iso_pu_bacteria | 8016603502 | 8016609373 | 307 |
| 877 | iso_pu_bacteria | 8016622563 | 8016625684 | 307 |
| 878 | iso_pu_bacteria | 8016630954 | 8016639246 | 307 |
| 879 | iso_pu_bacteria | 8019530166 | 8019533713 | 307 |
| 880 | iso_pu_bacteria | 8019547302 | 8019552762 | 307 |
| 881 | iso_pu_bacteria | 8019629233 | 8019633366 | 307 |
| 882 | iso_pu_bacteria | 8019638758 | 8019646534 | 307 |
| 883 | iso_pu_bacteria | 8019648815 | 8019649286 | 307 |
| 884 | iso_pu_bacteria | 8019678201 | 8019685413 | 307 |
| 885 | iso_pu_bacteria | 8019687851 | 8019691000 | 307 |
| 886 | iso_pu_bacteria | 8056967851 | 8056975142 | 307 |
| 887 | 3300005337 | Ga0070682_100192145 | Ga0070682_1001921452 | 308 |
| 888 | 3300005435 | Ga0070714_100168229 | Ga0070714_1001682293 | 308 |
| 889 | 3300013297 | Ga0157378_10043596 | Ga0157378_100435963 | 308 |
| 890 | 3300026088 | Ga0207641_10102640 | Ga0207641_101026402 | 308 |
| 891 | 3300028556 | Ga0265337_1012788 | Ga0265337_10127883 | 308 |
| 892 | 3300028558 | Ga0265326_10003400 | Ga0265326_100034004 | 308 |
| 893 | 3300028573 | Ga0265334_10004112 | Ga0265334_100041123 | 308 |
| 894 | 3300028653 | Ga0265323_10004703 | Ga0265323_100047032 | 308 |
| 895 | 3300028666 | Ga0265336_10001567 | Ga0265336_100015673 | 308 |
| 896 | 3300028800 | Ga0265338_10000034 | Ga0265338_10000034136 | 308 |
| 897 | 3300029957 | Ga0265324_10006370 | Ga0265324_100063702 | 308 |
| 898 | 3300031711 | Ga0265314_10111227 | Ga0265314_101112273 | 308 |
| 899 | 3300046473 | Ga0495582_0045575 | Ga0495582_0045575_1154_2095 | 308 |
| 900 | 3300047320 | Ga0495672_0045473 | Ga0495672_0045473_117_1058 | 308 |
| 901 | 3300048924 | Ga0496121_0000230 | Ga0496121_0000230_117156_118097 | 308 |
| 902 | 3300053119 | Ga0500595_000407 | Ga0500595_000407_198_1139 | 308 |
| 903 | iso_pu_bacteria | 2728368998 | 2728750104 | 308 |
| 904 | iso_pu_bacteria | 2922361189 | 2922368629 | 308 |
| 905 | 3300006038 | Ga0075365_10004575 | Ga0075365_100045757 | 309 |
| 906 | 3300006175 | Ga0070712_100333482 | Ga0070712_1003334822 | 309 |
| 907 | 3300009093 | Ga0105240_10074116 | Ga0105240_100741162 | 309 |
| 908 | 3300009098 | Ga0105245_10583035 | Ga0105245_105830351 | 309 |
| 909 | 3300009147 | Ga0114129_10042174 | Ga0114129_100421746 | 309 |
| 910 | 3300010159 | Ga0099796_10032738 | Ga0099796_100327381 | 309 |
| 911 | 3300021388 | Ga0213875_10037778 | Ga0213875_100377782 | 309 |
| 912 | 3300025912 | Ga0207707_10048060 | Ga0207707_100480604 | 309 |
| 913 | 3300025913 | Ga0207695_10054668 | Ga0207695_100546682 | 309 |
| 914 | 3300025915 | Ga0207693_10223237 | Ga0207693_102232372 | 309 |
| 915 | 3300025944 | Ga0207661_10002064 | Ga0207661_100020647 | 309 |
| 916 | 3300026118 | Ga0207675_100028015 | Ga0207675_1000280157 | 309 |
| 917 | 3300026121 | Ga0207683_10409288 | Ga0207683_104092882 | 309 |
| 918 | 3300027512 | Ga0209179_1004953 | Ga0209179_10049533 | 309 |
| 919 | 3300028800 | Ga0265338_10011933 | Ga0265338_100119337 | 309 |
| 920 | 3300031241 | Ga0265325_10011514 | Ga0265325_100115142 | 309 |
| 921 | 3300031241 | Ga0265325_10022776 | Ga0265325_100227762 | 309 |
| 922 | 3300031249 | Ga0265339_10000205 | Ga0265339_1000020536 | 309 |
| 923 | 3300031250 | Ga0265331_10024905 | Ga0265331_100249052 | 309 |
| 924 | 3300031595 | Ga0265313_10000353 | Ga0265313_1000035336 | 309 |
| 925 | 3300031711 | Ga0265314_10003716 | Ga0265314_1000371615 | 309 |
| 926 | 3300035086 | Ga0373934_0017217 | Ga0373934_0017217_1744_2679 | 309 |
| 927 | 3300035695 | Ga0373927_0061505 | Ga0373927_0061505_422_1357 | 309 |
| 928 | 3300035724 | Ga0373933_0006291 | Ga0373933_0006291_1600_2535 | 309 |
| 929 | 3300036401 | Ga0373937_0035287 | Ga0373937_0035287_543_1478 | 309 |
| 930 | 3300037466 | Ga0395898_0078195 | Ga0395898_0078195_776_1714 | 309 |
| 931 | 3300037853 | Ga0436364_1517684 | Ga0436364_1517684_1882_2820 | 309 |
| 932 | 3300038443 | Ga0395901_0239807 | Ga0395901_0239807_733_1671 | 309 |
| 933 | 3300045049 | Ga0466959_0368468 | Ga0466959_0368468_14_958 | 309 |
| 934 | 3300046459 | Ga0495629_0001610 | Ga0495629_0001610_14458_15468 | 309 |
| 935 | 3300046462 | Ga0495651_0001287 | Ga0495651_0001287_10108_11043 | 309 |
| 936 | 3300046463 | Ga0495653_0002060 | Ga0495653_0002060_4623_5633 | 309 |
| 937 | 3300046477 | Ga0495664_0013015 | Ga0495664_0013015_59_994 | 309 |
| 938 | 3300046511 | Ga0495608_0001118 | Ga0495608_0001118_5869_6879 | 309 |
| 939 | 3300046526 | Ga0495666_0107946 | Ga0495666_0107946_278_1288 | 309 |
| 940 | 3300046533 | Ga0495640_0014016 | Ga0495640_0014016_270_1280 | 309 |
| 941 | 3300046533 | Ga0495640_0090022 | Ga0495640_0090022_159_1094 | 309 |
| 942 | 3300046536 | Ga0495587_0000663 | Ga0495587_0000663_15708_16643 | 309 |
| 943 | 3300046543 | Ga0495645_0218043 | Ga0495645_0218043_35_979 | 309 |
| 944 | 3300046559 | Ga0495667_0001079 | Ga0495667_0001079_5529_6464 | 309 |
| 945 | 3300046642 | Ga0495634_0028186 | Ga0495634_0028186_2586_3596 | 309 |
| 946 | 3300046663 | Ga0495635_0001990 | Ga0495635_0001990_4655_5590 | 309 |
| 947 | 3300046675 | Ga0495657_0010180 | Ga0495657_0010180_1346_2356 | 309 |
| 948 | 3300046679 | Ga0495623_0012766 | Ga0495623_0012766_636_1571 | 309 |
| 949 | 3300046680 | Ga0495646_0008739 | Ga0495646_0008739_4994_6004 | 309 |
| 950 | 3300046689 | Ga0495613_0063093 | Ga0495613_0063093_1729_2664 | 309 |
| 951 | 3300046809 | Ga0495600_0007773 | Ga0495600_0007773_273_1208 | 309 |
| 952 | 3300047317 | Ga0495604_0000907 | Ga0495604_0000907_15738_16748 | 309 |
| 953 | 3300047319 | Ga0495674_0018702 | Ga0495674_0018702_4695_5630 | 309 |
| 954 | 3300047321 | Ga0495676_0063501 | Ga0495676_0063501_272_1207 | 309 |
| 955 | 3300047322 | Ga0495680_0005555 | Ga0495680_0005555_5395_6405 | 309 |
| 956 | 3300047322 | Ga0495680_0017386 | Ga0495680_0017386_2729_3664 | 309 |
| 957 | 3300047444 | Ga0495675_0105156 | Ga0495675_0105156_718_1653 | 309 |
| 958 | 3300047471 | Ga0495684_0007107 | Ga0495684_0007107_7212_8222 | 309 |
| 959 | 3300048088 | Ga0495602_0005125 | Ga0495602_0005125_9661_10596 | 309 |
| 960 | 3300048903 | Ga0496100_0165525 | Ga0496100_0165525_410_1348 | 309 |
| 961 | 3300048914 | Ga0496111_0083525 | Ga0496111_0083525_646_1584 | 309 |
| 962 | 3300048915 | Ga0496112_0000017 | Ga0496112_0000017_93816_94751 | 309 |
| 963 | 3300048928 | Ga0496125_0000040 | Ga0496125_0000040_69968_70912 | 309 |
| 964 | 3300048928 | Ga0496125_0003264 | Ga0496125_0003264_5769_6713 | 309 |
| 965 | 3300048929 | Ga0496126_0091048 | Ga0496126_0091048_1231_2322 | 309 |
| 966 | 3300048929 | Ga0496126_0113251 | Ga0496126_0113251_62_1006 | 309 |
| 967 | 3300049586 | Ga0501070_0011105 | Ga0501070_0011105_6126_7061 | 309 |
| 968 | 3300049593 | Ga0501077_0041562 | Ga0501077_0041562_1087_2025 | 309 |
| 969 | 3300049742 | Ga0501080_0117963 | Ga0501080_0117963_842_1777 | 309 |
| 970 | 3300050492 | nmdc:mga0yw44_2368_c1 | nmdc:mga0yw44_2368_c1_1402_2343 | 309 |
| 971 | 3300050507 | nmdc:mga05p37_15774_c1 | nmdc:mga05p37_15774_c1_3186_4124 | 309 |
| 972 | 3300053077 | Ga0495601_0003107 | Ga0495601_0003107_5761_6696 | 309 |
| 973 | 3300053077 | Ga0495601_0006299 | Ga0495601_0006299_1380_2390 | 309 |
| 974 | 3300053078 | Ga0495612_0001997 | Ga0495612_0001997_6407_7342 | 309 |
| 975 | 3300053084 | Ga0495595_0000216 | Ga0495595_0000216_15751_16686 | 309 |
| 976 | 3300053084 | Ga0495595_0000883 | Ga0495595_0000883_2273_3208 | 309 |
| 977 | 3300053085 | Ga0495619_0000897 | Ga0495619_0000897_10020_10955 | 309 |
| 978 | 3300053085 | Ga0495619_0001136 | Ga0495619_0001136_10970_11980 | 309 |
| 979 | 3300053102 | Ga0500554_002627 | Ga0500554_002627_1519_2463 | 309 |
| 980 | 3300053150 | Ga0500603_000394 | Ga0500603_000394_4364_5308 | 309 |
| 981 | 3300053178 | Ga0500637_0007251 | Ga0500637_0007251_2996_3940 | 309 |
| 982 | iso_pu_bacteria | 2513237098 | 2513677416 | 309 |
| 983 | iso_pu_bacteria | 2524023210 | 2524470443 | 309 |
| 984 | iso_pu_bacteria | 2602042107 | 2603860958 | 309 |
| 985 | iso_pu_bacteria | 2885383462 | 2885392472 | 309 |
| 986 | iso_pu_bacteria | 2893066018 | 2893069111 | 309 |
| 987 | iso_pu_bacteria | 2903768456 | 2903769664 | 309 |
| 988 | iso_pu_bacteria | 2919073203 | 2919079342 | 309 |
| 989 | iso_pu_bacteria | 8006926726 | 8006926816 | 309 |
| 990 | iso_pu_bacteria | 8056681323 | 8056684877 | 309 |
| 991 | iso_pu_bacteria | 8056689827 | 8056693117 | 309 |
| 992 | 3300005347 | Ga0070668_100048502 | Ga0070668_1000485023 | 310 |
| 993 | 3300005435 | Ga0070714_100009105 | Ga0070714_1000091057 | 310 |
| 994 | 3300005436 | Ga0070713_100019667 | Ga0070713_1000196674 | 310 |
| 995 | 3300005563 | Ga0068855_100492094 | Ga0068855_1004920941 | 310 |
| 996 | 3300005564 | Ga0070664_100402500 | Ga0070664_1004025001 | 310 |
| 997 | 3300005843 | Ga0068860_100000081 | Ga0068860_100000081133 | 310 |
| 998 | 3300006038 | Ga0075365_10021525 | Ga0075365_100215253 | 310 |
| 999 | 3300006931 | Ga0097620_100348056 | Ga0097620_1003480562 | 310 |
| 1000 | 3300009101 | Ga0105247_10059860 | Ga0105247_100598601 | 310 |
| 1001 | 3300009545 | Ga0105237_10090951 | Ga0105237_100909512 | 310 |
| 1002 | 3300013105 | Ga0157369_10007421 | Ga0157369_100074215 | 310 |
| 1003 | 3300013306 | Ga0163162_10137069 | Ga0163162_101370694 | 310 |
| 1004 | 3300013307 | Ga0157372_10065655 | Ga0157372_100656552 | 310 |
| 1005 | 3300020081 | Ga0206354_10772337 | Ga0206354_107723371 | 310 |
| 1006 | 3300025904 | Ga0207647_10099068 | Ga0207647_100990682 | 310 |
| 1007 | 3300025906 | Ga0207699_10022022 | Ga0207699_100220224 | 310 |
| 1008 | 3300025913 | Ga0207695_10025044 | Ga0207695_100250442 | 310 |
| 1009 | 3300025924 | Ga0207694_10164711 | Ga0207694_101647113 | 310 |
| 1010 | 3300025928 | Ga0207700_10003970 | Ga0207700_100039702 | 310 |
| 1011 | 3300025949 | Ga0207667_10076602 | Ga0207667_100766022 | 310 |
| 1012 | 3300026067 | Ga0207678_10177795 | Ga0207678_101777952 | 310 |
| 1013 | 3300026078 | Ga0207702_10221582 | Ga0207702_102215822 | 310 |
| 1014 | 3300026095 | Ga0207676_10320361 | Ga0207676_103203612 | 310 |
| 1015 | 3300028379 | Ga0268266_10054100 | Ga0268266_100541004 | 310 |
| 1016 | 3300028381 | Ga0268264_10000048 | Ga0268264_10000048125 | 310 |
| 1017 | 3300031616 | Ga0307508_10000032 | Ga0307508_10000032113 | 310 |
| 1018 | 3300031730 | Ga0307516_10024278 | Ga0307516_100242785 | 310 |
| 1019 | 3300033179 | Ga0307507_10048107 | Ga0307507_100481074 | 310 |
| 1020 | 3300035692 | Ga0373935_0007483 | Ga0373935_0007483_1890_2837 | 310 |
| 1021 | 3300035695 | Ga0373927_0018115 | Ga0373927_0018115_451_1398 | 310 |
| 1022 | 3300035724 | Ga0373933_0281862 | Ga0373933_0281862_79_1020 | 310 |
| 1023 | 3300037068 | Ga0373925_0040305 | Ga0373925_0040305_1493_2440 | 310 |
| 1024 | 3300037466 | Ga0395898_0070357 | Ga0395898_0070357_1622_2566 | 310 |
| 1025 | 3300037853 | Ga0436364_0158121 | Ga0436364_0158121_775_1719 | 310 |
| 1026 | 3300038443 | Ga0395901_0109506 | Ga0395901_0109506_550_1494 | 310 |
| 1027 | 3300038443 | Ga0395901_0528257 | Ga0395901_0528257_39_983 | 310 |
| 1028 | 3300039450 | Ga0436363_0276330 | Ga0436363_0276330_48_992 | 310 |
| 1029 | 3300041505 | Ga0451849_0905512 | Ga0451849_0905512_72_1019 | 310 |
| 1030 | 3300046455 | Ga0495603_0179421 | Ga0495603_0179421_215_1156 | 310 |
| 1031 | 3300046507 | Ga0495606_0164021 | Ga0495606_0164021_33_974 | 310 |
| 1032 | 3300046512 | Ga0495610_0132880 | Ga0495610_0132880_81_1022 | 310 |
| 1033 | 3300046524 | Ga0495648_0062681 | Ga0495648_0062681_1117_2058 | 310 |
| 1034 | 3300046616 | Ga0495668_0055283 | Ga0495668_0055283_1069_2010 | 310 |
| 1035 | 3300046660 | Ga0495625_0100157 | Ga0495625_0100157_314_1255 | 310 |
| 1036 | 3300046674 | Ga0495588_0007010 | Ga0495588_0007010_572_1513 | 310 |
| 1037 | 3300046679 | Ga0495623_0181432 | Ga0495623_0181432_144_1085 | 310 |
| 1038 | 3300047323 | Ga0495683_0041815 | Ga0495683_0041815_914_1855 | 310 |
| 1039 | 3300048903 | Ga0496100_0022125 | Ga0496100_0022125_2393_3334 | 310 |
| 1040 | 3300048904 | Ga0496101_0066146 | Ga0496101_0066146_680_1621 | 310 |
| 1041 | 3300048906 | Ga0496103_0137969 | Ga0496103_0137969_275_1210 | 310 |
| 1042 | 3300048907 | Ga0496104_0091277 | Ga0496104_0091277_1238_2179 | 310 |
| 1043 | 3300048908 | Ga0496105_0071435 | Ga0496105_0071435_867_1808 | 310 |
| 1044 | 3300048909 | Ga0496106_0000240 | Ga0496106_0000240_27685_28632 | 310 |
| 1045 | 3300048914 | Ga0496111_0256964 | Ga0496111_0256964_206_1147 | 310 |
| 1046 | 3300048915 | Ga0496112_0031464 | Ga0496112_0031464_2340_3299 | 310 |
| 1047 | 3300048919 | Ga0496116_0049951 | Ga0496116_0049951_1247_2188 | 310 |
| 1048 | 3300048924 | Ga0496121_0004398 | Ga0496121_0004398_15264_16211 | 310 |
| 1049 | 3300048924 | Ga0496121_0009774 | Ga0496121_0009774_9974_10915 | 310 |
| 1050 | 3300048924 | Ga0496121_0077850 | Ga0496121_0077850_1653_2594 | 310 |
| 1051 | 3300048927 | Ga0496124_0010351 | Ga0496124_0010351_1195_2142 | 310 |
| 1052 | 3300048929 | Ga0496126_0087675 | Ga0496126_0087675_457_1419 | 310 |
| 1053 | 3300048929 | Ga0496126_0260151 | Ga0496126_0260151_345_1286 | 310 |
| 1054 | 3300049573 | Ga0501037_0039808 | Ga0501037_0039808_1420_2364 | 310 |
| 1055 | 3300049822 | Ga0501035_0440342 | Ga0501035_0440342_68_1012 | 310 |
| 1056 | 3300050492 | nmdc:mga0yw44_11581_c1 | nmdc:mga0yw44_11581_c1_796_1737 | 310 |
| 1057 | 3300053080 | Ga0500635_0016196 | Ga0500635_0016196_1094_2041 | 310 |
| 1058 | 3300053080 | Ga0500635_0038984 | Ga0500635_0038984_69_1010 | 310 |
| 1059 | 3300053091 | Ga0500647_0053962 | Ga0500647_0053962_550_1497 | 310 |
| 1060 | 3300053094 | Ga0500566_0066768 | Ga0500566_0066768_516_1463 | 310 |
| 1061 | 3300053150 | Ga0500603_021441 | Ga0500603_021441_519_1466 | 310 |
| 1062 | 3300053162 | Ga0500638_081650 | Ga0500638_081650_445_1392 | 310 |
| 1063 | iso_pu_bacteria | 2513237096 | 2513654030 | 310 |
| 1064 | iso_pu_bacteria | 2513237137 | 2513856782 | 310 |
| 1065 | iso_pu_bacteria | 2513237145 | 2513918370 | 310 |
| 1066 | iso_pu_bacteria | 2517572143 | 2517891396 | 310 |
| 1067 | iso_pu_bacteria | 2524023228 | 2524538418 | 310 |
| 1068 | iso_pu_bacteria | 2667528175 | 2671118824 | 310 |
| 1069 | iso_pu_bacteria | 2791355197 | 2793066766 | 310 |
| 1070 | iso_pu_bacteria | 2885374607 | 2885375148 | 310 |
| 1071 | iso_pu_bacteria | 2904690495 | 2904691259 | 310 |
| 1072 | iso_pu_bacteria | 2904699407 | 2904704938 | 310 |
| 1073 | iso_pu_bacteria | 2906610324 | 2906616578 | 310 |
| 1074 | iso_pu_bacteria | 2906635258 | 2906635355 | 310 |
| 1075 | iso_pu_bacteria | 2906660503 | 2906666901 | 310 |
| 1076 | iso_pu_bacteria | 2908739725 | 2908741746 | 310 |
| 1077 | iso_pu_bacteria | 2908756301 | 2908759100 | 310 |
| 1078 | iso_pu_bacteria | 2922425934 | 2922431398 | 310 |
| 1079 | iso_pu_bacteria | 2935630451 | 2935633994 | 310 |
| 1080 | iso_pu_bacteria | 2941507105 | 2941510703 | 310 |
| 1081 | iso_pu_bacteria | 2941515067 | 2941518087 | 310 |
| 1082 | iso_pu_bacteria | 2941523033 | 2941527042 | 310 |
| 1083 | iso_pu_bacteria | 3005474847 | 3005481195 | 310 |
| 1084 | iso_pu_bacteria | 8019555841 | 8019565401 | 310 |
| 1085 | iso_pu_bacteria | 8019565922 | 8019575495 | 310 |
| 1086 | 3300003215 | JGI25153J46596_10003306 | JGI25153J46596_100033066 | 311 |
| 1087 | 3300003775 | Ga0055524_1038225 | Ga0055524_10382251 | 311 |
| 1088 | 3300003794 | Ga0055531_10007248 | Ga0055531_100072485 | 311 |
| 1089 | 3300005262 | Ga0065165_1001751 | Ga0065165_100175114 | 311 |
| 1090 | 3300005339 | Ga0070660_100119547 | Ga0070660_1001195472 | 311 |
| 1091 | 3300005355 | Ga0070671_100001331 | Ga0070671_1000013316 | 311 |
| 1092 | 3300005364 | Ga0070673_100001163 | Ga0070673_1000011632 | 311 |
| 1093 | 3300005434 | Ga0070709_10285123 | Ga0070709_102851231 | 311 |
| 1094 | 3300005435 | Ga0070714_100074625 | Ga0070714_1000746254 | 311 |
| 1095 | 3300005436 | Ga0070713_100437403 | Ga0070713_1004374032 | 311 |
| 1096 | 3300005439 | Ga0070711_100031068 | Ga0070711_1000310681 | 311 |
| 1097 | 3300005439 | Ga0070711_100342022 | Ga0070711_1003420221 | 311 |
| 1098 | 3300005467 | Ga0070706_100504310 | Ga0070706_1005043101 | 311 |
| 1099 | 3300005563 | Ga0068855_100109595 | Ga0068855_1001095954 | 311 |
| 1100 | 3300005563 | Ga0068855_100514364 | Ga0068855_1005143642 | 311 |
| 1101 | 3300005614 | Ga0068856_100000061 | Ga0068856_10000006199 | 311 |
| 1102 | 3300005614 | Ga0068856_100164062 | Ga0068856_1001640622 | 311 |
| 1103 | 3300005616 | Ga0068852_100057914 | Ga0068852_1000579143 | 311 |
| 1104 | 3300005844 | Ga0068862_100320378 | Ga0068862_1003203782 | 311 |
| 1105 | 3300006028 | Ga0070717_10000208 | Ga0070717_100002087 | 311 |
| 1106 | 3300006048 | Ga0075363_100133035 | Ga0075363_1001330352 | 311 |
| 1107 | 3300006173 | Ga0070716_100099943 | Ga0070716_1000999432 | 311 |
| 1108 | 3300006186 | Ga0075369_10022794 | Ga0075369_100227942 | 311 |
| 1109 | 3300006871 | Ga0075434_100104565 | Ga0075434_1001045652 | 311 |
| 1110 | 3300006871 | Ga0075434_100170865 | Ga0075434_1001708651 | 311 |
| 1111 | 3300006942 | Ga0099824_1029023 | Ga0099824_10290232 | 311 |
| 1112 | 3300007076 | Ga0075435_100075883 | Ga0075435_1000758833 | 311 |
| 1113 | 3300007788 | Ga0099795_10044907 | Ga0099795_100449071 | 311 |
| 1114 | 3300009098 | Ga0105245_10061269 | Ga0105245_100612693 | 311 |
| 1115 | 3300010375 | Ga0105239_10028563 | Ga0105239_100285633 | 311 |
| 1116 | 3300013105 | Ga0157369_10120105 | Ga0157369_101201054 | 311 |
| 1117 | 3300013308 | Ga0157375_10381399 | Ga0157375_103813992 | 311 |
| 1118 | 3300014969 | Ga0157376_10275313 | Ga0157376_102753132 | 311 |
| 1119 | 3300025245 | Ga0207425_1030064 | Ga0207425_10300641 | 311 |
| 1120 | 3300025253 | Ga0209677_100210 | Ga0209677_10021021 | 311 |
| 1121 | 3300025253 | Ga0209677_105160 | Ga0209677_1051606 | 311 |
| 1122 | 3300025261 | Ga0209233_1001530 | Ga0209233_10015303 | 311 |
| 1123 | 3300025272 | Ga0209455_1008006 | Ga0209455_10080063 | 311 |
| 1124 | 3300025295 | Ga0209564_1009757 | Ga0209564_10097574 | 311 |
| 1125 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011248 | 311 |
| 1126 | 3300025297 | Ga0209758_1001880 | Ga0209758_100188011 | 311 |
| 1127 | 3300025297 | Ga0209758_1013435 | Ga0209758_10134353 | 311 |
| 1128 | 3300025299 | Ga0209256_1006181 | Ga0209256_10061817 | 311 |
| 1129 | 3300025304 | Ga0209257_1002014 | Ga0209257_100201410 | 311 |
| 1130 | 3300025900 | Ga0207710_10086027 | Ga0207710_100860272 | 311 |
| 1131 | 3300025910 | Ga0207684_10168751 | Ga0207684_101687512 | 311 |
| 1132 | 3300025911 | Ga0207654_10164089 | Ga0207654_101640891 | 311 |
| 1133 | 3300025915 | Ga0207693_10013341 | Ga0207693_100133416 | 311 |
| 1134 | 3300025916 | Ga0207663_10033274 | Ga0207663_100332744 | 311 |
| 1135 | 3300025916 | Ga0207663_10200181 | Ga0207663_102001812 | 311 |
| 1136 | 3300025919 | Ga0207657_10138605 | Ga0207657_101386053 | 311 |
| 1137 | 3300025925 | Ga0207650_10019497 | Ga0207650_100194974 | 311 |
| 1138 | 3300025927 | Ga0207687_10163940 | Ga0207687_101639401 | 311 |
| 1139 | 3300025928 | Ga0207700_10002188 | Ga0207700_100021887 | 311 |
| 1140 | 3300025928 | Ga0207700_10022181 | Ga0207700_100221813 | 311 |
| 1141 | 3300025931 | Ga0207644_10000779 | Ga0207644_1000077911 | 311 |
| 1142 | 3300025932 | Ga0207690_10305323 | Ga0207690_103053231 | 311 |
| 1143 | 3300025936 | Ga0207670_10021834 | Ga0207670_100218344 | 311 |
| 1144 | 3300025941 | Ga0207711_10290566 | Ga0207711_102905662 | 311 |
| 1145 | 3300025944 | Ga0207661_10201337 | Ga0207661_102013371 | 311 |
| 1146 | 3300025960 | Ga0207651_10008556 | Ga0207651_100085562 | 311 |
| 1147 | 3300026067 | Ga0207678_10068174 | Ga0207678_100681744 | 311 |
| 1148 | 3300026078 | Ga0207702_10000674 | Ga0207702_100006744 | 311 |
| 1149 | 3300027363 | Ga0209700_100007 | Ga0209700_100007219 | 311 |
| 1150 | 3300027671 | Ga0209588_1000977 | Ga0209588_10009776 | 311 |
| 1151 | 3300031238 | Ga0265332_10046951 | Ga0265332_100469512 | 311 |
| 1152 | 3300031241 | Ga0265325_10013213 | Ga0265325_100132135 | 311 |
| 1153 | 3300031711 | Ga0265314_10005447 | Ga0265314_100054477 | 311 |
| 1154 | 3300031911 | Ga0307412_10199216 | Ga0307412_101992162 | 311 |
| 1155 | 3300033180 | Ga0307510_10094526 | Ga0307510_100945264 | 311 |
| 1156 | 3300035086 | Ga0373934_0013184 | Ga0373934_0013184_233_1177 | 311 |
| 1157 | 3300035116 | Ga0373945_0051348 | Ga0373945_0051348_257_1210 | 311 |
| 1158 | 3300035117 | Ga0373953_0094954 | Ga0373953_0094954_169_1113 | 311 |
| 1159 | 3300035118 | Ga0373954_0002403 | Ga0373954_0002403_2071_3015 | 311 |
| 1160 | 3300035120 | Ga0373957_0004788 | Ga0373957_0004788_1132_2076 | 311 |
| 1161 | 3300035170 | Ga0373943_0003753 | Ga0373943_0003753_4022_4978 | 311 |
| 1162 | 3300035172 | Ga0373955_0011024 | Ga0373955_0011024_1143_2096 | 311 |
| 1163 | 3300035172 | Ga0373955_0014829 | Ga0373955_0014829_130_1074 | 311 |
| 1164 | 3300035172 | Ga0373955_0269791 | Ga0373955_0269791_36_992 | 311 |
| 1165 | 3300035692 | Ga0373935_0022558 | Ga0373935_0022558_635_1591 | 311 |
| 1166 | 3300035695 | Ga0373927_0000121 | Ga0373927_0000121_44234_45190 | 311 |
| 1167 | 3300035724 | Ga0373933_0000406 | Ga0373933_0000406_21114_22073 | 311 |
| 1168 | 3300035724 | Ga0373933_0016314 | Ga0373933_0016314_1038_1982 | 311 |
| 1169 | 3300035725 | Ga0373947_0002018 | Ga0373947_0002018_1940_2896 | 311 |
| 1170 | 3300036401 | Ga0373937_0007295 | Ga0373937_0007295_5288_6241 | 311 |
| 1171 | 3300036401 | Ga0373937_0015887 | Ga0373937_0015887_1090_2046 | 311 |
| 1172 | 3300036401 | Ga0373937_0061008 | Ga0373937_0061008_811_1773 | 311 |
| 1173 | 3300036401 | Ga0373937_0068978 | Ga0373937_0068978_926_1870 | 311 |
| 1174 | 3300036401 | Ga0373937_0174380 | Ga0373937_0174380_392_1345 | 311 |
| 1175 | 3300037068 | Ga0373925_0002194 | Ga0373925_0002194_7364_8320 | 311 |
| 1176 | 3300037418 | Ga0395900_0159914 | Ga0395900_0159914_84_1028 | 311 |
| 1177 | 3300037853 | Ga0436364_0335801 | Ga0436364_0335801_138_1082 | 311 |
| 1178 | 3300037853 | Ga0436364_0806163 | Ga0436364_0806163_709_1659 | 311 |
| 1179 | 3300044656 | Ga0466969_0015817 | Ga0466969_0015817_899_1843 | 311 |
| 1180 | 3300044693 | Ga0466961_0000050 | Ga0466961_0000050_41642_42586 | 311 |
| 1181 | 3300044706 | Ga0466964_0073312 | Ga0466964_0073312_395_1339 | 311 |
| 1182 | 3300044842 | Ga0466957_0098530 | Ga0466957_0098530_166_1110 | 311 |
| 1183 | 3300045049 | Ga0466959_0005557 | Ga0466959_0005557_4108_5052 | 311 |
| 1184 | 3300046454 | Ga0495592_0044107 | Ga0495592_0044107_2065_3009 | 311 |
| 1185 | 3300046454 | Ga0495592_0051867 | Ga0495592_0051867_1563_2519 | 311 |
| 1186 | 3300046454 | Ga0495592_0079743 | Ga0495592_0079743_621_1583 | 311 |
| 1187 | 3300046455 | Ga0495603_0001782 | Ga0495603_0001782_4419_5375 | 311 |
| 1188 | 3300046459 | Ga0495629_0000242 | Ga0495629_0000242_19349_20305 | 311 |
| 1189 | 3300046459 | Ga0495629_0004164 | Ga0495629_0004164_9287_10231 | 311 |
| 1190 | 3300046459 | Ga0495629_0016212 | Ga0495629_0016212_94_1038 | 311 |
| 1191 | 3300046461 | Ga0495641_0000994 | Ga0495641_0000994_16235_17191 | 311 |
| 1192 | 3300046462 | Ga0495651_0003779 | Ga0495651_0003779_10102_11046 | 311 |
| 1193 | 3300046462 | Ga0495651_0052110 | Ga0495651_0052110_2090_3052 | 311 |
| 1194 | 3300046462 | Ga0495651_0055504 | Ga0495651_0055504_1548_2492 | 311 |
| 1195 | 3300046463 | Ga0495653_0008912 | Ga0495653_0008912_7184_8128 | 311 |
| 1196 | 3300046472 | Ga0495580_0009026 | Ga0495580_0009026_4428_5384 | 311 |
| 1197 | 3300046473 | Ga0495582_0000268 | Ga0495582_0000268_7219_8175 | 311 |
| 1198 | 3300046475 | Ga0495639_0000157 | Ga0495639_0000157_7843_8799 | 311 |
| 1199 | 3300046476 | Ga0495662_0007644 | Ga0495662_0007644_1902_2858 | 311 |
| 1200 | 3300046507 | Ga0495606_0031897 | Ga0495606_0031897_580_1524 | 311 |
| 1201 | 3300046511 | Ga0495608_0017348 | Ga0495608_0017348_279_1223 | 311 |
| 1202 | 3300046514 | Ga0495618_0044691 | Ga0495618_0044691_1625_2587 | 311 |
| 1203 | 3300046516 | Ga0495628_0042849 | Ga0495628_0042849_2247_3203 | 311 |
| 1204 | 3300046516 | Ga0495628_0130860 | Ga0495628_0130860_111_1073 | 311 |
| 1205 | 3300046516 | Ga0495628_0302491 | Ga0495628_0302491_114_1058 | 311 |
| 1206 | 3300046517 | Ga0495630_0001544 | Ga0495630_0001544_12412_13368 | 311 |
| 1207 | 3300046524 | Ga0495648_0012980 | Ga0495648_0012980_2793_3743 | 311 |
| 1208 | 3300046529 | Ga0495652_0023483 | Ga0495652_0023483_2299_3243 | 311 |
| 1209 | 3300046529 | Ga0495652_0130580 | Ga0495652_0130580_457_1401 | 311 |
| 1210 | 3300046529 | Ga0495652_0199919 | Ga0495652_0199919_367_1329 | 311 |
| 1211 | 3300046531 | Ga0495665_0000656 | Ga0495665_0000656_14607_15563 | 311 |
| 1212 | 3300046533 | Ga0495640_0031288 | Ga0495640_0031288_2294_3238 | 311 |
| 1213 | 3300046533 | Ga0495640_0150375 | Ga0495640_0150375_410_1372 | 311 |
| 1214 | 3300046536 | Ga0495587_0033298 | Ga0495587_0033298_1616_2560 | 311 |
| 1215 | 3300046536 | Ga0495587_0085585 | Ga0495587_0085585_410_1372 | 311 |
| 1216 | 3300046536 | Ga0495587_0089431 | Ga0495587_0089431_754_1704 | 311 |
| 1217 | 3300046543 | Ga0495645_0031198 | Ga0495645_0031198_532_1476 | 311 |
| 1218 | 3300046543 | Ga0495645_0032568 | Ga0495645_0032568_2647_3591 | 311 |
| 1219 | 3300046557 | Ga0495622_0002769 | Ga0495622_0002769_3227_4183 | 311 |
| 1220 | 3300046559 | Ga0495667_0023276 | Ga0495667_0023276_2234_3178 | 311 |
| 1221 | 3300046559 | Ga0495667_0034221 | Ga0495667_0034221_410_1372 | 311 |
| 1222 | 3300046559 | Ga0495667_0096335 | Ga0495667_0096335_164_1108 | 311 |
| 1223 | 3300046615 | Ga0495656_0106485 | Ga0495656_0106485_342_1292 | 311 |
| 1224 | 3300046642 | Ga0495634_0000206 | Ga0495634_0000206_21692_22648 | 311 |
| 1225 | 3300046642 | Ga0495634_0062601 | Ga0495634_0062601_197_1141 | 311 |
| 1226 | 3300046663 | Ga0495635_0000723 | Ga0495635_0000723_14828_15784 | 311 |
| 1227 | 3300046663 | Ga0495635_0001219 | Ga0495635_0001219_14039_14983 | 311 |
| 1228 | 3300046663 | Ga0495635_0013355 | Ga0495635_0013355_4750_5694 | 311 |
| 1229 | 3300046674 | Ga0495588_0023587 | Ga0495588_0023587_1112_2068 | 311 |
| 1230 | 3300046675 | Ga0495657_0008675 | Ga0495657_0008675_2802_3746 | 311 |
| 1231 | 3300046675 | Ga0495657_0044184 | Ga0495657_0044184_515_1459 | 311 |
| 1232 | 3300046678 | Ga0495599_0044999 | Ga0495599_0044999_992_1936 | 311 |
| 1233 | 3300046678 | Ga0495599_0070256 | Ga0495599_0070256_916_1878 | 311 |
| 1234 | 3300046679 | Ga0495623_0011265 | Ga0495623_0011265_424_1368 | 311 |
| 1235 | 3300046679 | Ga0495623_0029832 | Ga0495623_0029832_1913_2875 | 311 |
| 1236 | 3300046680 | Ga0495646_0068838 | Ga0495646_0068838_452_1396 | 311 |
| 1237 | 3300046680 | Ga0495646_0070746 | Ga0495646_0070746_163_1125 | 311 |
| 1238 | 3300046680 | Ga0495646_0085362 | Ga0495646_0085362_323_1267 | 311 |
| 1239 | 3300046681 | Ga0495647_0001229 | Ga0495647_0001229_4264_5220 | 311 |
| 1240 | 3300046683 | Ga0495658_0000188 | Ga0495658_0000188_22433_23389 | 311 |
| 1241 | 3300046689 | Ga0495613_0013006 | Ga0495613_0013006_2645_3601 | 311 |
| 1242 | 3300046689 | Ga0495613_0060722 | Ga0495613_0060722_49_993 | 311 |
| 1243 | 3300046690 | Ga0495624_0007942 | Ga0495624_0007942_1760_2716 | 311 |
| 1244 | 3300046690 | Ga0495624_0039263 | Ga0495624_0039263_228_1172 | 311 |
| 1245 | 3300046809 | Ga0495600_0000483 | Ga0495600_0000483_19450_20394 | 311 |
| 1246 | 3300046809 | Ga0495600_0011323 | Ga0495600_0011323_1771_2715 | 311 |
| 1247 | 3300046809 | Ga0495600_0203879 | Ga0495600_0203879_229_1185 | 311 |
| 1248 | 3300047315 | Ga0495581_0000166 | Ga0495581_0000166_15196_16152 | 311 |
| 1249 | 3300047317 | Ga0495604_0017915 | Ga0495604_0017915_380_1324 | 311 |
| 1250 | 3300047317 | Ga0495604_0058327 | Ga0495604_0058327_1533_2477 | 311 |
| 1251 | 3300047317 | Ga0495604_0138976 | Ga0495604_0138976_68_1030 | 311 |
| 1252 | 3300047317 | Ga0495604_0161565 | Ga0495604_0161565_410_1354 | 311 |
| 1253 | 3300047319 | Ga0495674_0009028 | Ga0495674_0009028_3983_4939 | 311 |
| 1254 | 3300047321 | Ga0495676_0069500 | Ga0495676_0069500_1339_2295 | 311 |
| 1255 | 3300047321 | Ga0495676_0085664 | Ga0495676_0085664_1252_2196 | 311 |
| 1256 | 3300047322 | Ga0495680_0044358 | Ga0495680_0044358_533_1477 | 311 |
| 1257 | 3300047322 | Ga0495680_0126487 | Ga0495680_0126487_378_1334 | 311 |
| 1258 | 3300047444 | Ga0495675_0013918 | Ga0495675_0013918_3148_4092 | 311 |
| 1259 | 3300047471 | Ga0495684_0224593 | Ga0495684_0224593_334_1278 | 311 |
| 1260 | 3300047472 | Ga0495686_0124056 | Ga0495686_0124056_346_1290 | 311 |
| 1261 | 3300047673 | Ga0495593_0000033 | Ga0495593_0000033_14934_15890 | 311 |
| 1262 | 3300048088 | Ga0495602_0028813 | Ga0495602_0028813_4120_5064 | 311 |
| 1263 | 3300048088 | Ga0495602_0033120 | Ga0495602_0033120_2195_3139 | 311 |
| 1264 | 3300048088 | Ga0495602_0061823 | Ga0495602_0061823_361_1305 | 311 |
| 1265 | 3300048088 | Ga0495602_0224989 | Ga0495602_0224989_253_1215 | 311 |
| 1266 | 3300048091 | Ga0495626_0023088 | Ga0495626_0023088_1899_2849 | 311 |
| 1267 | 3300048903 | Ga0496100_0322190 | Ga0496100_0322190_103_1062 | 311 |
| 1268 | 3300048905 | Ga0496102_0193234 | Ga0496102_0193234_217_1179 | 311 |
| 1269 | 3300048907 | Ga0496104_0018839 | Ga0496104_0018839_609_1568 | 311 |
| 1270 | 3300048909 | Ga0496106_0003104 | Ga0496106_0003104_5287_6246 | 311 |
| 1271 | 3300048911 | Ga0496108_0002539 | Ga0496108_0002539_13524_14483 | 311 |
| 1272 | 3300048912 | Ga0496109_0012367 | Ga0496109_0012367_6107_7066 | 311 |
| 1273 | 3300048912 | Ga0496109_0136395 | Ga0496109_0136395_952_1914 | 311 |
| 1274 | 3300048913 | Ga0496110_0014112 | Ga0496110_0014112_3443_4402 | 311 |
| 1275 | 3300048915 | Ga0496112_0006587 | Ga0496112_0006587_179_1138 | 311 |
| 1276 | 3300048915 | Ga0496112_0079018 | Ga0496112_0079018_449_1411 | 311 |
| 1277 | 3300048915 | Ga0496112_0390556 | Ga0496112_0390556_135_1097 | 311 |
| 1278 | 3300048916 | Ga0496113_0044236 | Ga0496113_0044236_461_1405 | 311 |
| 1279 | 3300048916 | Ga0496113_0119535 | Ga0496113_0119535_1003_1962 | 311 |
| 1280 | 3300048916 | Ga0496113_0408091 | Ga0496113_0408091_65_1027 | 311 |
| 1281 | 3300048918 | Ga0496115_0079065 | Ga0496115_0079065_1088_2032 | 311 |
| 1282 | 3300048918 | Ga0496115_0145934 | Ga0496115_0145934_896_1840 | 311 |
| 1283 | 3300048918 | Ga0496115_0333045 | Ga0496115_0333045_48_986 | 311 |
| 1284 | 3300048922 | Ga0496119_0007401 | Ga0496119_0007401_8210_9154 | 311 |
| 1285 | 3300048924 | Ga0496121_0029407 | Ga0496121_0029407_659_1609 | 311 |
| 1286 | 3300048924 | Ga0496121_0067206 | Ga0496121_0067206_696_1640 | 311 |
| 1287 | 3300048924 | Ga0496121_0072871 | Ga0496121_0072871_1351_2295 | 311 |
| 1288 | 3300048924 | Ga0496121_0131444 | Ga0496121_0131444_518_1462 | 311 |
| 1289 | 3300048925 | Ga0496122_0075240 | Ga0496122_0075240_640_1590 | 311 |
| 1290 | 3300048928 | Ga0496125_0072594 | Ga0496125_0072594_719_1663 | 311 |
| 1291 | 3300048929 | Ga0496126_0005072 | Ga0496126_0005072_4411_5352 | 311 |
| 1292 | 3300048929 | Ga0496126_0007510 | Ga0496126_0007510_6172_7122 | 311 |
| 1293 | 3300048929 | Ga0496126_0019129 | Ga0496126_0019129_5126_6088 | 311 |
| 1294 | 3300048929 | Ga0496126_0029901 | Ga0496126_0029901_3408_4352 | 311 |
| 1295 | 3300048929 | Ga0496126_0072340 | Ga0496126_0072340_304_1254 | 311 |
| 1296 | 3300049460 | Ga0495682_0058567 | Ga0495682_0058567_203_1147 | 311 |
| 1297 | 3300049580 | Ga0501046_0069104 | Ga0501046_0069104_228_1172 | 311 |
| 1298 | 3300049581 | Ga0501047_0033590 | Ga0501047_0033590_2890_3834 | 311 |
| 1299 | 3300049586 | Ga0501070_0003190 | Ga0501070_0003190_11808_12752 | 311 |
| 1300 | 3300049742 | Ga0501080_0059524 | Ga0501080_0059524_1845_2789 | 311 |
| 1301 | 3300049822 | Ga0501035_0110892 | Ga0501035_0110892_229_1173 | 311 |
| 1302 | 3300050512 | nmdc:mga0n895_101084_c1 | nmdc:mga0n895_101084_c1_1493_2443 | 311 |
| 1303 | 3300050513 | nmdc:mga0rr50_59482_c1 | nmdc:mga0rr50_59482_c1_1332_2282 | 311 |
| 1304 | 3300053077 | Ga0495601_0044171 | Ga0495601_0044171_146_1090 | 311 |
| 1305 | 3300053084 | Ga0495595_0029061 | Ga0495595_0029061_1026_1970 | 311 |
| 1306 | 3300053084 | Ga0495595_0078396 | Ga0495595_0078396_199_1161 | 311 |
| 1307 | 3300053085 | Ga0495619_0000557 | Ga0495619_0000557_23197_24141 | 311 |
| 1308 | 3300053094 | Ga0500566_0000331 | Ga0500566_0000331_17422_18372 | 311 |
| 1309 | 3300053094 | Ga0500566_0001048 | Ga0500566_0001048_14930_15874 | 311 |
| 1310 | 3300053094 | Ga0500566_0001969 | Ga0500566_0001969_404_1348 | 311 |
| 1311 | 3300053095 | Ga0500640_000214 | Ga0500640_000214_9737_10681 | 311 |
| 1312 | 3300053095 | Ga0500640_001983 | Ga0500640_001983_3163_4107 | 311 |
| 1313 | 3300053111 | Ga0500572_000175 | Ga0500572_000175_4840_5784 | 311 |
| 1314 | 3300053122 | Ga0500608_006744 | Ga0500608_006744_2556_3500 | 311 |
| 1315 | 3300053122 | Ga0500608_039749 | Ga0500608_039749_1163_2107 | 311 |
| 1316 | 3300053123 | Ga0500614_001781 | Ga0500614_001781_2715_3659 | 311 |
| 1317 | 3300053136 | Ga0500559_0001458 | Ga0500559_0001458_11069_12019 | 311 |
| 1318 | 3300053138 | Ga0500564_007644 | Ga0500564_007644_144_1088 | 311 |
| 1319 | 3300053150 | Ga0500603_002027 | Ga0500603_002027_2806_3750 | 311 |
| 1320 | 3300053162 | Ga0500638_001677 | Ga0500638_001677_3937_4881 | 311 |
| 1321 | 3300053163 | Ga0500639_000239 | Ga0500639_000239_7450_8394 | 311 |
| 1322 | 3300053177 | Ga0500636_0000102 | Ga0500636_0000102_40553_41497 | 311 |
| 1323 | 3300053177 | Ga0500636_0007566 | Ga0500636_0007566_2017_2967 | 311 |
| 1324 | 3300053735 | Ga0500596_000367 | Ga0500596_000367_1452_2396 | 311 |
| 1325 | 3300053737 | Ga0500601_000568 | Ga0500601_000568_4049_4993 | 311 |
| 1326 | 3300002077 | JGI24744J21845_10012885 | JGI24744J21845_100128852 | 312 |
| 1327 | 3300003215 | JGI25153J46596_10017828 | JGI25153J46596_100178281 | 312 |
| 1328 | 3300005329 | Ga0070683_100151988 | Ga0070683_1001519882 | 312 |
| 1329 | 3300005330 | Ga0070690_100067718 | Ga0070690_1000677182 | 312 |
| 1330 | 3300005330 | Ga0070690_100230714 | Ga0070690_1002307142 | 312 |
| 1331 | 3300005334 | Ga0068869_100040310 | Ga0068869_1000403102 | 312 |
| 1332 | 3300005338 | Ga0068868_100323848 | Ga0068868_1003238481 | 312 |
| 1333 | 3300005341 | Ga0070691_10055502 | Ga0070691_100555022 | 312 |
| 1334 | 3300005347 | Ga0070668_100335271 | Ga0070668_1003352712 | 312 |
| 1335 | 3300005438 | Ga0070701_10041569 | Ga0070701_100415692 | 312 |
| 1336 | 3300005440 | Ga0070705_100160119 | Ga0070705_1001601192 | 312 |
| 1337 | 3300005455 | Ga0070663_100007575 | Ga0070663_1000075753 | 312 |
| 1338 | 3300005455 | Ga0070663_100108146 | Ga0070663_1001081463 | 312 |
| 1339 | 3300005456 | Ga0070678_100034207 | Ga0070678_1000342075 | 312 |
| 1340 | 3300005467 | Ga0070706_100422434 | Ga0070706_1004224341 | 312 |
| 1341 | 3300005471 | Ga0070698_100117349 | Ga0070698_1001173492 | 312 |
| 1342 | 3300005518 | Ga0070699_100115865 | Ga0070699_1001158653 | 312 |
| 1343 | 3300005539 | Ga0068853_100061235 | Ga0068853_1000612352 | 312 |
| 1344 | 3300005544 | Ga0070686_100121701 | Ga0070686_1001217012 | 312 |
| 1345 | 3300005547 | Ga0070693_100092290 | Ga0070693_1000922902 | 312 |
| 1346 | 3300005548 | Ga0070665_100018182 | Ga0070665_1000181827 | 312 |
| 1347 | 3300005564 | Ga0070664_100067330 | Ga0070664_1000673302 | 312 |
| 1348 | 3300005564 | Ga0070664_100174708 | Ga0070664_1001747083 | 312 |
| 1349 | 3300005618 | Ga0068864_100052894 | Ga0068864_1000528942 | 312 |
| 1350 | 3300005719 | Ga0068861_100080957 | Ga0068861_1000809572 | 312 |
| 1351 | 3300005841 | Ga0068863_100209360 | Ga0068863_1002093603 | 312 |
| 1352 | 3300005937 | Ga0081455_10009007 | Ga0081455_100090078 | 312 |
| 1353 | 3300005983 | Ga0081540_1011941 | Ga0081540_10119417 | 312 |
| 1354 | 3300005983 | Ga0081540_1016188 | Ga0081540_10161882 | 312 |
| 1355 | 3300005985 | Ga0081539_10041150 | Ga0081539_100411503 | 312 |
| 1356 | 3300006038 | Ga0075365_10049600 | Ga0075365_100496003 | 312 |
| 1357 | 3300006038 | Ga0075365_10208039 | Ga0075365_102080392 | 312 |
| 1358 | 3300006048 | Ga0075363_100003841 | Ga0075363_1000038413 | 312 |
| 1359 | 3300006048 | Ga0075363_100055194 | Ga0075363_1000551943 | 312 |
| 1360 | 3300006051 | Ga0075364_10019920 | Ga0075364_100199203 | 312 |
| 1361 | 3300006051 | Ga0075364_10039910 | Ga0075364_100399105 | 312 |
| 1362 | 3300006173 | Ga0070716_100093962 | Ga0070716_1000939623 | 312 |
| 1363 | 3300006178 | Ga0075367_10005056 | Ga0075367_100050565 | 312 |
| 1364 | 3300006186 | Ga0075369_10037577 | Ga0075369_100375773 | 312 |
| 1365 | 3300006195 | Ga0075366_10022697 | Ga0075366_100226972 | 312 |
| 1366 | 3300006353 | Ga0075370_10021974 | Ga0075370_100219742 | 312 |
| 1367 | 3300006358 | Ga0068871_100244303 | Ga0068871_1002443031 | 312 |
| 1368 | 3300006358 | Ga0068871_100252316 | Ga0068871_1002523162 | 312 |
| 1369 | 3300006943 | Ga0099822_1019170 | Ga0099822_10191704 | 312 |
| 1370 | 3300009094 | Ga0111539_10131557 | Ga0111539_101315574 | 312 |
| 1371 | 3300009098 | Ga0105245_10041292 | Ga0105245_100412922 | 312 |
| 1372 | 3300009147 | Ga0114129_10042454 | Ga0114129_100424543 | 312 |
| 1373 | 3300009177 | Ga0105248_10026351 | Ga0105248_100263512 | 312 |
| 1374 | 3300010375 | Ga0105239_10012274 | Ga0105239_100122748 | 312 |
| 1375 | 3300011119 | Ga0105246_10021797 | Ga0105246_100217975 | 312 |
| 1376 | 3300013297 | Ga0157378_10228615 | Ga0157378_102286151 | 312 |
| 1377 | 3300013306 | Ga0163162_10206620 | Ga0163162_102066201 | 312 |
| 1378 | 3300013306 | Ga0163162_10223672 | Ga0163162_102236722 | 312 |
| 1379 | 3300013308 | Ga0157375_10117297 | Ga0157375_101172972 | 312 |
| 1380 | 3300013308 | Ga0157375_10358192 | Ga0157375_103581922 | 312 |
| 1381 | 3300014325 | Ga0163163_10013378 | Ga0163163_100133782 | 312 |
| 1382 | 3300014326 | Ga0157380_10106128 | Ga0157380_101061283 | 312 |
| 1383 | 3300014969 | Ga0157376_10105040 | Ga0157376_101050403 | 312 |
| 1384 | 3300014969 | Ga0157376_10194684 | Ga0157376_101946842 | 312 |
| 1385 | 3300025297 | Ga0209758_1011390 | Ga0209758_10113904 | 312 |
| 1386 | 3300025885 | Ga0207653_10037063 | Ga0207653_100370632 | 312 |
| 1387 | 3300025923 | Ga0207681_10351236 | Ga0207681_103512362 | 312 |
| 1388 | 3300025927 | Ga0207687_10008249 | Ga0207687_100082495 | 312 |
| 1389 | 3300025927 | Ga0207687_10034015 | Ga0207687_100340153 | 312 |
| 1390 | 3300025933 | Ga0207706_10044372 | Ga0207706_100443723 | 312 |
| 1391 | 3300025934 | Ga0207686_10190464 | Ga0207686_101904641 | 312 |
| 1392 | 3300025935 | Ga0207709_10041045 | Ga0207709_100410452 | 312 |
| 1393 | 3300025938 | Ga0207704_10016603 | Ga0207704_100166034 | 312 |
| 1394 | 3300025939 | Ga0207665_10087106 | Ga0207665_100871063 | 312 |
| 1395 | 3300025940 | Ga0207691_10103559 | Ga0207691_101035594 | 312 |
| 1396 | 3300025940 | Ga0207691_10295307 | Ga0207691_102953071 | 312 |
| 1397 | 3300025941 | Ga0207711_10163587 | Ga0207711_101635872 | 312 |
| 1398 | 3300025942 | Ga0207689_10045378 | Ga0207689_100453782 | 312 |
| 1399 | 3300025944 | Ga0207661_10139786 | Ga0207661_101397862 | 312 |
| 1400 | 3300025945 | Ga0207679_10073592 | Ga0207679_100735923 | 312 |
| 1401 | 3300025960 | Ga0207651_10161943 | Ga0207651_101619433 | 312 |
| 1402 | 3300025961 | Ga0207712_10133922 | Ga0207712_101339222 | 312 |
| 1403 | 3300025972 | Ga0207668_10075709 | Ga0207668_100757092 | 312 |
| 1404 | 3300026023 | Ga0207677_10055826 | Ga0207677_100558263 | 312 |
| 1405 | 3300026035 | Ga0207703_10034858 | Ga0207703_100348585 | 312 |
| 1406 | 3300026067 | Ga0207678_10048395 | Ga0207678_100483952 | 312 |
| 1407 | 3300026075 | Ga0207708_10097594 | Ga0207708_100975944 | 312 |
| 1408 | 3300026088 | Ga0207641_10359235 | Ga0207641_103592352 | 312 |
| 1409 | 3300026089 | Ga0207648_10277847 | Ga0207648_102778472 | 312 |
| 1410 | 3300026089 | Ga0207648_10310033 | Ga0207648_103100331 | 312 |
| 1411 | 3300026095 | Ga0207676_10639524 | Ga0207676_106395241 | 312 |
| 1412 | 3300026118 | Ga0207675_100053074 | Ga0207675_1000530746 | 312 |
| 1413 | 3300026121 | Ga0207683_10021252 | Ga0207683_100212524 | 312 |
| 1414 | 3300026121 | Ga0207683_10312436 | Ga0207683_103124361 | 312 |
| 1415 | 3300026121 | Ga0207683_10407319 | Ga0207683_104073192 | 312 |
| 1416 | 3300027907 | Ga0207428_10119708 | Ga0207428_101197082 | 312 |
| 1417 | 3300028379 | Ga0268266_10003344 | Ga0268266_1000334412 | 312 |
| 1418 | 3300028379 | Ga0268266_10079189 | Ga0268266_100791893 | 312 |
| 1419 | 3300028380 | Ga0268265_10383608 | Ga0268265_103836082 | 312 |
| 1420 | 3300028786 | Ga0307517_10104672 | Ga0307517_101046722 | 312 |
| 1421 | 3300031507 | Ga0307509_10363690 | Ga0307509_103636902 | 312 |
| 1422 | 3300031616 | Ga0307508_10211078 | Ga0307508_102110782 | 312 |
| 1423 | 3300031730 | Ga0307516_10059573 | Ga0307516_100595732 | 312 |
| 1424 | 3300033180 | Ga0307510_10003449 | Ga0307510_1000344910 | 312 |
| 1425 | 3300035112 | Ga0373932_0010303 | Ga0373932_0010303_1067_2143 | 312 |
| 1426 | 3300035207 | Ga0373942_0025301 | Ga0373942_0025301_491_1435 | 312 |
| 1427 | 3300035691 | Ga0373931_0006221 | Ga0373931_0006221_1898_2974 | 312 |
| 1428 | 3300035695 | Ga0373927_0017851 | Ga0373927_0017851_1976_2920 | 312 |
| 1429 | 3300037068 | Ga0373925_0161670 | Ga0373925_0161670_194_1138 | 312 |
| 1430 | 3300042157 | Ga0439458_0035939 | Ga0439458_0035939_42_980 | 312 |
| 1431 | 3300046453 | Ga0495627_052975 | Ga0495627_052975_140_1078 | 312 |
| 1432 | 3300046455 | Ga0495603_0027453 | Ga0495603_0027453_2211_3149 | 312 |
| 1433 | 3300046455 | Ga0495603_0089164 | Ga0495603_0089164_764_1702 | 312 |
| 1434 | 3300046477 | Ga0495664_0107218 | Ga0495664_0107218_682_1626 | 312 |
| 1435 | 3300046491 | Ga0495584_0166798 | Ga0495584_0166798_145_1083 | 312 |
| 1436 | 3300046492 | Ga0495585_0091017 | Ga0495585_0091017_606_1544 | 312 |
| 1437 | 3300046507 | Ga0495606_0162853 | Ga0495606_0162853_308_1246 | 312 |
| 1438 | 3300046519 | Ga0495632_0033563 | Ga0495632_0033563_1069_2007 | 312 |
| 1439 | 3300046529 | Ga0495652_0262573 | Ga0495652_0262573_101_1045 | 312 |
| 1440 | 3300046648 | Ga0495611_0126704 | Ga0495611_0126704_227_1165 | 312 |
| 1441 | 3300046674 | Ga0495588_0134831 | Ga0495588_0134831_278_1216 | 312 |
| 1442 | 3300046694 | Ga0495649_0116099 | Ga0495649_0116099_126_1064 | 312 |
| 1443 | 3300047320 | Ga0495672_0128453 | Ga0495672_0128453_32_973 | 312 |
| 1444 | 3300047445 | Ga0495677_0034301 | Ga0495677_0034301_135_1073 | 312 |
| 1445 | 3300047446 | Ga0495679_031312 | Ga0495679_031312_766_1704 | 312 |
| 1446 | 3300048904 | Ga0496101_0339580 | Ga0496101_0339580_50_1126 | 312 |
| 1447 | 3300048905 | Ga0496102_0401079 | Ga0496102_0401079_236_1174 | 312 |
| 1448 | 3300048906 | Ga0496103_0020025 | Ga0496103_0020025_2227_3171 | 312 |
| 1449 | 3300048907 | Ga0496104_0020301 | Ga0496104_0020301_1351_2295 | 312 |
| 1450 | 3300048907 | Ga0496104_0024862 | Ga0496104_0024862_3282_4358 | 312 |
| 1451 | 3300048908 | Ga0496105_0016130 | Ga0496105_0016130_702_1646 | 312 |
| 1452 | 3300048908 | Ga0496105_0341835 | Ga0496105_0341835_71_1147 | 312 |
| 1453 | 3300048909 | Ga0496106_0006834 | Ga0496106_0006834_61_1005 | 312 |
| 1454 | 3300048909 | Ga0496106_0044470 | Ga0496106_0044470_1207_2283 | 312 |
| 1455 | 3300048910 | Ga0496107_0037814 | Ga0496107_0037814_947_2023 | 312 |
| 1456 | 3300048911 | Ga0496108_0096940 | Ga0496108_0096940_390_1334 | 312 |
| 1457 | 3300048913 | Ga0496110_0034780 | Ga0496110_0034780_1092_2036 | 312 |
| 1458 | 3300048913 | Ga0496110_0047732 | Ga0496110_0047732_840_1916 | 312 |
| 1459 | 3300048914 | Ga0496111_0056594 | Ga0496111_0056594_254_1198 | 312 |
| 1460 | 3300048914 | Ga0496111_0401545 | Ga0496111_0401545_39_977 | 312 |
| 1461 | 3300048915 | Ga0496112_0001811 | Ga0496112_0001811_11926_13002 | 312 |
| 1462 | 3300048915 | Ga0496112_0004764 | Ga0496112_0004764_4241_5185 | 312 |
| 1463 | 3300048915 | Ga0496112_0172063 | Ga0496112_0172063_231_1169 | 312 |
| 1464 | 3300048916 | Ga0496113_0005360 | Ga0496113_0005360_846_1790 | 312 |
| 1465 | 3300048916 | Ga0496113_0010973 | Ga0496113_0010973_61_1137 | 312 |
| 1466 | 3300048917 | Ga0496114_0119721 | Ga0496114_0119721_221_1297 | 312 |
| 1467 | 3300048918 | Ga0496115_0004354 | Ga0496115_0004354_2430_3374 | 312 |
| 1468 | 3300048918 | Ga0496115_0016709 | Ga0496115_0016709_3150_4226 | 312 |
| 1469 | 3300048918 | Ga0496115_0145172 | Ga0496115_0145172_559_1497 | 312 |
| 1470 | 3300048924 | Ga0496121_0070273 | Ga0496121_0070273_730_1668 | 312 |
| 1471 | 3300048929 | Ga0496126_0005800 | Ga0496126_0005800_8614_9552 | 312 |
| 1472 | 3300050490 | nmdc:mga03n38_24684_c1 | nmdc:mga03n38_24684_c1_25_963 | 312 |
| 1473 | 3300050490 | nmdc:mga03n38_2872_c1 | nmdc:mga03n38_2872_c1_2986_3924 | 312 |
| 1474 | 3300050490 | nmdc:mga03n38_61621_c1 | nmdc:mga03n38_61621_c1_691_1629 | 312 |
| 1475 | 3300050491 | nmdc:mga00v17_50057_c1 | nmdc:mga00v17_50057_c1_273_1211 | 312 |
| 1476 | 3300050491 | nmdc:mga00v17_78206_c1 | nmdc:mga00v17_78206_c1_363_1301 | 312 |
| 1477 | 3300050494 | nmdc:mga06z11_131701_c1 | nmdc:mga06z11_131701_c1_345_1283 | 312 |
| 1478 | 3300050494 | nmdc:mga06z11_46757_c1 | nmdc:mga06z11_46757_c1_1188_2126 | 312 |
| 1479 | 3300050496 | nmdc:mga07m45_1086_c1 | nmdc:mga07m45_1086_c1_7314_8252 | 312 |
| 1480 | 3300050507 | nmdc:mga05p37_268632_c1 | nmdc:mga05p37_268632_c1_1017_1955 | 312 |
| 1481 | 3300050511 | nmdc:mga08y16_34714_c1 | nmdc:mga08y16_34714_c1_4340_5278 | 312 |
| 1482 | 3300050516 | nmdc:mga0sz30_20147_c1 | nmdc:mga0sz30_20147_c1_844_1782 | 312 |
| 1483 | 3300050516 | nmdc:mga0sz30_58797_c1 | nmdc:mga0sz30_58797_c1_490_1428 | 312 |
| 1484 | 3300053077 | Ga0495601_0092862 | Ga0495601_0092862_381_1325 | 312 |
| 1485 | 3300053094 | Ga0500566_0021105 | Ga0500566_0021105_2169_3113 | 312 |
| 1486 | 3300053104 | Ga0500556_0085971 | Ga0500556_0085971_155_1093 | 312 |
| 1487 | 3300053119 | Ga0500595_000715 | Ga0500595_000715_2749_3693 | 312 |
| 1488 | 3300053147 | Ga0500589_076989 | Ga0500589_076989_416_1354 | 312 |
| 1489 | 3300053162 | Ga0500638_005668 | Ga0500638_005668_3037_3981 | 312 |
| 1490 | 3300053178 | Ga0500637_0000265 | Ga0500637_0000265_13526_14470 | 312 |
| 1491 | 3300053730 | Ga0500645_027102 | Ga0500645_027102_560_1498 | 312 |
| 1492 | iso_pu_bacteria | 2903748898 | 2903755956 | 312 |
| 1493 | iso_pu_bacteria | 8006933436 | 8006939518 | 312 |
| 1494 | iso_pu_bacteria | 8006973647 | 8006979268 | 312 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3d03-assembly1.cif.gz_A | 1.9a structure of glycerophoshphodiesterase (gpdq) from enterobacter aerogenes | 0.796 | 55 | 256 |
| 2dxl-assembly1.cif.gz_A | glycerophosphodiesterase from enterobacter aerogenes | 0.7821 | 55 | 256 |
| 2hyp-assembly1.cif.gz_A-2 | crystal structure of rv0805 d66a mutant | 0.6787 | 55 | 256 |
| 3ib7-assembly1.cif.gz_A | crystal structure of full length rv0805 | 0.671 | 55 | 258 |
| 2hy1-assembly1.cif.gz_A-2 | crystal structure of rv0805 | 0.6691 | 55 | 256 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3d03A01 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;GpdQ, catalytic alpha/beta sandwich domain | 0.8224 | 55 | 143 | 3.60.21.40 |
| af_Q5M886_14_327_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.7584 | 53 | 251 | 3.60.21.10 |
| af_A0A1D6HZI4_13_293_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.7379 | 47 | 258 | 3.60.21.10 |
| af_Q4D1B4_43_325_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.694 | 53 | 258 | 3.60.21.10 |
| af_Q54NC3_152_453_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.6859 | 53 | 247 | 3.60.21.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537S6V3-F1-model_v4 | Metallophosphoesterase | 0.9437 | 88 | 214 |
GO:0005737
GO:0016787 |
| AF-A0A537S6V3-F1-model_v4 | Metallophosphoesterase | 0.9366 | 88 | 214 |
GO:0005737
GO:0016787 |
| AF-A0A530M2F0-F1-model_v4 | Metallophosphoesterase | 0.9187 | 179 | 240 |
|
| AF-A0A2V8ELA9-F1-model_v4 | Metallophosphoesterase | 0.9179 | 20 | 236 |
GO:0005737
GO:0016787 |
| AF-X7ZNG7-F1-model_v4 | Putative metallophosphoesterase | 0.9031 | 126 | 245 |
GO:0005737
GO:0016787 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar