F494358

General Info

Members Datasets Scaffolds Average Seq Length
1494 660 1292 310

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_100093962|Ga0070716_1000939623
Length 358
Sequence MTDASFAHENVITRPGPNRIAGNKPLLRLITSPKAQSRAEGEFVMSDHDHHDEGNGISRRRVLECMTWAGTGVLWTVTGGVPHSLGMVGSAQAAEATGMTFLQISDSHVGFDKPANPNALGTLEEAINKVRAMPAKPSFMIHTGDITHLSKAQEFDDAERIISQAKLDVHYVPGEHDIIDEEIKLYKERYGRGTKGGGWYSFDAGGVHFVGLVNVANLKGGGLGSLGNDQLEWLEDDLKGKSKSTPVVLFAHIPLWTVYPQWGWGTEDGARALDYVKGFGSVTVLNGHIHQVMQKVEGNVTFHTARSTAFPQPAPGTAXXXGPMKVEDAKLRSLLGVASINFKQNNQPLAIIDTPLQG

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
12 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
13 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
14 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
15 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
16 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
17 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
18 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
19 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
20 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
21 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
22 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
23 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
24 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
25 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
26 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
27 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
28 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
29 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
30 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
31 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
32 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
33 2818991467 Bosea vestrisii 3192 Isolate Unclassified
34 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
35 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
36 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
37 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
38 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
39 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
40 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
41 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
42 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
43 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
44 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
45 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
46 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
47 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
48 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
49 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
50 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
51 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
52 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
53 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
54 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
55 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
56 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
57 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
58 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
59 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
60 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
61 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
62 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
63 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
64 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
65 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
66 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
67 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
68 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
69 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
70 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
71 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
72 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
73 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
74 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
75 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
76 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
77 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
78 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
79 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
80 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
81 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
82 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
83 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
84 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
85 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
86 2904699407
87 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
88 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
89 2906610324
90 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
91 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
92 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
93 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
94 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
95 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
96 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
97 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
98 2922368715
99 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
100 2922425934
101 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
102 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
103 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
104 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
105 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
106 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
107 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
108 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
109 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
110 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
111 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
112 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
113 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
114 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
115 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
116 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
117 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
118 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
119 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
120 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
121 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
122 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
123 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
124 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
125 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
126 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
127 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
128 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
129 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
130 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
131 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
132 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
133 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
134 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
135 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
136 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
137 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
138 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
139 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
140 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
141 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
142 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
143 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
144 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
145 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
146 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
147 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
148 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
149 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
150 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
151 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
152 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
153 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
154 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
155 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
156 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
157 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
158 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
159 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
160 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
161 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
162 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
163 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
164 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
165 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
166 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
167 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
168 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
169 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
170 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
171 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
172 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
173 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
174 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
175 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
176 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
177 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
178 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
179 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
180 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
181 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
182 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
183 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
184 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
185 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
186 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
187 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
188 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
189 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
190 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
191 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
192 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
193 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
194 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
195 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
196 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
197 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
198 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
199 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
200 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
201 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
202 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
203 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
204 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
205 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
206 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
207 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
208 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
209 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
210 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
211 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
212 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
213 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
214 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
215 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
216 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
217 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
218 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
219 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
220 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
221 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
222 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
223 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
224 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
225 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
226 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
227 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
228 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
229 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
230 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
231 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
232 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
233 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
234 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
235 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
236 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
237 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
238 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
239 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
240 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
241 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
242 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
243 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
244 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
245 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
246 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
247 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
248 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
249 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
250 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
251 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
252 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
253 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
254 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
255 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
256 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
257 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
258 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
259 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
260 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
261 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
262 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
263 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
264 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
265 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
266 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
267 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
268 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
269 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
270 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
271 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
272 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
273 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
274 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
275 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
276 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
277 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
278 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
279 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
280 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
281 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
282 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
283 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
284 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
285 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
286 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
287 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
288 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
289 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
290 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
291 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
292 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
293 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
294 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
295 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
296 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
298 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
299 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
300 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
301 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
302 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
360 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
361 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
362 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
363 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
366 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
367 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
371 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
372 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
373 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
374 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
375 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
376 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
377 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
378 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
379 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
380 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
382 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
383 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
384 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
385 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
386 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
387 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
388 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
389 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
390 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
391 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
392 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
393 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
394 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
395 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
396 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
397 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
398 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
399 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
400 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
401 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
402 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
403 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
404 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
405 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
406 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
407 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
408 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
409 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
410 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
411 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
412 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
413 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
414 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
415 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
416 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
417 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
418 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
419 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
420 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
421 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
422 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
423 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
424 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
425 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
426 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
427 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
428 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
429 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
430 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
431 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
432 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
433 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
434 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
435 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
436 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
437 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
438 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
439 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
440 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
441 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
442 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
443 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
444 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
445 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
446 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
447 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
448 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
449 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
450 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
451 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
452 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
453 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
454 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
455 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
456 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
457 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
458 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
459 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
460 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
461 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
462 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
463 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
464 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
465 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
466 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
467 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
468 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
469 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
470 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
471 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
472 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
473 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
474 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
475 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
476 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
477 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
478 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
479 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
480 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
481 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
482 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
483 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
484 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
485 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
486 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
487 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
488 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
489 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
490 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
491 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
492 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
493 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
494 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
495 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
496 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
497 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
498 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
499 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
500 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
501 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
502 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
503 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
504 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
505 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
506 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
507 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
508 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
509 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
510 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
511 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
512 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
513 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
514 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
515 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
516 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
517 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
518 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
519 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
520 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
521 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
522 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
523 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
524 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
525 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
526 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
527 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
528 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
529 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
530 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
531 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
532 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
533 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
534 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
535 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
536 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
537 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
538 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
539 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
540 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
541 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
542 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
543 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
544 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
545 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
546 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
547 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
548 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
549 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
550 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
551 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
552 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
553 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
554 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
555 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
556 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
557 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
558 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
559 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
560 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
561 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
562 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
563 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
564 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
565 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
566 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
567 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
568 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
569 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
570 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
571 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
572 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
573 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
574 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
575 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
576 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
577 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
578 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
579 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
580 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
581 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
582 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
583 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
584 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
585 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
586 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
587 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
588 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
589 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
590 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
591 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
592 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
593 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
594 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
595 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
596 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
597 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
598 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
599 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
600 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
601 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
602 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
603 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
604 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
605 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
606 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
607 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
608 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
609 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
610 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
611 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
612 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
613 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
614 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
615 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
616 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
617 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
618 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
619 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
620 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
621 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
622 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
623 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
624 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
625 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
626 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
627 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
628 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
629 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
630 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
631 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
632 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
633 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
634 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
635 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
636 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
637 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
638 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
639 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
640 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
641 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
642 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
643 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
644 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
645 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
646 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
647 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
648 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
649 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
650 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
651 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
652 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
653 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
654 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
655 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
656 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
657 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
658 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
659 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
660 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.58
Metatranscriptomes 0.13
Isolates 13.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.11
Nodule 10.98
Rhizoplane 8.23
Rhizosphere 62.52
Stem 0
Stem Tuber 0
Unclassified 8.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10012885 3300002077 Bacteria 1689
2 JGI25406J46586_10000034 3300003203 Bacteria 64645
3 JGI25165J46597_1005127 3300003214 Bacteria 2597
4 JGI25153J46596_10001825 3300003215 Bacteria 12626
5 JGI25153J46596_10003306 3300003215 Bacteria 9060
6 JGI25153J46596_10003323 3300003215 Bacteria 9041
7 JGI25153J46596_10017828 3300003215 Bacteria 2780
8 JGI25160J50197_1001067 3300003354 Bacteria 14062
9 JGI25160J50197_1003948 3300003354 Bacteria 6482
10 Ga0055524_1038225 3300003775 Bacteria 1259
11 Ga0055531_10007248 3300003794 Bacteria 6093
12 Ga0065165_1001751 3300005262 Bacteria 21612
13 Ga0065165_1002727 3300005262 Bacteria 14113
14 Ga0065165_1007687 3300005262 Bacteria 5226
15 Ga0065712_10090736 3300005290 Bacteria 2406
16 Ga0070658_10006356 3300005327 Bacteria 9576
17 Ga0070683_100011551 3300005329 Bacteria 7642
18 Ga0070683_100151988 3300005329 Bacteria 2195
19 Ga0070683_100179425 3300005329 Bacteria 2010
20 Ga0070690_100067718 3300005330 Bacteria 2314
21 Ga0070690_100230714 3300005330 Bacteria 1301
22 Ga0070670_100019180 3300005331 Bacteria 5865
23 Ga0068869_100040310 3300005334 Bacteria 3339
24 Ga0070680_100003194 3300005336 Bacteria 12183
25 Ga0070680_100026227 3300005336 Bacteria 4660
26 Ga0070682_100192145 3300005337 Bacteria 1434
27 Ga0068868_100003369 3300005338 Bacteria 11116
28 Ga0068868_100323848 3300005338 Bacteria 1313
29 Ga0070660_100119547 3300005339 Bacteria 2102
30 Ga0070689_100228857 3300005340 Bacteria 1527
31 Ga0070691_10055502 3300005341 Bacteria 1898
32 Ga0070691_10152793 3300005341 Bacteria 1185
33 Ga0070661_100126323 3300005344 Bacteria 1919
34 Ga0070668_100048502 3300005347 Bacteria 3266
35 Ga0070668_100335271 3300005347 Bacteria 1276
36 Ga0070671_100001331 3300005355 Bacteria 18540
37 Ga0070671_100108912 3300005355 Bacteria 2326
38 Ga0070671_100123457 3300005355 Bacteria 2180
39 Ga0070671_100231660 3300005355 Bacteria 1567
40 Ga0070674_100418330 3300005356 Bacteria 1099
41 Ga0070673_100001163 3300005364 Bacteria 15102
42 Ga0070688_100009486 3300005365 Bacteria 5325
43 Ga0070659_100035456 3300005366 Bacteria 3885
44 Ga0070659_100171629 3300005366 Bacteria 1777
45 Ga0070667_100224514 3300005367 Bacteria 1673
46 Ga0070709_10000980 3300005434 Bacteria 15831
47 Ga0070709_10012949 3300005434 Bacteria 4678
48 Ga0070709_10023800 3300005434 Bacteria 3601
49 Ga0070709_10285123 3300005434 Bacteria 1202
50 Ga0070714_100009105 3300005435 Bacteria 7789
51 Ga0070714_100028817 3300005435 Bacteria 4610
52 Ga0070714_100074625 3300005435 Bacteria 2941
53 Ga0070714_100168229 3300005435 Bacteria 1988
54 Ga0070714_100204543 3300005435 Bacteria 1807
55 Ga0070714_100430093 3300005435 Bacteria 1251
56 Ga0070713_100016044 3300005436 Bacteria 5624
57 Ga0070713_100019667 3300005436 Bacteria 5164
58 Ga0070713_100104854 3300005436 Bacteria 2455
59 Ga0070713_100437403 3300005436 Bacteria 1226
60 Ga0070710_10001038 3300005437 Bacteria 13188
61 Ga0070710_10336147 3300005437 Bacteria 996
62 Ga0070701_10041569 3300005438 Bacteria 2343
63 Ga0070701_10097009 3300005438 Bacteria 1626
64 Ga0070711_100031068 3300005439 Bacteria 3542
65 Ga0070711_100210234 3300005439 Bacteria 1506
66 Ga0070711_100342022 3300005439 Bacteria 1201
67 Ga0070705_100160119 3300005440 Bacteria 1504
68 Ga0070708_100430775 3300005445 Bacteria 1244
69 Ga0070663_100007575 3300005455 Bacteria 6620
70 Ga0070663_100071340 3300005455 Bacteria 2527
71 Ga0070663_100108146 3300005455 Bacteria 2085
72 Ga0070663_100274661 3300005455 Bacteria 1341
73 Ga0070678_100034207 3300005456 Bacteria 3537
74 Ga0070678_100075509 3300005456 Bacteria 2536
75 Ga0070662_100014566 3300005457 Bacteria 5257
76 Ga0070681_10076110 3300005458 Bacteria 3315
77 Ga0070681_10141744 3300005458 Bacteria 2333
78 Ga0070685_10079820 3300005466 Bacteria 1959
79 Ga0070706_100093672 3300005467 Bacteria 2787
80 Ga0070706_100422434 3300005467 Bacteria 1241
81 Ga0070706_100504310 3300005467 Bacteria 1126
82 Ga0070706_100519681 3300005467 Bacteria 1107
83 Ga0070698_100117349 3300005471 Bacteria 2623
84 Ga0070698_100378137 3300005471 Bacteria 1349
85 Ga0070699_100020399 3300005518 Bacteria 5716
86 Ga0070699_100115865 3300005518 Bacteria 2355
87 Ga0070679_100003933 3300005530 Bacteria 13668
88 Ga0070679_100005873 3300005530 Bacteria 11399
89 Ga0070679_100030562 3300005530 Bacteria 5317
90 Ga0070679_100512987 3300005530 Bacteria 1143
91 Ga0070684_100004390 3300005535 Bacteria 10725
92 Ga0070684_100102059 3300005535 Bacteria 2564
93 Ga0068853_100061235 3300005539 Bacteria 3255
94 Ga0068853_100097378 3300005539 Bacteria 2597
95 Ga0068853_100308793 3300005539 Bacteria 1464
96 Ga0068853_100568835 3300005539 Bacteria 1075
97 Ga0070686_100120031 3300005544 Bacteria 1804
98 Ga0070686_100121701 3300005544 Bacteria 1793
99 Ga0070696_100104082 3300005546 Bacteria 2038
100 Ga0070693_100092290 3300005547 Bacteria 1828
101 Ga0070693_100224641 3300005547 Bacteria 1232
102 Ga0070665_100018182 3300005548 Bacteria 7051
103 Ga0070665_100089220 3300005548 Bacteria 3089
104 Ga0068855_100040685 3300005563 Bacteria 5515
105 Ga0068855_100109595 3300005563 Bacteria 3170
106 Ga0068855_100151421 3300005563 Bacteria 2637
107 Ga0068855_100153219 3300005563 Bacteria 2620
108 Ga0068855_100492094 3300005563 Bacteria 1334
109 Ga0068855_100514364 3300005563 Bacteria 1299
110 Ga0070664_100067330 3300005564 Bacteria 3061
111 Ga0070664_100112833 3300005564 Bacteria 2374
112 Ga0070664_100174708 3300005564 Bacteria 1907
113 Ga0070664_100402500 3300005564 Bacteria 1252
114 Ga0068857_100004623 3300005577 Bacteria 11662
115 Ga0068857_100183234 3300005577 Bacteria 1906
116 Ga0068857_100285856 3300005577 Bacteria 1518
117 Ga0068857_100340982 3300005577 Bacteria 1386
118 Ga0068854_100356583 3300005578 Bacteria 1199
119 Ga0068856_100000061 3300005614 Bacteria 100823
120 Ga0068856_100164062 3300005614 Bacteria 2233
121 Ga0068856_100385102 3300005614 Bacteria 1422
122 Ga0070702_100145231 3300005615 Bacteria 1516
123 Ga0068852_100057914 3300005616 Bacteria 3354
124 Ga0068852_100062101 3300005616 Bacteria 3248
125 Ga0068852_100154357 3300005616 Bacteria 2137
126 Ga0068864_100032645 3300005618 Bacteria 4424
127 Ga0068864_100052894 3300005618 Bacteria 3501
128 Ga0068861_100080957 3300005719 Bacteria 2541
129 Ga0068851_10013394 3300005834 Bacteria 3882
130 Ga0068863_100209360 3300005841 Bacteria 1877
131 Ga0068858_100129319 3300005842 Bacteria 2367
132 Ga0068860_100000081 3300005843 Bacteria 170066
133 Ga0068862_100320378 3300005844 Bacteria 1431
134 Ga0081455_10007949 3300005937 Bacteria 11092
135 Ga0081455_10009007 3300005937 Bacteria 10306
136 Ga0081455_10044794 3300005937 Bacteria 3855
137 Ga0081540_1002071 3300005983 Bacteria 16719
138 Ga0081540_1005540 3300005983 Bacteria 9406
139 Ga0081540_1011941 3300005983 Bacteria 5763
140 Ga0081540_1016188 3300005983 Bacteria 4681
141 Ga0081540_1051986 3300005983 Bacteria 2021
142 Ga0081539_10000113 3300005985 Bacteria 189418
143 Ga0081539_10041150 3300005985 Bacteria 2705
144 Ga0070717_10000208 3300006028 Bacteria 41212
145 Ga0070717_10066392 3300006028 Bacteria 3000
146 Ga0070717_10068036 3300006028 Bacteria 2964
147 Ga0075365_10004575 3300006038 Bacteria 7356
148 Ga0075365_10014013 3300006038 Bacteria 4814
149 Ga0075365_10021525 3300006038 Bacteria 4024
150 Ga0075365_10024117 3300006038 Bacteria 3833
151 Ga0075365_10049600 3300006038 Bacteria 2766
152 Ga0075365_10054563 3300006038 Bacteria 2650
153 Ga0075365_10152188 3300006038 Bacteria 1609
154 Ga0075365_10208039 3300006038 Bacteria 1371
155 Ga0075363_100003841 3300006048 Bacteria 6476
156 Ga0075363_100055194 3300006048 Bacteria 2127
157 Ga0075363_100133035 3300006048 Bacteria 1396
158 Ga0075364_10019920 3300006051 Bacteria 4215
159 Ga0075364_10034720 3300006051 Bacteria 3256
160 Ga0075364_10039910 3300006051 Bacteria 3044
161 Ga0075364_10158324 3300006051 Bacteria 1528
162 Ga0075364_10173534 3300006051 Bacteria 1457
163 Ga0070715_10065594 3300006163 Bacteria 1607
164 Ga0070715_10172285 3300006163 Bacteria 1079
165 Ga0070716_100093962 3300006173 Bacteria 1822
166 Ga0070716_100099943 3300006173 Bacteria 1776
167 Ga0070716_100103910 3300006173 Bacteria 1748
168 Ga0070716_100123649 3300006173 Bacteria 1624
169 Ga0070712_100135046 3300006175 Bacteria 1875
170 Ga0070712_100151972 3300006175 Bacteria 1778
171 Ga0070712_100180661 3300006175 Bacteria 1644
172 Ga0070712_100256228 3300006175 Bacteria 1400
173 Ga0070712_100333482 3300006175 Bacteria 1237
174 Ga0075362_10039864 3300006177 Bacteria 2067
175 Ga0075367_10005056 3300006178 Bacteria 6505
176 Ga0075367_10059371 3300006178 Bacteria 2277
177 Ga0075367_10157837 3300006178 Bacteria 1410
178 Ga0075369_10022794 3300006186 Bacteria 2585
179 Ga0075369_10037577 3300006186 Bacteria 2063
180 Ga0075369_10087865 3300006186 Bacteria 1385
181 Ga0075366_10022697 3300006195 Bacteria 3653
182 Ga0075370_10021974 3300006353 Bacteria 3498
183 Ga0075370_10105120 3300006353 Bacteria 1636
184 Ga0068871_100244303 3300006358 Bacteria 1562
185 Ga0068871_100252316 3300006358 Bacteria 1537
186 Ga0068871_100394270 3300006358 Bacteria 1232
187 Ga0075428_100022167 3300006844 Bacteria 7031
188 Ga0075428_100026465 3300006844 Bacteria 6421
189 Ga0075428_100079610 3300006844 Bacteria 3576
190 Ga0075428_100267586 3300006844 Bacteria 1839
191 Ga0075430_100004132 3300006846 Bacteria 12251
192 Ga0075431_100080863 3300006847 Bacteria 3355
193 Ga0075431_100264386 3300006847 Bacteria 1745
194 Ga0075433_10154365 3300006852 Bacteria 2042
195 Ga0075434_100001874 3300006871 Bacteria 18197
196 Ga0075434_100054546 3300006871 Bacteria 3970
197 Ga0075434_100103424 3300006871 Bacteria 2856
198 Ga0075434_100104565 3300006871 Bacteria 2841
199 Ga0075434_100170360 3300006871 Bacteria 2197
200 Ga0075434_100170865 3300006871 Bacteria 2194
201 Ga0075429_100007719 3300006880 Bacteria 9338
202 Ga0075429_100103107 3300006880 Bacteria 2491
203 Ga0075436_100005587 3300006914 Bacteria 8632
204 Ga0097620_100348056 3300006931 Bacteria 1577
205 Ga0099824_1008208 3300006942 Bacteria 13453
206 Ga0099824_1029023 3300006942 Bacteria 2417
207 Ga0099822_1019170 3300006943 Bacteria 7010
208 Ga0075435_100075883 3300007076 Bacteria 2754
209 Ga0075435_100200593 3300007076 Bacteria 1690
210 Ga0099795_10011722 3300007788 Bacteria 2633
211 Ga0099795_10044907 3300007788 Bacteria 1587
212 Ga0099795_10069235 3300007788 Bacteria 1328
213 Ga0105240_10006945 3300009093 Bacteria 16535
214 Ga0105240_10074116 3300009093 Bacteria 4202
215 Ga0105240_10322270 3300009093 Bacteria 1761
216 Ga0105240_10630473 3300009093 Bacteria 1177
217 Ga0111539_10019857 3300009094 Bacteria 8279
218 Ga0111539_10048617 3300009094 Bacteria 5063
219 Ga0111539_10131557 3300009094 Bacteria 2930
220 Ga0111539_10182131 3300009094 Bacteria 2453
221 Ga0111539_10198631 3300009094 Bacteria 2339
222 Ga0105245_10041292 3300009098 Bacteria 4112
223 Ga0105245_10042042 3300009098 Bacteria 4076
224 Ga0105245_10061269 3300009098 Bacteria 3391
225 Ga0105245_10374432 3300009098 Bacteria 1416
226 Ga0105245_10583035 3300009098 Bacteria 1143
227 Ga0105247_10059860 3300009101 Bacteria 2359
228 Ga0114129_10008567 3300009147 Bacteria 14580
229 Ga0114129_10042174 3300009147 Bacteria 6426
230 Ga0114129_10042454 3300009147 Bacteria 6404
231 Ga0114129_10185593 3300009147 Bacteria 2827
232 Ga0114129_10265232 3300009147 Bacteria 2300
233 Ga0114129_10346200 3300009147 Bacteria 1970
234 Ga0105242_10203400 3300009176 Bacteria 1760
235 Ga0105242_10313825 3300009176 Bacteria 1435
236 Ga0105248_10026351 3300009177 Bacteria 6466
237 Ga0105248_10038782 3300009177 Bacteria 5333
238 Ga0105248_10194247 3300009177 Bacteria 2287
239 Ga0105237_10008888 3300009545 Bacteria 10825
240 Ga0105237_10017912 3300009545 Bacteria 7341
241 Ga0105237_10059562 3300009545 Bacteria 3820
242 Ga0105237_10090951 3300009545 Bacteria 3041
243 Ga0105237_10207419 3300009545 Bacteria 1960
244 Ga0105238_10005132 3300009551 Bacteria 12943
245 Ga0105238_10009886 3300009551 Bacteria 9562
246 Ga0105238_10254680 3300009551 Bacteria 1734
247 Ga0105249_10390340 3300009553 Bacteria 1420
248 Ga0099796_10002743 3300010159 Bacteria 3945
249 Ga0099796_10032738 3300010159 Bacteria 1706
250 Ga0099796_10044171 3300010159 Bacteria 1521
251 Ga0099796_10083612 3300010159 Bacteria 1175
252 Ga0105239_10012274 3300010375 Bacteria 9542
253 Ga0105239_10028563 3300010375 Bacteria 6132
254 Ga0105246_10021797 3300011119 Bacteria 4127
255 Ga0105246_10132191 3300011119 Bacteria 1865
256 Ga0105246_10146800 3300011119 Bacteria 1781
257 Ga0157370_10008947 3300013104 Bacteria 10757
258 Ga0157370_10181189 3300013104 Bacteria 1957
259 Ga0157369_10007421 3300013105 Bacteria 12626
260 Ga0157369_10049936 3300013105 Bacteria 4532
261 Ga0157369_10104121 3300013105 Bacteria 3023
262 Ga0157369_10120105 3300013105 Bacteria 2789
263 Ga0157378_10009553 3300013297 Bacteria 8447
264 Ga0157378_10043596 3300013297 Bacteria 3984
265 Ga0157378_10054478 3300013297 Bacteria 3561
266 Ga0157378_10228615 3300013297 Bacteria 1771
267 Ga0163162_10068601 3300013306 Bacteria 3598
268 Ga0163162_10137069 3300013306 Bacteria 2559
269 Ga0163162_10149195 3300013306 Bacteria 2455
270 Ga0163162_10206620 3300013306 Bacteria 2093
271 Ga0163162_10223672 3300013306 Bacteria 2012
272 Ga0163162_10658319 3300013306 Bacteria 1171
273 Ga0157372_10065655 3300013307 Bacteria 4075
274 Ga0157372_10144333 3300013307 Bacteria 2745
275 Ga0157372_10167444 3300013307 Bacteria 2542
276 Ga0157372_10366476 3300013307 Bacteria 1679
277 Ga0157375_10117297 3300013308 Bacteria 2767
278 Ga0157375_10264780 3300013308 Bacteria 1880
279 Ga0157375_10358192 3300013308 Bacteria 1625
280 Ga0157375_10381399 3300013308 Bacteria 1576
281 Ga0163163_10004545 3300014325 Bacteria 11850
282 Ga0163163_10013378 3300014325 Bacteria 7511
283 Ga0163163_10020333 3300014325 Bacteria 6250
284 Ga0163163_10037933 3300014325 Bacteria 4691
285 Ga0163163_10496919 3300014325 Bacteria 1282
286 Ga0157380_10106128 3300014326 Bacteria 2350
287 Ga0182008_10015082 3300014497 Bacteria 4040
288 Ga0157376_10105040 3300014969 Bacteria 2476
289 Ga0157376_10194684 3300014969 Bacteria 1861
290 Ga0157376_10275313 3300014969 Bacteria 1583
291 Ga0182006_1090949 3300015261 Bacteria 1098
292 Ga0206354_10772337 3300020081 Bacteria 1107
293 Ga0213872_10068362 3300021361 Bacteria 1603
294 Ga0213874_10003010 3300021377 Bacteria 3695
295 Ga0213874_10010728 3300021377 Bacteria 2301
296 Ga0213876_10001034 3300021384 Bacteria 17966
297 Ga0213876_10001237 3300021384 Bacteria 16109
298 Ga0213876_10003065 3300021384 Bacteria 9662
299 Ga0213875_10000053 3300021388 Bacteria 141791
300 Ga0213875_10000902 3300021388 Bacteria 21584
301 Ga0213875_10010291 3300021388 Bacteria 4686
302 Ga0213875_10037778 3300021388 Bacteria 2275
303 Ga0209563_102501 3300025230 Bacteria 4134
304 Ga0207425_1030064 3300025245 Bacteria 1091
305 Ga0209677_100210 3300025253 Bacteria 44738
306 Ga0209677_105160 3300025253 Bacteria 3496
307 Ga0209148_1000180 3300025254 Bacteria 124830
308 Ga0209148_1000530 3300025254 Bacteria 37591
309 Ga0209233_1001530 3300025261 Bacteria 9065
310 Ga0209455_1000326 3300025272 Bacteria 46230
311 Ga0209455_1008006 3300025272 Bacteria 2921
312 Ga0209564_1009757 3300025295 Bacteria 4516
313 Ga0209758_1000011 3300025297 Bacteria 1049685
314 Ga0209758_1001429 3300025297 Bacteria 28224
315 Ga0209758_1001880 3300025297 Bacteria 22994
316 Ga0209758_1004591 3300025297 Bacteria 11369
317 Ga0209758_1011390 3300025297 Bacteria 5158
318 Ga0209758_1013435 3300025297 Bacteria 4463
319 Ga0209256_1006181 3300025299 Bacteria 6463
320 Ga0209256_1032783 3300025299 Bacteria 1405
321 Ga0207426_1000429 3300025302 Bacteria 68612
322 Ga0207426_1000620 3300025302 Bacteria 45305
323 Ga0207426_1019649 3300025302 Bacteria 2358
324 Ga0209257_1002014 3300025304 Bacteria 21724
325 Ga0209257_1040647 3300025304 Bacteria 1386
326 Ga0207653_10037063 3300025885 Bacteria 1590
327 Ga0207692_10001278 3300025898 Bacteria 9337
328 Ga0207692_10030503 3300025898 Bacteria 2572
329 Ga0207642_10030124 3300025899 Bacteria 2256
330 Ga0207710_10086027 3300025900 Bacteria 1465
331 Ga0207688_10084804 3300025901 Bacteria 1814
332 Ga0207647_10008887 3300025904 Bacteria 7164
333 Ga0207647_10099068 3300025904 Bacteria 1731
334 Ga0207685_10002938 3300025905 Bacteria 4033
335 Ga0207685_10041009 3300025905 Bacteria 1729
336 Ga0207699_10011463 3300025906 Bacteria 4478
337 Ga0207699_10021454 3300025906 Bacteria 3481
338 Ga0207699_10022022 3300025906 Bacteria 3447
339 Ga0207699_10034223 3300025906 Bacteria 2879
340 Ga0207699_10051062 3300025906 Bacteria 2442
341 Ga0207705_10022855 3300025909 Bacteria 4458
342 Ga0207705_10037077 3300025909 Bacteria 3489
343 Ga0207705_10086970 3300025909 Bacteria 2285
344 Ga0207684_10168751 3300025910 Bacteria 1886
345 Ga0207654_10164089 3300025911 Bacteria 1437
346 Ga0207654_10289648 3300025911 Bacteria 1110
347 Ga0207707_10001229 3300025912 Bacteria 24021
348 Ga0207707_10048060 3300025912 Bacteria 3717
349 Ga0207707_10142145 3300025912 Bacteria 2098
350 Ga0207707_10287256 3300025912 Bacteria 1423
351 Ga0207695_10000008 3300025913 Bacteria 1058268
352 Ga0207695_10025044 3300025913 Bacteria 6692
353 Ga0207695_10029844 3300025913 Bacteria 6016
354 Ga0207695_10054668 3300025913 Bacteria 4167
355 Ga0207695_10106569 3300025913 Bacteria 2789
356 Ga0207671_10008749 3300025914 Bacteria 8531
357 Ga0207671_10020103 3300025914 Bacteria 5091
358 Ga0207671_10132031 3300025914 Bacteria 1917
359 Ga0207693_10006620 3300025915 Bacteria 9572
360 Ga0207693_10013341 3300025915 Bacteria 6624
361 Ga0207693_10054488 3300025915 Bacteria 3137
362 Ga0207693_10088878 3300025915 Bacteria 2421
363 Ga0207693_10097479 3300025915 Bacteria 2305
364 Ga0207693_10131365 3300025915 Bacteria 1969
365 Ga0207693_10223237 3300025915 Bacteria 1480
366 Ga0207663_10033274 3300025916 Bacteria 3069
367 Ga0207663_10047065 3300025916 Bacteria 2661
368 Ga0207663_10200181 3300025916 Bacteria 1440
369 Ga0207663_10294988 3300025916 Bacteria 1209
370 Ga0207660_10044712 3300025917 Bacteria 3116
371 Ga0207657_10000658 3300025919 Bacteria 36762
372 Ga0207657_10041142 3300025919 Bacteria 4088
373 Ga0207657_10138605 3300025919 Bacteria 1989
374 Ga0207652_10003041 3300025921 Bacteria 13986
375 Ga0207681_10037411 3300025923 Bacteria 3207
376 Ga0207681_10351236 3300025923 Bacteria 1180
377 Ga0207694_10058318 3300025924 Bacteria 3003
378 Ga0207694_10164711 3300025924 Bacteria 1792
379 Ga0207694_10195723 3300025924 Bacteria 1643
380 Ga0207650_10019497 3300025925 Bacteria 4767
381 Ga0207650_10048647 3300025925 Bacteria 3128
382 Ga0207650_10050330 3300025925 Bacteria 3080
383 Ga0207650_10131962 3300025925 Bacteria 1956
384 Ga0207687_10008249 3300025927 Bacteria 6815
385 Ga0207687_10034015 3300025927 Bacteria 3459
386 Ga0207687_10163940 3300025927 Bacteria 1708
387 Ga0207700_10002188 3300025928 Bacteria 11212
388 Ga0207700_10003970 3300025928 Bacteria 8655
389 Ga0207700_10022181 3300025928 Bacteria 4351
390 Ga0207700_10026454 3300025928 Bacteria 4045
391 Ga0207700_10055560 3300025928 Bacteria 2977
392 Ga0207700_10078191 3300025928 Bacteria 2573
393 Ga0207700_10118403 3300025928 Bacteria 2143
394 Ga0207700_10185390 3300025928 Bacteria 1745
395 Ga0207664_10004931 3300025929 Bacteria 9075
396 Ga0207664_10043388 3300025929 Bacteria 3516
397 Ga0207664_10062949 3300025929 Bacteria 2964
398 Ga0207664_10067320 3300025929 Bacteria 2874
399 Ga0207664_10256089 3300025929 Bacteria 1529
400 Ga0207664_10377598 3300025929 Bacteria 1258
401 Ga0207644_10000779 3300025931 Bacteria 20223
402 Ga0207644_10045790 3300025931 Bacteria 3113
403 Ga0207690_10089000 3300025932 Bacteria 2176
404 Ga0207690_10095851 3300025932 Bacteria 2108
405 Ga0207690_10240626 3300025932 Bacteria 1394
406 Ga0207690_10305323 3300025932 Bacteria 1246
407 Ga0207706_10027569 3300025933 Bacteria 5078
408 Ga0207706_10044372 3300025933 Bacteria 3940
409 Ga0207706_10060204 3300025933 Bacteria 3344
410 Ga0207686_10069432 3300025934 Bacteria 2260
411 Ga0207686_10190464 3300025934 Bacteria 1462
412 Ga0207709_10041045 3300025935 Bacteria 2774
413 Ga0207670_10021834 3300025936 Bacteria 3956
414 Ga0207669_10120499 3300025937 Bacteria 1780
415 Ga0207704_10016603 3300025938 Bacteria 3788
416 Ga0207665_10017817 3300025939 Bacteria 4668
417 Ga0207665_10028857 3300025939 Bacteria 3668
418 Ga0207665_10057788 3300025939 Bacteria 2621
419 Ga0207665_10087106 3300025939 Bacteria 2158
420 Ga0207665_10096918 3300025939 Bacteria 2052
421 Ga0207691_10103559 3300025940 Bacteria 2538
422 Ga0207691_10295307 3300025940 Bacteria 1393
423 Ga0207711_10088461 3300025941 Bacteria 2719
424 Ga0207711_10163587 3300025941 Bacteria 2016
425 Ga0207711_10290566 3300025941 Bacteria 1507
426 Ga0207711_10316412 3300025941 Bacteria 1441
427 Ga0207689_10045378 3300025942 Bacteria 3634
428 Ga0207661_10002064 3300025944 Bacteria 13826
429 Ga0207661_10002496 3300025944 Bacteria 12664
430 Ga0207661_10032605 3300025944 Bacteria 4037
431 Ga0207661_10139786 3300025944 Bacteria 2083
432 Ga0207661_10149598 3300025944 Bacteria 2017
433 Ga0207661_10201337 3300025944 Bacteria 1751
434 Ga0207679_10073592 3300025945 Bacteria 2586
435 Ga0207667_10018061 3300025949 Bacteria 7921
436 Ga0207667_10076602 3300025949 Bacteria 3470
437 Ga0207667_10112938 3300025949 Bacteria 2801
438 Ga0207651_10008556 3300025960 Bacteria 5534
439 Ga0207651_10161943 3300025960 Bacteria 1755
440 Ga0207651_10262647 3300025960 Bacteria 1418
441 Ga0207651_10338732 3300025960 Bacteria 1263
442 Ga0207712_10133922 3300025961 Bacteria 1893
443 Ga0207668_10075709 3300025972 Bacteria 2420
444 Ga0207658_10080461 3300025986 Bacteria 2496
445 Ga0207658_10137296 3300025986 Bacteria 1974
446 Ga0207677_10028736 3300026023 Bacteria 3523
447 Ga0207677_10055826 3300026023 Bacteria 2703
448 Ga0207703_10034858 3300026035 Bacteria 3996
449 Ga0207703_10083894 3300026035 Bacteria 2663
450 Ga0207703_10087184 3300026035 Bacteria 2617
451 Ga0207639_10185542 3300026041 Bacteria 1773
452 Ga0207678_10048395 3300026067 Bacteria 3675
453 Ga0207678_10055777 3300026067 Bacteria 3403
454 Ga0207678_10068174 3300026067 Bacteria 3053
455 Ga0207678_10177795 3300026067 Bacteria 1817
456 Ga0207708_10097594 3300026075 Bacteria 2271
457 Ga0207702_10000674 3300026078 Bacteria 37110
458 Ga0207702_10221582 3300026078 Bacteria 1763
459 Ga0207641_10102640 3300026088 Bacteria 2522
460 Ga0207641_10359235 3300026088 Bacteria 1390
461 Ga0207648_10277847 3300026089 Bacteria 1497
462 Ga0207648_10310033 3300026089 Bacteria 1417
463 Ga0207676_10073278 3300026095 Bacteria 2755
464 Ga0207676_10320361 3300026095 Bacteria 1423
465 Ga0207676_10639524 3300026095 Bacteria 1025
466 Ga0207674_10052044 3300026116 Bacteria 4177
467 Ga0207674_10434963 3300026116 Bacteria 1268
468 Ga0207675_100028015 3300026118 Bacteria 5245
469 Ga0207675_100053074 3300026118 Bacteria 3783
470 Ga0207675_100261455 3300026118 Bacteria 1677
471 Ga0207683_10021252 3300026121 Bacteria 5554
472 Ga0207683_10080288 3300026121 Bacteria 2893
473 Ga0207683_10312436 3300026121 Bacteria 1439
474 Ga0207683_10407319 3300026121 Bacteria 1251
475 Ga0207683_10409288 3300026121 Bacteria 1248
476 Ga0207698_10070805 3300026142 Bacteria 2764
477 Ga0207698_10247337 3300026142 Bacteria 1629
478 Ga0207698_10404606 3300026142 Bacteria 1305
479 Ga0209389_1000001 3300027296 Bacteria 463799
480 Ga0209389_1000134 3300027296 Bacteria 65168
481 Ga0209589_1000014 3300027357 Bacteria 227996
482 Ga0209589_1000033 3300027357 Bacteria 140561
483 Ga0209489_100014 3300027361 Bacteria 227996
484 Ga0209489_100040 3300027361 Bacteria 164986
485 Ga0209700_100007 3300027363 Bacteria 454608
486 Ga0209700_100024 3300027363 Bacteria 227996
487 Ga0209179_1001581 3300027512 Bacteria 2838
488 Ga0209179_1001865 3300027512 Bacteria 2712
489 Ga0209179_1004953 3300027512 Bacteria 2050
490 Ga0209588_1000977 3300027671 Bacteria 7339
491 Ga0207428_10000141 3300027907 Bacteria 97064
492 Ga0207428_10111008 3300027907 Bacteria 2110
493 Ga0207428_10119708 3300027907 Bacteria 2020
494 Ga0207428_10146560 3300027907 Bacteria 1799
495 Ga0265357_1001321 3300028023 Bacteria 1790
496 Ga0268266_10003344 3300028379 Bacteria 16058
497 Ga0268266_10054100 3300028379 Bacteria 3450
498 Ga0268266_10070883 3300028379 Bacteria 3020
499 Ga0268266_10079189 3300028379 Bacteria 2860
500 Ga0268265_10383608 3300028380 Bacteria 1293
501 Ga0268264_10000048 3300028381 Bacteria 334457
502 Ga0268264_10764044 3300028381 Bacteria 964
503 Ga0265337_1000412 3300028556 Bacteria 22867
504 Ga0265337_1012788 3300028556 Bacteria 2839
505 Ga0265326_10003400 3300028558 Bacteria 5215
506 Ga0265319_1014589 3300028563 Bacteria 3078
507 Ga0265334_10004112 3300028573 Bacteria 6519
508 Ga0265318_10076934 3300028577 Bacteria 1234
509 Ga0265323_10004703 3300028653 Bacteria 5853
510 Ga0265336_10001567 3300028666 Bacteria 10262
511 Ga0307517_10104672 3300028786 Bacteria 2202
512 Ga0265338_10000034 3300028800 Bacteria 244623
513 Ga0265338_10011933 3300028800 Bacteria 9965
514 Ga0265338_10073271 3300028800 Bacteria 2920
515 Ga0265324_10006370 3300029957 Bacteria 4930
516 Ga0265760_10020199 3300031090 Bacteria 1922
517 Ga0265330_10031043 3300031235 Bacteria 2395
518 Ga0265332_10001857 3300031238 Bacteria 11220
519 Ga0265332_10046951 3300031238 Bacteria 1859
520 Ga0265328_10000014 3300031239 Bacteria 151076
521 Ga0265328_10011006 3300031239 Bacteria 3626
522 Ga0265325_10010015 3300031241 Bacteria 5507
523 Ga0265325_10011514 3300031241 Bacteria 5080
524 Ga0265325_10013213 3300031241 Bacteria 4705
525 Ga0265325_10013606 3300031241 Bacteria 4625
526 Ga0265325_10022776 3300031241 Bacteria 3427
527 Ga0265329_10007587 3300031242 Bacteria 4183
528 Ga0265340_10006014 3300031247 Bacteria 6702
529 Ga0265340_10029731 3300031247 Bacteria 2744
530 Ga0265340_10080349 3300031247 Bacteria 1536
531 Ga0265339_10000205 3300031249 Bacteria 48438
532 Ga0265339_10003091 3300031249 Bacteria 11711
533 Ga0265339_10005140 3300031249 Bacteria 8777
534 Ga0265339_10063362 3300031249 Bacteria 1985
535 Ga0265331_10003191 3300031250 Bacteria 10704
536 Ga0265331_10007501 3300031250 Bacteria 6306
537 Ga0265331_10024905 3300031250 Bacteria 3023
538 Ga0265316_10249737 3300031344 Bacteria 1303
539 Ga0307509_10363690 3300031507 Bacteria 1165
540 Ga0265313_10000353 3300031595 Bacteria 50100
541 Ga0265313_10008687 3300031595 Bacteria 6716
542 Ga0307508_10000032 3300031616 Bacteria 163293
543 Ga0307508_10211078 3300031616 Bacteria 1542
544 Ga0265314_10003716 3300031711 Bacteria 14613
545 Ga0265314_10005447 3300031711 Bacteria 11490
546 Ga0265314_10111227 3300031711 Bacteria 1740
547 Ga0265342_10000092 3300031712 Bacteria 99040
548 Ga0265342_10000417 3300031712 Bacteria 46743
549 Ga0307516_10024278 3300031730 Bacteria 6194
550 Ga0307516_10059573 3300031730 Bacteria 3713
551 Ga0307412_10199216 3300031911 Bacteria 1519
552 Ga0307507_10048107 3300033179 Bacteria 4154
553 Ga0307510_10003449 3300033180 Bacteria 18439
554 Ga0307510_10019865 3300033180 Bacteria 7868
555 Ga0307510_10094526 3300033180 Bacteria 2814
556 Ga0373948_0026685 3300034817 Bacteria 1140
557 Ga0373959_0011219 3300034820 Bacteria 1579
558 Ga0373926_0046762 3300035083 Bacteria 1553
559 Ga0373929_0005008 3300035085 Bacteria 2379
560 Ga0373934_0013184 3300035086 Bacteria 3122
561 Ga0373934_0017217 3300035086 Bacteria 2756
562 Ga0373934_0062699 3300035086 Bacteria 1482
563 Ga0373944_0009808 3300035089 Bacteria 2603
564 Ga0373944_0025007 3300035089 Bacteria 1755
565 Ga0373951_0048896 3300035091 Bacteria 1037
566 Ga0373923_0006563 3300035111 Bacteria 4030
567 Ga0373923_0019915 3300035111 Bacteria 2602
568 Ga0373932_0010303 3300035112 Bacteria 2260
569 Ga0373936_0015788 3300035113 Bacteria 2897
570 Ga0373936_0016211 3300035113 Bacteria 2865
571 Ga0373936_0019424 3300035113 Bacteria 2633
572 Ga0373945_0024554 3300035116 Bacteria 2089
573 Ga0373945_0030588 3300035116 Bacteria 1898
574 Ga0373945_0031487 3300035116 Bacteria 1874
575 Ga0373945_0051348 3300035116 Bacteria 1517
576 Ga0373953_0094954 3300035117 Bacteria 1250
577 Ga0373954_0002403 3300035118 Bacteria 7844
578 Ga0373954_0040850 3300035118 Bacteria 2162
579 Ga0373956_0016342 3300035119 Bacteria 3116
580 Ga0373956_0032843 3300035119 Bacteria 2279
581 Ga0373956_0111027 3300035119 Bacteria 1276
582 Ga0373957_0004788 3300035120 Bacteria 4145
583 Ga0373943_0003753 3300035170 Bacteria 6905
584 Ga0373943_0008120 3300035170 Bacteria 4708
585 Ga0373943_0011869 3300035170 Bacteria 3920
586 Ga0373943_0072054 3300035170 Bacteria 1752
587 Ga0373943_0082205 3300035170 Bacteria 1653
588 Ga0373946_0003292 3300035171 Bacteria 5739
589 Ga0373946_0009193 3300035171 Bacteria 3635
590 Ga0373946_0085654 3300035171 Bacteria 1387
591 Ga0373946_0095151 3300035171 Bacteria 1326
592 Ga0373955_0011024 3300035172 Bacteria 4292
593 Ga0373955_0014829 3300035172 Bacteria 3802
594 Ga0373955_0035254 3300035172 Bacteria 2649
595 Ga0373955_0066836 3300035172 Bacteria 1999
596 Ga0373955_0147015 3300035172 Bacteria 1385
597 Ga0373955_0269791 3300035172 Bacteria 1022
598 Ga0373942_0025301 3300035207 Bacteria 1529
599 Ga0373962_0045692 3300035242 Bacteria 1248
600 Ga0373931_0006221 3300035691 Bacteria 5566
601 Ga0373931_0120592 3300035691 Bacteria 1498
602 Ga0373935_0007483 3300035692 Bacteria 6537
603 Ga0373935_0014513 3300035692 Bacteria 4754
604 Ga0373935_0022558 3300035692 Bacteria 3862
605 Ga0373935_0024166 3300035692 Bacteria 3738
606 Ga0373935_0031087 3300035692 Bacteria 3311
607 Ga0373927_0000121 3300035695 Bacteria 59449
608 Ga0373927_0017851 3300035695 Bacteria 4666
609 Ga0373927_0018115 3300035695 Bacteria 4631
610 Ga0373927_0028965 3300035695 Bacteria 3610
611 Ga0373927_0033452 3300035695 Bacteria 3348
612 Ga0373927_0061505 3300035695 Bacteria 2429
613 Ga0373927_0130957 3300035695 Bacteria 1638
614 Ga0373933_0000406 3300035724 Bacteria 27321
615 Ga0373933_0006291 3300035724 Bacteria 6462
616 Ga0373933_0016314 3300035724 Bacteria 4150
617 Ga0373933_0026628 3300035724 Bacteria 3322
618 Ga0373933_0041100 3300035724 Bacteria 2728
619 Ga0373933_0281862 3300035724 Bacteria 1074
620 Ga0373947_0002018 3300035725 Bacteria 12396
621 Ga0373947_0012161 3300035725 Bacteria 4928
622 Ga0373947_0061898 3300035725 Bacteria 2275
623 Ga0373947_0081521 3300035725 Bacteria 2004
624 Ga0373937_0007295 3300036401 Bacteria 9568
625 Ga0373937_0015887 3300036401 Bacteria 6676
626 Ga0373937_0035287 3300036401 Bacteria 4551
627 Ga0373937_0039454 3300036401 Bacteria 4303
628 Ga0373937_0061008 3300036401 Bacteria 3466
629 Ga0373937_0068978 3300036401 Bacteria 3259
630 Ga0373937_0101871 3300036401 Bacteria 2665
631 Ga0373937_0174380 3300036401 Bacteria 2018
632 Ga0373937_0184857 3300036401 Bacteria 1957
633 Ga0373925_0002194 3300037068 Bacteria 15853
634 Ga0373925_0009548 3300037068 Bacteria 7065
635 Ga0373925_0040305 3300037068 Bacteria 3458
636 Ga0373925_0120437 3300037068 Bacteria 2037
637 Ga0373925_0120850 3300037068 Bacteria 2033
638 Ga0373925_0161670 3300037068 Bacteria 1764
639 Ga0373925_0162551 3300037068 Bacteria 1759
640 Ga0373925_0192515 3300037068 Bacteria 1618
641 Ga0373925_0414047 3300037068 Bacteria 1100
642 Ga0395899_0015112 3300037312 Bacteria 5885
643 Ga0395900_0000948 3300037418 Bacteria 37848
644 Ga0395900_0023638 3300037418 Bacteria 6287
645 Ga0395900_0159914 3300037418 Bacteria 2298
646 Ga0395898_0045341 3300037466 Bacteria 4322
647 Ga0395898_0060604 3300037466 Bacteria 3677
648 Ga0395898_0070357 3300037466 Bacteria 3383
649 Ga0395898_0078195 3300037466 Bacteria 3192
650 Ga0395898_0081007 3300037466 Bacteria 3131
651 Ga0395898_0191145 3300037466 Bacteria 1956
652 Ga0395905_0004515 3300037471 Bacteria 14421
653 Ga0436364_0158121 3300037853 Bacteria 2458
654 Ga0436364_0231907 3300037853 Bacteria 3238
655 Ga0436364_0288952 3300037853 Bacteria 32031
656 Ga0436364_0335801 3300037853 Bacteria 1942
657 Ga0436364_0346238 3300037853 Bacteria 35487
658 Ga0436364_0806163 3300037853 Bacteria 3078
659 Ga0436364_1223619 3300037853 Bacteria 3719
660 Ga0436364_1517684 3300037853 Bacteria 3958
661 Ga0395901_0011040 3300038443 Bacteria 9150
662 Ga0395901_0020520 3300038443 Bacteria 6763
663 Ga0395901_0109506 3300038443 Bacteria 2900
664 Ga0395901_0239807 3300038443 Bacteria 1891
665 Ga0395901_0312242 3300038443 Bacteria 1628
666 Ga0395901_0528257 3300038443 Bacteria 1198
667 Ga0436365_0947948 3300039437 Bacteria 2470
668 Ga0436365_1308689 3300039437 Bacteria 1808
669 Ga0436365_1382071 3300039437 Bacteria 38509
670 Ga0436365_1685276 3300039437 Bacteria 10594
671 Ga0436365_1835761 3300039437 Bacteria 36188
672 Ga0436360_0904398 3300039438 Bacteria 1992
673 Ga0436361_0458971 3300039447 Bacteria 1418
674 Ga0436361_0774027 3300039447 Bacteria 8719
675 Ga0436363_0276330 3300039450 Bacteria 1201
676 Ga0436363_0362302 3300039450 Bacteria 4805
677 Ga0436363_0688960 3300039450 Bacteria 1128
678 Ga0436363_1051136 3300039450 Bacteria 2439
679 Ga0436362_1193065 3300039453 Bacteria 3700
680 Ga0451802_2171387 3300041460 Bacteria 1891
681 Ga0451849_0905512 3300041505 Bacteria 1074
682 Ga0451853_0987069 3300041512 Bacteria 1291
683 Ga0439458_0035939 3300042157 Bacteria 1192
684 Ga0466969_0015817 3300044656 Bacteria 3955
685 Ga0466972_0001899 3300044658 Bacteria 10263
686 Ga0466972_0010445 3300044658 Bacteria 4663
687 Ga0466961_0000050 3300044693 Bacteria 71289
688 Ga0466963_0010492 3300044694 Bacteria 5609
689 Ga0466964_0073312 3300044706 Bacteria 1453
690 Ga0466968_0033968 3300044735 Bacteria 2127
691 Ga0466957_0098530 3300044842 Bacteria 1840
692 Ga0466960_0088853 3300044901 Bacteria 1571
693 Ga0466959_0005557 3300045049 Bacteria 8654
694 Ga0466959_0368468 3300045049 Bacteria 978
695 Ga0466967_0006446 3300045976 Bacteria 8303
696 Ga0466967_0398633 3300045976 Bacteria 1338
697 Ga0466967_0816272 3300045976 Bacteria 926
698 Ga0495627_052975 3300046453 Bacteria 1216
699 Ga0495592_0016464 3300046454 Bacteria 5610
700 Ga0495592_0044107 3300046454 Bacteria 3333
701 Ga0495592_0051867 3300046454 Bacteria 3047
702 Ga0495592_0079743 3300046454 Bacteria 2369
703 Ga0495592_0192931 3300046454 Bacteria 1379
704 Ga0495603_0001782 3300046455 Bacteria 12698
705 Ga0495603_0027225 3300046455 Bacteria 3450
706 Ga0495603_0027453 3300046455 Bacteria 3436
707 Ga0495603_0089164 3300046455 Bacteria 1804
708 Ga0495603_0119435 3300046455 Bacteria 1536
709 Ga0495603_0179421 3300046455 Bacteria 1225
710 Ga0495603_0204880 3300046455 Bacteria 1140
711 Ga0495603_0244089 3300046455 Bacteria 1034
712 Ga0495629_0000242 3300046459 Bacteria 47556
713 Ga0495629_0001610 3300046459 Bacteria 17737
714 Ga0495629_0003645 3300046459 Bacteria 11646
715 Ga0495629_0004164 3300046459 Bacteria 10856
716 Ga0495629_0016212 3300046459 Bacteria 5349
717 Ga0495629_0042588 3300046459 Bacteria 3190
718 Ga0495629_0044721 3300046459 Bacteria 3107
719 Ga0495638_0022384 3300046460 Bacteria 4149
720 Ga0495638_0032269 3300046460 Bacteria 3359
721 Ga0495641_0000994 3300046461 Bacteria 24305
722 Ga0495641_0020070 3300046461 Bacteria 3399
723 Ga0495641_0047082 3300046461 Bacteria 1980
724 Ga0495651_0001287 3300046462 Bacteria 19450
725 Ga0495651_0003779 3300046462 Bacteria 11580
726 Ga0495651_0033843 3300046462 Bacteria 3985
727 Ga0495651_0052110 3300046462 Bacteria 3152
728 Ga0495651_0055504 3300046462 Bacteria 3043
729 Ga0495653_0002060 3300046463 Bacteria 15803
730 Ga0495653_0008912 3300046463 Bacteria 8203
731 Ga0495653_0040572 3300046463 Bacteria 3637
732 Ga0495580_0004514 3300046472 Bacteria 11688
733 Ga0495580_0009026 3300046472 Bacteria 7872
734 Ga0495580_0015783 3300046472 Bacteria 5690
735 Ga0495582_0000268 3300046473 Bacteria 29098
736 Ga0495582_0036962 3300046473 Bacteria 2686
737 Ga0495582_0045575 3300046473 Bacteria 2415
738 Ga0495582_0052564 3300046473 Bacteria 2246
739 Ga0495582_0055744 3300046473 Bacteria 2178
740 Ga0495639_0000157 3300046475 Bacteria 35000
741 Ga0495639_0004971 3300046475 Bacteria 5703
742 Ga0495639_0017148 3300046475 Bacteria 3145
743 Ga0495639_0075581 3300046475 Bacteria 1562
744 Ga0495662_0004509 3300046476 Bacteria 6984
745 Ga0495662_0007644 3300046476 Bacteria 5332
746 Ga0495662_0034815 3300046476 Bacteria 2431
747 Ga0495662_0060984 3300046476 Bacteria 1822
748 Ga0495664_0013015 3300046477 Bacteria 4716
749 Ga0495664_0019517 3300046477 Bacteria 3898
750 Ga0495664_0107218 3300046477 Bacteria 1685
751 Ga0495664_0199603 3300046477 Bacteria 1212
752 Ga0495584_0005529 3300046491 Bacteria 6690
753 Ga0495584_0015148 3300046491 Bacteria 3927
754 Ga0495584_0016934 3300046491 Bacteria 3714
755 Ga0495584_0053845 3300046491 Bacteria 2025
756 Ga0495584_0166798 3300046491 Bacteria 1119
757 Ga0495584_0184903 3300046491 Bacteria 1059
758 Ga0495585_0026524 3300046492 Bacteria 3310
759 Ga0495585_0030890 3300046492 Bacteria 3045
760 Ga0495585_0056176 3300046492 Bacteria 2175
761 Ga0495585_0091017 3300046492 Bacteria 1643
762 Ga0495594_0068333 3300046499 Bacteria 1973
763 Ga0495596_0047198 3300046500 Bacteria 1690
764 Ga0495607_0056662 3300046501 Bacteria 2249
765 Ga0495607_0129517 3300046501 Bacteria 1315
766 Ga0495606_0031897 3300046507 Bacteria 3657
767 Ga0495606_0162853 3300046507 Bacteria 1300
768 Ga0495606_0164021 3300046507 Bacteria 1294
769 Ga0495608_0001118 3300046511 Bacteria 19026
770 Ga0495608_0014419 3300046511 Bacteria 5483
771 Ga0495608_0017348 3300046511 Bacteria 4980
772 Ga0495608_0148244 3300046511 Bacteria 1496
773 Ga0495610_0132880 3300046512 Bacteria 1079
774 Ga0495616_0022264 3300046513 Bacteria 3423
775 Ga0495618_0003470 3300046514 Bacteria 9794
776 Ga0495618_0044691 3300046514 Bacteria 2794
777 Ga0495618_0314335 3300046514 Bacteria 971
778 Ga0495628_0042849 3300046516 Bacteria 3608
779 Ga0495628_0056590 3300046516 Bacteria 3086
780 Ga0495628_0065041 3300046516 Bacteria 2854
781 Ga0495628_0108961 3300046516 Bacteria 2132
782 Ga0495628_0130860 3300046516 Bacteria 1919
783 Ga0495628_0302491 3300046516 Bacteria 1183
784 Ga0495630_0001544 3300046517 Bacteria 15994
785 Ga0495630_0067130 3300046517 Bacteria 2695
786 Ga0495630_0123739 3300046517 Bacteria 1962
787 Ga0495630_0153722 3300046517 Bacteria 1751
788 Ga0495632_0033563 3300046519 Bacteria 2633
789 Ga0495643_0054647 3300046522 Bacteria 2137
790 Ga0495644_0023731 3300046523 Bacteria 2334
791 Ga0495644_0094647 3300046523 Bacteria 1128
792 Ga0495648_0012980 3300046524 Bacteria 6183
793 Ga0495648_0026326 3300046524 Bacteria 3917
794 Ga0495648_0062681 3300046524 Bacteria 2200
795 Ga0495648_0137062 3300046524 Bacteria 1293
796 Ga0495666_0107946 3300046526 Bacteria 1309
797 Ga0495652_0021349 3300046529 Bacteria 5758
798 Ga0495652_0023483 3300046529 Bacteria 5466
799 Ga0495652_0080346 3300046529 Bacteria 2693
800 Ga0495652_0130580 3300046529 Bacteria 1989
801 Ga0495652_0199919 3300046529 Bacteria 1517
802 Ga0495652_0262573 3300046529 Bacteria 1274
803 Ga0495665_0000656 3300046531 Bacteria 17748
804 Ga0495665_0119526 3300046531 Bacteria 1380
805 Ga0495640_0014016 3300046533 Bacteria 6082
806 Ga0495640_0029778 3300046533 Bacteria 3914
807 Ga0495640_0031288 3300046533 Bacteria 3799
808 Ga0495640_0040839 3300046533 Bacteria 3246
809 Ga0495640_0067651 3300046533 Bacteria 2405
810 Ga0495640_0070785 3300046533 Bacteria 2342
811 Ga0495640_0090022 3300046533 Bacteria 2026
812 Ga0495640_0150375 3300046533 Bacteria 1496
813 Ga0495586_0039863 3300046535 Bacteria 2526
814 Ga0495587_0000663 3300046536 Bacteria 23065
815 Ga0495587_0033298 3300046536 Bacteria 3111
816 Ga0495587_0044655 3300046536 Bacteria 2635
817 Ga0495587_0085585 3300046536 Bacteria 1825
818 Ga0495587_0089431 3300046536 Bacteria 1780
819 Ga0495598_0001524 3300046537 Bacteria 4627
820 Ga0495598_0085668 3300046537 Bacteria 1019
821 Ga0495609_0110258 3300046538 Bacteria 1188
822 Ga0495621_0045437 3300046539 Bacteria 1556
823 Ga0495597_0071126 3300046542 Bacteria 1499
824 Ga0495645_0031198 3300046543 Bacteria 3883
825 Ga0495645_0032568 3300046543 Bacteria 3803
826 Ga0495645_0134405 3300046543 Bacteria 1731
827 Ga0495645_0218043 3300046543 Bacteria 1285
828 Ga0495622_0002769 3300046557 Bacteria 8377
829 Ga0495622_0146030 3300046557 Bacteria 1072
830 Ga0495667_0001079 3300046559 Bacteria 17670
831 Ga0495667_0020988 3300046559 Bacteria 4405
832 Ga0495667_0023276 3300046559 Bacteria 4173
833 Ga0495667_0034221 3300046559 Bacteria 3397
834 Ga0495667_0096335 3300046559 Bacteria 1915
835 Ga0495667_0223037 3300046559 Bacteria 1203
836 Ga0495656_0004934 3300046615 Bacteria 4593
837 Ga0495656_0010606 3300046615 Bacteria 3355
838 Ga0495656_0106485 3300046615 Bacteria 1305
839 Ga0495668_0055283 3300046616 Bacteria 2192
840 Ga0495634_0000206 3300046642 Bacteria 55145
841 Ga0495634_0016827 3300046642 Bacteria 5224
842 Ga0495634_0028186 3300046642 Bacteria 3900
843 Ga0495634_0062601 3300046642 Bacteria 2470
844 Ga0495634_0073645 3300046642 Bacteria 2245
845 Ga0495634_0135855 3300046642 Bacteria 1564
846 Ga0495611_0117885 3300046648 Bacteria 1237
847 Ga0495611_0126704 3300046648 Bacteria 1191
848 Ga0495625_0100157 3300046660 Bacteria 1992
849 Ga0495635_0000723 3300046663 Bacteria 21319
850 Ga0495635_0001219 3300046663 Bacteria 17201
851 Ga0495635_0001519 3300046663 Bacteria 15542
852 Ga0495635_0001990 3300046663 Bacteria 13876
853 Ga0495635_0013355 3300046663 Bacteria 5749
854 Ga0495635_0141557 3300046663 Bacteria 1638
855 Ga0495635_0225741 3300046663 Bacteria 1266
856 Ga0495661_0018009 3300046665 Bacteria 4653
857 Ga0495661_0084017 3300046665 Bacteria 1829
858 Ga0495588_0007010 3300046674 Bacteria 5109
859 Ga0495588_0016581 3300046674 Bacteria 3562
860 Ga0495588_0023587 3300046674 Bacteria 3048
861 Ga0495588_0068183 3300046674 Bacteria 1847
862 Ga0495588_0070600 3300046674 Bacteria 1815
863 Ga0495588_0120757 3300046674 Bacteria 1381
864 Ga0495588_0134831 3300046674 Bacteria 1303
865 Ga0495657_0008675 3300046675 Bacteria 7759
866 Ga0495657_0010180 3300046675 Bacteria 7084
867 Ga0495657_0042701 3300046675 Bacteria 3094
868 Ga0495657_0044184 3300046675 Bacteria 3032
869 Ga0495599_0041117 3300046678 Bacteria 2903
870 Ga0495599_0044999 3300046678 Bacteria 2767
871 Ga0495599_0070256 3300046678 Bacteria 2185
872 Ga0495623_0011265 3300046679 Bacteria 5783
873 Ga0495623_0012766 3300046679 Bacteria 5438
874 Ga0495623_0029832 3300046679 Bacteria 3509
875 Ga0495623_0072950 3300046679 Bacteria 2134
876 Ga0495623_0181432 3300046679 Bacteria 1223
877 Ga0495646_0008739 3300046680 Bacteria 6434
878 Ga0495646_0015182 3300046680 Bacteria 4892
879 Ga0495646_0068838 3300046680 Bacteria 2089
880 Ga0495646_0070746 3300046680 Bacteria 2054
881 Ga0495646_0085362 3300046680 Bacteria 1832
882 Ga0495647_0001229 3300046681 Bacteria 7899
883 Ga0495647_0020275 3300046681 Bacteria 2384
884 Ga0495658_0000188 3300046683 Bacteria 35609
885 Ga0495658_0028537 3300046683 Bacteria 3013
886 Ga0495658_0093002 3300046683 Bacteria 1788
887 Ga0495613_0013006 3300046689 Bacteria 6184
888 Ga0495613_0020761 3300046689 Bacteria 4896
889 Ga0495613_0060722 3300046689 Bacteria 2768
890 Ga0495613_0063093 3300046689 Bacteria 2711
891 Ga0495613_0188337 3300046689 Bacteria 1459
892 Ga0495624_0007942 3300046690 Bacteria 7441
893 Ga0495624_0034608 3300046690 Bacteria 3266
894 Ga0495624_0039263 3300046690 Bacteria 3035
895 Ga0495624_0050701 3300046690 Bacteria 2628
896 Ga0495670_0050592 3300046691 Bacteria 2080
897 Ga0495670_0112324 3300046691 Bacteria 1411
898 Ga0495670_0139497 3300046691 Bacteria 1267
899 Ga0495670_0252675 3300046691 Bacteria 940
900 Ga0495671_0018194 3300046692 Bacteria 3731
901 Ga0495671_0081679 3300046692 Bacteria 1584
902 Ga0495649_0116099 3300046694 Bacteria 1417
903 Ga0495600_0000483 3300046809 Bacteria 20562
904 Ga0495600_0007773 3300046809 Bacteria 6563
905 Ga0495600_0011323 3300046809 Bacteria 5557
906 Ga0495600_0011929 3300046809 Bacteria 5425
907 Ga0495600_0203879 3300046809 Bacteria 1269
908 Ga0495600_0241579 3300046809 Bacteria 1151
909 Ga0495581_0000166 3300047315 Bacteria 29591
910 Ga0495581_0029409 3300047315 Bacteria 3185
911 Ga0495581_0080467 3300047315 Bacteria 1886
912 Ga0495604_0000907 3300047317 Bacteria 24618
913 Ga0495604_0017915 3300047317 Bacteria 5666
914 Ga0495604_0031834 3300047317 Bacteria 4182
915 Ga0495604_0058327 3300047317 Bacteria 2964
916 Ga0495604_0138976 3300047317 Bacteria 1737
917 Ga0495604_0161565 3300047317 Bacteria 1582
918 Ga0495674_0009028 3300047319 Bacteria 9475
919 Ga0495674_0014830 3300047319 Bacteria 7291
920 Ga0495674_0018702 3300047319 Bacteria 6447
921 Ga0495674_0040498 3300047319 Bacteria 4167
922 Ga0495674_0083972 3300047319 Bacteria 2730
923 Ga0495674_0111784 3300047319 Bacteria 2315
924 Ga0495672_0045473 3300047320 Bacteria 2626
925 Ga0495672_0128453 3300047320 Bacteria 1337
926 Ga0495676_0034215 3300047321 Bacteria 4266
927 Ga0495676_0063501 3300047321 Bacteria 2878
928 Ga0495676_0069500 3300047321 Bacteria 2717
929 Ga0495676_0085664 3300047321 Bacteria 2373
930 Ga0495676_0222726 3300047321 Bacteria 1299
931 Ga0495680_0005555 3300047322 Bacteria 11839
932 Ga0495680_0005583 3300047322 Bacteria 11795
933 Ga0495680_0017386 3300047322 Bacteria 6143
934 Ga0495680_0044358 3300047322 Bacteria 3516
935 Ga0495680_0126487 3300047322 Bacteria 1882
936 Ga0495683_0041815 3300047323 Bacteria 2312
937 Ga0495683_0065575 3300047323 Bacteria 1791
938 Ga0495675_0013918 3300047444 Bacteria 5087
939 Ga0495675_0076330 3300047444 Bacteria 2112
940 Ga0495675_0105156 3300047444 Bacteria 1764
941 Ga0495675_0207036 3300047444 Bacteria 1192
942 Ga0495677_0034301 3300047445 Bacteria 1851
943 Ga0495679_031312 3300047446 Bacteria 1717
944 Ga0495673_0058648 3300047469 Bacteria 1658
945 Ga0495673_0118071 3300047469 Bacteria 1053
946 Ga0495684_0007107 3300047471 Bacteria 8689
947 Ga0495684_0012905 3300047471 Bacteria 6449
948 Ga0495684_0224593 3300047471 Bacteria 1375
949 Ga0495686_0033809 3300047472 Bacteria 3298
950 Ga0495686_0124056 3300047472 Bacteria 1537
951 Ga0495593_0000033 3300047673 Bacteria 58363
952 Ga0495593_0013832 3300047673 Bacteria 4597
953 Ga0495593_0043771 3300047673 Bacteria 2397
954 Ga0495593_0093590 3300047673 Bacteria 1546
955 Ga0495602_0005125 3300048088 Bacteria 13727
956 Ga0495602_0028813 3300048088 Bacteria 5305
957 Ga0495602_0033120 3300048088 Bacteria 4853
958 Ga0495602_0061823 3300048088 Bacteria 3253
959 Ga0495602_0193942 3300048088 Bacteria 1555
960 Ga0495602_0224989 3300048088 Bacteria 1413
961 Ga0495626_0023088 3300048091 Bacteria 3067
962 Ga0496100_0004573 3300048903 Bacteria 7355
963 Ga0496100_0022125 3300048903 Bacteria 3842
964 Ga0496100_0028425 3300048903 Bacteria 3449
965 Ga0496100_0117942 3300048903 Bacteria 1853
966 Ga0496100_0165525 3300048903 Bacteria 1588
967 Ga0496100_0322190 3300048903 Bacteria 1161
968 Ga0496101_0008538 3300048904 Bacteria 6695
969 Ga0496101_0066146 3300048904 Bacteria 2636
970 Ga0496101_0074262 3300048904 Bacteria 2500
971 Ga0496101_0079431 3300048904 Bacteria 2422
972 Ga0496101_0339580 3300048904 Bacteria 1179
973 Ga0496102_0022051 3300048905 Bacteria 5640
974 Ga0496102_0111497 3300048905 Bacteria 2550
975 Ga0496102_0193234 3300048905 Bacteria 1918
976 Ga0496102_0229022 3300048905 Bacteria 1752
977 Ga0496102_0401079 3300048905 Bacteria 1289
978 Ga0496103_0020025 3300048906 Bacteria 4017
979 Ga0496103_0137969 3300048906 Bacteria 1559
980 Ga0496103_0145741 3300048906 Bacteria 1516
981 Ga0496104_0005685 3300048907 Bacteria 10915
982 Ga0496104_0014292 3300048907 Bacteria 7168
983 Ga0496104_0018839 3300048907 Bacteria 6305
984 Ga0496104_0020301 3300048907 Bacteria 6088
985 Ga0496104_0023859 3300048907 Bacteria 5625
986 Ga0496104_0024862 3300048907 Bacteria 5515
987 Ga0496104_0091277 3300048907 Bacteria 2911
988 Ga0496104_0098246 3300048907 Bacteria 2803
989 Ga0496105_0008654 3300048908 Bacteria 7914
990 Ga0496105_0016130 3300048908 Bacteria 5958
991 Ga0496105_0032948 3300048908 Bacteria 4253
992 Ga0496105_0051704 3300048908 Bacteria 3394
993 Ga0496105_0063602 3300048908 Bacteria 3044
994 Ga0496105_0068948 3300048908 Bacteria 2922
995 Ga0496105_0071435 3300048908 Bacteria 2868
996 Ga0496105_0168437 3300048908 Bacteria 1796
997 Ga0496105_0275916 3300048908 Bacteria 1357
998 Ga0496105_0341835 3300048908 Bacteria 1196
999 Ga0496106_0000240 3300048909 Bacteria 38188
1000 Ga0496106_0003104 3300048909 Bacteria 12404
1001 Ga0496106_0006834 3300048909 Bacteria 8446
1002 Ga0496106_0044470 3300048909 Bacteria 3333
1003 Ga0496106_0135536 3300048909 Bacteria 1934
1004 Ga0496106_0149332 3300048909 Bacteria 1843
1005 Ga0496107_0016125 3300048910 Bacteria 5242
1006 Ga0496107_0037814 3300048910 Bacteria 3464
1007 Ga0496107_0060779 3300048910 Bacteria 2735
1008 Ga0496107_0113202 3300048910 Bacteria 1995
1009 Ga0496108_0002539 3300048911 Bacteria 14611
1010 Ga0496108_0011304 3300048911 Bacteria 7252
1011 Ga0496108_0011769 3300048911 Bacteria 7116
1012 Ga0496108_0018897 3300048911 Bacteria 5651
1013 Ga0496108_0036158 3300048911 Bacteria 4108
1014 Ga0496108_0041472 3300048911 Bacteria 3842
1015 Ga0496108_0096940 3300048911 Bacteria 2512
1016 Ga0496108_0218756 3300048911 Bacteria 1655
1017 Ga0496108_0406977 3300048911 Bacteria 1188
1018 Ga0496109_0000377 3300048912 Bacteria 40679
1019 Ga0496109_0001620 3300048912 Bacteria 18810
1020 Ga0496109_0005500 3300048912 Bacteria 10606
1021 Ga0496109_0012367 3300048912 Bacteria 7369
1022 Ga0496109_0033408 3300048912 Bacteria 4628
1023 Ga0496109_0136395 3300048912 Bacteria 2293
1024 Ga0496109_0330830 3300048912 Bacteria 1438
1025 Ga0496110_0004983 3300048913 Bacteria 10368
1026 Ga0496110_0014112 3300048913 Bacteria 6624
1027 Ga0496110_0024066 3300048913 Bacteria 5189
1028 Ga0496110_0034780 3300048913 Bacteria 4367
1029 Ga0496110_0047732 3300048913 Bacteria 3751
1030 Ga0496111_0009981 3300048914 Bacteria 6351
1031 Ga0496111_0013193 3300048914 Bacteria 5619
1032 Ga0496111_0020473 3300048914 Bacteria 4606
1033 Ga0496111_0056594 3300048914 Bacteria 2837
1034 Ga0496111_0083525 3300048914 Bacteria 2334
1035 Ga0496111_0256964 3300048914 Bacteria 1296
1036 Ga0496111_0269072 3300048914 Bacteria 1264
1037 Ga0496111_0401545 3300048914 Bacteria 1013
1038 Ga0496112_0000017 3300048915 Bacteria 191284
1039 Ga0496112_0001811 3300048915 Bacteria 16811
1040 Ga0496112_0004764 3300048915 Bacteria 11568
1041 Ga0496112_0005098 3300048915 Bacteria 11287
1042 Ga0496112_0006587 3300048915 Bacteria 10221
1043 Ga0496112_0009154 3300048915 Bacteria 8894
1044 Ga0496112_0031464 3300048915 Bacteria 5147
1045 Ga0496112_0079018 3300048915 Bacteria 3253
1046 Ga0496112_0079947 3300048915 Bacteria 3233
1047 Ga0496112_0083809 3300048915 Bacteria 3153
1048 Ga0496112_0124964 3300048915 Bacteria 2543
1049 Ga0496112_0172063 3300048915 Bacteria 2131
1050 Ga0496112_0203110 3300048915 Bacteria 1940
1051 Ga0496112_0390556 3300048915 Bacteria 1332
1052 Ga0496112_0396390 3300048915 Bacteria 1320
1053 Ga0496113_0001469 3300048916 Bacteria 13151
1054 Ga0496113_0005360 3300048916 Bacteria 7994
1055 Ga0496113_0008097 3300048916 Bacteria 6825
1056 Ga0496113_0010973 3300048916 Bacteria 6019
1057 Ga0496113_0020026 3300048916 Bacteria 4694
1058 Ga0496113_0044236 3300048916 Bacteria 3298
1059 Ga0496113_0083058 3300048916 Bacteria 2457
1060 Ga0496113_0089336 3300048916 Bacteria 2371
1061 Ga0496113_0119535 3300048916 Bacteria 2059
1062 Ga0496113_0124227 3300048916 Bacteria 2020
1063 Ga0496113_0384140 3300048916 Bacteria 1127
1064 Ga0496113_0408091 3300048916 Bacteria 1091
1065 Ga0496114_0021241 3300048917 Bacteria 5279
1066 Ga0496114_0119721 3300048917 Bacteria 2263
1067 Ga0496114_0136841 3300048917 Bacteria 2118
1068 Ga0496114_0183601 3300048917 Bacteria 1827
1069 Ga0496114_0499580 3300048917 Bacteria 1076
1070 Ga0496115_0004354 3300048918 Bacteria 10246
1071 Ga0496115_0016709 3300048918 Bacteria 5592
1072 Ga0496115_0032733 3300048918 Bacteria 4103
1073 Ga0496115_0056716 3300048918 Bacteria 3148
1074 Ga0496115_0056752 3300048918 Bacteria 3147
1075 Ga0496115_0068565 3300048918 Bacteria 2872
1076 Ga0496115_0079065 3300048918 Bacteria 2676
1077 Ga0496115_0145172 3300048918 Bacteria 1958
1078 Ga0496115_0145934 3300048918 Bacteria 1953
1079 Ga0496115_0174202 3300048918 Bacteria 1779
1080 Ga0496115_0200483 3300048918 Bacteria 1649
1081 Ga0496115_0333045 3300048918 Bacteria 1240
1082 Ga0496116_0001913 3300048919 Bacteria 22414
1083 Ga0496116_0049951 3300048919 Bacteria 2791
1084 Ga0496118_0069374 3300048921 Bacteria 2553
1085 Ga0496119_0007401 3300048922 Bacteria 9897
1086 Ga0496120_0150319 3300048923 Bacteria 1171
1087 Ga0496121_0000230 3300048924 Bacteria 120616
1088 Ga0496121_0004398 3300048924 Bacteria 19000
1089 Ga0496121_0009774 3300048924 Bacteria 10965
1090 Ga0496121_0029407 3300048924 Bacteria 5081
1091 Ga0496121_0043862 3300048924 Bacteria 3866
1092 Ga0496121_0067206 3300048924 Bacteria 2906
1093 Ga0496121_0070273 3300048924 Bacteria 2821
1094 Ga0496121_0072871 3300048924 Bacteria 2755
1095 Ga0496121_0077850 3300048924 Bacteria 2639
1096 Ga0496121_0131444 3300048924 Bacteria 1872
1097 Ga0496122_0009319 3300048925 Bacteria 10374
1098 Ga0496122_0016804 3300048925 Bacteria 6891
1099 Ga0496122_0075240 3300048925 Bacteria 2384
1100 Ga0496123_0006663 3300048926 Bacteria 11130
1101 Ga0496123_0031624 3300048926 Bacteria 3847
1102 Ga0496124_0010351 3300048927 Bacteria 9456
1103 Ga0496124_0049528 3300048927 Bacteria 3584
1104 Ga0496125_0000040 3300048928 Bacteria 314478
1105 Ga0496125_0003264 3300048928 Bacteria 19969
1106 Ga0496125_0010916 3300048928 Bacteria 9134
1107 Ga0496125_0038188 3300048928 Bacteria 4161
1108 Ga0496125_0072594 3300048928 Bacteria 2681
1109 Ga0496126_0005072 3300048929 Bacteria 15276
1110 Ga0496126_0005800 3300048929 Bacteria 13963
1111 Ga0496126_0007510 3300048929 Bacteria 11940
1112 Ga0496126_0019129 3300048929 Bacteria 6755
1113 Ga0496126_0029901 3300048929 Bacteria 5170
1114 Ga0496126_0072340 3300048929 Bacteria 3067
1115 Ga0496126_0087675 3300048929 Bacteria 2743
1116 Ga0496126_0091048 3300048929 Bacteria 2683
1117 Ga0496126_0113251 3300048929 Bacteria 2361
1118 Ga0496126_0130655 3300048929 Bacteria 2170
1119 Ga0496126_0260151 3300048929 Bacteria 1443
1120 Ga0495682_0058567 3300049460 Bacteria 1393
1121 Ga0501034_0284032 3300049571 Bacteria 1594
1122 Ga0501034_0857228 3300049571 Bacteria 798
1123 Ga0501037_0039808 3300049573 Bacteria 3459
1124 Ga0501046_0069104 3300049580 Bacteria 2749
1125 Ga0501047_0033590 3300049581 Bacteria 4951
1126 Ga0501047_0047317 3300049581 Bacteria 4156
1127 Ga0501067_0027796 3300049583 Bacteria 3134
1128 Ga0501069_0037162 3300049585 Bacteria 2687
1129 Ga0501070_0003190 3300049586 Bacteria 14262
1130 Ga0501070_0011105 3300049586 Bacteria 7603
1131 Ga0501070_0035395 3300049586 Bacteria 4172
1132 Ga0501072_0063369 3300049588 Bacteria 2916
1133 Ga0501072_0142676 3300049588 Bacteria 1910
1134 Ga0501073_0027417 3300049589 Bacteria 4073
1135 Ga0501074_0115382 3300049590 Bacteria 1921
1136 Ga0501077_0041562 3300049593 Bacteria 2926
1137 Ga0501080_0056270 3300049742 Bacteria 3663
1138 Ga0501080_0059524 3300049742 Bacteria 3554
1139 Ga0501080_0117963 3300049742 Bacteria 2460
1140 Ga0501035_0000197 3300049822 Bacteria 73618
1141 Ga0501035_0110892 3300049822 Bacteria 2405
1142 Ga0501035_0440342 3300049822 Bacteria 1079
1143 Ga0501044_0048264 3300049823 Bacteria 4399
1144 Ga0501044_0098289 3300049823 Bacteria 2947
1145 nmdc:mga03683_10234_c2 3300050489 Bacteria 1864
1146 nmdc:mga03n38_23182_c1 3300050490 Bacteria 2522
1147 nmdc:mga03n38_24684_c1 3300050490 Bacteria 2460
1148 nmdc:mga03n38_2872_c1 3300050490 Bacteria 5425
1149 nmdc:mga03n38_61621_c1 3300050490 Bacteria 1709
1150 nmdc:mga00v17_18761_c1 3300050491 Bacteria 3545
1151 nmdc:mga00v17_50057_c1 3300050491 Bacteria 2537
1152 nmdc:mga00v17_7665_c1 3300050491 Bacteria 5775
1153 nmdc:mga00v17_78206_c1 3300050491 Bacteria 2061
1154 nmdc:mga0yw44_11581_c1 3300050492 Bacteria 4562
1155 nmdc:mga0yw44_1289_c1 3300050492 Bacteria 9898
1156 nmdc:mga0yw44_13355_c1 3300050492 Bacteria 4322
1157 nmdc:mga0yw44_196826_c1 3300050492 Bacteria 1330
1158 nmdc:mga0yw44_2368_c1 3300050492 Bacteria 8005
1159 nmdc:mga0yw44_6230_c2 3300050492 Bacteria 2972
1160 nmdc:mga0yw44_71559_c1 3300050492 Bacteria 2153
1161 nmdc:mga0yw44_99914_c1 3300050492 Bacteria 1847
1162 nmdc:mga06z11_131701_c1 3300050494 Bacteria 1405
1163 nmdc:mga06z11_304611_c1 3300050494 Bacteria 948
1164 nmdc:mga06z11_46757_c1 3300050494 Bacteria 2195
1165 nmdc:mga04h51_137402_c1 3300050495 Bacteria 924
1166 nmdc:mga07m45_1086_c1 3300050496 Bacteria 12118
1167 nmdc:mga07m45_140468_c1 3300050496 Bacteria 1399
1168 nmdc:mga07m45_262798_c1 3300050496 Bacteria 1004
1169 nmdc:mga07m45_77756_c1 3300050496 Bacteria 1893
1170 nmdc:mga05p37_115695_c1 3300050507 Bacteria 3296
1171 nmdc:mga05p37_15774_c1 3300050507 Bacteria 9086
1172 nmdc:mga05p37_190261_c1 3300050507 Bacteria 2492
1173 nmdc:mga05p37_190426_c1 3300050507 Bacteria 2491
1174 nmdc:mga05p37_214122_c1 3300050507 Bacteria 2328
1175 nmdc:mga05p37_268632_c1 3300050507 Bacteria 2039
1176 nmdc:mga05p37_287153_c1 3300050507 Bacteria 1959
1177 nmdc:mga05p37_786377_c1 3300050507 Bacteria 1043
1178 nmdc:mga09592_110359_c1 3300050508 Bacteria 2360
1179 nmdc:mga09592_270300_c1 3300050508 Bacteria 1474
1180 nmdc:mga0qj67_121416_c1 3300050509 Bacteria 2114
1181 nmdc:mga0qj67_19636_c1 3300050509 Bacteria 5166
1182 nmdc:mga06r32_21123_c1 3300050510 Bacteria 6007
1183 nmdc:mga06r32_9316_c1 3300050510 Bacteria 8853
1184 nmdc:mga08y16_112037_c1 3300050511 Bacteria 2840
1185 nmdc:mga08y16_187406_c1 3300050511 Bacteria 2147
1186 nmdc:mga08y16_244684_c1 3300050511 Bacteria 1854
1187 nmdc:mga08y16_34714_c1 3300050511 Bacteria 5299
1188 nmdc:mga08y16_53774_c1 3300050511 Bacteria 4208
1189 nmdc:mga0n895_101084_c1 3300050512 Bacteria 2893
1190 nmdc:mga0n895_170644_c1 3300050512 Bacteria 2207
1191 nmdc:mga0n895_1857_c1 3300050512 Bacteria 16116
1192 nmdc:mga0n895_240452_c1 3300050512 Bacteria 1837
1193 nmdc:mga0n895_399571_c1 3300050512 Bacteria 1390
1194 nmdc:mga0rr50_59482_c1 3300050513 Bacteria 2869
1195 nmdc:mga0rr50_61233_c1 3300050513 Bacteria 2835
1196 nmdc:mga08x19_17358_c1 3300050514 Bacteria 4403
1197 nmdc:mga0a205_502602_c1 3300050515 Bacteria 1069
1198 nmdc:mga0a205_96584_c1 3300050515 Bacteria 2854
1199 nmdc:mga0sz30_18017_c1 3300050516 Bacteria 2822
1200 nmdc:mga0sz30_20147_c1 3300050516 Bacteria 2688
1201 nmdc:mga0sz30_58797_c1 3300050516 Bacteria 1639
1202 Ga0495601_0002639 3300053077 Bacteria 10177
1203 Ga0495601_0003107 3300053077 Bacteria 9484
1204 Ga0495601_0006299 3300053077 Bacteria 6932
1205 Ga0495601_0019700 3300053077 Bacteria 4117
1206 Ga0495601_0025844 3300053077 Bacteria 3622
1207 Ga0495601_0038407 3300053077 Bacteria 2995
1208 Ga0495601_0044171 3300053077 Bacteria 2801
1209 Ga0495601_0092862 3300053077 Bacteria 1944
1210 Ga0495601_0112481 3300053077 Bacteria 1764
1211 Ga0495612_0001997 3300053078 Bacteria 8403
1212 Ga0495612_0008658 3300053078 Bacteria 4126
1213 Ga0495612_0160290 3300053078 Bacteria 982
1214 Ga0500635_0016196 3300053080 Bacteria 2213
1215 Ga0500635_0038984 3300053080 Bacteria 1578
1216 Ga0495595_0000216 3300053084 Bacteria 23117
1217 Ga0495595_0000883 3300053084 Bacteria 11520
1218 Ga0495595_0010987 3300053084 Bacteria 3778
1219 Ga0495595_0011645 3300053084 Bacteria 3680
1220 Ga0495595_0024819 3300053084 Bacteria 2650
1221 Ga0495595_0029061 3300053084 Bacteria 2471
1222 Ga0495595_0078396 3300053084 Bacteria 1570
1223 Ga0495595_0138821 3300053084 Bacteria 1192
1224 Ga0495619_0000557 3300053085 Bacteria 24670
1225 Ga0495619_0000897 3300053085 Bacteria 19498
1226 Ga0495619_0001136 3300053085 Bacteria 17480
1227 Ga0495619_0010203 3300053085 Bacteria 5917
1228 Ga0495619_0014586 3300053085 Bacteria 4963
1229 Ga0495619_0015410 3300053085 Bacteria 4835
1230 Ga0495619_0045284 3300053085 Bacteria 2890
1231 Ga0495619_0046742 3300053085 Bacteria 2847
1232 Ga0500578_0321589 3300053086 Bacteria 912
1233 Ga0500643_000125 3300053087 Bacteria 79651
1234 Ga0500643_007887 3300053087 Bacteria 4240
1235 Ga0500643_016954 3300053087 Bacteria 2451
1236 Ga0500644_0001722 3300053088 Bacteria 5685
1237 Ga0500647_0053962 3300053091 Bacteria 1934
1238 Ga0500583_0045525 3300053092 Bacteria 2015
1239 Ga0500566_0000331 3300053094 Bacteria 25736
1240 Ga0500566_0001048 3300053094 Bacteria 16009
1241 Ga0500566_0001969 3300053094 Bacteria 12102
1242 Ga0500566_0020614 3300053094 Bacteria 3875
1243 Ga0500566_0021105 3300053094 Bacteria 3831
1244 Ga0500566_0066768 3300053094 Bacteria 2026
1245 Ga0500640_000214 3300053095 Bacteria 12549
1246 Ga0500640_001983 3300053095 Bacteria 6567
1247 Ga0500554_002627 3300053102 Bacteria 3568
1248 Ga0500555_000626 3300053103 Bacteria 13668
1249 Ga0500556_0000069 3300053104 Bacteria 101263
1250 Ga0500556_0085971 3300053104 Bacteria 1195
1251 Ga0500557_000040 3300053105 Bacteria 66268
1252 Ga0500572_000175 3300053111 Bacteria 22657
1253 Ga0500595_000001 3300053119 Bacteria 1088438
1254 Ga0500595_000407 3300053119 Bacteria 27509
1255 Ga0500595_000715 3300053119 Bacteria 19771
1256 Ga0500595_007199 3300053119 Bacteria 4636
1257 Ga0500608_006744 3300053122 Bacteria 4703
1258 Ga0500608_039749 3300053122 Bacteria 2253
1259 Ga0500614_001781 3300053123 Bacteria 4996
1260 Ga0500642_0000032 3300053130 Bacteria 111097
1261 Ga0500642_0000118 3300053130 Bacteria 36204
1262 Ga0500642_0017555 3300053130 Bacteria 2746
1263 Ga0500652_001281 3300053131 Bacteria 7967
1264 Ga0500655_010216 3300053133 Bacteria 1694
1265 Ga0500559_0001458 3300053136 Bacteria 13416
1266 Ga0500564_007644 3300053138 Bacteria 4593
1267 Ga0500586_020181 3300053145 Bacteria 2083
1268 Ga0500589_076989 3300053147 Bacteria 1497
1269 Ga0500603_000394 3300053150 Bacteria 11457
1270 Ga0500603_002027 3300053150 Bacteria 4486
1271 Ga0500603_021441 3300053150 Bacteria 1589
1272 Ga0500604_0013468 3300053151 Bacteria 2216
1273 Ga0500616_0000001 3300053153 Bacteria 1986011
1274 Ga0500616_0000461 3300053153 Bacteria 53095
1275 Ga0500616_0036537 3300053153 Bacteria 2666
1276 Ga0500622_0000602 3300053156 Bacteria 32636
1277 Ga0500622_0010928 3300053156 Bacteria 4956
1278 Ga0500638_001677 3300053162 Bacteria 7185
1279 Ga0500638_005668 3300053162 Bacteria 5012
1280 Ga0500638_081650 3300053162 Bacteria 1534
1281 Ga0500639_000239 3300053163 Bacteria 27228
1282 Ga0500636_0000102 3300053177 Bacteria 43520
1283 Ga0500636_0007566 3300053177 Bacteria 6281
1284 Ga0500636_0061804 3300053177 Bacteria 2185
1285 Ga0500637_0000265 3300053178 Bacteria 19602
1286 Ga0500637_0007251 3300053178 Bacteria 5532
1287 Ga0500657_021837 3300053728 Bacteria 3032
1288 Ga0500645_027102 3300053730 Bacteria 1739
1289 Ga0500645_035738 3300053730 Bacteria 1479
1290 Ga0500596_000367 3300053735 Bacteria 8162
1291 Ga0500601_000568 3300053737 Bacteria 5399
1292 Ga0501084_0357611 3300054114 Bacteria 1234

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300033180 Ga0307510_10019865 Ga0307510_100198654 243
2 3300049571 Ga0501034_0857228 Ga0501034_0857228_16_771 250
3 3300035091 Ga0373951_0048896 Ga0373951_0048896_229_1026 256
4 3300006175 Ga0070712_100151972 Ga0070712_1001519722 280
5 3300025915 Ga0207693_10054488 Ga0207693_100544883 280
6 3300039450 Ga0436363_0688960 Ga0436363_0688960_233_1111 283
7 3300006847 Ga0075431_100264386 Ga0075431_1002643861 285
8 3300009094 Ga0111539_10198631 Ga0111539_101986313 285
9 3300053086 Ga0500578_0321589 Ga0500578_0321589_26_895 286
10 3300038443 Ga0395901_0312242 Ga0395901_0312242_18_905 288
11 3300048907 Ga0496104_0098246 Ga0496104_0098246_50_931 288
12 3300048911 Ga0496108_0218756 Ga0496108_0218756_758_1645 288
13 3300031241 Ga0265325_10013606 Ga0265325_100136062 289
14 iso_pu_bacteria 8016575299 8016576465 289
15 3300006038 Ga0075365_10014013 Ga0075365_100140135 290
16 3300006051 Ga0075364_10034720 Ga0075364_100347204 290
17 3300006177 Ga0075362_10039864 Ga0075362_100398643 290
18 3300006844 Ga0075428_100267586 Ga0075428_1002675863 290
19 3300021377 Ga0213874_10010728 Ga0213874_100107284 290
20 3300037853 Ga0436364_1223619 Ga0436364_1223619_2684_3634 290
21 3300050489 nmdc:mga03683_10234_c2 nmdc:mga03683_10234_c2_32_970 290
22 3300050491 nmdc:mga00v17_7665_c1 nmdc:mga00v17_7665_c1_142_1080 290
23 3300050492 nmdc:mga0yw44_1289_c1 nmdc:mga0yw44_1289_c1_7798_8736 290
24 3300050507 nmdc:mga05p37_287153_c1 nmdc:mga05p37_287153_c1_185_1123 290
25 3300050509 nmdc:mga0qj67_121416_c1 nmdc:mga0qj67_121416_c1_1103_2041 290
26 3300050511 nmdc:mga08y16_112037_c1 nmdc:mga08y16_112037_c1_1439_2377 290
27 3300053077 Ga0495601_0038407 Ga0495601_0038407_203_1150 290
28 3300005530 Ga0070679_100003933 Ga0070679_10000393311 292
29 3300006173 Ga0070716_100123649 Ga0070716_1001236493 292
30 3300014497 Ga0182008_10015082 Ga0182008_100150825 292
31 3300035113 Ga0373936_0019424 Ga0373936_0019424_28_909 292
32 3300035119 Ga0373956_0016342 Ga0373956_0016342_46_927 292
33 3300035242 Ga0373962_0045692 Ga0373962_0045692_174_1055 292
34 3300037068 Ga0373925_0120850 Ga0373925_0120850_336_1289 292
35 3300039438 Ga0436360_0904398 Ga0436360_0904398_27_908 292
36 3300045976 Ga0466967_0816272 Ga0466967_0816272_28_909 292
37 3300046455 Ga0495603_0204880 Ga0495603_0204880_46_927 292
38 3300046455 Ga0495603_0244089 Ga0495603_0244089_46_999 292
39 3300046460 Ga0495638_0022384 Ga0495638_0022384_2262_3143 292
40 3300046475 Ga0495639_0075581 Ga0495639_0075581_441_1394 292
41 3300046477 Ga0495664_0199603 Ga0495664_0199603_257_1138 292
42 3300046501 Ga0495607_0056662 Ga0495607_0056662_998_1879 292
43 3300046513 Ga0495616_0022264 Ga0495616_0022264_1788_2669 292
44 3300046517 Ga0495630_0153722 Ga0495630_0153722_126_1079 292
45 3300046522 Ga0495643_0054647 Ga0495643_0054647_849_1730 292
46 3300046524 Ga0495648_0137062 Ga0495648_0137062_220_1101 292
47 3300046533 Ga0495640_0040839 Ga0495640_0040839_1759_2712 292
48 3300046542 Ga0495597_0071126 Ga0495597_0071126_471_1352 292
49 3300046559 Ga0495667_0223037 Ga0495667_0223037_168_1115 292
50 3300046642 Ga0495634_0016827 Ga0495634_0016827_1615_2568 292
51 3300046665 Ga0495661_0018009 Ga0495661_0018009_1938_2819 292
52 3300046689 Ga0495613_0188337 Ga0495613_0188337_40_993 292
53 3300046691 Ga0495670_0112324 Ga0495670_0112324_421_1302 292
54 3300046691 Ga0495670_0252675 Ga0495670_0252675_26_907 292
55 3300046692 Ga0495671_0018194 Ga0495671_0018194_1267_2148 292
56 3300047319 Ga0495674_0083972 Ga0495674_0083972_1642_2595 292
57 3300047321 Ga0495676_0222726 Ga0495676_0222726_82_1035 292
58 3300047469 Ga0495673_0058648 Ga0495673_0058648_36_917 292
59 3300047472 Ga0495686_0033809 Ga0495686_0033809_1811_2692 292
60 3300048909 Ga0496106_0149332 Ga0496106_0149332_751_1632 292
61 3300048911 Ga0496108_0036158 Ga0496108_0036158_17_898 292
62 3300048911 Ga0496108_0406977 Ga0496108_0406977_79_960 292
63 3300048918 Ga0496115_0068565 Ga0496115_0068565_587_1561 292
64 3300048918 Ga0496115_0174202 Ga0496115_0174202_190_1071 292
65 3300048919 Ga0496116_0001913 Ga0496116_0001913_3746_4627 292
66 3300048924 Ga0496121_0043862 Ga0496121_0043862_85_966 292
67 3300048925 Ga0496122_0016804 Ga0496122_0016804_5861_6742 292
68 3300048926 Ga0496123_0031624 Ga0496123_0031624_1258_2139 292
69 3300048927 Ga0496124_0049528 Ga0496124_0049528_1713_2594 292
70 3300048928 Ga0496125_0010916 Ga0496125_0010916_5353_6234 292
71 3300048928 Ga0496125_0038188 Ga0496125_0038188_1713_2594 292
72 3300048929 Ga0496126_0130655 Ga0496126_0130655_416_1297 292
73 3300050491 nmdc:mga00v17_18761_c1 nmdc:mga00v17_18761_c1_1805_2686 292
74 3300050492 nmdc:mga0yw44_6230_c2 nmdc:mga0yw44_6230_c2_188_1069 292
75 3300050492 nmdc:mga0yw44_99914_c1 nmdc:mga0yw44_99914_c1_107_988 292
76 3300050494 nmdc:mga06z11_304611_c1 nmdc:mga06z11_304611_c1_28_909 292
77 3300050507 nmdc:mga05p37_786377_c1 nmdc:mga05p37_786377_c1_138_1019 292
78 3300050512 nmdc:mga0n895_170644_c1 nmdc:mga0n895_170644_c1_279_1160 292
79 3300050515 nmdc:mga0a205_502602_c1 nmdc:mga0a205_502602_c1_177_1058 292
80 3300050516 nmdc:mga0sz30_18017_c1 nmdc:mga0sz30_18017_c1_1616_2497 292
81 3300053077 Ga0495601_0002639 Ga0495601_0002639_2086_3039 292
82 3300053078 Ga0495612_0160290 Ga0495612_0160290_47_928 292
83 3300053085 Ga0495619_0015410 Ga0495619_0015410_3822_4769 292
84 3300053087 Ga0500643_016954 Ga0500643_016954_714_1595 292
85 3300053104 Ga0500556_0000069 Ga0500556_0000069_54953_55834 292
86 3300053130 Ga0500642_0000032 Ga0500642_0000032_72062_72943 292
87 3300053131 Ga0500652_001281 Ga0500652_001281_6970_7851 292
88 3300053145 Ga0500586_020181 Ga0500586_020181_678_1559 292
89 3300053151 Ga0500604_0013468 Ga0500604_0013468_215_1096 292
90 3300053153 Ga0500616_0000461 Ga0500616_0000461_6678_7559 292
91 3300053156 Ga0500622_0000602 Ga0500622_0000602_2199_3080 292
92 3300006175 Ga0070712_100135046 Ga0070712_1001350461 293
93 3300021388 Ga0213875_10000902 Ga0213875_1000090210 293
94 3300025905 Ga0207685_10002938 Ga0207685_100029381 293
95 3300025915 Ga0207693_10088878 Ga0207693_100888782 293
96 3300037853 Ga0436364_0346238 Ga0436364_0346238_22041_22967 293
97 3300046491 Ga0495584_0184903 Ga0495584_0184903_23_904 293
98 3300046648 Ga0495611_0117885 Ga0495611_0117885_329_1210 293
99 3300047469 Ga0495673_0118071 Ga0495673_0118071_151_1032 293
100 3300048908 Ga0496105_0275916 Ga0496105_0275916_287_1231 293
101 3300048915 Ga0496112_0396390 Ga0496112_0396390_65_1009 293
102 3300048917 Ga0496114_0499580 Ga0496114_0499580_22_903 293
103 3300048925 Ga0496122_0009319 Ga0496122_0009319_6758_7705 293
104 3300048926 Ga0496123_0006663 Ga0496123_0006663_7774_8721 293
105 3300050495 nmdc:mga04h51_137402_c1 nmdc:mga04h51_137402_c1_13_894 293
106 3300053085 Ga0495619_0010203 Ga0495619_0010203_2835_3716 293
107 3300005341 Ga0070691_10152793 Ga0070691_101527932 294
108 3300005530 Ga0070679_100512987 Ga0070679_1005129872 294
109 3300005615 Ga0070702_100145231 Ga0070702_1001452312 294
110 3300013104 Ga0157370_10181189 Ga0157370_101811893 294
111 3300014325 Ga0163163_10004545 Ga0163163_1000454510 294
112 3300021361 Ga0213872_10068362 Ga0213872_100683623 294
113 3300037312 Ga0395899_0015112 Ga0395899_0015112_3749_4681 294
114 3300037418 Ga0395900_0023638 Ga0395900_0023638_4733_5665 294
115 3300037466 Ga0395898_0045341 Ga0395898_0045341_570_1502 294
116 3300038443 Ga0395901_0011040 Ga0395901_0011040_1694_2626 294
117 3300039437 Ga0436365_1685276 Ga0436365_1685276_71_967 294
118 3300007076 Ga0075435_100200593 Ga0075435_1002005932 295
119 3300010159 Ga0099796_10044171 Ga0099796_100441712 295
120 3300009545 Ga0105237_10207419 Ga0105237_102074192 296
121 3300046665 Ga0495661_0084017 Ga0495661_0084017_139_1068 296
122 3300006844 Ga0075428_100026465 Ga0075428_1000264652 297
123 3300006844 Ga0075428_100079610 Ga0075428_1000796103 297
124 3300006847 Ga0075431_100080863 Ga0075431_1000808632 297
125 3300006852 Ga0075433_10154365 Ga0075433_101543653 297
126 3300006871 Ga0075434_100170360 Ga0075434_1001703603 297
127 3300009176 Ga0105242_10313825 Ga0105242_103138252 297
128 3300009551 Ga0105238_10009886 Ga0105238_100098865 297
129 3300027907 Ga0207428_10146560 Ga0207428_101465602 297
130 3300031239 Ga0265328_10011006 Ga0265328_100110065 297
131 3300046674 Ga0495588_0068183 Ga0495588_0068183_892_1821 297
132 3300047319 Ga0495674_0040498 Ga0495674_0040498_329_1258 297
133 3300050507 nmdc:mga05p37_115695_c1 nmdc:mga05p37_115695_c1_850_1797 297
134 3300050507 nmdc:mga05p37_214122_c1 nmdc:mga05p37_214122_c1_524_1450 297
135 3300050508 nmdc:mga09592_110359_c1 nmdc:mga09592_110359_c1_532_1458 297
136 3300050510 nmdc:mga06r32_21123_c1 nmdc:mga06r32_21123_c1_4595_5521 297
137 3300050511 nmdc:mga08y16_244684_c1 nmdc:mga08y16_244684_c1_410_1336 297
138 3300050515 nmdc:mga0a205_96584_c1 nmdc:mga0a205_96584_c1_1597_2523 297
139 3300053077 Ga0495601_0025844 Ga0495601_0025844_2682_3611 297
140 3300005290 Ga0065712_10090736 Ga0065712_100907363 298
141 3300005329 Ga0070683_100011551 Ga0070683_1000115514 298
142 3300005336 Ga0070680_100003194 Ga0070680_1000031942 298
143 3300005344 Ga0070661_100126323 Ga0070661_1001263231 298
144 3300005355 Ga0070671_100123457 Ga0070671_1001234572 298
145 3300005434 Ga0070709_10023800 Ga0070709_100238003 298
146 3300005435 Ga0070714_100204543 Ga0070714_1002045433 298
147 3300005436 Ga0070713_100104854 Ga0070713_1001048544 298
148 3300005467 Ga0070706_100093672 Ga0070706_1000936723 298
149 3300005535 Ga0070684_100004390 Ga0070684_10000439010 298
150 3300005547 Ga0070693_100224641 Ga0070693_1002246412 298
151 3300005577 Ga0068857_100004623 Ga0068857_1000046233 298
152 3300005834 Ga0068851_10013394 Ga0068851_100133942 298
153 3300005937 Ga0081455_10044794 Ga0081455_100447943 298
154 3300006028 Ga0070717_10066392 Ga0070717_100663923 298
155 3300006038 Ga0075365_10054563 Ga0075365_100545634 298
156 3300006038 Ga0075365_10152188 Ga0075365_101521882 298
157 3300006051 Ga0075364_10158324 Ga0075364_101583242 298
158 3300006163 Ga0070715_10065594 Ga0070715_100655943 298
159 3300006178 Ga0075367_10157837 Ga0075367_101578372 298
160 3300006871 Ga0075434_100054546 Ga0075434_1000545462 298
161 3300009147 Ga0114129_10265232 Ga0114129_102652323 298
162 3300009545 Ga0105237_10008888 Ga0105237_100088882 298
163 3300009545 Ga0105237_10059562 Ga0105237_100595624 298
164 3300009551 Ga0105238_10005132 Ga0105238_100051323 298
165 3300013104 Ga0157370_10008947 Ga0157370_100089476 298
166 3300013105 Ga0157369_10049936 Ga0157369_100499365 298
167 3300013307 Ga0157372_10167444 Ga0157372_101674442 298
168 3300025898 Ga0207692_10030503 Ga0207692_100305033 298
169 3300025905 Ga0207685_10041009 Ga0207685_100410091 298
170 3300025906 Ga0207699_10021454 Ga0207699_100214545 298
171 3300025906 Ga0207699_10051062 Ga0207699_100510621 298
172 3300025909 Ga0207705_10086970 Ga0207705_100869703 298
173 3300025912 Ga0207707_10001229 Ga0207707_1000122911 298
174 3300025913 Ga0207695_10106569 Ga0207695_101065692 298
175 3300025914 Ga0207671_10020103 Ga0207671_100201036 298
176 3300025915 Ga0207693_10097479 Ga0207693_100974791 298
177 3300025916 Ga0207663_10047065 Ga0207663_100470652 298
178 3300025919 Ga0207657_10000658 Ga0207657_1000065827 298
179 3300025921 Ga0207652_10003041 Ga0207652_1000304113 298
180 3300025928 Ga0207700_10078191 Ga0207700_100781914 298
181 3300025928 Ga0207700_10118403 Ga0207700_101184033 298
182 3300025928 Ga0207700_10185390 Ga0207700_101853901 298
183 3300025929 Ga0207664_10067320 Ga0207664_100673204 298
184 3300025929 Ga0207664_10256089 Ga0207664_102560893 298
185 3300025932 Ga0207690_10095851 Ga0207690_100958511 298
186 3300025933 Ga0207706_10060204 Ga0207706_100602042 298
187 3300025939 Ga0207665_10028857 Ga0207665_100288573 298
188 3300025939 Ga0207665_10096918 Ga0207665_100969183 298
189 3300025944 Ga0207661_10032605 Ga0207661_100326053 298
190 3300025949 Ga0207667_10112938 Ga0207667_101129381 298
191 3300026116 Ga0207674_10052044 Ga0207674_100520443 298
192 3300037068 Ga0373925_0120437 Ga0373925_0120437_312_1253 298
193 3300039447 Ga0436361_0774027 Ga0436361_0774027_1566_2504 298
194 3300046460 Ga0495638_0032269 Ga0495638_0032269_1201_2136 298
195 3300046491 Ga0495584_0005529 Ga0495584_0005529_4687_5622 298
196 3300046491 Ga0495584_0053845 Ga0495584_0053845_273_1211 298
197 3300046492 Ga0495585_0056176 Ga0495585_0056176_785_1723 298
198 3300046501 Ga0495607_0129517 Ga0495607_0129517_289_1227 298
199 3300046557 Ga0495622_0146030 Ga0495622_0146030_60_998 298
200 3300046615 Ga0495656_0010606 Ga0495656_0010606_2249_3187 298
201 3300046691 Ga0495670_0050592 Ga0495670_0050592_624_1562 298
202 3300046692 Ga0495671_0081679 Ga0495671_0081679_266_1204 298
203 3300048904 Ga0496101_0079431 Ga0496101_0079431_1203_2141 298
204 3300048905 Ga0496102_0229022 Ga0496102_0229022_730_1668 298
205 3300048906 Ga0496103_0145741 Ga0496103_0145741_125_1069 298
206 3300048908 Ga0496105_0068948 Ga0496105_0068948_1746_2690 298
207 3300048909 Ga0496106_0135536 Ga0496106_0135536_104_1054 298
208 3300048910 Ga0496107_0113202 Ga0496107_0113202_979_1917 298
209 3300048914 Ga0496111_0269072 Ga0496111_0269072_84_1022 298
210 3300048916 Ga0496113_0384140 Ga0496113_0384140_111_1043 298
211 3300048917 Ga0496114_0136841 Ga0496114_0136841_897_1841 298
212 3300048917 Ga0496114_0183601 Ga0496114_0183601_575_1516 298
213 3300048918 Ga0496115_0200483 Ga0496115_0200483_343_1275 298
214 3300049571 Ga0501034_0284032 Ga0501034_0284032_29_958 298
215 3300049583 Ga0501067_0027796 Ga0501067_0027796_1140_2069 298
216 3300049586 Ga0501070_0035395 Ga0501070_0035395_1488_2417 298
217 3300049589 Ga0501073_0027417 Ga0501073_0027417_2971_3900 298
218 3300049590 Ga0501074_0115382 Ga0501074_0115382_434_1363 298
219 3300049742 Ga0501080_0056270 Ga0501080_0056270_436_1365 298
220 3300049823 Ga0501044_0048264 Ga0501044_0048264_236_1165 298
221 3300050507 nmdc:mga05p37_190261_c1 nmdc:mga05p37_190261_c1_608_1546 298
222 3300050508 nmdc:mga09592_270300_c1 nmdc:mga09592_270300_c1_139_1077 298
223 3300050512 nmdc:mga0n895_399571_c1 nmdc:mga0n895_399571_c1_24_962 298
224 3300053119 Ga0500595_007199 Ga0500595_007199_2335_3279 298
225 3300005340 Ga0070689_100228857 Ga0070689_1002288572 299
226 3300005355 Ga0070671_100231660 Ga0070671_1002316602 299
227 3300005438 Ga0070701_10097009 Ga0070701_100970092 299
228 3300005439 Ga0070711_100210234 Ga0070711_1002102342 299
229 3300005539 Ga0068853_100308793 Ga0068853_1003087931 299
230 3300005564 Ga0070664_100112833 Ga0070664_1001128333 299
231 3300005842 Ga0068858_100129319 Ga0068858_1001293194 299
232 3300006358 Ga0068871_100394270 Ga0068871_1003942702 299
233 3300009094 Ga0111539_10048617 Ga0111539_100486174 299
234 3300009147 Ga0114129_10185593 Ga0114129_101855934 299
235 3300009147 Ga0114129_10346200 Ga0114129_103462002 299
236 3300013306 Ga0163162_10658319 Ga0163162_106583192 299
237 3300025925 Ga0207650_10048647 Ga0207650_100486474 299
238 3300025937 Ga0207669_10120499 Ga0207669_101204992 299
239 3300026035 Ga0207703_10087184 Ga0207703_100871841 299
240 3300027907 Ga0207428_10111008 Ga0207428_101110082 299
241 3300035083 Ga0373926_0046762 Ga0373926_0046762_140_1078 299
242 3300035089 Ga0373944_0025007 Ga0373944_0025007_753_1691 299
243 3300035113 Ga0373936_0015788 Ga0373936_0015788_1315_2253 299
244 3300035116 Ga0373945_0024554 Ga0373945_0024554_675_1613 299
245 3300035170 Ga0373943_0011869 Ga0373943_0011869_950_1888 299
246 3300035171 Ga0373946_0085654 Ga0373946_0085654_160_1098 299
247 3300035172 Ga0373955_0147015 Ga0373955_0147015_71_1009 299
248 3300035692 Ga0373935_0031087 Ga0373935_0031087_1434_2372 299
249 3300035695 Ga0373927_0130957 Ga0373927_0130957_666_1604 299
250 3300035725 Ga0373947_0061898 Ga0373947_0061898_609_1547 299
251 3300035725 Ga0373947_0081521 Ga0373947_0081521_478_1422 299
252 3300037068 Ga0373925_0192515 Ga0373925_0192515_113_1051 299
253 3300046455 Ga0495603_0027225 Ga0495603_0027225_1566_2504 299
254 3300046459 Ga0495629_0044721 Ga0495629_0044721_347_1285 299
255 3300046461 Ga0495641_0047082 Ga0495641_0047082_567_1505 299
256 3300046472 Ga0495580_0015783 Ga0495580_0015783_1550_2488 299
257 3300046473 Ga0495582_0036962 Ga0495582_0036962_1281_2219 299
258 3300046475 Ga0495639_0017148 Ga0495639_0017148_944_1882 299
259 3300046476 Ga0495662_0060984 Ga0495662_0060984_496_1440 299
260 3300046491 Ga0495584_0015148 Ga0495584_0015148_2081_3019 299
261 3300046492 Ga0495585_0026524 Ga0495585_0026524_441_1379 299
262 3300046499 Ga0495594_0068333 Ga0495594_0068333_418_1356 299
263 3300046514 Ga0495618_0314335 Ga0495618_0314335_11_949 299
264 3300046523 Ga0495644_0023731 Ga0495644_0023731_1327_2265 299
265 3300046531 Ga0495665_0119526 Ga0495665_0119526_350_1288 299
266 3300046533 Ga0495640_0070785 Ga0495640_0070785_1316_2260 299
267 3300046537 Ga0495598_0001524 Ga0495598_0001524_1962_2900 299
268 3300046538 Ga0495609_0110258 Ga0495609_0110258_144_1082 299
269 3300046539 Ga0495621_0045437 Ga0495621_0045437_545_1483 299
270 3300046615 Ga0495656_0004934 Ga0495656_0004934_2048_2986 299
271 3300046663 Ga0495635_0225741 Ga0495635_0225741_289_1233 299
272 3300046674 Ga0495588_0070600 Ga0495588_0070600_461_1399 299
273 3300046681 Ga0495647_0020275 Ga0495647_0020275_1075_2013 299
274 3300046683 Ga0495658_0093002 Ga0495658_0093002_767_1705 299
275 3300046809 Ga0495600_0241579 Ga0495600_0241579_167_1105 299
276 3300047315 Ga0495581_0029409 Ga0495581_0029409_476_1414 299
277 3300047315 Ga0495581_0080467 Ga0495581_0080467_491_1435 299
278 3300047319 Ga0495674_0111784 Ga0495674_0111784_463_1401 299
279 3300047323 Ga0495683_0065575 Ga0495683_0065575_827_1765 299
280 3300047673 Ga0495593_0093590 Ga0495593_0093590_501_1439 299
281 3300048903 Ga0496100_0117942 Ga0496100_0117942_136_1080 299
282 3300048904 Ga0496101_0074262 Ga0496101_0074262_935_1873 299
283 3300048905 Ga0496102_0111497 Ga0496102_0111497_420_1358 299
284 3300048910 Ga0496107_0060779 Ga0496107_0060779_303_1241 299
285 3300048911 Ga0496108_0041472 Ga0496108_0041472_1983_2927 299
286 3300048912 Ga0496109_0001620 Ga0496109_0001620_15892_16836 299
287 3300048915 Ga0496112_0083809 Ga0496112_0083809_551_1495 299
288 3300048916 Ga0496113_0020026 Ga0496113_0020026_1746_2690 299
289 3300049588 Ga0501072_0142676 Ga0501072_0142676_659_1591 299
290 3300050507 nmdc:mga05p37_190426_c1 nmdc:mga05p37_190426_c1_1417_2361 299
291 3300050511 nmdc:mga08y16_53774_c1 nmdc:mga08y16_53774_c1_2908_3846 299
292 3300050512 nmdc:mga0n895_240452_c1 nmdc:mga0n895_240452_c1_275_1213 299
293 3300053085 Ga0495619_0046742 Ga0495619_0046742_245_1183 299
294 3300054114 Ga0501084_0357611 Ga0501084_0357611_60_992 299
295 3300005262 Ga0065165_1002727 Ga0065165_10027275 300
296 3300005331 Ga0070670_100019180 Ga0070670_1000191803 300
297 3300005445 Ga0070708_100430775 Ga0070708_1004307751 300
298 3300005467 Ga0070706_100519681 Ga0070706_1005196812 300
299 3300005471 Ga0070698_100378137 Ga0070698_1003781371 300
300 3300005614 Ga0068856_100385102 Ga0068856_1003851021 300
301 3300006038 Ga0075365_10024117 Ga0075365_100241174 300
302 3300007788 Ga0099795_10011722 Ga0099795_100117223 300
303 3300009094 Ga0111539_10182131 Ga0111539_101821312 300
304 3300009098 Ga0105245_10374432 Ga0105245_103744321 300
305 3300009553 Ga0105249_10390340 Ga0105249_103903401 300
306 3300010159 Ga0099796_10083612 Ga0099796_100836121 300
307 3300011119 Ga0105246_10132191 Ga0105246_101321912 300
308 3300013306 Ga0163162_10068601 Ga0163162_100686013 300
309 3300014325 Ga0163163_10020333 Ga0163163_100203335 300
310 3300021384 Ga0213876_10001034 Ga0213876_100010347 300
311 3300021388 Ga0213875_10010291 Ga0213875_100102912 300
312 3300025302 Ga0207426_1000620 Ga0207426_100062029 300
313 3300025915 Ga0207693_10131365 Ga0207693_101313652 300
314 3300025925 Ga0207650_10131962 Ga0207650_101319622 300
315 3300025932 Ga0207690_10240626 Ga0207690_102406262 300
316 3300025941 Ga0207711_10316412 Ga0207711_103164122 300
317 3300027512 Ga0209179_1001865 Ga0209179_10018653 300
318 3300028381 Ga0268264_10764044 Ga0268264_107640441 300
319 3300028800 Ga0265338_10073271 Ga0265338_100732713 300
320 3300031090 Ga0265760_10020199 Ga0265760_100201992 300
321 3300031235 Ga0265330_10031043 Ga0265330_100310432 300
322 3300031239 Ga0265328_10000014 Ga0265328_1000001496 300
323 3300031249 Ga0265339_10063362 Ga0265339_100633623 300
324 3300031250 Ga0265331_10003191 Ga0265331_100031919 300
325 3300035086 Ga0373934_0062699 Ga0373934_0062699_82_1011 300
326 3300035089 Ga0373944_0009808 Ga0373944_0009808_1218_2147 300
327 3300035111 Ga0373923_0019915 Ga0373923_0019915_1545_2474 300
328 3300035113 Ga0373936_0016211 Ga0373936_0016211_291_1220 300
329 3300035116 Ga0373945_0030588 Ga0373945_0030588_918_1847 300
330 3300035118 Ga0373954_0040850 Ga0373954_0040850_429_1358 300
331 3300035119 Ga0373956_0032843 Ga0373956_0032843_834_1769 300
332 3300035119 Ga0373956_0111027 Ga0373956_0111027_221_1150 300
333 3300035170 Ga0373943_0082205 Ga0373943_0082205_265_1203 300
334 3300035171 Ga0373946_0009193 Ga0373946_0009193_762_1691 300
335 3300035171 Ga0373946_0095151 Ga0373946_0095151_133_1071 300
336 3300035172 Ga0373955_0035254 Ga0373955_0035254_1275_2204 300
337 3300035692 Ga0373935_0024166 Ga0373935_0024166_1940_2869 300
338 3300035724 Ga0373933_0041100 Ga0373933_0041100_638_1567 300
339 3300036401 Ga0373937_0101871 Ga0373937_0101871_1269_2198 300
340 3300036401 Ga0373937_0184857 Ga0373937_0184857_541_1470 300
341 3300037068 Ga0373925_0009548 Ga0373925_0009548_4460_5389 300
342 3300037068 Ga0373925_0162551 Ga0373925_0162551_688_1626 300
343 3300037068 Ga0373925_0414047 Ga0373925_0414047_10_948 300
344 3300039447 Ga0436361_0458971 Ga0436361_0458971_212_1147 300
345 3300044694 Ga0466963_0010492 Ga0466963_0010492_3649_4581 300
346 3300045976 Ga0466967_0006446 Ga0466967_0006446_357_1289 300
347 3300046454 Ga0495592_0192931 Ga0495592_0192931_401_1330 300
348 3300046455 Ga0495603_0119435 Ga0495603_0119435_357_1295 300
349 3300046459 Ga0495629_0003645 Ga0495629_0003645_4572_5501 300
350 3300046461 Ga0495641_0020070 Ga0495641_0020070_1697_2626 300
351 3300046462 Ga0495651_0033843 Ga0495651_0033843_1079_2008 300
352 3300046463 Ga0495653_0040572 Ga0495653_0040572_2261_3190 300
353 3300046473 Ga0495582_0052564 Ga0495582_0052564_355_1293 300
354 3300046473 Ga0495582_0055744 Ga0495582_0055744_466_1395 300
355 3300046476 Ga0495662_0004509 Ga0495662_0004509_2134_3063 300
356 3300046491 Ga0495584_0016934 Ga0495584_0016934_48_986 300
357 3300046492 Ga0495585_0030890 Ga0495585_0030890_883_1821 300
358 3300046511 Ga0495608_0014419 Ga0495608_0014419_3360_4289 300
359 3300046514 Ga0495618_0003470 Ga0495618_0003470_8723_9652 300
360 3300046516 Ga0495628_0056590 Ga0495628_0056590_512_1441 300
361 3300046516 Ga0495628_0108961 Ga0495628_0108961_235_1170 300
362 3300046517 Ga0495630_0067130 Ga0495630_0067130_734_1663 300
363 3300046523 Ga0495644_0094647 Ga0495644_0094647_155_1084 300
364 3300046524 Ga0495648_0026326 Ga0495648_0026326_1184_2131 300
365 3300046529 Ga0495652_0021349 Ga0495652_0021349_4123_5052 300
366 3300046533 Ga0495640_0067651 Ga0495640_0067651_284_1213 300
367 3300046535 Ga0495586_0039863 Ga0495586_0039863_78_1007 300
368 3300046536 Ga0495587_0044655 Ga0495587_0044655_291_1220 300
369 3300046537 Ga0495598_0085668 Ga0495598_0085668_26_955 300
370 3300046543 Ga0495645_0134405 Ga0495645_0134405_142_1071 300
371 3300046559 Ga0495667_0020988 Ga0495667_0020988_2822_3751 300
372 3300046642 Ga0495634_0073645 Ga0495634_0073645_1033_1962 300
373 3300046663 Ga0495635_0001519 Ga0495635_0001519_3190_4119 300
374 3300046674 Ga0495588_0016581 Ga0495588_0016581_2167_3096 300
375 3300046674 Ga0495588_0120757 Ga0495588_0120757_341_1279 300
376 3300046675 Ga0495657_0042701 Ga0495657_0042701_260_1189 300
377 3300046678 Ga0495599_0041117 Ga0495599_0041117_1705_2634 300
378 3300046679 Ga0495623_0072950 Ga0495623_0072950_934_1863 300
379 3300046683 Ga0495658_0028537 Ga0495658_0028537_1809_2747 300
380 3300046689 Ga0495613_0020761 Ga0495613_0020761_3391_4320 300
381 3300046690 Ga0495624_0050701 Ga0495624_0050701_507_1436 300
382 3300046691 Ga0495670_0139497 Ga0495670_0139497_183_1112 300
383 3300046809 Ga0495600_0011929 Ga0495600_0011929_1024_1953 300
384 3300047317 Ga0495604_0031834 Ga0495604_0031834_1132_2061 300
385 3300047319 Ga0495674_0014830 Ga0495674_0014830_6220_7149 300
386 3300047321 Ga0495676_0034215 Ga0495676_0034215_2789_3727 300
387 3300047322 Ga0495680_0005583 Ga0495680_0005583_3692_4621 300
388 3300047444 Ga0495675_0076330 Ga0495675_0076330_1167_2096 300
389 3300047471 Ga0495684_0012905 Ga0495684_0012905_1058_1987 300
390 3300047673 Ga0495593_0013832 Ga0495593_0013832_1547_2476 300
391 3300048088 Ga0495602_0193942 Ga0495602_0193942_142_1071 300
392 3300048907 Ga0496104_0023859 Ga0496104_0023859_683_1621 300
393 3300048908 Ga0496105_0051704 Ga0496105_0051704_1111_2058 300
394 3300048908 Ga0496105_0168437 Ga0496105_0168437_418_1356 300
395 3300048911 Ga0496108_0011304 Ga0496108_0011304_5826_6764 300
396 3300048911 Ga0496108_0011769 Ga0496108_0011769_3733_4680 300
397 3300048912 Ga0496109_0005500 Ga0496109_0005500_506_1444 300
398 3300048913 Ga0496110_0004983 Ga0496110_0004983_3244_4182 300
399 3300048913 Ga0496110_0024066 Ga0496110_0024066_2044_2991 300
400 3300048914 Ga0496111_0020473 Ga0496111_0020473_2816_3754 300
401 3300048915 Ga0496112_0005098 Ga0496112_0005098_2765_3703 300
402 3300048915 Ga0496112_0124964 Ga0496112_0124964_115_1062 300
403 3300048916 Ga0496113_0001469 Ga0496113_0001469_7022_7960 300
404 3300048916 Ga0496113_0089336 Ga0496113_0089336_210_1157 300
405 3300049588 Ga0501072_0063369 Ga0501072_0063369_1837_2766 300
406 3300050492 nmdc:mga0yw44_196826_c1 nmdc:mga0yw44_196826_c1_178_1116 300
407 3300053077 Ga0495601_0019700 Ga0495601_0019700_2905_3834 300
408 3300053078 Ga0495612_0008658 Ga0495612_0008658_2394_3323 300
409 3300053084 Ga0495595_0011645 Ga0495595_0011645_1074_2003 300
410 3300053084 Ga0495595_0024819 Ga0495595_0024819_213_1148 300
411 3300053084 Ga0495595_0138821 Ga0495595_0138821_35_991 300
412 3300053085 Ga0495619_0045284 Ga0495619_0045284_1678_2607 300
413 3300053087 Ga0500643_007887 Ga0500643_007887_2135_3064 300
414 3300053094 Ga0500566_0020614 Ga0500566_0020614_1355_2284 300
415 3300053728 Ga0500657_021837 Ga0500657_021837_1763_2692 300
416 3300005356 Ga0070674_100418330 Ga0070674_1004183301 301
417 3300005365 Ga0070688_100009486 Ga0070688_1000094863 301
418 3300005455 Ga0070663_100274661 Ga0070663_1002746612 301
419 3300005456 Ga0070678_100075509 Ga0070678_1000755093 301
420 3300005457 Ga0070662_100014566 Ga0070662_1000145666 301
421 3300005466 Ga0070685_10079820 Ga0070685_100798203 301
422 3300005518 Ga0070699_100020399 Ga0070699_1000203996 301
423 3300005544 Ga0070686_100120031 Ga0070686_1001200311 301
424 3300005618 Ga0068864_100032645 Ga0068864_1000326455 301
425 3300006173 Ga0070716_100103910 Ga0070716_1001039102 301
426 3300009176 Ga0105242_10203400 Ga0105242_102034001 301
427 3300009177 Ga0105248_10038782 Ga0105248_100387826 301
428 3300009177 Ga0105248_10194247 Ga0105248_101942472 301
429 3300009551 Ga0105238_10254680 Ga0105238_102546802 301
430 3300011119 Ga0105246_10146800 Ga0105246_101468003 301
431 3300013308 Ga0157375_10264780 Ga0157375_102647801 301
432 3300014325 Ga0163163_10496919 Ga0163163_104969192 301
433 3300025899 Ga0207642_10030124 Ga0207642_100301242 301
434 3300025901 Ga0207688_10084804 Ga0207688_100848043 301
435 3300025923 Ga0207681_10037411 Ga0207681_100374113 301
436 3300025933 Ga0207706_10027569 Ga0207706_100275692 301
437 3300025934 Ga0207686_10069432 Ga0207686_100694323 301
438 3300025939 Ga0207665_10057788 Ga0207665_100577882 301
439 3300025941 Ga0207711_10088461 Ga0207711_100884613 301
440 3300025960 Ga0207651_10262647 Ga0207651_102626472 301
441 3300025986 Ga0207658_10080461 Ga0207658_100804613 301
442 3300026035 Ga0207703_10083894 Ga0207703_100838942 301
443 3300026095 Ga0207676_10073278 Ga0207676_100732784 301
444 3300026118 Ga0207675_100261455 Ga0207675_1002614553 301
445 3300026121 Ga0207683_10080288 Ga0207683_100802883 301
446 3300026142 Ga0207698_10404606 Ga0207698_104046062 301
447 3300028023 Ga0265357_1001321 Ga0265357_10013213 301
448 3300028556 Ga0265337_1000412 Ga0265337_100041222 301
449 3300031247 Ga0265340_10029731 Ga0265340_100297313 301
450 3300034817 Ga0373948_0026685 Ga0373948_0026685_123_1064 301
451 3300034820 Ga0373959_0011219 Ga0373959_0011219_415_1377 301
452 3300035085 Ga0373929_0005008 Ga0373929_0005008_46_987 301
453 3300035172 Ga0373955_0066836 Ga0373955_0066836_777_1706 301
454 3300035691 Ga0373931_0120592 Ga0373931_0120592_286_1227 301
455 3300035724 Ga0373933_0026628 Ga0373933_0026628_1436_2365 301
456 3300036401 Ga0373937_0039454 Ga0373937_0039454_2375_3304 301
457 3300037466 Ga0395898_0081007 Ga0395898_0081007_904_1848 301
458 3300046663 Ga0495635_0141557 Ga0495635_0141557_632_1561 301
459 3300047444 Ga0495675_0207036 Ga0495675_0207036_113_1042 301
460 3300048903 Ga0496100_0004573 Ga0496100_0004573_5062_6003 301
461 3300048903 Ga0496100_0028425 Ga0496100_0028425_1262_2197 301
462 3300048904 Ga0496101_0008538 Ga0496101_0008538_3237_4178 301
463 3300048905 Ga0496102_0022051 Ga0496102_0022051_3083_4024 301
464 3300048907 Ga0496104_0005685 Ga0496104_0005685_3406_4341 301
465 3300048907 Ga0496104_0014292 Ga0496104_0014292_1592_2533 301
466 3300048908 Ga0496105_0008654 Ga0496105_0008654_6894_7829 301
467 3300048908 Ga0496105_0032948 Ga0496105_0032948_261_1202 301
468 3300048910 Ga0496107_0016125 Ga0496107_0016125_3981_4922 301
469 3300048911 Ga0496108_0018897 Ga0496108_0018897_1138_2073 301
470 3300048912 Ga0496109_0000377 Ga0496109_0000377_2423_3358 301
471 3300048912 Ga0496109_0033408 Ga0496109_0033408_452_1393 301
472 3300048914 Ga0496111_0009981 Ga0496111_0009981_5171_6106 301
473 3300048914 Ga0496111_0013193 Ga0496111_0013193_2064_3005 301
474 3300048915 Ga0496112_0009154 Ga0496112_0009154_3406_4341 301
475 3300048915 Ga0496112_0079947 Ga0496112_0079947_2183_3124 301
476 3300048916 Ga0496113_0008097 Ga0496113_0008097_3086_4048 301
477 3300048916 Ga0496113_0083058 Ga0496113_0083058_404_1345 301
478 3300048917 Ga0496114_0021241 Ga0496114_0021241_2986_3927 301
479 3300048918 Ga0496115_0056716 Ga0496115_0056716_2049_2984 301
480 3300048918 Ga0496115_0056752 Ga0496115_0056752_314_1255 301
481 3300053084 Ga0495595_0010987 Ga0495595_0010987_913_1842 301
482 3300053085 Ga0495619_0014586 Ga0495619_0014586_1731_2660 301
483 3300005434 Ga0070709_10000980 Ga0070709_100009805 302
484 3300005436 Ga0070713_100016044 Ga0070713_1000160445 302
485 3300005437 Ga0070710_10001038 Ga0070710_100010388 302
486 3300005577 Ga0068857_100285856 Ga0068857_1002858562 302
487 3300006175 Ga0070712_100180661 Ga0070712_1001806612 302
488 3300006175 Ga0070712_100256228 Ga0070712_1002562281 302
489 3300006914 Ga0075436_100005587 Ga0075436_1000055878 302
490 3300007788 Ga0099795_10069235 Ga0099795_100692352 302
491 3300010159 Ga0099796_10002743 Ga0099796_100027434 302
492 3300025898 Ga0207692_10001278 Ga0207692_100012785 302
493 3300025906 Ga0207699_10011463 Ga0207699_100114635 302
494 3300025915 Ga0207693_10006620 Ga0207693_100066204 302
495 3300025928 Ga0207700_10026454 Ga0207700_100264545 302
496 3300025929 Ga0207664_10004931 Ga0207664_100049312 302
497 3300025939 Ga0207665_10017817 Ga0207665_100178175 302
498 3300027512 Ga0209179_1001581 Ga0209179_10015812 302
499 3300050514 nmdc:mga08x19_17358_c1 nmdc:mga08x19_17358_c1_2140_3114 302
500 3300053119 Ga0500595_000001 Ga0500595_000001_525053_525982 302
501 3300003203 JGI25406J46586_10000034 JGI25406J46586_1000003437 303
502 3300005985 Ga0081539_10000113 Ga0081539_1000011320 303
503 3300013306 Ga0163162_10149195 Ga0163162_101491952 303
504 3300021388 Ga0213875_10000053 Ga0213875_10000053128 303
505 3300035170 Ga0373943_0072054 Ga0373943_0072054_258_1202 303
506 3300037853 Ga0436364_0288952 Ga0436364_0288952_8882_9829 303
507 3300046476 Ga0495662_0034815 Ga0495662_0034815_456_1427 303
508 3300049585 Ga0501069_0037162 Ga0501069_0037162_1394_2329 303
509 3300049822 Ga0501035_0000197 Ga0501035_0000197_71384_72319 303
510 3300005435 Ga0070714_100430093 Ga0070714_1004300931 304
511 3300005458 Ga0070681_10141744 Ga0070681_101417445 304
512 3300005983 Ga0081540_1051986 Ga0081540_10519863 304
513 3300009093 Ga0105240_10322270 Ga0105240_103222701 304
514 3300009098 Ga0105245_10042042 Ga0105245_100420421 304
515 3300021384 Ga0213876_10003065 Ga0213876_100030654 304
516 3300025254 Ga0209148_1000530 Ga0209148_100053019 304
517 3300025272 Ga0209455_1000326 Ga0209455_100032613 304
518 3300039437 Ga0436365_1835761 Ga0436365_1835761_8373_9314 304
519 3300039450 Ga0436363_1051136 Ga0436363_1051136_639_1580 304
520 3300005435 Ga0070714_100028817 Ga0070714_1000288175 305
521 3300005535 Ga0070684_100102059 Ga0070684_1001020593 305
522 3300005983 Ga0081540_1002071 Ga0081540_100207112 305
523 3300006028 Ga0070717_10068036 Ga0070717_100680362 305
524 3300013307 Ga0157372_10144333 Ga0157372_101443332 305
525 3300025299 Ga0209256_1032783 Ga0209256_10327831 305
526 3300025924 Ga0207694_10195723 Ga0207694_101957232 305
527 3300025929 Ga0207664_10062949 Ga0207664_100629494 305
528 3300037466 Ga0395898_0191145 Ga0395898_0191145_257_1198 305
529 3300041512 Ga0451853_0987069 Ga0451853_0987069_128_1081 305
530 3300048918 Ga0496115_0032733 Ga0496115_0032733_1645_2574 305
531 3300048921 Ga0496118_0069374 Ga0496118_0069374_1288_2229 305
532 3300003214 JGI25165J46597_1005127 JGI25165J46597_10051273 306
533 3300003215 JGI25153J46596_10001825 JGI25153J46596_100018255 306
534 3300003215 JGI25153J46596_10003323 JGI25153J46596_100033235 306
535 3300003354 JGI25160J50197_1001067 JGI25160J50197_10010672 306
536 3300003354 JGI25160J50197_1003948 JGI25160J50197_10039483 306
537 3300005262 Ga0065165_1007687 Ga0065165_10076874 306
538 3300005336 Ga0070680_100026227 Ga0070680_1000262272 306
539 3300005355 Ga0070671_100108912 Ga0070671_1001089122 306
540 3300005434 Ga0070709_10012949 Ga0070709_100129492 306
541 3300005437 Ga0070710_10336147 Ga0070710_103361471 306
542 3300005455 Ga0070663_100071340 Ga0070663_1000713403 306
543 3300005458 Ga0070681_10076110 Ga0070681_100761103 306
544 3300005530 Ga0070679_100005873 Ga0070679_1000058731 306
545 3300005530 Ga0070679_100030562 Ga0070679_1000305621 306
546 3300005539 Ga0068853_100097378 Ga0068853_1000973782 306
547 3300005546 Ga0070696_100104082 Ga0070696_1001040822 306
548 3300005563 Ga0068855_100040685 Ga0068855_1000406854 306
549 3300005563 Ga0068855_100153219 Ga0068855_1001532193 306
550 3300005578 Ga0068854_100356583 Ga0068854_1003565832 306
551 3300006051 Ga0075364_10173534 Ga0075364_101735342 306
552 3300006178 Ga0075367_10059371 Ga0075367_100593712 306
553 3300006186 Ga0075369_10087865 Ga0075369_100878651 306
554 3300006353 Ga0075370_10105120 Ga0075370_101051202 306
555 3300006871 Ga0075434_100103424 Ga0075434_1001034243 306
556 3300006880 Ga0075429_100007719 Ga0075429_1000077199 306
557 3300009093 Ga0105240_10006945 Ga0105240_1000694510 306
558 3300009545 Ga0105237_10017912 Ga0105237_100179126 306
559 3300013105 Ga0157369_10104121 Ga0157369_101041212 306
560 3300014325 Ga0163163_10037933 Ga0163163_100379333 306
561 3300021384 Ga0213876_10001237 Ga0213876_1000123710 306
562 3300025230 Ga0209563_102501 Ga0209563_1025013 306
563 3300025254 Ga0209148_1000180 Ga0209148_100018032 306
564 3300025297 Ga0209758_1001429 Ga0209758_100142918 306
565 3300025297 Ga0209758_1004591 Ga0209758_10045913 306
566 3300025302 Ga0207426_1000429 Ga0207426_100042952 306
567 3300025302 Ga0207426_1019649 Ga0207426_10196492 306
568 3300025304 Ga0209257_1040647 Ga0209257_10406472 306
569 3300025904 Ga0207647_10008887 Ga0207647_100088873 306
570 3300025906 Ga0207699_10034223 Ga0207699_100342231 306
571 3300025911 Ga0207654_10289648 Ga0207654_102896481 306
572 3300025912 Ga0207707_10142145 Ga0207707_101421452 306
573 3300025913 Ga0207695_10000008 Ga0207695_10000008730 306
574 3300025913 Ga0207695_10029844 Ga0207695_100298443 306
575 3300025914 Ga0207671_10008749 Ga0207671_100087496 306
576 3300025925 Ga0207650_10050330 Ga0207650_100503304 306
577 3300025928 Ga0207700_10055560 Ga0207700_100555601 306
578 3300025931 Ga0207644_10045790 Ga0207644_100457902 306
579 3300025944 Ga0207661_10002496 Ga0207661_100024968 306
580 3300025949 Ga0207667_10018061 Ga0207667_100180616 306
581 3300025960 Ga0207651_10338732 Ga0207651_103387321 306
582 3300026041 Ga0207639_10185542 Ga0207639_101855423 306
583 3300026067 Ga0207678_10055777 Ga0207678_100557772 306
584 3300027296 Ga0209389_1000001 Ga0209389_1000001205 306
585 3300027296 Ga0209389_1000134 Ga0209389_10001346 306
586 3300027357 Ga0209589_1000033 Ga0209589_100003368 306
587 3300027361 Ga0209489_100040 Ga0209489_10004082 306
588 3300028563 Ga0265319_1014589 Ga0265319_10145894 306
589 3300035111 Ga0373923_0006563 Ga0373923_0006563_1627_2577 306
590 3300035116 Ga0373945_0031487 Ga0373945_0031487_610_1560 306
591 3300035170 Ga0373943_0008120 Ga0373943_0008120_1824_2774 306
592 3300035171 Ga0373946_0003292 Ga0373946_0003292_4411_5361 306
593 3300035692 Ga0373935_0014513 Ga0373935_0014513_603_1553 306
594 3300035695 Ga0373927_0028965 Ga0373927_0028965_1212_2162 306
595 3300035695 Ga0373927_0033452 Ga0373927_0033452_323_1273 306
596 3300035725 Ga0373947_0012161 Ga0373947_0012161_2285_3235 306
597 3300037418 Ga0395900_0000948 Ga0395900_0000948_24963_25901 306
598 3300037466 Ga0395898_0060604 Ga0395898_0060604_1116_2054 306
599 3300037471 Ga0395905_0004515 Ga0395905_0004515_3161_4105 306
600 3300038443 Ga0395901_0020520 Ga0395901_0020520_4257_5195 306
601 3300039437 Ga0436365_0947948 Ga0436365_0947948_1157_2098 306
602 3300039437 Ga0436365_1382071 Ga0436365_1382071_17578_18510 306
603 3300039453 Ga0436362_1193065 Ga0436362_1193065_2699_3649 306
604 3300041460 Ga0451802_2171387 Ga0451802_2171387_268_1212 306
605 3300044658 Ga0466972_0001899 Ga0466972_0001899_4280_5218 306
606 3300044658 Ga0466972_0010445 Ga0466972_0010445_2512_3456 306
607 3300044735 Ga0466968_0033968 Ga0466968_0033968_53_997 306
608 3300044901 Ga0466960_0088853 Ga0466960_0088853_88_1032 306
609 3300045976 Ga0466967_0398633 Ga0466967_0398633_346_1290 306
610 3300046454 Ga0495592_0016464 Ga0495592_0016464_4105_5055 306
611 3300046459 Ga0495629_0042588 Ga0495629_0042588_1030_1980 306
612 3300046472 Ga0495580_0004514 Ga0495580_0004514_1851_2801 306
613 3300046475 Ga0495639_0004971 Ga0495639_0004971_1995_2945 306
614 3300046477 Ga0495664_0019517 Ga0495664_0019517_158_1108 306
615 3300046511 Ga0495608_0148244 Ga0495608_0148244_263_1213 306
616 3300046516 Ga0495628_0065041 Ga0495628_0065041_107_1057 306
617 3300046517 Ga0495630_0123739 Ga0495630_0123739_723_1673 306
618 3300046533 Ga0495640_0029778 Ga0495640_0029778_118_1068 306
619 3300046642 Ga0495634_0135855 Ga0495634_0135855_476_1426 306
620 3300046680 Ga0495646_0015182 Ga0495646_0015182_1127_2077 306
621 3300046690 Ga0495624_0034608 Ga0495624_0034608_158_1108 306
622 3300047673 Ga0495593_0043771 Ga0495593_0043771_1084_2034 306
623 3300048908 Ga0496105_0063602 Ga0496105_0063602_564_1508 306
624 3300048912 Ga0496109_0330830 Ga0496109_0330830_476_1420 306
625 3300048915 Ga0496112_0203110 Ga0496112_0203110_206_1150 306
626 3300048916 Ga0496113_0124227 Ga0496113_0124227_309_1253 306
627 3300048923 Ga0496120_0150319 Ga0496120_0150319_12_956 306
628 3300050490 nmdc:mga03n38_23182_c1 nmdc:mga03n38_23182_c1_284_1228 306
629 3300050492 nmdc:mga0yw44_13355_c1 nmdc:mga0yw44_13355_c1_1716_2660 306
630 3300050496 nmdc:mga07m45_140468_c1 nmdc:mga07m45_140468_c1_67_1011 306
631 3300050496 nmdc:mga07m45_77756_c1 nmdc:mga07m45_77756_c1_540_1484 306
632 3300053077 Ga0495601_0112481 Ga0495601_0112481_125_1075 306
633 3300053087 Ga0500643_000125 Ga0500643_000125_59419_60363 306
634 3300053088 Ga0500644_0001722 Ga0500644_0001722_3416_4378 306
635 3300053092 Ga0500583_0045525 Ga0500583_0045525_1032_1976 306
636 3300053103 Ga0500555_000626 Ga0500555_000626_3285_4229 306
637 3300053105 Ga0500557_000040 Ga0500557_000040_43107_44051 306
638 3300053130 Ga0500642_0000118 Ga0500642_0000118_16649_17593 306
639 3300053130 Ga0500642_0017555 Ga0500642_0017555_820_1764 306
640 3300053133 Ga0500655_010216 Ga0500655_010216_577_1521 306
641 3300053153 Ga0500616_0000001 Ga0500616_0000001_1459877_1460839 306
642 3300053153 Ga0500616_0036537 Ga0500616_0036537_1403_2347 306
643 3300053156 Ga0500622_0010928 Ga0500622_0010928_2471_3415 306
644 3300053177 Ga0500636_0061804 Ga0500636_0061804_1181_2125 306
645 3300053730 Ga0500645_035738 Ga0500645_035738_427_1371 306
646 iso_pu_bacteria 2528768022 2528849050 306
647 iso_pu_bacteria 2818991467 2819717643 306
648 iso_pu_bacteria 2824661429 2824668531 306
649 iso_pu_bacteria 2879099564 2879107068 306
650 iso_pu_bacteria 2922368715 2922372478 306
651 iso_pu_bacteria 2929615660 2929620957 306
652 iso_pu_bacteria 2929624759 2929626212 306
653 iso_pu_bacteria 2932784394 2932784909 306
654 iso_pu_bacteria 2932809354 2932809943 306
655 iso_pu_bacteria 2932818245 2932818314 306
656 iso_pu_bacteria 2932828146 2932828746 306
657 iso_pu_bacteria 2933577622 2933583173 306
658 iso_pu_bacteria 2935616580 2935619834 306
659 iso_pu_bacteria 2935638405 2935638816 306
660 iso_pu_bacteria 2935665750 2935666334 306
661 iso_pu_bacteria 2935684952 2935685004 306
662 iso_pu_bacteria 2935694250 2935694700 306
663 iso_pu_bacteria 2935703347 2935703821 306
664 iso_pu_bacteria 2935713505 2935713557 306
665 iso_pu_bacteria 2935722832 2935724177 306
666 iso_pu_bacteria 2935732158 2935733465 306
667 iso_pu_bacteria 2935741537 2935742844 306
668 iso_pu_bacteria 2935750917 2935750969 306
669 iso_pu_bacteria 2935760218 2935760502 306
670 iso_pu_bacteria 2935801545 2935801958 306
671 iso_pu_bacteria 2935810662 2935810727 306
672 iso_pu_bacteria 2935827899 2935828310 306
673 iso_pu_bacteria 2935837841 2935839725 306
674 iso_pu_bacteria 2935855204 2935857851 306
675 iso_pu_bacteria 2935864058 2935868807 306
676 iso_pu_bacteria 2935873716 2935874222 306
677 iso_pu_bacteria 2935992306 2935992853 306
678 iso_pu_bacteria 2936002035 2936002766 306
679 iso_pu_bacteria 2936037263 2936037853 306
680 iso_pu_bacteria 2940556831 2940558228 306
681 iso_pu_bacteria 2941538514 2941540934 306
682 iso_pu_bacteria 8016511872 8016520728 306
683 iso_pu_bacteria 8017057580 8017064855 306
684 iso_pu_bacteria 8019576017 8019584229 306
685 iso_pu_bacteria 8019586578 8019591996 306
686 iso_pu_bacteria 8019597564 8019599295 306
687 iso_pu_bacteria 8019608314 8019609064 306
688 iso_pu_bacteria 8019619141 8019619747 306
689 iso_pu_bacteria 8055742211 8055745180 306
690 3300005327 Ga0070658_10006356 Ga0070658_100063563 307
691 3300005329 Ga0070683_100179425 Ga0070683_1001794253 307
692 3300005338 Ga0068868_100003369 Ga0068868_1000033698 307
693 3300005366 Ga0070659_100035456 Ga0070659_1000354562 307
694 3300005366 Ga0070659_100171629 Ga0070659_1001716291 307
695 3300005367 Ga0070667_100224514 Ga0070667_1002245141 307
696 3300005539 Ga0068853_100568835 Ga0068853_1005688351 307
697 3300005548 Ga0070665_100089220 Ga0070665_1000892205 307
698 3300005563 Ga0068855_100151421 Ga0068855_1001514213 307
699 3300005577 Ga0068857_100183234 Ga0068857_1001832343 307
700 3300005577 Ga0068857_100340982 Ga0068857_1003409822 307
701 3300005616 Ga0068852_100062101 Ga0068852_1000621013 307
702 3300005616 Ga0068852_100154357 Ga0068852_1001543572 307
703 3300005937 Ga0081455_10007949 Ga0081455_100079495 307
704 3300005983 Ga0081540_1005540 Ga0081540_10055403 307
705 3300006163 Ga0070715_10172285 Ga0070715_101722851 307
706 3300006844 Ga0075428_100022167 Ga0075428_1000221672 307
707 3300006846 Ga0075430_100004132 Ga0075430_1000041327 307
708 3300006871 Ga0075434_100001874 Ga0075434_10000187411 307
709 3300006880 Ga0075429_100103107 Ga0075429_1001031073 307
710 3300006942 Ga0099824_1008208 Ga0099824_10082089 307
711 3300009093 Ga0105240_10630473 Ga0105240_106304731 307
712 3300009094 Ga0111539_10019857 Ga0111539_1001985712 307
713 3300009147 Ga0114129_10008567 Ga0114129_1000856714 307
714 3300013297 Ga0157378_10009553 Ga0157378_100095536 307
715 3300013297 Ga0157378_10054478 Ga0157378_100544782 307
716 3300013307 Ga0157372_10366476 Ga0157372_103664762 307
717 3300015261 Ga0182006_1090949 Ga0182006_10909492 307
718 3300021377 Ga0213874_10003010 Ga0213874_100030104 307
719 3300025909 Ga0207705_10022855 Ga0207705_100228552 307
720 3300025909 Ga0207705_10037077 Ga0207705_100370773 307
721 3300025912 Ga0207707_10287256 Ga0207707_102872561 307
722 3300025914 Ga0207671_10132031 Ga0207671_101320313 307
723 3300025916 Ga0207663_10294988 Ga0207663_102949882 307
724 3300025917 Ga0207660_10044712 Ga0207660_100447121 307
725 3300025919 Ga0207657_10041142 Ga0207657_100411424 307
726 3300025924 Ga0207694_10058318 Ga0207694_100583183 307
727 3300025929 Ga0207664_10043388 Ga0207664_100433885 307
728 3300025929 Ga0207664_10377598 Ga0207664_103775981 307
729 3300025932 Ga0207690_10089000 Ga0207690_100890003 307
730 3300025944 Ga0207661_10149598 Ga0207661_101495983 307
731 3300025986 Ga0207658_10137296 Ga0207658_101372962 307
732 3300026023 Ga0207677_10028736 Ga0207677_100287362 307
733 3300026116 Ga0207674_10434963 Ga0207674_104349632 307
734 3300026142 Ga0207698_10070805 Ga0207698_100708053 307
735 3300026142 Ga0207698_10247337 Ga0207698_102473372 307
736 3300027357 Ga0209589_1000014 Ga0209589_1000014135 307
737 3300027361 Ga0209489_100014 Ga0209489_100014135 307
738 3300027363 Ga0209700_100024 Ga0209700_100024135 307
739 3300027907 Ga0207428_10000141 Ga0207428_1000014111 307
740 3300028379 Ga0268266_10070883 Ga0268266_100708832 307
741 3300028577 Ga0265318_10076934 Ga0265318_100769342 307
742 3300031238 Ga0265332_10001857 Ga0265332_100018579 307
743 3300031241 Ga0265325_10010015 Ga0265325_100100154 307
744 3300031242 Ga0265329_10007587 Ga0265329_100075873 307
745 3300031247 Ga0265340_10006014 Ga0265340_100060143 307
746 3300031247 Ga0265340_10080349 Ga0265340_100803492 307
747 3300031249 Ga0265339_10003091 Ga0265339_100030912 307
748 3300031249 Ga0265339_10005140 Ga0265339_100051407 307
749 3300031250 Ga0265331_10007501 Ga0265331_100075016 307
750 3300031344 Ga0265316_10249737 Ga0265316_102497372 307
751 3300031595 Ga0265313_10008687 Ga0265313_100086876 307
752 3300031712 Ga0265342_10000092 Ga0265342_1000009278 307
753 3300031712 Ga0265342_10000417 Ga0265342_1000041721 307
754 3300037853 Ga0436364_0231907 Ga0436364_0231907_1449_2384 307
755 3300039437 Ga0436365_1308689 Ga0436365_1308689_621_1568 307
756 3300039450 Ga0436363_0362302 Ga0436363_0362302_1937_2893 307
757 3300046500 Ga0495596_0047198 Ga0495596_0047198_228_1166 307
758 3300046529 Ga0495652_0080346 Ga0495652_0080346_1376_2305 307
759 3300049581 Ga0501047_0047317 Ga0501047_0047317_2243_3181 307
760 3300049823 Ga0501044_0098289 Ga0501044_0098289_1454_2392 307
761 3300050492 nmdc:mga0yw44_71559_c1 nmdc:mga0yw44_71559_c1_1111_2049 307
762 3300050496 nmdc:mga07m45_262798_c1 nmdc:mga07m45_262798_c1_11_949 307
763 3300050509 nmdc:mga0qj67_19636_c1 nmdc:mga0qj67_19636_c1_4051_5109 307
764 3300050510 nmdc:mga06r32_9316_c1 nmdc:mga06r32_9316_c1_1705_2763 307
765 3300050511 nmdc:mga08y16_187406_c1 nmdc:mga08y16_187406_c1_904_1962 307
766 3300050512 nmdc:mga0n895_1857_c1 nmdc:mga0n895_1857_c1_2954_4012 307
767 3300050513 nmdc:mga0rr50_61233_c1 nmdc:mga0rr50_61233_c1_1289_2347 307
768 iso_pu_bacteria 2507262055 2507507724 307
769 iso_pu_bacteria 2508501009 2508541844 307
770 iso_pu_bacteria 2508501042 2508692613 307
771 iso_pu_bacteria 2508501128 2509149353 307
772 iso_pu_bacteria 2511231028 2511397122 307
773 iso_pu_bacteria 2513237092 2513622990 307
774 iso_pu_bacteria 2513237094 2513642911 307
775 iso_pu_bacteria 2513237095 2513647451 307
776 iso_pu_bacteria 2513237104 2513719427 307
777 iso_pu_bacteria 2513237139 2513878456 307
778 iso_pu_bacteria 2513237141 2513891310 307
779 iso_pu_bacteria 2513237161 2514009496 307
780 iso_pu_bacteria 2515154112 2515626020 307
781 iso_pu_bacteria 2517093001 2517104091 307
782 iso_pu_bacteria 2524023205 2524436347 307
783 iso_pu_bacteria 2617270735 2617346735 307
784 iso_pu_bacteria 2744054633 2745080699 307
785 iso_pu_bacteria 2791355196 2793064417 307
786 iso_pu_bacteria 2802429603 2805919120 307
787 iso_pu_bacteria 2816332527 2818236488 307
788 iso_pu_bacteria 2824600985 2824607106 307
789 iso_pu_bacteria 2824609381 2824612988 307
790 iso_pu_bacteria 2824653114 2824660197 307
791 iso_pu_bacteria 2824671348 2824674828 307
792 iso_pu_bacteria 2824679649 2824682955 307
793 iso_pu_bacteria 2824687955 2824693488 307
794 iso_pu_bacteria 2824696289 2824701981 307
795 iso_pu_bacteria 2824704595 2824712521 307
796 iso_pu_bacteria 2824753945 2824758485 307
797 iso_pu_bacteria 2824763712 2824770069 307
798 iso_pu_bacteria 2824773399 2824775192 307
799 iso_pu_bacteria 2838122688 2838128864 307
800 iso_pu_bacteria 2841941048 2841944990 307
801 iso_pu_bacteria 2841949485 2841953413 307
802 iso_pu_bacteria 2841957949 2841959759 307
803 iso_pu_bacteria 2841966195 2841972116 307
804 iso_pu_bacteria 2841974524 2841978138 307
805 iso_pu_bacteria 2841983080 2841986239 307
806 iso_pu_bacteria 2842038055 2842040588 307
807 iso_pu_bacteria 2842045827 2842046466 307
808 iso_pu_bacteria 2844315083 2844319953 307
809 iso_pu_bacteria 2847930680 2847937265 307
810 iso_pu_bacteria 2847939898 2847947675 307
811 iso_pu_bacteria 2849076700 2849078469 307
812 iso_pu_bacteria 2874590934 2874598832 307
813 iso_pu_bacteria 2874612657 2874614640 307
814 iso_pu_bacteria 2874620515 2874628015 307
815 iso_pu_bacteria 2874628541 2874635094 307
816 iso_pu_bacteria 2874645413 2874652288 307
817 iso_pu_bacteria 2876761206 2876766156 307
818 iso_pu_bacteria 2876771140 2876778871 307
819 iso_pu_bacteria 2876818435 2876824234 307
820 iso_pu_bacteria 2879074833 2879082664 307
821 iso_pu_bacteria 2879083081 2879086570 307
822 iso_pu_bacteria 2879127579 2879132176 307
823 iso_pu_bacteria 2879142872 2879148297 307
824 iso_pu_bacteria 2881364244 2881371524 307
825 iso_pu_bacteria 2881665667 2881673709 307
826 iso_pu_bacteria 2885409591 2885414640 307
827 iso_pu_bacteria 2888378607 2888385388 307
828 iso_pu_bacteria 2888388044 2888392861 307
829 iso_pu_bacteria 2888419890 2888425522 307
830 iso_pu_bacteria 2903727486 2903730374 307
831 iso_pu_bacteria 2904666416 2904674367 307
832 iso_pu_bacteria 2904711408 2904712048 307
833 iso_pu_bacteria 2906602504 2906604693 307
834 iso_pu_bacteria 2906626472 2906627407 307
835 iso_pu_bacteria 2906643746 2906643890 307
836 iso_pu_bacteria 2922393267 2922397131 307
837 iso_pu_bacteria 2932794094 2932795217 307
838 iso_pu_bacteria 2932801729 2932805747 307
839 iso_pu_bacteria 2935608549 2935609765 307
840 iso_pu_bacteria 2935648319 2935654185 307
841 iso_pu_bacteria 2935656913 2935663122 307
842 iso_pu_bacteria 2935675223 2935676620 307
843 iso_pu_bacteria 2935769743 2935772006 307
844 iso_pu_bacteria 2935777560 2935784276 307
845 iso_pu_bacteria 2935785616 2935787606 307
846 iso_pu_bacteria 2935793552 2935796238 307
847 iso_pu_bacteria 2935819856 2935822927 307
848 iso_pu_bacteria 2935847175 2935848509 307
849 iso_pu_bacteria 2935883170 2935883883 307
850 iso_pu_bacteria 2935908558 2935909686 307
851 iso_pu_bacteria 2935916978 2935917410 307
852 iso_pu_bacteria 2935926038 2935927167 307
853 iso_pu_bacteria 2935934488 2935936989 307
854 iso_pu_bacteria 2935942939 2935944708 307
855 iso_pu_bacteria 2935951376 2935953145 307
856 iso_pu_bacteria 2935959822 2935966657 307
857 iso_pu_bacteria 2935967501 2935969985 307
858 iso_pu_bacteria 2935975950 2935980270 307
859 iso_pu_bacteria 2935984226 2935986968 307
860 iso_pu_bacteria 2936011229 2936017278 307
861 iso_pu_bacteria 2936019824 2936025780 307
862 iso_pu_bacteria 2936028420 2936034565 307
863 iso_pu_bacteria 2936046547 2936052622 307
864 iso_pu_bacteria 2936055302 2936062095 307
865 iso_pu_bacteria 2941531003 2941531138 307
866 iso_pu_bacteria 3005594810 3005600237 307
867 iso_pu_bacteria 3005710791 3005715745 307
868 iso_pu_bacteria 3005718088 3005723093 307
869 iso_pu_bacteria 8016522445 8016528761 307
870 iso_pu_bacteria 8016530956 8016533940 307
871 iso_pu_bacteria 8016539877 8016547168 307
872 iso_pu_bacteria 8016548790 8016554960 307
873 iso_pu_bacteria 8016566248 8016572280 307
874 iso_pu_bacteria 8016583857 8016594245 307
875 iso_pu_bacteria 8016595262 8016601078 307
876 iso_pu_bacteria 8016603502 8016609373 307
877 iso_pu_bacteria 8016622563 8016625684 307
878 iso_pu_bacteria 8016630954 8016639246 307
879 iso_pu_bacteria 8019530166 8019533713 307
880 iso_pu_bacteria 8019547302 8019552762 307
881 iso_pu_bacteria 8019629233 8019633366 307
882 iso_pu_bacteria 8019638758 8019646534 307
883 iso_pu_bacteria 8019648815 8019649286 307
884 iso_pu_bacteria 8019678201 8019685413 307
885 iso_pu_bacteria 8019687851 8019691000 307
886 iso_pu_bacteria 8056967851 8056975142 307
887 3300005337 Ga0070682_100192145 Ga0070682_1001921452 308
888 3300005435 Ga0070714_100168229 Ga0070714_1001682293 308
889 3300013297 Ga0157378_10043596 Ga0157378_100435963 308
890 3300026088 Ga0207641_10102640 Ga0207641_101026402 308
891 3300028556 Ga0265337_1012788 Ga0265337_10127883 308
892 3300028558 Ga0265326_10003400 Ga0265326_100034004 308
893 3300028573 Ga0265334_10004112 Ga0265334_100041123 308
894 3300028653 Ga0265323_10004703 Ga0265323_100047032 308
895 3300028666 Ga0265336_10001567 Ga0265336_100015673 308
896 3300028800 Ga0265338_10000034 Ga0265338_10000034136 308
897 3300029957 Ga0265324_10006370 Ga0265324_100063702 308
898 3300031711 Ga0265314_10111227 Ga0265314_101112273 308
899 3300046473 Ga0495582_0045575 Ga0495582_0045575_1154_2095 308
900 3300047320 Ga0495672_0045473 Ga0495672_0045473_117_1058 308
901 3300048924 Ga0496121_0000230 Ga0496121_0000230_117156_118097 308
902 3300053119 Ga0500595_000407 Ga0500595_000407_198_1139 308
903 iso_pu_bacteria 2728368998 2728750104 308
904 iso_pu_bacteria 2922361189 2922368629 308
905 3300006038 Ga0075365_10004575 Ga0075365_100045757 309
906 3300006175 Ga0070712_100333482 Ga0070712_1003334822 309
907 3300009093 Ga0105240_10074116 Ga0105240_100741162 309
908 3300009098 Ga0105245_10583035 Ga0105245_105830351 309
909 3300009147 Ga0114129_10042174 Ga0114129_100421746 309
910 3300010159 Ga0099796_10032738 Ga0099796_100327381 309
911 3300021388 Ga0213875_10037778 Ga0213875_100377782 309
912 3300025912 Ga0207707_10048060 Ga0207707_100480604 309
913 3300025913 Ga0207695_10054668 Ga0207695_100546682 309
914 3300025915 Ga0207693_10223237 Ga0207693_102232372 309
915 3300025944 Ga0207661_10002064 Ga0207661_100020647 309
916 3300026118 Ga0207675_100028015 Ga0207675_1000280157 309
917 3300026121 Ga0207683_10409288 Ga0207683_104092882 309
918 3300027512 Ga0209179_1004953 Ga0209179_10049533 309
919 3300028800 Ga0265338_10011933 Ga0265338_100119337 309
920 3300031241 Ga0265325_10011514 Ga0265325_100115142 309
921 3300031241 Ga0265325_10022776 Ga0265325_100227762 309
922 3300031249 Ga0265339_10000205 Ga0265339_1000020536 309
923 3300031250 Ga0265331_10024905 Ga0265331_100249052 309
924 3300031595 Ga0265313_10000353 Ga0265313_1000035336 309
925 3300031711 Ga0265314_10003716 Ga0265314_1000371615 309
926 3300035086 Ga0373934_0017217 Ga0373934_0017217_1744_2679 309
927 3300035695 Ga0373927_0061505 Ga0373927_0061505_422_1357 309
928 3300035724 Ga0373933_0006291 Ga0373933_0006291_1600_2535 309
929 3300036401 Ga0373937_0035287 Ga0373937_0035287_543_1478 309
930 3300037466 Ga0395898_0078195 Ga0395898_0078195_776_1714 309
931 3300037853 Ga0436364_1517684 Ga0436364_1517684_1882_2820 309
932 3300038443 Ga0395901_0239807 Ga0395901_0239807_733_1671 309
933 3300045049 Ga0466959_0368468 Ga0466959_0368468_14_958 309
934 3300046459 Ga0495629_0001610 Ga0495629_0001610_14458_15468 309
935 3300046462 Ga0495651_0001287 Ga0495651_0001287_10108_11043 309
936 3300046463 Ga0495653_0002060 Ga0495653_0002060_4623_5633 309
937 3300046477 Ga0495664_0013015 Ga0495664_0013015_59_994 309
938 3300046511 Ga0495608_0001118 Ga0495608_0001118_5869_6879 309
939 3300046526 Ga0495666_0107946 Ga0495666_0107946_278_1288 309
940 3300046533 Ga0495640_0014016 Ga0495640_0014016_270_1280 309
941 3300046533 Ga0495640_0090022 Ga0495640_0090022_159_1094 309
942 3300046536 Ga0495587_0000663 Ga0495587_0000663_15708_16643 309
943 3300046543 Ga0495645_0218043 Ga0495645_0218043_35_979 309
944 3300046559 Ga0495667_0001079 Ga0495667_0001079_5529_6464 309
945 3300046642 Ga0495634_0028186 Ga0495634_0028186_2586_3596 309
946 3300046663 Ga0495635_0001990 Ga0495635_0001990_4655_5590 309
947 3300046675 Ga0495657_0010180 Ga0495657_0010180_1346_2356 309
948 3300046679 Ga0495623_0012766 Ga0495623_0012766_636_1571 309
949 3300046680 Ga0495646_0008739 Ga0495646_0008739_4994_6004 309
950 3300046689 Ga0495613_0063093 Ga0495613_0063093_1729_2664 309
951 3300046809 Ga0495600_0007773 Ga0495600_0007773_273_1208 309
952 3300047317 Ga0495604_0000907 Ga0495604_0000907_15738_16748 309
953 3300047319 Ga0495674_0018702 Ga0495674_0018702_4695_5630 309
954 3300047321 Ga0495676_0063501 Ga0495676_0063501_272_1207 309
955 3300047322 Ga0495680_0005555 Ga0495680_0005555_5395_6405 309
956 3300047322 Ga0495680_0017386 Ga0495680_0017386_2729_3664 309
957 3300047444 Ga0495675_0105156 Ga0495675_0105156_718_1653 309
958 3300047471 Ga0495684_0007107 Ga0495684_0007107_7212_8222 309
959 3300048088 Ga0495602_0005125 Ga0495602_0005125_9661_10596 309
960 3300048903 Ga0496100_0165525 Ga0496100_0165525_410_1348 309
961 3300048914 Ga0496111_0083525 Ga0496111_0083525_646_1584 309
962 3300048915 Ga0496112_0000017 Ga0496112_0000017_93816_94751 309
963 3300048928 Ga0496125_0000040 Ga0496125_0000040_69968_70912 309
964 3300048928 Ga0496125_0003264 Ga0496125_0003264_5769_6713 309
965 3300048929 Ga0496126_0091048 Ga0496126_0091048_1231_2322 309
966 3300048929 Ga0496126_0113251 Ga0496126_0113251_62_1006 309
967 3300049586 Ga0501070_0011105 Ga0501070_0011105_6126_7061 309
968 3300049593 Ga0501077_0041562 Ga0501077_0041562_1087_2025 309
969 3300049742 Ga0501080_0117963 Ga0501080_0117963_842_1777 309
970 3300050492 nmdc:mga0yw44_2368_c1 nmdc:mga0yw44_2368_c1_1402_2343 309
971 3300050507 nmdc:mga05p37_15774_c1 nmdc:mga05p37_15774_c1_3186_4124 309
972 3300053077 Ga0495601_0003107 Ga0495601_0003107_5761_6696 309
973 3300053077 Ga0495601_0006299 Ga0495601_0006299_1380_2390 309
974 3300053078 Ga0495612_0001997 Ga0495612_0001997_6407_7342 309
975 3300053084 Ga0495595_0000216 Ga0495595_0000216_15751_16686 309
976 3300053084 Ga0495595_0000883 Ga0495595_0000883_2273_3208 309
977 3300053085 Ga0495619_0000897 Ga0495619_0000897_10020_10955 309
978 3300053085 Ga0495619_0001136 Ga0495619_0001136_10970_11980 309
979 3300053102 Ga0500554_002627 Ga0500554_002627_1519_2463 309
980 3300053150 Ga0500603_000394 Ga0500603_000394_4364_5308 309
981 3300053178 Ga0500637_0007251 Ga0500637_0007251_2996_3940 309
982 iso_pu_bacteria 2513237098 2513677416 309
983 iso_pu_bacteria 2524023210 2524470443 309
984 iso_pu_bacteria 2602042107 2603860958 309
985 iso_pu_bacteria 2885383462 2885392472 309
986 iso_pu_bacteria 2893066018 2893069111 309
987 iso_pu_bacteria 2903768456 2903769664 309
988 iso_pu_bacteria 2919073203 2919079342 309
989 iso_pu_bacteria 8006926726 8006926816 309
990 iso_pu_bacteria 8056681323 8056684877 309
991 iso_pu_bacteria 8056689827 8056693117 309
992 3300005347 Ga0070668_100048502 Ga0070668_1000485023 310
993 3300005435 Ga0070714_100009105 Ga0070714_1000091057 310
994 3300005436 Ga0070713_100019667 Ga0070713_1000196674 310
995 3300005563 Ga0068855_100492094 Ga0068855_1004920941 310
996 3300005564 Ga0070664_100402500 Ga0070664_1004025001 310
997 3300005843 Ga0068860_100000081 Ga0068860_100000081133 310
998 3300006038 Ga0075365_10021525 Ga0075365_100215253 310
999 3300006931 Ga0097620_100348056 Ga0097620_1003480562 310
1000 3300009101 Ga0105247_10059860 Ga0105247_100598601 310
1001 3300009545 Ga0105237_10090951 Ga0105237_100909512 310
1002 3300013105 Ga0157369_10007421 Ga0157369_100074215 310
1003 3300013306 Ga0163162_10137069 Ga0163162_101370694 310
1004 3300013307 Ga0157372_10065655 Ga0157372_100656552 310
1005 3300020081 Ga0206354_10772337 Ga0206354_107723371 310
1006 3300025904 Ga0207647_10099068 Ga0207647_100990682 310
1007 3300025906 Ga0207699_10022022 Ga0207699_100220224 310
1008 3300025913 Ga0207695_10025044 Ga0207695_100250442 310
1009 3300025924 Ga0207694_10164711 Ga0207694_101647113 310
1010 3300025928 Ga0207700_10003970 Ga0207700_100039702 310
1011 3300025949 Ga0207667_10076602 Ga0207667_100766022 310
1012 3300026067 Ga0207678_10177795 Ga0207678_101777952 310
1013 3300026078 Ga0207702_10221582 Ga0207702_102215822 310
1014 3300026095 Ga0207676_10320361 Ga0207676_103203612 310
1015 3300028379 Ga0268266_10054100 Ga0268266_100541004 310
1016 3300028381 Ga0268264_10000048 Ga0268264_10000048125 310
1017 3300031616 Ga0307508_10000032 Ga0307508_10000032113 310
1018 3300031730 Ga0307516_10024278 Ga0307516_100242785 310
1019 3300033179 Ga0307507_10048107 Ga0307507_100481074 310
1020 3300035692 Ga0373935_0007483 Ga0373935_0007483_1890_2837 310
1021 3300035695 Ga0373927_0018115 Ga0373927_0018115_451_1398 310
1022 3300035724 Ga0373933_0281862 Ga0373933_0281862_79_1020 310
1023 3300037068 Ga0373925_0040305 Ga0373925_0040305_1493_2440 310
1024 3300037466 Ga0395898_0070357 Ga0395898_0070357_1622_2566 310
1025 3300037853 Ga0436364_0158121 Ga0436364_0158121_775_1719 310
1026 3300038443 Ga0395901_0109506 Ga0395901_0109506_550_1494 310
1027 3300038443 Ga0395901_0528257 Ga0395901_0528257_39_983 310
1028 3300039450 Ga0436363_0276330 Ga0436363_0276330_48_992 310
1029 3300041505 Ga0451849_0905512 Ga0451849_0905512_72_1019 310
1030 3300046455 Ga0495603_0179421 Ga0495603_0179421_215_1156 310
1031 3300046507 Ga0495606_0164021 Ga0495606_0164021_33_974 310
1032 3300046512 Ga0495610_0132880 Ga0495610_0132880_81_1022 310
1033 3300046524 Ga0495648_0062681 Ga0495648_0062681_1117_2058 310
1034 3300046616 Ga0495668_0055283 Ga0495668_0055283_1069_2010 310
1035 3300046660 Ga0495625_0100157 Ga0495625_0100157_314_1255 310
1036 3300046674 Ga0495588_0007010 Ga0495588_0007010_572_1513 310
1037 3300046679 Ga0495623_0181432 Ga0495623_0181432_144_1085 310
1038 3300047323 Ga0495683_0041815 Ga0495683_0041815_914_1855 310
1039 3300048903 Ga0496100_0022125 Ga0496100_0022125_2393_3334 310
1040 3300048904 Ga0496101_0066146 Ga0496101_0066146_680_1621 310
1041 3300048906 Ga0496103_0137969 Ga0496103_0137969_275_1210 310
1042 3300048907 Ga0496104_0091277 Ga0496104_0091277_1238_2179 310
1043 3300048908 Ga0496105_0071435 Ga0496105_0071435_867_1808 310
1044 3300048909 Ga0496106_0000240 Ga0496106_0000240_27685_28632 310
1045 3300048914 Ga0496111_0256964 Ga0496111_0256964_206_1147 310
1046 3300048915 Ga0496112_0031464 Ga0496112_0031464_2340_3299 310
1047 3300048919 Ga0496116_0049951 Ga0496116_0049951_1247_2188 310
1048 3300048924 Ga0496121_0004398 Ga0496121_0004398_15264_16211 310
1049 3300048924 Ga0496121_0009774 Ga0496121_0009774_9974_10915 310
1050 3300048924 Ga0496121_0077850 Ga0496121_0077850_1653_2594 310
1051 3300048927 Ga0496124_0010351 Ga0496124_0010351_1195_2142 310
1052 3300048929 Ga0496126_0087675 Ga0496126_0087675_457_1419 310
1053 3300048929 Ga0496126_0260151 Ga0496126_0260151_345_1286 310
1054 3300049573 Ga0501037_0039808 Ga0501037_0039808_1420_2364 310
1055 3300049822 Ga0501035_0440342 Ga0501035_0440342_68_1012 310
1056 3300050492 nmdc:mga0yw44_11581_c1 nmdc:mga0yw44_11581_c1_796_1737 310
1057 3300053080 Ga0500635_0016196 Ga0500635_0016196_1094_2041 310
1058 3300053080 Ga0500635_0038984 Ga0500635_0038984_69_1010 310
1059 3300053091 Ga0500647_0053962 Ga0500647_0053962_550_1497 310
1060 3300053094 Ga0500566_0066768 Ga0500566_0066768_516_1463 310
1061 3300053150 Ga0500603_021441 Ga0500603_021441_519_1466 310
1062 3300053162 Ga0500638_081650 Ga0500638_081650_445_1392 310
1063 iso_pu_bacteria 2513237096 2513654030 310
1064 iso_pu_bacteria 2513237137 2513856782 310
1065 iso_pu_bacteria 2513237145 2513918370 310
1066 iso_pu_bacteria 2517572143 2517891396 310
1067 iso_pu_bacteria 2524023228 2524538418 310
1068 iso_pu_bacteria 2667528175 2671118824 310
1069 iso_pu_bacteria 2791355197 2793066766 310
1070 iso_pu_bacteria 2885374607 2885375148 310
1071 iso_pu_bacteria 2904690495 2904691259 310
1072 iso_pu_bacteria 2904699407 2904704938 310
1073 iso_pu_bacteria 2906610324 2906616578 310
1074 iso_pu_bacteria 2906635258 2906635355 310
1075 iso_pu_bacteria 2906660503 2906666901 310
1076 iso_pu_bacteria 2908739725 2908741746 310
1077 iso_pu_bacteria 2908756301 2908759100 310
1078 iso_pu_bacteria 2922425934 2922431398 310
1079 iso_pu_bacteria 2935630451 2935633994 310
1080 iso_pu_bacteria 2941507105 2941510703 310
1081 iso_pu_bacteria 2941515067 2941518087 310
1082 iso_pu_bacteria 2941523033 2941527042 310
1083 iso_pu_bacteria 3005474847 3005481195 310
1084 iso_pu_bacteria 8019555841 8019565401 310
1085 iso_pu_bacteria 8019565922 8019575495 310
1086 3300003215 JGI25153J46596_10003306 JGI25153J46596_100033066 311
1087 3300003775 Ga0055524_1038225 Ga0055524_10382251 311
1088 3300003794 Ga0055531_10007248 Ga0055531_100072485 311
1089 3300005262 Ga0065165_1001751 Ga0065165_100175114 311
1090 3300005339 Ga0070660_100119547 Ga0070660_1001195472 311
1091 3300005355 Ga0070671_100001331 Ga0070671_1000013316 311
1092 3300005364 Ga0070673_100001163 Ga0070673_1000011632 311
1093 3300005434 Ga0070709_10285123 Ga0070709_102851231 311
1094 3300005435 Ga0070714_100074625 Ga0070714_1000746254 311
1095 3300005436 Ga0070713_100437403 Ga0070713_1004374032 311
1096 3300005439 Ga0070711_100031068 Ga0070711_1000310681 311
1097 3300005439 Ga0070711_100342022 Ga0070711_1003420221 311
1098 3300005467 Ga0070706_100504310 Ga0070706_1005043101 311
1099 3300005563 Ga0068855_100109595 Ga0068855_1001095954 311
1100 3300005563 Ga0068855_100514364 Ga0068855_1005143642 311
1101 3300005614 Ga0068856_100000061 Ga0068856_10000006199 311
1102 3300005614 Ga0068856_100164062 Ga0068856_1001640622 311
1103 3300005616 Ga0068852_100057914 Ga0068852_1000579143 311
1104 3300005844 Ga0068862_100320378 Ga0068862_1003203782 311
1105 3300006028 Ga0070717_10000208 Ga0070717_100002087 311
1106 3300006048 Ga0075363_100133035 Ga0075363_1001330352 311
1107 3300006173 Ga0070716_100099943 Ga0070716_1000999432 311
1108 3300006186 Ga0075369_10022794 Ga0075369_100227942 311
1109 3300006871 Ga0075434_100104565 Ga0075434_1001045652 311
1110 3300006871 Ga0075434_100170865 Ga0075434_1001708651 311
1111 3300006942 Ga0099824_1029023 Ga0099824_10290232 311
1112 3300007076 Ga0075435_100075883 Ga0075435_1000758833 311
1113 3300007788 Ga0099795_10044907 Ga0099795_100449071 311
1114 3300009098 Ga0105245_10061269 Ga0105245_100612693 311
1115 3300010375 Ga0105239_10028563 Ga0105239_100285633 311
1116 3300013105 Ga0157369_10120105 Ga0157369_101201054 311
1117 3300013308 Ga0157375_10381399 Ga0157375_103813992 311
1118 3300014969 Ga0157376_10275313 Ga0157376_102753132 311
1119 3300025245 Ga0207425_1030064 Ga0207425_10300641 311
1120 3300025253 Ga0209677_100210 Ga0209677_10021021 311
1121 3300025253 Ga0209677_105160 Ga0209677_1051606 311
1122 3300025261 Ga0209233_1001530 Ga0209233_10015303 311
1123 3300025272 Ga0209455_1008006 Ga0209455_10080063 311
1124 3300025295 Ga0209564_1009757 Ga0209564_10097574 311
1125 3300025297 Ga0209758_1000011 Ga0209758_1000011248 311
1126 3300025297 Ga0209758_1001880 Ga0209758_100188011 311
1127 3300025297 Ga0209758_1013435 Ga0209758_10134353 311
1128 3300025299 Ga0209256_1006181 Ga0209256_10061817 311
1129 3300025304 Ga0209257_1002014 Ga0209257_100201410 311
1130 3300025900 Ga0207710_10086027 Ga0207710_100860272 311
1131 3300025910 Ga0207684_10168751 Ga0207684_101687512 311
1132 3300025911 Ga0207654_10164089 Ga0207654_101640891 311
1133 3300025915 Ga0207693_10013341 Ga0207693_100133416 311
1134 3300025916 Ga0207663_10033274 Ga0207663_100332744 311
1135 3300025916 Ga0207663_10200181 Ga0207663_102001812 311
1136 3300025919 Ga0207657_10138605 Ga0207657_101386053 311
1137 3300025925 Ga0207650_10019497 Ga0207650_100194974 311
1138 3300025927 Ga0207687_10163940 Ga0207687_101639401 311
1139 3300025928 Ga0207700_10002188 Ga0207700_100021887 311
1140 3300025928 Ga0207700_10022181 Ga0207700_100221813 311
1141 3300025931 Ga0207644_10000779 Ga0207644_1000077911 311
1142 3300025932 Ga0207690_10305323 Ga0207690_103053231 311
1143 3300025936 Ga0207670_10021834 Ga0207670_100218344 311
1144 3300025941 Ga0207711_10290566 Ga0207711_102905662 311
1145 3300025944 Ga0207661_10201337 Ga0207661_102013371 311
1146 3300025960 Ga0207651_10008556 Ga0207651_100085562 311
1147 3300026067 Ga0207678_10068174 Ga0207678_100681744 311
1148 3300026078 Ga0207702_10000674 Ga0207702_100006744 311
1149 3300027363 Ga0209700_100007 Ga0209700_100007219 311
1150 3300027671 Ga0209588_1000977 Ga0209588_10009776 311
1151 3300031238 Ga0265332_10046951 Ga0265332_100469512 311
1152 3300031241 Ga0265325_10013213 Ga0265325_100132135 311
1153 3300031711 Ga0265314_10005447 Ga0265314_100054477 311
1154 3300031911 Ga0307412_10199216 Ga0307412_101992162 311
1155 3300033180 Ga0307510_10094526 Ga0307510_100945264 311
1156 3300035086 Ga0373934_0013184 Ga0373934_0013184_233_1177 311
1157 3300035116 Ga0373945_0051348 Ga0373945_0051348_257_1210 311
1158 3300035117 Ga0373953_0094954 Ga0373953_0094954_169_1113 311
1159 3300035118 Ga0373954_0002403 Ga0373954_0002403_2071_3015 311
1160 3300035120 Ga0373957_0004788 Ga0373957_0004788_1132_2076 311
1161 3300035170 Ga0373943_0003753 Ga0373943_0003753_4022_4978 311
1162 3300035172 Ga0373955_0011024 Ga0373955_0011024_1143_2096 311
1163 3300035172 Ga0373955_0014829 Ga0373955_0014829_130_1074 311
1164 3300035172 Ga0373955_0269791 Ga0373955_0269791_36_992 311
1165 3300035692 Ga0373935_0022558 Ga0373935_0022558_635_1591 311
1166 3300035695 Ga0373927_0000121 Ga0373927_0000121_44234_45190 311
1167 3300035724 Ga0373933_0000406 Ga0373933_0000406_21114_22073 311
1168 3300035724 Ga0373933_0016314 Ga0373933_0016314_1038_1982 311
1169 3300035725 Ga0373947_0002018 Ga0373947_0002018_1940_2896 311
1170 3300036401 Ga0373937_0007295 Ga0373937_0007295_5288_6241 311
1171 3300036401 Ga0373937_0015887 Ga0373937_0015887_1090_2046 311
1172 3300036401 Ga0373937_0061008 Ga0373937_0061008_811_1773 311
1173 3300036401 Ga0373937_0068978 Ga0373937_0068978_926_1870 311
1174 3300036401 Ga0373937_0174380 Ga0373937_0174380_392_1345 311
1175 3300037068 Ga0373925_0002194 Ga0373925_0002194_7364_8320 311
1176 3300037418 Ga0395900_0159914 Ga0395900_0159914_84_1028 311
1177 3300037853 Ga0436364_0335801 Ga0436364_0335801_138_1082 311
1178 3300037853 Ga0436364_0806163 Ga0436364_0806163_709_1659 311
1179 3300044656 Ga0466969_0015817 Ga0466969_0015817_899_1843 311
1180 3300044693 Ga0466961_0000050 Ga0466961_0000050_41642_42586 311
1181 3300044706 Ga0466964_0073312 Ga0466964_0073312_395_1339 311
1182 3300044842 Ga0466957_0098530 Ga0466957_0098530_166_1110 311
1183 3300045049 Ga0466959_0005557 Ga0466959_0005557_4108_5052 311
1184 3300046454 Ga0495592_0044107 Ga0495592_0044107_2065_3009 311
1185 3300046454 Ga0495592_0051867 Ga0495592_0051867_1563_2519 311
1186 3300046454 Ga0495592_0079743 Ga0495592_0079743_621_1583 311
1187 3300046455 Ga0495603_0001782 Ga0495603_0001782_4419_5375 311
1188 3300046459 Ga0495629_0000242 Ga0495629_0000242_19349_20305 311
1189 3300046459 Ga0495629_0004164 Ga0495629_0004164_9287_10231 311
1190 3300046459 Ga0495629_0016212 Ga0495629_0016212_94_1038 311
1191 3300046461 Ga0495641_0000994 Ga0495641_0000994_16235_17191 311
1192 3300046462 Ga0495651_0003779 Ga0495651_0003779_10102_11046 311
1193 3300046462 Ga0495651_0052110 Ga0495651_0052110_2090_3052 311
1194 3300046462 Ga0495651_0055504 Ga0495651_0055504_1548_2492 311
1195 3300046463 Ga0495653_0008912 Ga0495653_0008912_7184_8128 311
1196 3300046472 Ga0495580_0009026 Ga0495580_0009026_4428_5384 311
1197 3300046473 Ga0495582_0000268 Ga0495582_0000268_7219_8175 311
1198 3300046475 Ga0495639_0000157 Ga0495639_0000157_7843_8799 311
1199 3300046476 Ga0495662_0007644 Ga0495662_0007644_1902_2858 311
1200 3300046507 Ga0495606_0031897 Ga0495606_0031897_580_1524 311
1201 3300046511 Ga0495608_0017348 Ga0495608_0017348_279_1223 311
1202 3300046514 Ga0495618_0044691 Ga0495618_0044691_1625_2587 311
1203 3300046516 Ga0495628_0042849 Ga0495628_0042849_2247_3203 311
1204 3300046516 Ga0495628_0130860 Ga0495628_0130860_111_1073 311
1205 3300046516 Ga0495628_0302491 Ga0495628_0302491_114_1058 311
1206 3300046517 Ga0495630_0001544 Ga0495630_0001544_12412_13368 311
1207 3300046524 Ga0495648_0012980 Ga0495648_0012980_2793_3743 311
1208 3300046529 Ga0495652_0023483 Ga0495652_0023483_2299_3243 311
1209 3300046529 Ga0495652_0130580 Ga0495652_0130580_457_1401 311
1210 3300046529 Ga0495652_0199919 Ga0495652_0199919_367_1329 311
1211 3300046531 Ga0495665_0000656 Ga0495665_0000656_14607_15563 311
1212 3300046533 Ga0495640_0031288 Ga0495640_0031288_2294_3238 311
1213 3300046533 Ga0495640_0150375 Ga0495640_0150375_410_1372 311
1214 3300046536 Ga0495587_0033298 Ga0495587_0033298_1616_2560 311
1215 3300046536 Ga0495587_0085585 Ga0495587_0085585_410_1372 311
1216 3300046536 Ga0495587_0089431 Ga0495587_0089431_754_1704 311
1217 3300046543 Ga0495645_0031198 Ga0495645_0031198_532_1476 311
1218 3300046543 Ga0495645_0032568 Ga0495645_0032568_2647_3591 311
1219 3300046557 Ga0495622_0002769 Ga0495622_0002769_3227_4183 311
1220 3300046559 Ga0495667_0023276 Ga0495667_0023276_2234_3178 311
1221 3300046559 Ga0495667_0034221 Ga0495667_0034221_410_1372 311
1222 3300046559 Ga0495667_0096335 Ga0495667_0096335_164_1108 311
1223 3300046615 Ga0495656_0106485 Ga0495656_0106485_342_1292 311
1224 3300046642 Ga0495634_0000206 Ga0495634_0000206_21692_22648 311
1225 3300046642 Ga0495634_0062601 Ga0495634_0062601_197_1141 311
1226 3300046663 Ga0495635_0000723 Ga0495635_0000723_14828_15784 311
1227 3300046663 Ga0495635_0001219 Ga0495635_0001219_14039_14983 311
1228 3300046663 Ga0495635_0013355 Ga0495635_0013355_4750_5694 311
1229 3300046674 Ga0495588_0023587 Ga0495588_0023587_1112_2068 311
1230 3300046675 Ga0495657_0008675 Ga0495657_0008675_2802_3746 311
1231 3300046675 Ga0495657_0044184 Ga0495657_0044184_515_1459 311
1232 3300046678 Ga0495599_0044999 Ga0495599_0044999_992_1936 311
1233 3300046678 Ga0495599_0070256 Ga0495599_0070256_916_1878 311
1234 3300046679 Ga0495623_0011265 Ga0495623_0011265_424_1368 311
1235 3300046679 Ga0495623_0029832 Ga0495623_0029832_1913_2875 311
1236 3300046680 Ga0495646_0068838 Ga0495646_0068838_452_1396 311
1237 3300046680 Ga0495646_0070746 Ga0495646_0070746_163_1125 311
1238 3300046680 Ga0495646_0085362 Ga0495646_0085362_323_1267 311
1239 3300046681 Ga0495647_0001229 Ga0495647_0001229_4264_5220 311
1240 3300046683 Ga0495658_0000188 Ga0495658_0000188_22433_23389 311
1241 3300046689 Ga0495613_0013006 Ga0495613_0013006_2645_3601 311
1242 3300046689 Ga0495613_0060722 Ga0495613_0060722_49_993 311
1243 3300046690 Ga0495624_0007942 Ga0495624_0007942_1760_2716 311
1244 3300046690 Ga0495624_0039263 Ga0495624_0039263_228_1172 311
1245 3300046809 Ga0495600_0000483 Ga0495600_0000483_19450_20394 311
1246 3300046809 Ga0495600_0011323 Ga0495600_0011323_1771_2715 311
1247 3300046809 Ga0495600_0203879 Ga0495600_0203879_229_1185 311
1248 3300047315 Ga0495581_0000166 Ga0495581_0000166_15196_16152 311
1249 3300047317 Ga0495604_0017915 Ga0495604_0017915_380_1324 311
1250 3300047317 Ga0495604_0058327 Ga0495604_0058327_1533_2477 311
1251 3300047317 Ga0495604_0138976 Ga0495604_0138976_68_1030 311
1252 3300047317 Ga0495604_0161565 Ga0495604_0161565_410_1354 311
1253 3300047319 Ga0495674_0009028 Ga0495674_0009028_3983_4939 311
1254 3300047321 Ga0495676_0069500 Ga0495676_0069500_1339_2295 311
1255 3300047321 Ga0495676_0085664 Ga0495676_0085664_1252_2196 311
1256 3300047322 Ga0495680_0044358 Ga0495680_0044358_533_1477 311
1257 3300047322 Ga0495680_0126487 Ga0495680_0126487_378_1334 311
1258 3300047444 Ga0495675_0013918 Ga0495675_0013918_3148_4092 311
1259 3300047471 Ga0495684_0224593 Ga0495684_0224593_334_1278 311
1260 3300047472 Ga0495686_0124056 Ga0495686_0124056_346_1290 311
1261 3300047673 Ga0495593_0000033 Ga0495593_0000033_14934_15890 311
1262 3300048088 Ga0495602_0028813 Ga0495602_0028813_4120_5064 311
1263 3300048088 Ga0495602_0033120 Ga0495602_0033120_2195_3139 311
1264 3300048088 Ga0495602_0061823 Ga0495602_0061823_361_1305 311
1265 3300048088 Ga0495602_0224989 Ga0495602_0224989_253_1215 311
1266 3300048091 Ga0495626_0023088 Ga0495626_0023088_1899_2849 311
1267 3300048903 Ga0496100_0322190 Ga0496100_0322190_103_1062 311
1268 3300048905 Ga0496102_0193234 Ga0496102_0193234_217_1179 311
1269 3300048907 Ga0496104_0018839 Ga0496104_0018839_609_1568 311
1270 3300048909 Ga0496106_0003104 Ga0496106_0003104_5287_6246 311
1271 3300048911 Ga0496108_0002539 Ga0496108_0002539_13524_14483 311
1272 3300048912 Ga0496109_0012367 Ga0496109_0012367_6107_7066 311
1273 3300048912 Ga0496109_0136395 Ga0496109_0136395_952_1914 311
1274 3300048913 Ga0496110_0014112 Ga0496110_0014112_3443_4402 311
1275 3300048915 Ga0496112_0006587 Ga0496112_0006587_179_1138 311
1276 3300048915 Ga0496112_0079018 Ga0496112_0079018_449_1411 311
1277 3300048915 Ga0496112_0390556 Ga0496112_0390556_135_1097 311
1278 3300048916 Ga0496113_0044236 Ga0496113_0044236_461_1405 311
1279 3300048916 Ga0496113_0119535 Ga0496113_0119535_1003_1962 311
1280 3300048916 Ga0496113_0408091 Ga0496113_0408091_65_1027 311
1281 3300048918 Ga0496115_0079065 Ga0496115_0079065_1088_2032 311
1282 3300048918 Ga0496115_0145934 Ga0496115_0145934_896_1840 311
1283 3300048918 Ga0496115_0333045 Ga0496115_0333045_48_986 311
1284 3300048922 Ga0496119_0007401 Ga0496119_0007401_8210_9154 311
1285 3300048924 Ga0496121_0029407 Ga0496121_0029407_659_1609 311
1286 3300048924 Ga0496121_0067206 Ga0496121_0067206_696_1640 311
1287 3300048924 Ga0496121_0072871 Ga0496121_0072871_1351_2295 311
1288 3300048924 Ga0496121_0131444 Ga0496121_0131444_518_1462 311
1289 3300048925 Ga0496122_0075240 Ga0496122_0075240_640_1590 311
1290 3300048928 Ga0496125_0072594 Ga0496125_0072594_719_1663 311
1291 3300048929 Ga0496126_0005072 Ga0496126_0005072_4411_5352 311
1292 3300048929 Ga0496126_0007510 Ga0496126_0007510_6172_7122 311
1293 3300048929 Ga0496126_0019129 Ga0496126_0019129_5126_6088 311
1294 3300048929 Ga0496126_0029901 Ga0496126_0029901_3408_4352 311
1295 3300048929 Ga0496126_0072340 Ga0496126_0072340_304_1254 311
1296 3300049460 Ga0495682_0058567 Ga0495682_0058567_203_1147 311
1297 3300049580 Ga0501046_0069104 Ga0501046_0069104_228_1172 311
1298 3300049581 Ga0501047_0033590 Ga0501047_0033590_2890_3834 311
1299 3300049586 Ga0501070_0003190 Ga0501070_0003190_11808_12752 311
1300 3300049742 Ga0501080_0059524 Ga0501080_0059524_1845_2789 311
1301 3300049822 Ga0501035_0110892 Ga0501035_0110892_229_1173 311
1302 3300050512 nmdc:mga0n895_101084_c1 nmdc:mga0n895_101084_c1_1493_2443 311
1303 3300050513 nmdc:mga0rr50_59482_c1 nmdc:mga0rr50_59482_c1_1332_2282 311
1304 3300053077 Ga0495601_0044171 Ga0495601_0044171_146_1090 311
1305 3300053084 Ga0495595_0029061 Ga0495595_0029061_1026_1970 311
1306 3300053084 Ga0495595_0078396 Ga0495595_0078396_199_1161 311
1307 3300053085 Ga0495619_0000557 Ga0495619_0000557_23197_24141 311
1308 3300053094 Ga0500566_0000331 Ga0500566_0000331_17422_18372 311
1309 3300053094 Ga0500566_0001048 Ga0500566_0001048_14930_15874 311
1310 3300053094 Ga0500566_0001969 Ga0500566_0001969_404_1348 311
1311 3300053095 Ga0500640_000214 Ga0500640_000214_9737_10681 311
1312 3300053095 Ga0500640_001983 Ga0500640_001983_3163_4107 311
1313 3300053111 Ga0500572_000175 Ga0500572_000175_4840_5784 311
1314 3300053122 Ga0500608_006744 Ga0500608_006744_2556_3500 311
1315 3300053122 Ga0500608_039749 Ga0500608_039749_1163_2107 311
1316 3300053123 Ga0500614_001781 Ga0500614_001781_2715_3659 311
1317 3300053136 Ga0500559_0001458 Ga0500559_0001458_11069_12019 311
1318 3300053138 Ga0500564_007644 Ga0500564_007644_144_1088 311
1319 3300053150 Ga0500603_002027 Ga0500603_002027_2806_3750 311
1320 3300053162 Ga0500638_001677 Ga0500638_001677_3937_4881 311
1321 3300053163 Ga0500639_000239 Ga0500639_000239_7450_8394 311
1322 3300053177 Ga0500636_0000102 Ga0500636_0000102_40553_41497 311
1323 3300053177 Ga0500636_0007566 Ga0500636_0007566_2017_2967 311
1324 3300053735 Ga0500596_000367 Ga0500596_000367_1452_2396 311
1325 3300053737 Ga0500601_000568 Ga0500601_000568_4049_4993 311
1326 3300002077 JGI24744J21845_10012885 JGI24744J21845_100128852 312
1327 3300003215 JGI25153J46596_10017828 JGI25153J46596_100178281 312
1328 3300005329 Ga0070683_100151988 Ga0070683_1001519882 312
1329 3300005330 Ga0070690_100067718 Ga0070690_1000677182 312
1330 3300005330 Ga0070690_100230714 Ga0070690_1002307142 312
1331 3300005334 Ga0068869_100040310 Ga0068869_1000403102 312
1332 3300005338 Ga0068868_100323848 Ga0068868_1003238481 312
1333 3300005341 Ga0070691_10055502 Ga0070691_100555022 312
1334 3300005347 Ga0070668_100335271 Ga0070668_1003352712 312
1335 3300005438 Ga0070701_10041569 Ga0070701_100415692 312
1336 3300005440 Ga0070705_100160119 Ga0070705_1001601192 312
1337 3300005455 Ga0070663_100007575 Ga0070663_1000075753 312
1338 3300005455 Ga0070663_100108146 Ga0070663_1001081463 312
1339 3300005456 Ga0070678_100034207 Ga0070678_1000342075 312
1340 3300005467 Ga0070706_100422434 Ga0070706_1004224341 312
1341 3300005471 Ga0070698_100117349 Ga0070698_1001173492 312
1342 3300005518 Ga0070699_100115865 Ga0070699_1001158653 312
1343 3300005539 Ga0068853_100061235 Ga0068853_1000612352 312
1344 3300005544 Ga0070686_100121701 Ga0070686_1001217012 312
1345 3300005547 Ga0070693_100092290 Ga0070693_1000922902 312
1346 3300005548 Ga0070665_100018182 Ga0070665_1000181827 312
1347 3300005564 Ga0070664_100067330 Ga0070664_1000673302 312
1348 3300005564 Ga0070664_100174708 Ga0070664_1001747083 312
1349 3300005618 Ga0068864_100052894 Ga0068864_1000528942 312
1350 3300005719 Ga0068861_100080957 Ga0068861_1000809572 312
1351 3300005841 Ga0068863_100209360 Ga0068863_1002093603 312
1352 3300005937 Ga0081455_10009007 Ga0081455_100090078 312
1353 3300005983 Ga0081540_1011941 Ga0081540_10119417 312
1354 3300005983 Ga0081540_1016188 Ga0081540_10161882 312
1355 3300005985 Ga0081539_10041150 Ga0081539_100411503 312
1356 3300006038 Ga0075365_10049600 Ga0075365_100496003 312
1357 3300006038 Ga0075365_10208039 Ga0075365_102080392 312
1358 3300006048 Ga0075363_100003841 Ga0075363_1000038413 312
1359 3300006048 Ga0075363_100055194 Ga0075363_1000551943 312
1360 3300006051 Ga0075364_10019920 Ga0075364_100199203 312
1361 3300006051 Ga0075364_10039910 Ga0075364_100399105 312
1362 3300006173 Ga0070716_100093962 Ga0070716_1000939623 312
1363 3300006178 Ga0075367_10005056 Ga0075367_100050565 312
1364 3300006186 Ga0075369_10037577 Ga0075369_100375773 312
1365 3300006195 Ga0075366_10022697 Ga0075366_100226972 312
1366 3300006353 Ga0075370_10021974 Ga0075370_100219742 312
1367 3300006358 Ga0068871_100244303 Ga0068871_1002443031 312
1368 3300006358 Ga0068871_100252316 Ga0068871_1002523162 312
1369 3300006943 Ga0099822_1019170 Ga0099822_10191704 312
1370 3300009094 Ga0111539_10131557 Ga0111539_101315574 312
1371 3300009098 Ga0105245_10041292 Ga0105245_100412922 312
1372 3300009147 Ga0114129_10042454 Ga0114129_100424543 312
1373 3300009177 Ga0105248_10026351 Ga0105248_100263512 312
1374 3300010375 Ga0105239_10012274 Ga0105239_100122748 312
1375 3300011119 Ga0105246_10021797 Ga0105246_100217975 312
1376 3300013297 Ga0157378_10228615 Ga0157378_102286151 312
1377 3300013306 Ga0163162_10206620 Ga0163162_102066201 312
1378 3300013306 Ga0163162_10223672 Ga0163162_102236722 312
1379 3300013308 Ga0157375_10117297 Ga0157375_101172972 312
1380 3300013308 Ga0157375_10358192 Ga0157375_103581922 312
1381 3300014325 Ga0163163_10013378 Ga0163163_100133782 312
1382 3300014326 Ga0157380_10106128 Ga0157380_101061283 312
1383 3300014969 Ga0157376_10105040 Ga0157376_101050403 312
1384 3300014969 Ga0157376_10194684 Ga0157376_101946842 312
1385 3300025297 Ga0209758_1011390 Ga0209758_10113904 312
1386 3300025885 Ga0207653_10037063 Ga0207653_100370632 312
1387 3300025923 Ga0207681_10351236 Ga0207681_103512362 312
1388 3300025927 Ga0207687_10008249 Ga0207687_100082495 312
1389 3300025927 Ga0207687_10034015 Ga0207687_100340153 312
1390 3300025933 Ga0207706_10044372 Ga0207706_100443723 312
1391 3300025934 Ga0207686_10190464 Ga0207686_101904641 312
1392 3300025935 Ga0207709_10041045 Ga0207709_100410452 312
1393 3300025938 Ga0207704_10016603 Ga0207704_100166034 312
1394 3300025939 Ga0207665_10087106 Ga0207665_100871063 312
1395 3300025940 Ga0207691_10103559 Ga0207691_101035594 312
1396 3300025940 Ga0207691_10295307 Ga0207691_102953071 312
1397 3300025941 Ga0207711_10163587 Ga0207711_101635872 312
1398 3300025942 Ga0207689_10045378 Ga0207689_100453782 312
1399 3300025944 Ga0207661_10139786 Ga0207661_101397862 312
1400 3300025945 Ga0207679_10073592 Ga0207679_100735923 312
1401 3300025960 Ga0207651_10161943 Ga0207651_101619433 312
1402 3300025961 Ga0207712_10133922 Ga0207712_101339222 312
1403 3300025972 Ga0207668_10075709 Ga0207668_100757092 312
1404 3300026023 Ga0207677_10055826 Ga0207677_100558263 312
1405 3300026035 Ga0207703_10034858 Ga0207703_100348585 312
1406 3300026067 Ga0207678_10048395 Ga0207678_100483952 312
1407 3300026075 Ga0207708_10097594 Ga0207708_100975944 312
1408 3300026088 Ga0207641_10359235 Ga0207641_103592352 312
1409 3300026089 Ga0207648_10277847 Ga0207648_102778472 312
1410 3300026089 Ga0207648_10310033 Ga0207648_103100331 312
1411 3300026095 Ga0207676_10639524 Ga0207676_106395241 312
1412 3300026118 Ga0207675_100053074 Ga0207675_1000530746 312
1413 3300026121 Ga0207683_10021252 Ga0207683_100212524 312
1414 3300026121 Ga0207683_10312436 Ga0207683_103124361 312
1415 3300026121 Ga0207683_10407319 Ga0207683_104073192 312
1416 3300027907 Ga0207428_10119708 Ga0207428_101197082 312
1417 3300028379 Ga0268266_10003344 Ga0268266_1000334412 312
1418 3300028379 Ga0268266_10079189 Ga0268266_100791893 312
1419 3300028380 Ga0268265_10383608 Ga0268265_103836082 312
1420 3300028786 Ga0307517_10104672 Ga0307517_101046722 312
1421 3300031507 Ga0307509_10363690 Ga0307509_103636902 312
1422 3300031616 Ga0307508_10211078 Ga0307508_102110782 312
1423 3300031730 Ga0307516_10059573 Ga0307516_100595732 312
1424 3300033180 Ga0307510_10003449 Ga0307510_1000344910 312
1425 3300035112 Ga0373932_0010303 Ga0373932_0010303_1067_2143 312
1426 3300035207 Ga0373942_0025301 Ga0373942_0025301_491_1435 312
1427 3300035691 Ga0373931_0006221 Ga0373931_0006221_1898_2974 312
1428 3300035695 Ga0373927_0017851 Ga0373927_0017851_1976_2920 312
1429 3300037068 Ga0373925_0161670 Ga0373925_0161670_194_1138 312
1430 3300042157 Ga0439458_0035939 Ga0439458_0035939_42_980 312
1431 3300046453 Ga0495627_052975 Ga0495627_052975_140_1078 312
1432 3300046455 Ga0495603_0027453 Ga0495603_0027453_2211_3149 312
1433 3300046455 Ga0495603_0089164 Ga0495603_0089164_764_1702 312
1434 3300046477 Ga0495664_0107218 Ga0495664_0107218_682_1626 312
1435 3300046491 Ga0495584_0166798 Ga0495584_0166798_145_1083 312
1436 3300046492 Ga0495585_0091017 Ga0495585_0091017_606_1544 312
1437 3300046507 Ga0495606_0162853 Ga0495606_0162853_308_1246 312
1438 3300046519 Ga0495632_0033563 Ga0495632_0033563_1069_2007 312
1439 3300046529 Ga0495652_0262573 Ga0495652_0262573_101_1045 312
1440 3300046648 Ga0495611_0126704 Ga0495611_0126704_227_1165 312
1441 3300046674 Ga0495588_0134831 Ga0495588_0134831_278_1216 312
1442 3300046694 Ga0495649_0116099 Ga0495649_0116099_126_1064 312
1443 3300047320 Ga0495672_0128453 Ga0495672_0128453_32_973 312
1444 3300047445 Ga0495677_0034301 Ga0495677_0034301_135_1073 312
1445 3300047446 Ga0495679_031312 Ga0495679_031312_766_1704 312
1446 3300048904 Ga0496101_0339580 Ga0496101_0339580_50_1126 312
1447 3300048905 Ga0496102_0401079 Ga0496102_0401079_236_1174 312
1448 3300048906 Ga0496103_0020025 Ga0496103_0020025_2227_3171 312
1449 3300048907 Ga0496104_0020301 Ga0496104_0020301_1351_2295 312
1450 3300048907 Ga0496104_0024862 Ga0496104_0024862_3282_4358 312
1451 3300048908 Ga0496105_0016130 Ga0496105_0016130_702_1646 312
1452 3300048908 Ga0496105_0341835 Ga0496105_0341835_71_1147 312
1453 3300048909 Ga0496106_0006834 Ga0496106_0006834_61_1005 312
1454 3300048909 Ga0496106_0044470 Ga0496106_0044470_1207_2283 312
1455 3300048910 Ga0496107_0037814 Ga0496107_0037814_947_2023 312
1456 3300048911 Ga0496108_0096940 Ga0496108_0096940_390_1334 312
1457 3300048913 Ga0496110_0034780 Ga0496110_0034780_1092_2036 312
1458 3300048913 Ga0496110_0047732 Ga0496110_0047732_840_1916 312
1459 3300048914 Ga0496111_0056594 Ga0496111_0056594_254_1198 312
1460 3300048914 Ga0496111_0401545 Ga0496111_0401545_39_977 312
1461 3300048915 Ga0496112_0001811 Ga0496112_0001811_11926_13002 312
1462 3300048915 Ga0496112_0004764 Ga0496112_0004764_4241_5185 312
1463 3300048915 Ga0496112_0172063 Ga0496112_0172063_231_1169 312
1464 3300048916 Ga0496113_0005360 Ga0496113_0005360_846_1790 312
1465 3300048916 Ga0496113_0010973 Ga0496113_0010973_61_1137 312
1466 3300048917 Ga0496114_0119721 Ga0496114_0119721_221_1297 312
1467 3300048918 Ga0496115_0004354 Ga0496115_0004354_2430_3374 312
1468 3300048918 Ga0496115_0016709 Ga0496115_0016709_3150_4226 312
1469 3300048918 Ga0496115_0145172 Ga0496115_0145172_559_1497 312
1470 3300048924 Ga0496121_0070273 Ga0496121_0070273_730_1668 312
1471 3300048929 Ga0496126_0005800 Ga0496126_0005800_8614_9552 312
1472 3300050490 nmdc:mga03n38_24684_c1 nmdc:mga03n38_24684_c1_25_963 312
1473 3300050490 nmdc:mga03n38_2872_c1 nmdc:mga03n38_2872_c1_2986_3924 312
1474 3300050490 nmdc:mga03n38_61621_c1 nmdc:mga03n38_61621_c1_691_1629 312
1475 3300050491 nmdc:mga00v17_50057_c1 nmdc:mga00v17_50057_c1_273_1211 312
1476 3300050491 nmdc:mga00v17_78206_c1 nmdc:mga00v17_78206_c1_363_1301 312
1477 3300050494 nmdc:mga06z11_131701_c1 nmdc:mga06z11_131701_c1_345_1283 312
1478 3300050494 nmdc:mga06z11_46757_c1 nmdc:mga06z11_46757_c1_1188_2126 312
1479 3300050496 nmdc:mga07m45_1086_c1 nmdc:mga07m45_1086_c1_7314_8252 312
1480 3300050507 nmdc:mga05p37_268632_c1 nmdc:mga05p37_268632_c1_1017_1955 312
1481 3300050511 nmdc:mga08y16_34714_c1 nmdc:mga08y16_34714_c1_4340_5278 312
1482 3300050516 nmdc:mga0sz30_20147_c1 nmdc:mga0sz30_20147_c1_844_1782 312
1483 3300050516 nmdc:mga0sz30_58797_c1 nmdc:mga0sz30_58797_c1_490_1428 312
1484 3300053077 Ga0495601_0092862 Ga0495601_0092862_381_1325 312
1485 3300053094 Ga0500566_0021105 Ga0500566_0021105_2169_3113 312
1486 3300053104 Ga0500556_0085971 Ga0500556_0085971_155_1093 312
1487 3300053119 Ga0500595_000715 Ga0500595_000715_2749_3693 312
1488 3300053147 Ga0500589_076989 Ga0500589_076989_416_1354 312
1489 3300053162 Ga0500638_005668 Ga0500638_005668_3037_3981 312
1490 3300053178 Ga0500637_0000265 Ga0500637_0000265_13526_14470 312
1491 3300053730 Ga0500645_027102 Ga0500645_027102_560_1498 312
1492 iso_pu_bacteria 2903748898 2903755956 312
1493 iso_pu_bacteria 8006933436 8006939518 312
1494 iso_pu_bacteria 8006973647 8006979268 312

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

99

292

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d03-assembly1.cif.gz_A 1.9a structure of glycerophoshphodiesterase (gpdq) from enterobacter aerogenes 0.796 55 256
2dxl-assembly1.cif.gz_A glycerophosphodiesterase from enterobacter aerogenes 0.7821 55 256
2hyp-assembly1.cif.gz_A-2 crystal structure of rv0805 d66a mutant 0.6787 55 256
3ib7-assembly1.cif.gz_A crystal structure of full length rv0805 0.671 55 258
2hy1-assembly1.cif.gz_A-2 crystal structure of rv0805 0.6691 55 256
ID Description Score Start End Superfamily
3d03A01 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;GpdQ, catalytic alpha/beta sandwich domain 0.8224 55 143 3.60.21.40
af_Q5M886_14_327_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7584 53 251 3.60.21.10
af_A0A1D6HZI4_13_293_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7379 47 258 3.60.21.10
af_Q4D1B4_43_325_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.694 53 258 3.60.21.10
af_Q54NC3_152_453_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6859 53 247 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A537S6V3-F1-model_v4 Metallophosphoesterase 0.9437 88 214 GO:0005737
GO:0016787
AF-A0A537S6V3-F1-model_v4 Metallophosphoesterase 0.9366 88 214 GO:0005737
GO:0016787
AF-A0A530M2F0-F1-model_v4 Metallophosphoesterase 0.9187 179 240
AF-A0A2V8ELA9-F1-model_v4 Metallophosphoesterase 0.9179 20 236 GO:0005737
GO:0016787
AF-X7ZNG7-F1-model_v4 Putative metallophosphoesterase 0.9031 126 245 GO:0005737
GO:0016787

Feature Viewer

pLDDT pTM Quality
74.85 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map