F494294
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1484 | 684 | 1247 | 230 |
Family's Representative Sequence
| Representative Sequence | 3300005617|Ga0068859_100051874|Ga0068859_1000518745 |
| Length | 249 |
| Sequence | MSLTAAAVYHITIRRKEMVMLNQSITHSVVSTNTTHTVPSPAANPFAEITGHAGLIATEFSYKKDEEIYGEDEPAEYVYQVISGAVRSYKLLSDGRRQIGAFHLPGDVFGLEFGSAHRLAAEAIIDTTVRLVKRRSLEQAAGVDVAVARKLWTMTAGDLRHAEDHMLLLGRKTAMERVATFLLEMDRRLAVAGMMALPMCRRDIGDYLGLTLETVSRALSQLQSQGVLGFSGARQIVLRNRQRLRSMDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 10 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 11 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 12 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 13 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 14 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 15 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 16 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 17 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 18 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 19 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 20 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 21 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 22 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 23 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 24 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 25 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 26 | 2791355199 | |||
| 27 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 28 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 29 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 30 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 31 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 32 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 33 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 34 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 35 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 36 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 37 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 38 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 39 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 40 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 41 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 42 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 43 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 44 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 45 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 46 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 47 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 48 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 49 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 50 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 51 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 52 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 53 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 54 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 55 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 56 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 57 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 58 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 59 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 60 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 61 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 62 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 63 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 64 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 65 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 66 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 67 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 68 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 69 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 70 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 71 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 72 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 73 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 74 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 75 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 76 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 77 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 78 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 79 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 80 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 81 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 82 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 83 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 84 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 85 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 86 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 87 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 88 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 89 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 90 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 91 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 92 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 93 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 94 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 95 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 96 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 97 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 98 | 2922368715 | |||
| 99 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 100 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 101 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 102 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 103 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 104 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 105 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 106 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 107 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 108 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 109 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 110 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 111 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 112 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 113 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 114 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 115 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 116 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 117 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 118 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 119 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 120 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 121 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 122 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 123 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 124 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 125 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 126 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 127 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 128 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 129 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 130 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 131 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 132 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 133 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 134 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 135 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 136 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 137 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 138 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 139 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 140 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 141 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 142 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 143 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 144 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 145 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 146 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 147 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 148 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 149 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 150 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 151 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 152 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 153 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 154 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 155 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 156 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 157 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 158 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 159 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 160 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 161 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 162 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 163 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 164 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 165 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 166 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 167 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 168 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 169 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 170 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 171 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 172 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 173 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 174 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 175 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 176 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 177 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 180 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 181 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 183 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 184 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 185 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 186 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 188 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 190 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 198 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 200 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 201 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 202 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 204 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 209 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 210 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 211 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 212 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 214 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 215 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 216 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 218 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 219 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 222 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 224 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 225 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 226 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 227 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 228 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 229 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 230 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 231 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 232 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 233 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 234 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 235 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 236 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 237 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 238 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 239 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 240 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 241 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 242 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 243 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 244 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 245 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 246 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 247 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 248 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 249 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 250 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 251 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 252 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 253 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 255 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 256 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 257 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 258 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 259 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 261 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 262 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 263 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 264 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 265 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 266 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 267 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 268 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 270 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 271 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 273 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 274 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 275 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 276 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 277 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 278 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 279 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 280 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 281 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 282 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 283 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 284 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 285 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 286 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 287 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 288 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 289 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 290 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 291 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 292 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 293 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 294 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 295 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 296 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 297 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 298 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 299 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 300 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 301 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 302 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 303 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 304 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 305 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 306 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 307 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 308 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 309 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 310 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 311 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 312 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 313 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 374 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 375 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 376 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 377 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 380 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 381 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 385 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 386 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 387 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 388 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 389 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 390 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 391 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 392 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 394 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 395 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 396 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 397 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 398 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 399 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 400 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 401 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 402 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 403 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 404 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 405 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 406 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 407 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 408 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 409 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 410 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 411 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 412 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 413 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 414 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 415 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 416 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 417 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 418 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 419 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 420 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 421 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 422 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 423 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 424 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 425 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 426 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 427 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 428 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 429 | 3300036242 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 430 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 431 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 432 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 433 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 434 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 435 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 436 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 437 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 438 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 439 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 440 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 441 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 442 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 443 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 444 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 445 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 446 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 447 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 448 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 449 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 450 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 451 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 452 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 453 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 454 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 455 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 456 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 457 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 534 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 535 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 536 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 537 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 538 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 539 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 540 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 541 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 542 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 543 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 544 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 545 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 546 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 547 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 548 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 549 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 550 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 551 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 552 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 553 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 554 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 555 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 556 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 557 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 558 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 559 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 561 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 562 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 563 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 564 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 565 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 566 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 567 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 568 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 569 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 570 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 571 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 572 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 573 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 574 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 575 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 576 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 577 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 578 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 579 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 580 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 581 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 582 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 583 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 584 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 585 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 586 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 587 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 588 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 589 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 590 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 591 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 592 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 593 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 596 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 600 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 601 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 602 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 603 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 604 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 605 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 606 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 607 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 608 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 609 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 610 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 611 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 612 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 613 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 614 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 615 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 616 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 617 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 618 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 619 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 620 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 621 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 622 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 623 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 624 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 625 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 626 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 627 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 628 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 629 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 630 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 631 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 632 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 633 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 634 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 635 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 636 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 637 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 638 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 639 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 640 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 641 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 642 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 643 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 644 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 645 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 646 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 647 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 648 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 649 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 650 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 651 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 652 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 653 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 654 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 655 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 656 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 657 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 658 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 659 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 660 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 661 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 662 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 663 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 664 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 665 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 666 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 667 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 668 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 669 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 670 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 671 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 672 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 673 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 674 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 675 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 676 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 677 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 678 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 679 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 680 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 681 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 682 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 683 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 684 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.94 |
| Metatranscriptomes | 0.2 |
| Isolates | 15.86 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.27 |
| Nodule | 12.53 |
| Rhizoplane | 6.2 |
| Rhizosphere | 57.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10004382 | 3300003215 | Bacteria | 7617 |
| 2 | JGI25153J46596_10004474 | 3300003215 | Bacteria | 7534 |
| 3 | JGI25153J46596_10023126 | 3300003215 | Bacteria | 2272 |
| 4 | JGI25153J46596_10039897 | 3300003215 | Bacteria | 1462 |
| 5 | rootL2_10276112 | 3300003322 | Bacteria | 1490 |
| 6 | JGI25160J50197_1001088 | 3300003354 | Bacteria | 13913 |
| 7 | JGI25160J50197_1005535 | 3300003354 | Bacteria | 5241 |
| 8 | JGI25160J50197_1012990 | 3300003354 | Bacteria | 2859 |
| 9 | JGI25404J52841_10002046 | 3300003659 | Bacteria | 3732 |
| 10 | JGI25404J52841_10008625 | 3300003659 | Bacteria | 2175 |
| 11 | JGI25404J52841_10010725 | 3300003659 | Bacteria | 1971 |
| 12 | JGI25404J52841_10011426 | 3300003659 | Bacteria | 1914 |
| 13 | Ga0055539_1001910 | 3300003752 | Bacteria | 3491 |
| 14 | Ga0055542_1003299 | 3300003762 | Bacteria | 4474 |
| 15 | Ga0055524_1016563 | 3300003775 | Bacteria | 2638 |
| 16 | Ga0055531_10002968 | 3300003794 | Bacteria | 11025 |
| 17 | Ga0055531_10004025 | 3300003794 | Bacteria | 9119 |
| 18 | Ga0065165_1001485 | 3300005262 | Bacteria | 24928 |
| 19 | Ga0065165_1003538 | 3300005262 | Bacteria | 10812 |
| 20 | Ga0065165_1007237 | 3300005262 | Bacteria | 5523 |
| 21 | Ga0065704_10016712 | 3300005289 | Bacteria | 1715 |
| 22 | Ga0070658_10232430 | 3300005327 | Bacteria | 1561 |
| 23 | Ga0070658_10759682 | 3300005327 | Bacteria | 842 |
| 24 | Ga0070676_10163900 | 3300005328 | Bacteria | 1433 |
| 25 | Ga0070676_10202147 | 3300005328 | Bacteria | 1303 |
| 26 | Ga0070683_100088893 | 3300005329 | Bacteria | 2899 |
| 27 | Ga0070690_100170840 | 3300005330 | Bacteria | 1496 |
| 28 | Ga0070670_100079423 | 3300005331 | Bacteria | 2819 |
| 29 | Ga0070670_100097365 | 3300005331 | Bacteria | 2531 |
| 30 | Ga0070670_100419702 | 3300005331 | Bacteria | 1183 |
| 31 | Ga0068869_100183941 | 3300005334 | Bacteria | 1639 |
| 32 | Ga0070680_100012857 | 3300005336 | Bacteria | 6512 |
| 33 | Ga0070682_100196475 | 3300005337 | Bacteria | 1420 |
| 34 | Ga0070682_100563442 | 3300005337 | Bacteria | 893 |
| 35 | Ga0068868_100009489 | 3300005338 | Bacteria | 7007 |
| 36 | Ga0068868_100009995 | 3300005338 | Bacteria | 6856 |
| 37 | Ga0068868_100116950 | 3300005338 | Bacteria | 2172 |
| 38 | Ga0070660_100280599 | 3300005339 | Bacteria | 1363 |
| 39 | Ga0070660_100438439 | 3300005339 | Bacteria | 1083 |
| 40 | Ga0070689_100199048 | 3300005340 | Bacteria | 1635 |
| 41 | Ga0070661_100169956 | 3300005344 | Bacteria | 1655 |
| 42 | Ga0070692_10057416 | 3300005345 | Bacteria | 2041 |
| 43 | Ga0070668_100029750 | 3300005347 | Bacteria | 4149 |
| 44 | Ga0070668_100071526 | 3300005347 | Bacteria | 2702 |
| 45 | Ga0070668_100131339 | 3300005347 | Bacteria | 2010 |
| 46 | Ga0070668_100256230 | 3300005347 | Bacteria | 1454 |
| 47 | Ga0070668_100322200 | 3300005347 | Bacteria | 1301 |
| 48 | Ga0070668_100465296 | 3300005347 | Bacteria | 1089 |
| 49 | Ga0070669_100051698 | 3300005353 | Bacteria | 3004 |
| 50 | Ga0070669_100262863 | 3300005353 | Bacteria | 1378 |
| 51 | Ga0070675_100143451 | 3300005354 | Bacteria | 2043 |
| 52 | Ga0070675_100513571 | 3300005354 | Bacteria | 1081 |
| 53 | Ga0070675_100716780 | 3300005354 | Bacteria | 912 |
| 54 | Ga0070675_100845270 | 3300005354 | Bacteria | 837 |
| 55 | Ga0070671_100011809 | 3300005355 | Bacteria | 7026 |
| 56 | Ga0070671_100178580 | 3300005355 | Bacteria | 1797 |
| 57 | Ga0070671_100191982 | 3300005355 | Bacteria | 1731 |
| 58 | Ga0070674_100107344 | 3300005356 | Bacteria | 2044 |
| 59 | Ga0070659_100320582 | 3300005366 | Bacteria | 1295 |
| 60 | Ga0070667_100032529 | 3300005367 | Bacteria | 4350 |
| 61 | Ga0070667_100137772 | 3300005367 | Bacteria | 2135 |
| 62 | Ga0070667_100464305 | 3300005367 | Bacteria | 1158 |
| 63 | Ga0070667_100582975 | 3300005367 | Bacteria | 1030 |
| 64 | Ga0070667_100619249 | 3300005367 | Bacteria | 998 |
| 65 | Ga0070709_10001978 | 3300005434 | Bacteria | 11170 |
| 66 | Ga0070709_10002525 | 3300005434 | Bacteria | 9903 |
| 67 | Ga0070709_10008266 | 3300005434 | Bacteria | 5715 |
| 68 | Ga0070709_10185738 | 3300005434 | Bacteria | 1463 |
| 69 | Ga0070714_100001459 | 3300005435 | Bacteria | 17220 |
| 70 | Ga0070714_100033282 | 3300005435 | Bacteria | 4308 |
| 71 | Ga0070714_100628543 | 3300005435 | Bacteria | 1033 |
| 72 | Ga0070713_100017039 | 3300005436 | Bacteria | 5481 |
| 73 | Ga0070713_100020912 | 3300005436 | Bacteria | 5024 |
| 74 | Ga0070713_100027548 | 3300005436 | Bacteria | 4475 |
| 75 | Ga0070713_100115555 | 3300005436 | Bacteria | 2345 |
| 76 | Ga0070713_100184258 | 3300005436 | Bacteria | 1878 |
| 77 | Ga0070713_101060488 | 3300005436 | Bacteria | 783 |
| 78 | Ga0070710_10000316 | 3300005437 | Bacteria | 23048 |
| 79 | Ga0070710_10001024 | 3300005437 | Bacteria | 13270 |
| 80 | Ga0070701_10013117 | 3300005438 | Bacteria | 3760 |
| 81 | Ga0070711_100000617 | 3300005439 | Bacteria | 18550 |
| 82 | Ga0070711_100009683 | 3300005439 | Bacteria | 5938 |
| 83 | Ga0070711_100018449 | 3300005439 | Bacteria | 4456 |
| 84 | Ga0070711_100046989 | 3300005439 | Bacteria | 2944 |
| 85 | Ga0070711_100445136 | 3300005439 | Bacteria | 1060 |
| 86 | Ga0070711_100535735 | 3300005439 | Bacteria | 970 |
| 87 | Ga0070700_100188768 | 3300005441 | Bacteria | 1439 |
| 88 | Ga0070700_100599842 | 3300005441 | Bacteria | 863 |
| 89 | Ga0070708_100294553 | 3300005445 | Bacteria | 1528 |
| 90 | Ga0070663_100007753 | 3300005455 | Bacteria | 6556 |
| 91 | Ga0070663_100013684 | 3300005455 | Bacteria | 5184 |
| 92 | Ga0070663_100014812 | 3300005455 | Bacteria | 5013 |
| 93 | Ga0070663_100024348 | 3300005455 | Bacteria | 4073 |
| 94 | Ga0070663_100033723 | 3300005455 | Bacteria | 3539 |
| 95 | Ga0070663_100293301 | 3300005455 | Bacteria | 1300 |
| 96 | Ga0070663_100349102 | 3300005455 | Bacteria | 1197 |
| 97 | Ga0070663_100438289 | 3300005455 | Bacteria | 1075 |
| 98 | Ga0070678_100009842 | 3300005456 | Bacteria | 5813 |
| 99 | Ga0070678_100376752 | 3300005456 | Bacteria | 1227 |
| 100 | Ga0070678_100457902 | 3300005456 | Bacteria | 1118 |
| 101 | Ga0070678_100662807 | 3300005456 | Bacteria | 937 |
| 102 | Ga0070662_100006982 | 3300005457 | Bacteria | 7307 |
| 103 | Ga0070662_100171985 | 3300005457 | Bacteria | 1702 |
| 104 | Ga0070662_100275940 | 3300005457 | Bacteria | 1359 |
| 105 | Ga0070662_100330256 | 3300005457 | Bacteria | 1246 |
| 106 | Ga0070681_10014127 | 3300005458 | Bacteria | 7948 |
| 107 | Ga0068867_100040366 | 3300005459 | Bacteria | 3406 |
| 108 | Ga0070707_100639019 | 3300005468 | Bacteria | 1027 |
| 109 | Ga0070698_100010278 | 3300005471 | Bacteria | 9997 |
| 110 | Ga0070698_100220007 | 3300005471 | Bacteria | 1833 |
| 111 | Ga0070699_100189658 | 3300005518 | Bacteria | 1826 |
| 112 | Ga0070684_100557337 | 3300005535 | Bacteria | 1064 |
| 113 | Ga0070697_100080748 | 3300005536 | Bacteria | 2679 |
| 114 | Ga0068853_100251795 | 3300005539 | Bacteria | 1621 |
| 115 | Ga0068853_100350689 | 3300005539 | Unclassified | 1373 |
| 116 | Ga0070672_100184840 | 3300005543 | Bacteria | 1738 |
| 117 | Ga0070686_100094487 | 3300005544 | Bacteria | 2007 |
| 118 | Ga0070695_100060185 | 3300005545 | Bacteria | 2461 |
| 119 | Ga0070693_100304043 | 3300005547 | Bacteria | 1076 |
| 120 | Ga0070665_100032680 | 3300005548 | Bacteria | 5236 |
| 121 | Ga0070665_100041394 | 3300005548 | Bacteria | 4631 |
| 122 | Ga0070665_100061161 | 3300005548 | Bacteria | 3775 |
| 123 | Ga0070665_100061786 | 3300005548 | Bacteria | 3756 |
| 124 | Ga0070665_100218358 | 3300005548 | Bacteria | 1907 |
| 125 | Ga0070665_100228640 | 3300005548 | Bacteria | 1860 |
| 126 | Ga0070665_100351429 | 3300005548 | Bacteria | 1480 |
| 127 | Ga0070665_100443489 | 3300005548 | Bacteria | 1307 |
| 128 | Ga0070665_100742704 | 3300005548 | Bacteria | 994 |
| 129 | Ga0068855_100012945 | 3300005563 | Bacteria | 10063 |
| 130 | Ga0068855_100361321 | 3300005563 | Bacteria | 1597 |
| 131 | Ga0068855_100571113 | 3300005563 | Bacteria | 1222 |
| 132 | Ga0070664_100337338 | 3300005564 | Bacteria | 1368 |
| 133 | Ga0070664_100468042 | 3300005564 | Bacteria | 1159 |
| 134 | Ga0068857_100169751 | 3300005577 | Bacteria | 1982 |
| 135 | Ga0068857_100761507 | 3300005577 | Bacteria | 923 |
| 136 | Ga0068854_100171225 | 3300005578 | Bacteria | 1690 |
| 137 | Ga0068854_100463210 | 3300005578 | Bacteria | 1061 |
| 138 | Ga0068856_100144639 | 3300005614 | Bacteria | 2385 |
| 139 | Ga0068856_100172083 | 3300005614 | Bacteria | 2178 |
| 140 | Ga0068856_100188519 | 3300005614 | Bacteria | 2076 |
| 141 | Ga0068856_100233436 | 3300005614 | Bacteria | 1855 |
| 142 | Ga0068856_100255951 | 3300005614 | Bacteria | 1766 |
| 143 | Ga0070702_100021410 | 3300005615 | Bacteria | 3401 |
| 144 | Ga0068852_100060941 | 3300005616 | Bacteria | 3277 |
| 145 | Ga0068852_100106137 | 3300005616 | Bacteria | 2546 |
| 146 | Ga0068852_100803405 | 3300005616 | Bacteria | 955 |
| 147 | Ga0068859_100022345 | 3300005617 | Bacteria | 6342 |
| 148 | Ga0068859_100022663 | 3300005617 | Bacteria | 6296 |
| 149 | Ga0068859_100051874 | 3300005617 | Bacteria | 4124 |
| 150 | Ga0068859_100079164 | 3300005617 | Bacteria | 3326 |
| 151 | Ga0068859_100695716 | 3300005617 | Bacteria | 1107 |
| 152 | Ga0068859_100749466 | 3300005617 | Bacteria | 1065 |
| 153 | Ga0068859_100806373 | 3300005617 | Bacteria | 1026 |
| 154 | Ga0068864_100140540 | 3300005618 | Bacteria | 2178 |
| 155 | Ga0068864_100365528 | 3300005618 | Bacteria | 1364 |
| 156 | Ga0068866_10040264 | 3300005718 | Bacteria | 2312 |
| 157 | Ga0068861_100011495 | 3300005719 | Bacteria | 6158 |
| 158 | Ga0068861_100013644 | 3300005719 | Bacteria | 5688 |
| 159 | Ga0068861_100079787 | 3300005719 | Bacteria | 2559 |
| 160 | Ga0068861_100226626 | 3300005719 | Bacteria | 1583 |
| 161 | Ga0068861_100559370 | 3300005719 | Bacteria | 1043 |
| 162 | Ga0068861_100618353 | 3300005719 | Bacteria | 996 |
| 163 | Ga0068851_10091721 | 3300005834 | Bacteria | 1600 |
| 164 | Ga0068870_10055148 | 3300005840 | Bacteria | 2117 |
| 165 | Ga0068870_10277536 | 3300005840 | Bacteria | 1049 |
| 166 | Ga0068863_100452352 | 3300005841 | Bacteria | 1260 |
| 167 | Ga0068863_100832382 | 3300005841 | Bacteria | 921 |
| 168 | Ga0068858_100091005 | 3300005842 | Bacteria | 2839 |
| 169 | Ga0068858_100592630 | 3300005842 | Bacteria | 1075 |
| 170 | Ga0068858_100824898 | 3300005842 | Bacteria | 905 |
| 171 | Ga0068860_100000360 | 3300005843 | Bacteria | 60297 |
| 172 | Ga0068860_100456806 | 3300005843 | Bacteria | 1270 |
| 173 | Ga0068862_100042542 | 3300005844 | Bacteria | 3870 |
| 174 | Ga0081455_10001783 | 3300005937 | Bacteria | 26011 |
| 175 | Ga0081455_10009563 | 3300005937 | Bacteria | 9956 |
| 176 | Ga0081455_10046046 | 3300005937 | Bacteria | 3789 |
| 177 | Ga0081455_10157595 | 3300005937 | Bacteria | 1743 |
| 178 | Ga0081455_10241042 | 3300005937 | Bacteria | 1329 |
| 179 | Ga0081538_10071617 | 3300005981 | Bacteria | 1905 |
| 180 | Ga0081540_1000585 | 3300005983 | Bacteria | 35126 |
| 181 | Ga0081540_1000629 | 3300005983 | Bacteria | 33549 |
| 182 | Ga0081540_1004181 | 3300005983 | Bacteria | 11108 |
| 183 | Ga0081540_1004785 | 3300005983 | Bacteria | 10207 |
| 184 | Ga0081540_1007022 | 3300005983 | Bacteria | 8100 |
| 185 | Ga0081540_1015840 | 3300005983 | Bacteria | 4752 |
| 186 | Ga0081540_1044598 | 3300005983 | Bacteria | 2262 |
| 187 | Ga0081540_1058435 | 3300005983 | Bacteria | 1858 |
| 188 | Ga0081540_1183673 | 3300005983 | Bacteria | 779 |
| 189 | Ga0070717_10004019 | 3300006028 | Bacteria | 10592 |
| 190 | Ga0070717_10019302 | 3300006028 | Bacteria | 5345 |
| 191 | Ga0070717_10515197 | 3300006028 | Bacteria | 1082 |
| 192 | Ga0075365_10001902 | 3300006038 | Bacteria | 9838 |
| 193 | Ga0075365_10013729 | 3300006038 | Bacteria | 4857 |
| 194 | Ga0075365_10093855 | 3300006038 | Bacteria | 2047 |
| 195 | Ga0075365_10095876 | 3300006038 | Bacteria | 2027 |
| 196 | Ga0075365_10118909 | 3300006038 | Bacteria | 1821 |
| 197 | Ga0075365_10138146 | 3300006038 | Bacteria | 1690 |
| 198 | Ga0075365_10219570 | 3300006038 | Bacteria | 1333 |
| 199 | Ga0075368_10029327 | 3300006042 | Bacteria | 2127 |
| 200 | Ga0075368_10080404 | 3300006042 | Bacteria | 1326 |
| 201 | Ga0075363_100032501 | 3300006048 | Bacteria | 2711 |
| 202 | Ga0075363_100159775 | 3300006048 | Bacteria | 1275 |
| 203 | Ga0075363_100281854 | 3300006048 | Bacteria | 962 |
| 204 | Ga0075364_10002061 | 3300006051 | Bacteria | 11221 |
| 205 | Ga0075364_10049387 | 3300006051 | Bacteria | 2743 |
| 206 | Ga0070715_10000563 | 3300006163 | Bacteria | 9759 |
| 207 | Ga0070715_10057725 | 3300006163 | Bacteria | 1692 |
| 208 | Ga0070716_100003783 | 3300006173 | Bacteria | 7174 |
| 209 | Ga0070716_100133116 | 3300006173 | Bacteria | 1575 |
| 210 | Ga0070716_100137205 | 3300006173 | Bacteria | 1555 |
| 211 | Ga0070712_100001723 | 3300006175 | Bacteria | 13377 |
| 212 | Ga0070712_100064359 | 3300006175 | Bacteria | 2600 |
| 213 | Ga0070712_100072062 | 3300006175 | Bacteria | 2474 |
| 214 | Ga0070712_100075559 | 3300006175 | Bacteria | 2423 |
| 215 | Ga0070712_100101369 | 3300006175 | Bacteria | 2130 |
| 216 | Ga0070712_100162136 | 3300006175 | Bacteria | 1727 |
| 217 | Ga0070712_100421594 | 3300006175 | Bacteria | 1106 |
| 218 | Ga0070712_100449471 | 3300006175 | Bacteria | 1073 |
| 219 | Ga0075362_10010036 | 3300006177 | Bacteria | 3684 |
| 220 | Ga0075362_10076290 | 3300006177 | Bacteria | 1539 |
| 221 | Ga0075362_10219354 | 3300006177 | Bacteria | 929 |
| 222 | Ga0075367_10078657 | 3300006178 | Bacteria | 1992 |
| 223 | Ga0075367_10167176 | 3300006178 | Bacteria | 1369 |
| 224 | Ga0075367_10193191 | 3300006178 | Bacteria | 1270 |
| 225 | Ga0075367_10371991 | 3300006178 | Bacteria | 903 |
| 226 | Ga0075369_10030412 | 3300006186 | Bacteria | 2274 |
| 227 | Ga0075366_10184151 | 3300006195 | Bacteria | 1269 |
| 228 | Ga0075366_10217981 | 3300006195 | Bacteria | 1162 |
| 229 | Ga0075366_10224973 | 3300006195 | Bacteria | 1143 |
| 230 | Ga0075366_10302222 | 3300006195 | Bacteria | 979 |
| 231 | Ga0097621_100109570 | 3300006237 | Bacteria | 2332 |
| 232 | Ga0097621_100127925 | 3300006237 | Bacteria | 2159 |
| 233 | Ga0097621_100151163 | 3300006237 | Bacteria | 1991 |
| 234 | Ga0097621_100261013 | 3300006237 | Bacteria | 1520 |
| 235 | Ga0097621_100448750 | 3300006237 | Bacteria | 1162 |
| 236 | Ga0097621_100511638 | 3300006237 | Bacteria | 1089 |
| 237 | Ga0075370_10016919 | 3300006353 | Bacteria | 3932 |
| 238 | Ga0075370_10043907 | 3300006353 | Bacteria | 2526 |
| 239 | Ga0068871_100232424 | 3300006358 | Bacteria | 1600 |
| 240 | Ga0068871_100233898 | 3300006358 | Bacteria | 1596 |
| 241 | Ga0068871_100326793 | 3300006358 | Bacteria | 1352 |
| 242 | Ga0068871_100807853 | 3300006358 | Bacteria | 865 |
| 243 | Ga0075428_100065933 | 3300006844 | Bacteria | 3965 |
| 244 | Ga0075434_100094092 | 3300006871 | Bacteria | 3001 |
| 245 | Ga0075434_100622146 | 3300006871 | Bacteria | 1098 |
| 246 | Ga0068865_100112101 | 3300006881 | Bacteria | 2014 |
| 247 | Ga0068865_100220213 | 3300006881 | Bacteria | 1483 |
| 248 | Ga0097620_100022345 | 3300006931 | Bacteria | 6342 |
| 249 | Ga0097620_100022663 | 3300006931 | Bacteria | 6296 |
| 250 | Ga0097620_100051875 | 3300006931 | Bacteria | 4124 |
| 251 | Ga0097620_100079166 | 3300006931 | Bacteria | 3326 |
| 252 | Ga0097620_100695825 | 3300006931 | Bacteria | 1107 |
| 253 | Ga0097620_100749440 | 3300006931 | Bacteria | 1065 |
| 254 | Ga0097620_100806340 | 3300006931 | Bacteria | 1026 |
| 255 | Ga0099824_1023507 | 3300006942 | Bacteria | 3807 |
| 256 | Ga0099822_1054190 | 3300006943 | Bacteria | 1532 |
| 257 | Ga0099823_1056087 | 3300006944 | Bacteria | 2211 |
| 258 | Ga0075435_100236741 | 3300007076 | Bacteria | 1552 |
| 259 | Ga0099794_10024766 | 3300007265 | Bacteria | 2758 |
| 260 | Ga0099794_10034930 | 3300007265 | Bacteria | 2371 |
| 261 | Ga0099795_10111393 | 3300007788 | Bacteria | 1085 |
| 262 | Ga0105250_10033561 | 3300009092 | Bacteria | 2061 |
| 263 | Ga0105240_10015188 | 3300009093 | Bacteria | 10478 |
| 264 | Ga0105240_10031599 | 3300009093 | Bacteria | 6863 |
| 265 | Ga0105240_10210792 | 3300009093 | Bacteria | 2270 |
| 266 | Ga0105240_11069458 | 3300009093 | Bacteria | 860 |
| 267 | Ga0111539_10279995 | 3300009094 | Bacteria | 1941 |
| 268 | Ga0111539_10319964 | 3300009094 | Bacteria | 1805 |
| 269 | Ga0105245_10015268 | 3300009098 | Bacteria | 6692 |
| 270 | Ga0105245_10044536 | 3300009098 | Bacteria | 3961 |
| 271 | Ga0105245_10070764 | 3300009098 | Bacteria | 3167 |
| 272 | Ga0105245_10082045 | 3300009098 | Bacteria | 2949 |
| 273 | Ga0105245_10175532 | 3300009098 | Bacteria | 2043 |
| 274 | Ga0105247_10023373 | 3300009101 | Bacteria | 3724 |
| 275 | Ga0105247_10099588 | 3300009101 | Bacteria | 1857 |
| 276 | Ga0114129_10045050 | 3300009147 | Bacteria | 6202 |
| 277 | Ga0114129_11856830 | 3300009147 | Bacteria | 731 |
| 278 | Ga0105243_10020983 | 3300009148 | Bacteria | 4957 |
| 279 | Ga0105243_10044783 | 3300009148 | Bacteria | 3474 |
| 280 | Ga0105243_10076810 | 3300009148 | Bacteria | 2715 |
| 281 | Ga0105243_10417760 | 3300009148 | Bacteria | 1250 |
| 282 | Ga0105243_10567541 | 3300009148 | Bacteria | 1087 |
| 283 | Ga0105241_10010573 | 3300009174 | Bacteria | 6771 |
| 284 | Ga0105241_10013936 | 3300009174 | Bacteria | 5892 |
| 285 | Ga0105241_10038188 | 3300009174 | Bacteria | 3620 |
| 286 | Ga0105242_10057194 | 3300009176 | Bacteria | 3192 |
| 287 | Ga0105242_10089119 | 3300009176 | Bacteria | 2592 |
| 288 | Ga0105242_10984324 | 3300009176 | Bacteria | 850 |
| 289 | Ga0105248_10026062 | 3300009177 | Bacteria | 6505 |
| 290 | Ga0105248_10090673 | 3300009177 | Bacteria | 3442 |
| 291 | Ga0105248_10158216 | 3300009177 | Bacteria | 2556 |
| 292 | Ga0105248_10241458 | 3300009177 | Bacteria | 2034 |
| 293 | Ga0105248_10298373 | 3300009177 | Bacteria | 1815 |
| 294 | Ga0105237_10004211 | 3300009545 | Bacteria | 16746 |
| 295 | Ga0105237_10006317 | 3300009545 | Bacteria | 13172 |
| 296 | Ga0105237_10059054 | 3300009545 | Bacteria | 3838 |
| 297 | Ga0105237_10139841 | 3300009545 | Bacteria | 2415 |
| 298 | Ga0105237_10170955 | 3300009545 | Bacteria | 2173 |
| 299 | Ga0105237_10264365 | 3300009545 | Bacteria | 1723 |
| 300 | Ga0105238_10044483 | 3300009551 | Bacteria | 4488 |
| 301 | Ga0105238_10076894 | 3300009551 | Bacteria | 3330 |
| 302 | Ga0105238_10275422 | 3300009551 | Bacteria | 1663 |
| 303 | Ga0105238_10405076 | 3300009551 | Bacteria | 1358 |
| 304 | Ga0105249_10045684 | 3300009553 | Bacteria | 3984 |
| 305 | Ga0105249_10129091 | 3300009553 | Bacteria | 2411 |
| 306 | Ga0105249_10144812 | 3300009553 | Bacteria | 2282 |
| 307 | Ga0105249_10258619 | 3300009553 | Bacteria | 1729 |
| 308 | Ga0105249_10350444 | 3300009553 | Bacteria | 1496 |
| 309 | Ga0105249_10764859 | 3300009553 | Bacteria | 1029 |
| 310 | Ga0099796_10199126 | 3300010159 | Bacteria | 812 |
| 311 | Ga0105239_10007324 | 3300010375 | Bacteria | 12668 |
| 312 | Ga0105239_10043843 | 3300010375 | Bacteria | 4905 |
| 313 | Ga0105239_10101961 | 3300010375 | Bacteria | 3176 |
| 314 | Ga0105239_10102612 | 3300010375 | Bacteria | 3165 |
| 315 | Ga0105239_10186840 | 3300010375 | Bacteria | 2319 |
| 316 | Ga0105239_10187191 | 3300010375 | Bacteria | 2317 |
| 317 | Ga0105239_10235261 | 3300010375 | Bacteria | 2056 |
| 318 | Ga0105239_10593912 | 3300010375 | Bacteria | 1263 |
| 319 | Ga0105239_10688587 | 3300010375 | Bacteria | 1169 |
| 320 | Ga0105246_10007577 | 3300011119 | Bacteria | 6660 |
| 321 | Ga0105246_10074364 | 3300011119 | Bacteria | 2402 |
| 322 | Ga0105246_10301879 | 3300011119 | Bacteria | 1293 |
| 323 | Ga0157370_10561219 | 3300013104 | Bacteria | 1046 |
| 324 | Ga0157369_10355444 | 3300013105 | Bacteria | 1521 |
| 325 | Ga0157374_10003708 | 3300013296 | Bacteria | 12840 |
| 326 | Ga0157378_10000706 | 3300013297 | Bacteria | 31286 |
| 327 | Ga0157378_10009737 | 3300013297 | Bacteria | 8373 |
| 328 | Ga0157378_10036769 | 3300013297 | Bacteria | 4333 |
| 329 | Ga0157378_10074982 | 3300013297 | Bacteria | 3045 |
| 330 | Ga0157378_10187155 | 3300013297 | Bacteria | 1951 |
| 331 | Ga0157378_10548319 | 3300013297 | Bacteria | 1161 |
| 332 | Ga0163162_10005573 | 3300013306 | Bacteria | 12181 |
| 333 | Ga0163162_10006254 | 3300013306 | Bacteria | 11543 |
| 334 | Ga0163162_10124380 | 3300013306 | Bacteria | 2685 |
| 335 | Ga0163162_10444229 | 3300013306 | Bacteria | 1429 |
| 336 | Ga0163162_10511344 | 3300013306 | Bacteria | 1331 |
| 337 | Ga0157372_10259451 | 3300013307 | Bacteria | 2018 |
| 338 | Ga0157375_10240474 | 3300013308 | Bacteria | 1970 |
| 339 | Ga0157375_10255052 | 3300013308 | Bacteria | 1915 |
| 340 | Ga0157375_10329718 | 3300013308 | Bacteria | 1691 |
| 341 | Ga0157375_10452476 | 3300013308 | Bacteria | 1450 |
| 342 | Ga0157375_10511498 | 3300013308 | Bacteria | 1364 |
| 343 | Ga0157375_10779039 | 3300013308 | Bacteria | 1106 |
| 344 | Ga0163163_10027833 | 3300014325 | Bacteria | 5420 |
| 345 | Ga0163163_10073241 | 3300014325 | Bacteria | 3416 |
| 346 | Ga0163163_10095731 | 3300014325 | Bacteria | 2989 |
| 347 | Ga0163163_10372665 | 3300014325 | Bacteria | 1485 |
| 348 | Ga0163163_10588260 | 3300014325 | Bacteria | 1176 |
| 349 | Ga0163163_10677597 | 3300014325 | Bacteria | 1095 |
| 350 | Ga0157380_10022035 | 3300014326 | Bacteria | 4787 |
| 351 | Ga0157380_10191261 | 3300014326 | Bacteria | 1807 |
| 352 | Ga0157380_10384866 | 3300014326 | Bacteria | 1325 |
| 353 | Ga0157379_10122531 | 3300014968 | Bacteria | 2339 |
| 354 | Ga0157379_10545095 | 3300014968 | Bacteria | 1079 |
| 355 | Ga0157376_10038827 | 3300014969 | Bacteria | 3877 |
| 356 | Ga0157376_10346421 | 3300014969 | Bacteria | 1420 |
| 357 | Ga0157376_10346721 | 3300014969 | Bacteria | 1420 |
| 358 | Ga0182006_1120839 | 3300015261 | Bacteria | 910 |
| 359 | Ga0163161_10106416 | 3300017792 | Bacteria | 2093 |
| 360 | Ga0163161_10358607 | 3300017792 | Bacteria | 1161 |
| 361 | Ga0163161_10653284 | 3300017792 | Bacteria | 872 |
| 362 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 363 | Ga0214542_1000606 | 3300021321 | Bacteria | 66272 |
| 364 | Ga0214542_1031903 | 3300021321 | Bacteria | 1914 |
| 365 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 366 | Ga0214545_1024560 | 3300021324 | Bacteria | 3687 |
| 367 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 368 | Ga0214543_1026447 | 3300021327 | Bacteria | 3119 |
| 369 | Ga0213873_10001201 | 3300021358 | Bacteria | 4249 |
| 370 | Ga0213872_10141816 | 3300021361 | Bacteria | 1054 |
| 371 | Ga0213874_10090067 | 3300021377 | Bacteria | 1006 |
| 372 | Ga0213876_10000880 | 3300021384 | Bacteria | 20080 |
| 373 | Ga0209563_101250 | 3300025230 | Bacteria | 6974 |
| 374 | Ga0209677_100502 | 3300025253 | Bacteria | 22034 |
| 375 | Ga0209677_104007 | 3300025253 | Bacteria | 4448 |
| 376 | Ga0209148_1000479 | 3300025254 | Bacteria | 42062 |
| 377 | Ga0209148_1008698 | 3300025254 | Bacteria | 2026 |
| 378 | Ga0209233_1010455 | 3300025261 | Bacteria | 2780 |
| 379 | Ga0209233_1016085 | 3300025261 | Bacteria | 2068 |
| 380 | Ga0209455_1001925 | 3300025272 | Bacteria | 8587 |
| 381 | Ga0209455_1004461 | 3300025272 | Bacteria | 4574 |
| 382 | Ga0209455_1030492 | 3300025272 | Bacteria | 918 |
| 383 | Ga0209564_1007279 | 3300025295 | Bacteria | 5745 |
| 384 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 385 | Ga0209758_1000120 | 3300025297 | Bacteria | 192212 |
| 386 | Ga0209758_1002106 | 3300025297 | Bacteria | 21111 |
| 387 | Ga0209758_1002858 | 3300025297 | Bacteria | 16762 |
| 388 | Ga0209758_1010292 | 3300025297 | Bacteria | 5623 |
| 389 | Ga0209758_1018402 | 3300025297 | Bacteria | 3424 |
| 390 | Ga0209758_1022083 | 3300025297 | Bacteria | 2936 |
| 391 | Ga0209758_1037364 | 3300025297 | Bacteria | 1878 |
| 392 | Ga0209758_1039361 | 3300025297 | Bacteria | 1799 |
| 393 | Ga0209758_1053333 | 3300025297 | Bacteria | 1390 |
| 394 | Ga0209256_1001013 | 3300025299 | Bacteria | 33164 |
| 395 | Ga0207426_1000458 | 3300025302 | Bacteria | 64019 |
| 396 | Ga0207426_1001218 | 3300025302 | Bacteria | 22703 |
| 397 | Ga0207426_1003017 | 3300025302 | Bacteria | 9768 |
| 398 | Ga0207426_1004317 | 3300025302 | Bacteria | 7004 |
| 399 | Ga0207426_1020535 | 3300025302 | Bacteria | 2294 |
| 400 | Ga0209257_1004704 | 3300025304 | Bacteria | 10245 |
| 401 | Ga0209257_1016464 | 3300025304 | Bacteria | 2990 |
| 402 | Ga0209257_1017778 | 3300025304 | Bacteria | 2779 |
| 403 | Ga0207697_10083591 | 3300025315 | Bacteria | 1347 |
| 404 | Ga0207653_10080280 | 3300025885 | Bacteria | 1128 |
| 405 | Ga0207692_10000790 | 3300025898 | Bacteria | 11241 |
| 406 | Ga0207692_10001383 | 3300025898 | Bacteria | 9068 |
| 407 | Ga0207692_10088053 | 3300025898 | Bacteria | 1677 |
| 408 | Ga0207642_10025888 | 3300025899 | Bacteria | 2380 |
| 409 | Ga0207642_10098867 | 3300025899 | Bacteria | 1460 |
| 410 | Ga0207710_10212420 | 3300025900 | Bacteria | 958 |
| 411 | Ga0207688_10005552 | 3300025901 | Bacteria | 6859 |
| 412 | Ga0207688_10110563 | 3300025901 | Bacteria | 1595 |
| 413 | Ga0207688_10496014 | 3300025901 | Bacteria | 764 |
| 414 | Ga0207680_10319535 | 3300025903 | Bacteria | 1085 |
| 415 | Ga0207647_10001853 | 3300025904 | Bacteria | 16209 |
| 416 | Ga0207647_10277469 | 3300025904 | Bacteria | 957 |
| 417 | Ga0207685_10013251 | 3300025905 | Bacteria | 2545 |
| 418 | Ga0207685_10069996 | 3300025905 | Bacteria | 1419 |
| 419 | Ga0207685_10118488 | 3300025905 | Bacteria | 1158 |
| 420 | Ga0207699_10018415 | 3300025906 | Bacteria | 3700 |
| 421 | Ga0207699_10038002 | 3300025906 | Bacteria | 2755 |
| 422 | Ga0207699_10101858 | 3300025906 | Bacteria | 1824 |
| 423 | Ga0207699_10322282 | 3300025906 | Bacteria | 1084 |
| 424 | Ga0207645_10079819 | 3300025907 | Bacteria | 2097 |
| 425 | Ga0207645_10162395 | 3300025907 | Bacteria | 1462 |
| 426 | Ga0207643_10057555 | 3300025908 | Bacteria | 2213 |
| 427 | Ga0207684_10156077 | 3300025910 | Bacteria | 1964 |
| 428 | Ga0207684_10167474 | 3300025910 | Bacteria | 1894 |
| 429 | Ga0207654_10026270 | 3300025911 | Bacteria | 3151 |
| 430 | Ga0207654_10156360 | 3300025911 | Bacteria | 1469 |
| 431 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 432 | Ga0207695_10024377 | 3300025913 | Bacteria | 6810 |
| 433 | Ga0207671_10011583 | 3300025914 | Bacteria | 7163 |
| 434 | Ga0207671_10160589 | 3300025914 | Bacteria | 1740 |
| 435 | Ga0207671_10178443 | 3300025914 | Bacteria | 1652 |
| 436 | Ga0207693_10000259 | 3300025915 | Bacteria | 48819 |
| 437 | Ga0207693_10001116 | 3300025915 | Bacteria | 24102 |
| 438 | Ga0207693_10034331 | 3300025915 | Bacteria | 4001 |
| 439 | Ga0207693_10080664 | 3300025915 | Bacteria | 2547 |
| 440 | Ga0207693_10094297 | 3300025915 | Bacteria | 2346 |
| 441 | Ga0207693_10184221 | 3300025915 | Bacteria | 1644 |
| 442 | Ga0207663_10001316 | 3300025916 | Bacteria | 11488 |
| 443 | Ga0207663_10018614 | 3300025916 | Bacteria | 3896 |
| 444 | Ga0207663_10024383 | 3300025916 | Bacteria | 3483 |
| 445 | Ga0207663_10046659 | 3300025916 | Bacteria | 2670 |
| 446 | Ga0207663_10109442 | 3300025916 | Bacteria | 1873 |
| 447 | Ga0207663_10156229 | 3300025916 | Bacteria | 1605 |
| 448 | Ga0207663_10390662 | 3300025916 | Bacteria | 1062 |
| 449 | Ga0207660_10146484 | 3300025917 | Bacteria | 1810 |
| 450 | Ga0207649_10060907 | 3300025920 | Bacteria | 2373 |
| 451 | Ga0207652_10210825 | 3300025921 | Bacteria | 1749 |
| 452 | Ga0207681_10047012 | 3300025923 | Bacteria | 2905 |
| 453 | Ga0207694_10243554 | 3300025924 | Bacteria | 1470 |
| 454 | Ga0207694_10383732 | 3300025924 | Bacteria | 1166 |
| 455 | Ga0207694_10581223 | 3300025924 | Bacteria | 941 |
| 456 | Ga0207694_10784059 | 3300025924 | Bacteria | 805 |
| 457 | Ga0207650_10556215 | 3300025925 | Bacteria | 962 |
| 458 | Ga0207659_10081566 | 3300025926 | Bacteria | 2392 |
| 459 | Ga0207659_10878950 | 3300025926 | Bacteria | 771 |
| 460 | Ga0207687_10006921 | 3300025927 | Bacteria | 7470 |
| 461 | Ga0207687_10039149 | 3300025927 | Bacteria | 3244 |
| 462 | Ga0207687_10046631 | 3300025927 | Bacteria | 3001 |
| 463 | Ga0207687_10217950 | 3300025927 | Bacteria | 1501 |
| 464 | Ga0207687_10690745 | 3300025927 | Bacteria | 865 |
| 465 | Ga0207700_10010667 | 3300025928 | Bacteria | 5812 |
| 466 | Ga0207700_10012013 | 3300025928 | Bacteria | 5558 |
| 467 | Ga0207700_10120282 | 3300025928 | Bacteria | 2128 |
| 468 | Ga0207700_10170688 | 3300025928 | Bacteria | 1814 |
| 469 | Ga0207700_10252814 | 3300025928 | Bacteria | 1506 |
| 470 | Ga0207700_10486708 | 3300025928 | Bacteria | 1091 |
| 471 | Ga0207700_10891748 | 3300025928 | Bacteria | 796 |
| 472 | Ga0207664_10008672 | 3300025929 | Bacteria | 7109 |
| 473 | Ga0207664_10474688 | 3300025929 | Bacteria | 1118 |
| 474 | Ga0207644_10228671 | 3300025931 | Bacteria | 1477 |
| 475 | Ga0207644_10240604 | 3300025931 | Bacteria | 1441 |
| 476 | Ga0207644_10679375 | 3300025931 | Bacteria | 858 |
| 477 | Ga0207690_10284874 | 3300025932 | Bacteria | 1288 |
| 478 | Ga0207706_10158982 | 3300025933 | Bacteria | 1987 |
| 479 | Ga0207706_10169631 | 3300025933 | Bacteria | 1918 |
| 480 | Ga0207706_10188478 | 3300025933 | Bacteria | 1811 |
| 481 | Ga0207686_10497615 | 3300025934 | Bacteria | 945 |
| 482 | Ga0207709_10050566 | 3300025935 | Bacteria | 2543 |
| 483 | Ga0207709_10105981 | 3300025935 | Bacteria | 1869 |
| 484 | Ga0207709_10219030 | 3300025935 | Bacteria | 1371 |
| 485 | Ga0207670_10138034 | 3300025936 | Bacteria | 1795 |
| 486 | Ga0207670_10536302 | 3300025936 | Bacteria | 954 |
| 487 | Ga0207669_10029306 | 3300025937 | Bacteria | 3042 |
| 488 | Ga0207704_10118053 | 3300025938 | Bacteria | 1808 |
| 489 | Ga0207704_10143723 | 3300025938 | Bacteria | 1673 |
| 490 | Ga0207665_10000974 | 3300025939 | Bacteria | 19386 |
| 491 | Ga0207665_10002524 | 3300025939 | Bacteria | 12316 |
| 492 | Ga0207665_10046557 | 3300025939 | Bacteria | 2906 |
| 493 | Ga0207665_10101547 | 3300025939 | Bacteria | 2009 |
| 494 | Ga0207691_10025071 | 3300025940 | Bacteria | 5602 |
| 495 | Ga0207691_10136529 | 3300025940 | Bacteria | 2163 |
| 496 | Ga0207691_10179571 | 3300025940 | Bacteria | 1850 |
| 497 | Ga0207711_10044329 | 3300025941 | Bacteria | 3797 |
| 498 | Ga0207711_10476850 | 3300025941 | Bacteria | 1162 |
| 499 | Ga0207689_10007828 | 3300025942 | Bacteria | 9342 |
| 500 | Ga0207689_10071057 | 3300025942 | Bacteria | 2859 |
| 501 | Ga0207689_10199445 | 3300025942 | Bacteria | 1652 |
| 502 | Ga0207661_10074658 | 3300025944 | Bacteria | 2780 |
| 503 | Ga0207679_10283829 | 3300025945 | Bacteria | 1421 |
| 504 | Ga0207667_10028236 | 3300025949 | Bacteria | 6096 |
| 505 | Ga0207667_10255377 | 3300025949 | Bacteria | 1793 |
| 506 | Ga0207651_10095089 | 3300025960 | Bacteria | 2193 |
| 507 | Ga0207651_10652301 | 3300025960 | Bacteria | 924 |
| 508 | Ga0207712_10029555 | 3300025961 | Bacteria | 3678 |
| 509 | Ga0207712_10076093 | 3300025961 | Bacteria | 2428 |
| 510 | Ga0207712_10127903 | 3300025961 | Bacteria | 1932 |
| 511 | Ga0207668_10003594 | 3300025972 | Bacteria | 9112 |
| 512 | Ga0207668_10124817 | 3300025972 | Bacteria | 1955 |
| 513 | Ga0207668_10679568 | 3300025972 | Bacteria | 903 |
| 514 | Ga0207640_10028073 | 3300025981 | Bacteria | 3436 |
| 515 | Ga0207640_10159619 | 3300025981 | Bacteria | 1667 |
| 516 | Ga0207640_10326608 | 3300025981 | Bacteria | 1223 |
| 517 | Ga0207658_10148644 | 3300025986 | Bacteria | 1906 |
| 518 | Ga0207658_10825971 | 3300025986 | Bacteria | 842 |
| 519 | Ga0207677_10040545 | 3300026023 | Bacteria | 3071 |
| 520 | Ga0207677_10164390 | 3300026023 | Bacteria | 1728 |
| 521 | Ga0207703_10051105 | 3300026035 | Bacteria | 3348 |
| 522 | Ga0207703_10447117 | 3300026035 | Bacteria | 1206 |
| 523 | Ga0207703_10565312 | 3300026035 | Bacteria | 1073 |
| 524 | Ga0207703_10577006 | 3300026035 | Bacteria | 1062 |
| 525 | Ga0207703_10798815 | 3300026035 | Bacteria | 901 |
| 526 | Ga0207703_11011197 | 3300026035 | Bacteria | 798 |
| 527 | Ga0207639_10166335 | 3300026041 | Bacteria | 1863 |
| 528 | Ga0207639_10492971 | 3300026041 | Bacteria | 1118 |
| 529 | Ga0207639_10612664 | 3300026041 | Bacteria | 1005 |
| 530 | Ga0207678_10010880 | 3300026067 | Bacteria | 7995 |
| 531 | Ga0207678_10012486 | 3300026067 | Bacteria | 7459 |
| 532 | Ga0207678_10013604 | 3300026067 | Bacteria | 7148 |
| 533 | Ga0207678_10018553 | 3300026067 | Bacteria | 6108 |
| 534 | Ga0207678_10019226 | 3300026067 | Bacteria | 5999 |
| 535 | Ga0207678_10020798 | 3300026067 | Bacteria | 5751 |
| 536 | Ga0207678_10033429 | 3300026067 | Bacteria | 4480 |
| 537 | Ga0207678_10040116 | 3300026067 | Bacteria | 4061 |
| 538 | Ga0207678_10044384 | 3300026067 | Bacteria | 3845 |
| 539 | Ga0207678_10364503 | 3300026067 | Bacteria | 1247 |
| 540 | Ga0207678_10489274 | 3300026067 | Bacteria | 1072 |
| 541 | Ga0207708_10084208 | 3300026075 | Bacteria | 2445 |
| 542 | Ga0207708_10140832 | 3300026075 | Bacteria | 1892 |
| 543 | Ga0207702_10123822 | 3300026078 | Bacteria | 2317 |
| 544 | Ga0207702_10143887 | 3300026078 | Bacteria | 2161 |
| 545 | Ga0207702_10299862 | 3300026078 | Bacteria | 1525 |
| 546 | Ga0207648_10023917 | 3300026089 | Bacteria | 5461 |
| 547 | Ga0207648_10218683 | 3300026089 | Bacteria | 1693 |
| 548 | Ga0207648_10235485 | 3300026089 | Bacteria | 1629 |
| 549 | Ga0207676_10220663 | 3300026095 | Bacteria | 1688 |
| 550 | Ga0207676_10477062 | 3300026095 | Bacteria | 1181 |
| 551 | Ga0207676_10551609 | 3300026095 | Bacteria | 1101 |
| 552 | Ga0207674_10021271 | 3300026116 | Bacteria | 6992 |
| 553 | Ga0207675_100013202 | 3300026118 | Bacteria | 7709 |
| 554 | Ga0207675_100024684 | 3300026118 | Bacteria | 5590 |
| 555 | Ga0207675_100026976 | 3300026118 | Bacteria | 5348 |
| 556 | Ga0207675_100326577 | 3300026118 | Bacteria | 1499 |
| 557 | Ga0207675_100338233 | 3300026118 | Bacteria | 1473 |
| 558 | Ga0207675_100383865 | 3300026118 | Bacteria | 1382 |
| 559 | Ga0207675_101131000 | 3300026118 | Bacteria | 803 |
| 560 | Ga0207683_10024719 | 3300026121 | Bacteria | 5176 |
| 561 | Ga0207683_10074586 | 3300026121 | Bacteria | 3001 |
| 562 | Ga0207683_10257376 | 3300026121 | Bacteria | 1593 |
| 563 | Ga0207683_10297532 | 3300026121 | Bacteria | 1476 |
| 564 | Ga0207683_10378775 | 3300026121 | Bacteria | 1300 |
| 565 | Ga0207683_10435442 | 3300026121 | Bacteria | 1208 |
| 566 | Ga0207683_10737527 | 3300026121 | Bacteria | 914 |
| 567 | Ga0207698_10025711 | 3300026142 | Bacteria | 4152 |
| 568 | Ga0207698_10115985 | 3300026142 | Bacteria | 2256 |
| 569 | Ga0207698_10129425 | 3300026142 | Bacteria | 2154 |
| 570 | Ga0209389_1000077 | 3300027296 | Bacteria | 91273 |
| 571 | Ga0209389_1000097 | 3300027296 | Bacteria | 80338 |
| 572 | Ga0209589_1000132 | 3300027357 | Bacteria | 80338 |
| 573 | Ga0209489_100251 | 3300027361 | Bacteria | 91273 |
| 574 | Ga0209489_100368 | 3300027361 | Bacteria | 80342 |
| 575 | Ga0209700_100271 | 3300027363 | Bacteria | 91215 |
| 576 | Ga0209179_1058156 | 3300027512 | Bacteria | 837 |
| 577 | Ga0209588_1001815 | 3300027671 | Bacteria | 5681 |
| 578 | Ga0209813_10024797 | 3300027866 | Bacteria | 1719 |
| 579 | Ga0207428_10169993 | 3300027907 | Bacteria | 1651 |
| 580 | Ga0268266_10000857 | 3300028379 | Bacteria | 39606 |
| 581 | Ga0268266_10007117 | 3300028379 | Bacteria | 10147 |
| 582 | Ga0268266_10029071 | 3300028379 | Bacteria | 4698 |
| 583 | Ga0268266_10226857 | 3300028379 | Bacteria | 1719 |
| 584 | Ga0268266_10259992 | 3300028379 | Bacteria | 1608 |
| 585 | Ga0268266_10378623 | 3300028379 | Bacteria | 1334 |
| 586 | Ga0268266_10386034 | 3300028379 | Bacteria | 1322 |
| 587 | Ga0268266_10390879 | 3300028379 | Bacteria | 1313 |
| 588 | Ga0268265_10027618 | 3300028380 | Bacteria | 4053 |
| 589 | Ga0268265_10215720 | 3300028380 | Bacteria | 1675 |
| 590 | Ga0268265_10223949 | 3300028380 | Bacteria | 1648 |
| 591 | Ga0268265_10355229 | 3300028380 | Bacteria | 1339 |
| 592 | Ga0268264_10000030 | 3300028381 | Bacteria | 418542 |
| 593 | Ga0268264_10087254 | 3300028381 | Bacteria | 2682 |
| 594 | Ga0268264_10171755 | 3300028381 | Bacteria | 1961 |
| 595 | Ga0265337_1002404 | 3300028556 | Bacteria | 8612 |
| 596 | Ga0265334_10008556 | 3300028573 | Bacteria | 4346 |
| 597 | Ga0265334_10009569 | 3300028573 | Bacteria | 4100 |
| 598 | Ga0265334_10012351 | 3300028573 | Bacteria | 3590 |
| 599 | Ga0265323_10000276 | 3300028653 | Bacteria | 29667 |
| 600 | Ga0265336_10000268 | 3300028666 | Bacteria | 36633 |
| 601 | Ga0307517_10001951 | 3300028786 | Bacteria | 33688 |
| 602 | Ga0307517_10121022 | 3300028786 | Bacteria | 1935 |
| 603 | Ga0307517_10208587 | 3300028786 | Bacteria | 1208 |
| 604 | Ga0307515_10023166 | 3300028794 | Bacteria | 10898 |
| 605 | Ga0265338_10000280 | 3300028800 | Bacteria | 91942 |
| 606 | Ga0265324_10003108 | 3300029957 | Bacteria | 8093 |
| 607 | Ga0265763_1003008 | 3300030763 | Bacteria | 1319 |
| 608 | Ga0265330_10020175 | 3300031235 | Bacteria | 3046 |
| 609 | Ga0265332_10071251 | 3300031238 | Bacteria | 1480 |
| 610 | Ga0265332_10082669 | 3300031238 | Bacteria | 1362 |
| 611 | Ga0265340_10083545 | 3300031247 | Bacteria | 1500 |
| 612 | Ga0265340_10219543 | 3300031247 | Bacteria | 852 |
| 613 | Ga0265316_10513737 | 3300031344 | Bacteria | 855 |
| 614 | Ga0307508_10000015 | 3300031616 | Bacteria | 210182 |
| 615 | Ga0307508_10087619 | 3300031616 | Bacteria | 2697 |
| 616 | Ga0307508_10178537 | 3300031616 | Bacteria | 1726 |
| 617 | Ga0307508_10501094 | 3300031616 | Bacteria | 809 |
| 618 | Ga0265342_10049653 | 3300031712 | Bacteria | 2510 |
| 619 | Ga0307516_10005336 | 3300031730 | Bacteria | 15451 |
| 620 | Ga0307516_10018310 | 3300031730 | Bacteria | 7282 |
| 621 | Ga0307516_10024596 | 3300031730 | Bacteria | 6150 |
| 622 | Ga0307516_10102338 | 3300031730 | Bacteria | 2679 |
| 623 | Ga0307405_10418501 | 3300031731 | Bacteria | 1054 |
| 624 | Ga0307413_10006217 | 3300031824 | Bacteria | 5426 |
| 625 | Ga0307410_10612720 | 3300031852 | Bacteria | 909 |
| 626 | Ga0307409_100163143 | 3300031995 | Bacteria | 1952 |
| 627 | Ga0307416_100523804 | 3300032002 | Bacteria | 1254 |
| 628 | Ga0307411_10106497 | 3300032005 | Bacteria | 1996 |
| 629 | Ga0307411_10113700 | 3300032005 | Bacteria | 1943 |
| 630 | Ga0307507_10047307 | 3300033179 | Bacteria | 4203 |
| 631 | Ga0307510_10006778 | 3300033180 | Bacteria | 13657 |
| 632 | Ga0307510_10014911 | 3300033180 | Bacteria | 9191 |
| 633 | Ga0307510_10044432 | 3300033180 | Bacteria | 4812 |
| 634 | Ga0307510_10162952 | 3300033180 | Bacteria | 1823 |
| 635 | Ga0307510_10400293 | 3300033180 | Bacteria | 816 |
| 636 | Ga0373938_0008929 | 3300034957 | Bacteria | 1802 |
| 637 | Ga0373926_0110107 | 3300035083 | Bacteria | 1034 |
| 638 | Ga0373926_0125307 | 3300035083 | Bacteria | 970 |
| 639 | Ga0373934_0001348 | 3300035086 | Bacteria | 8949 |
| 640 | Ga0373923_0004069 | 3300035111 | Bacteria | 4805 |
| 641 | Ga0373923_0019072 | 3300035111 | Bacteria | 2650 |
| 642 | Ga0373923_0182118 | 3300035111 | Bacteria | 966 |
| 643 | Ga0373932_0039456 | 3300035112 | Bacteria | 1354 |
| 644 | Ga0373932_0058953 | 3300035112 | Bacteria | 1161 |
| 645 | Ga0373936_0002506 | 3300035113 | Bacteria | 6885 |
| 646 | Ga0373936_0032337 | 3300035113 | Bacteria | 2069 |
| 647 | Ga0373936_0089117 | 3300035113 | Bacteria | 1292 |
| 648 | Ga0373945_0086052 | 3300035116 | Bacteria | 1211 |
| 649 | Ga0373953_0000092 | 3300035117 | Bacteria | 21395 |
| 650 | Ga0373954_0000223 | 3300035118 | Bacteria | 20807 |
| 651 | Ga0373956_0002691 | 3300035119 | Bacteria | 7194 |
| 652 | Ga0373957_0002000 | 3300035120 | Bacteria | 5693 |
| 653 | Ga0373943_0008846 | 3300035170 | Bacteria | 4509 |
| 654 | Ga0373946_0001786 | 3300035171 | Bacteria | 7501 |
| 655 | Ga0373946_0024266 | 3300035171 | Bacteria | 2375 |
| 656 | Ga0373955_0001089 | 3300035172 | Bacteria | 11546 |
| 657 | Ga0373955_0059739 | 3300035172 | Bacteria | 2100 |
| 658 | Ga0373955_0150337 | 3300035172 | Bacteria | 1370 |
| 659 | Ga0373955_0271840 | 3300035172 | Bacteria | 1019 |
| 660 | Ga0373961_0065076 | 3300035241 | Bacteria | 1116 |
| 661 | Ga0373924_0001415 | 3300035410 | Bacteria | 7773 |
| 662 | Ga0373924_0030132 | 3300035410 | Bacteria | 2173 |
| 663 | Ga0373931_0028275 | 3300035691 | Bacteria | 2869 |
| 664 | Ga0373931_0246647 | 3300035691 | Bacteria | 1084 |
| 665 | Ga0373931_0361629 | 3300035691 | Bacteria | 911 |
| 666 | Ga0373931_0423484 | 3300035691 | Bacteria | 847 |
| 667 | Ga0373935_0000803 | 3300035692 | Bacteria | 16787 |
| 668 | Ga0373935_0012593 | 3300035692 | Bacteria | 5088 |
| 669 | Ga0373935_0079641 | 3300035692 | Bacteria | 2127 |
| 670 | Ga0373927_0001990 | 3300035695 | Bacteria | 15058 |
| 671 | Ga0373927_0021017 | 3300035695 | Bacteria | 4278 |
| 672 | Ga0373927_0021697 | 3300035695 | Bacteria | 4208 |
| 673 | Ga0373927_0032437 | 3300035695 | Bacteria | 3402 |
| 674 | Ga0373927_0051578 | 3300035695 | Bacteria | 2660 |
| 675 | Ga0373927_0236123 | 3300035695 | Bacteria | 1201 |
| 676 | Ga0373933_0000758 | 3300035724 | Bacteria | 19787 |
| 677 | Ga0373933_0027558 | 3300035724 | Bacteria | 3273 |
| 678 | Ga0373947_0000647 | 3300035725 | Bacteria | 20623 |
| 679 | Ga0373947_0166529 | 3300035725 | Bacteria | 1428 |
| 680 | Ga0310104_05893 | 3300036242 | Bacteria | 1046 |
| 681 | Ga0373937_0011287 | 3300036401 | Bacteria | 7835 |
| 682 | Ga0373937_0174880 | 3300036401 | Bacteria | 2015 |
| 683 | Ga0373937_0279464 | 3300036401 | Bacteria | 1576 |
| 684 | Ga0373937_0610044 | 3300036401 | Bacteria | 1036 |
| 685 | Ga0372808_010828 | 3300036459 | Bacteria | 1287 |
| 686 | Ga0373925_0001112 | 3300037068 | Bacteria | 23957 |
| 687 | Ga0373925_0007023 | 3300037068 | Bacteria | 8225 |
| 688 | Ga0373925_0141227 | 3300037068 | Bacteria | 1885 |
| 689 | Ga0373925_0148316 | 3300037068 | Bacteria | 1840 |
| 690 | Ga0373925_0286347 | 3300037068 | Bacteria | 1328 |
| 691 | Ga0373925_0330287 | 3300037068 | Bacteria | 1235 |
| 692 | Ga0395900_0001310 | 3300037418 | Bacteria | 30209 |
| 693 | Ga0395900_0055509 | 3300037418 | Bacteria | 4079 |
| 694 | Ga0395900_0280357 | 3300037418 | Bacteria | 1659 |
| 695 | Ga0395898_0008958 | 3300037466 | Bacteria | 10537 |
| 696 | Ga0395898_0040336 | 3300037466 | Bacteria | 4617 |
| 697 | Ga0395905_0008401 | 3300037471 | Bacteria | 10182 |
| 698 | Ga0395905_0093170 | 3300037471 | Bacteria | 2825 |
| 699 | Ga0395905_0103015 | 3300037471 | Bacteria | 2680 |
| 700 | Ga0395905_0565963 | 3300037471 | Bacteria | 1038 |
| 701 | Ga0395901_0013467 | 3300038443 | Bacteria | 8315 |
| 702 | Ga0395901_0025727 | 3300038443 | Bacteria | 6042 |
| 703 | Ga0395901_0358871 | 3300038443 | Bacteria | 1503 |
| 704 | Ga0395901_0376709 | 3300038443 | Bacteria | 1461 |
| 705 | Ga0395901_0399117 | 3300038443 | Bacteria | 1413 |
| 706 | Ga0436365_0100896 | 3300039437 | Bacteria | 2615 |
| 707 | Ga0436365_1236739 | 3300039437 | Bacteria | 30341 |
| 708 | Ga0436365_1283747 | 3300039437 | Bacteria | 4018 |
| 709 | Ga0436361_0573481 | 3300039447 | Bacteria | 3919 |
| 710 | Ga0436361_1064158 | 3300039447 | Bacteria | 2934 |
| 711 | Ga0436363_1627615 | 3300039450 | Bacteria | 3231 |
| 712 | Ga0436362_0031186 | 3300039453 | Bacteria | 7569 |
| 713 | Ga0436362_0970189 | 3300039453 | Bacteria | 4268 |
| 714 | Ga0451802_0592381 | 3300041460 | Bacteria | 1243 |
| 715 | Ga0451835_0015839 | 3300041492 | Bacteria | 812 |
| 716 | Ga0451837_0899558 | 3300041494 | Bacteria | 803 |
| 717 | Ga0451847_0671333 | 3300041503 | Bacteria | 1125 |
| 718 | Ga0451853_3449489 | 3300041512 | Bacteria | 962 |
| 719 | Ga0451853_3581848 | 3300041512 | Bacteria | 1211 |
| 720 | Ga0451853_3998411 | 3300041512 | Bacteria | 1354 |
| 721 | Ga0439459_0052452 | 3300042438 | Bacteria | 900 |
| 722 | Ga0466969_0129516 | 3300044656 | Bacteria | 1170 |
| 723 | Ga0466969_0194011 | 3300044656 | Bacteria | 927 |
| 724 | Ga0466972_0001031 | 3300044658 | Bacteria | 13361 |
| 725 | Ga0466965_0228744 | 3300044683 | Bacteria | 993 |
| 726 | Ga0466966_0000191 | 3300044684 | Bacteria | 40906 |
| 727 | Ga0466966_0093402 | 3300044684 | Bacteria | 1866 |
| 728 | Ga0466961_0000005 | 3300044693 | Bacteria | 173105 |
| 729 | Ga0466963_0341100 | 3300044694 | Bacteria | 1055 |
| 730 | Ga0466964_0028100 | 3300044706 | Bacteria | 2214 |
| 731 | Ga0466970_0060878 | 3300044765 | Bacteria | 2022 |
| 732 | Ga0466970_0278525 | 3300044765 | Bacteria | 940 |
| 733 | Ga0466957_0056414 | 3300044842 | Bacteria | 2402 |
| 734 | Ga0466959_0000654 | 3300045049 | Bacteria | 20198 |
| 735 | Ga0466959_0084079 | 3300045049 | Bacteria | 2291 |
| 736 | Ga0466959_0167521 | 3300045049 | Bacteria | 1542 |
| 737 | Ga0495617_046188 | 3300046452 | Bacteria | 1451 |
| 738 | Ga0495592_0000714 | 3300046454 | Bacteria | 23202 |
| 739 | Ga0495592_0009461 | 3300046454 | Bacteria | 7327 |
| 740 | Ga0495592_0019732 | 3300046454 | Bacteria | 5128 |
| 741 | Ga0495603_0002274 | 3300046455 | Bacteria | 11278 |
| 742 | Ga0495603_0050885 | 3300046455 | Bacteria | 2463 |
| 743 | Ga0495603_0058358 | 3300046455 | Bacteria | 2282 |
| 744 | Ga0495603_0063119 | 3300046455 | Bacteria | 2186 |
| 745 | Ga0495603_0070565 | 3300046455 | Bacteria | 2053 |
| 746 | Ga0495603_0192505 | 3300046455 | Bacteria | 1179 |
| 747 | Ga0495629_0000533 | 3300046459 | Bacteria | 31488 |
| 748 | Ga0495629_0000585 | 3300046459 | Bacteria | 29571 |
| 749 | Ga0495629_0003982 | 3300046459 | Bacteria | 11105 |
| 750 | Ga0495638_0002117 | 3300046460 | Bacteria | 16743 |
| 751 | Ga0495641_0007833 | 3300046461 | Bacteria | 6612 |
| 752 | Ga0495651_0003125 | 3300046462 | Bacteria | 12770 |
| 753 | Ga0495651_0119678 | 3300046462 | Bacteria | 1936 |
| 754 | Ga0495651_0380230 | 3300046462 | Bacteria | 926 |
| 755 | Ga0495653_0000404 | 3300046463 | Bacteria | 34649 |
| 756 | Ga0495653_0042601 | 3300046463 | Bacteria | 3535 |
| 757 | Ga0495653_0143676 | 3300046463 | Bacteria | 1675 |
| 758 | Ga0495650_0027735 | 3300046471 | Bacteria | 2612 |
| 759 | Ga0495580_0000166 | 3300046472 | Bacteria | 48913 |
| 760 | Ga0495580_0148068 | 3300046472 | Bacteria | 1627 |
| 761 | Ga0495580_0285655 | 3300046472 | Bacteria | 1125 |
| 762 | Ga0495582_0002361 | 3300046473 | Bacteria | 10558 |
| 763 | Ga0495605_0059460 | 3300046474 | Bacteria | 1835 |
| 764 | Ga0495639_0000075 | 3300046475 | Bacteria | 46617 |
| 765 | Ga0495639_0048742 | 3300046475 | Bacteria | 1922 |
| 766 | Ga0495639_0082956 | 3300046475 | Bacteria | 1495 |
| 767 | Ga0495639_0096815 | 3300046475 | Bacteria | 1390 |
| 768 | Ga0495639_0146958 | 3300046475 | Bacteria | 1135 |
| 769 | Ga0495662_0000356 | 3300046476 | Bacteria | 20088 |
| 770 | Ga0495662_0124596 | 3300046476 | Bacteria | 1265 |
| 771 | Ga0495664_0057062 | 3300046477 | Bacteria | 2323 |
| 772 | Ga0495664_0207672 | 3300046477 | Bacteria | 1186 |
| 773 | Ga0495664_0367982 | 3300046477 | Bacteria | 865 |
| 774 | Ga0495584_0106574 | 3300046491 | Bacteria | 1417 |
| 775 | Ga0495585_0045348 | 3300046492 | Bacteria | 2454 |
| 776 | Ga0495585_0078928 | 3300046492 | Bacteria | 1785 |
| 777 | Ga0495585_0079894 | 3300046492 | Bacteria | 1773 |
| 778 | Ga0495594_0000120 | 3300046499 | Bacteria | 36823 |
| 779 | Ga0495594_0016464 | 3300046499 | Bacteria | 3895 |
| 780 | Ga0495594_0112587 | 3300046499 | Bacteria | 1535 |
| 781 | Ga0495594_0196800 | 3300046499 | Bacteria | 1149 |
| 782 | Ga0495583_0084632 | 3300046506 | Bacteria | 1374 |
| 783 | Ga0495606_0006293 | 3300046507 | Bacteria | 11004 |
| 784 | Ga0495606_0040781 | 3300046507 | Bacteria | 3118 |
| 785 | Ga0495606_0186378 | 3300046507 | Bacteria | 1192 |
| 786 | Ga0495608_0000932 | 3300046511 | Bacteria | 20541 |
| 787 | Ga0495608_0017146 | 3300046511 | Bacteria | 5013 |
| 788 | Ga0495618_0012136 | 3300046514 | Bacteria | 5229 |
| 789 | Ga0495618_0163946 | 3300046514 | Bacteria | 1416 |
| 790 | Ga0495618_0171842 | 3300046514 | Bacteria | 1379 |
| 791 | Ga0495620_0071298 | 3300046515 | Bacteria | 1421 |
| 792 | Ga0495620_0076224 | 3300046515 | Bacteria | 1363 |
| 793 | Ga0495628_0031051 | 3300046516 | Bacteria | 4321 |
| 794 | Ga0495628_0221072 | 3300046516 | Bacteria | 1422 |
| 795 | Ga0495628_0453242 | 3300046516 | Bacteria | 931 |
| 796 | Ga0495630_0001903 | 3300046517 | Bacteria | 14540 |
| 797 | Ga0495630_0059141 | 3300046517 | Bacteria | 2875 |
| 798 | Ga0495631_0176444 | 3300046518 | Bacteria | 916 |
| 799 | Ga0495644_0032459 | 3300046523 | Bacteria | 1973 |
| 800 | Ga0495648_0003336 | 3300046524 | Bacteria | 14161 |
| 801 | Ga0495648_0003484 | 3300046524 | Bacteria | 13806 |
| 802 | Ga0495648_0043575 | 3300046524 | Bacteria | 2811 |
| 803 | Ga0495648_0052682 | 3300046524 | Bacteria | 2470 |
| 804 | Ga0495648_0204606 | 3300046524 | Bacteria | 985 |
| 805 | Ga0495663_0036772 | 3300046525 | Bacteria | 1475 |
| 806 | Ga0495666_0138142 | 3300046526 | Bacteria | 1137 |
| 807 | Ga0495666_0170416 | 3300046526 | Bacteria | 1007 |
| 808 | Ga0495642_0050354 | 3300046528 | Bacteria | 1713 |
| 809 | Ga0495652_0006289 | 3300046529 | Bacteria | 11063 |
| 810 | Ga0495652_0013257 | 3300046529 | Bacteria | 7421 |
| 811 | Ga0495652_0019231 | 3300046529 | Bacteria | 6083 |
| 812 | Ga0495652_0220305 | 3300046529 | Bacteria | 1426 |
| 813 | Ga0495665_0000085 | 3300046531 | Bacteria | 41455 |
| 814 | Ga0495640_0000210 | 3300046533 | Bacteria | 38945 |
| 815 | Ga0495640_0007521 | 3300046533 | Bacteria | 8561 |
| 816 | Ga0495640_0017549 | 3300046533 | Bacteria | 5331 |
| 817 | Ga0495640_0019283 | 3300046533 | Bacteria | 5037 |
| 818 | Ga0495587_0003370 | 3300046536 | Bacteria | 10651 |
| 819 | Ga0495587_0029262 | 3300046536 | Bacteria | 3344 |
| 820 | Ga0495587_0092400 | 3300046536 | Bacteria | 1747 |
| 821 | Ga0495587_0172064 | 3300046536 | Bacteria | 1230 |
| 822 | Ga0495598_0005668 | 3300046537 | Bacteria | 2783 |
| 823 | Ga0495609_0029919 | 3300046538 | Bacteria | 2478 |
| 824 | Ga0495609_0143707 | 3300046538 | Bacteria | 1017 |
| 825 | Ga0495597_0102447 | 3300046542 | Bacteria | 1206 |
| 826 | Ga0495645_0014090 | 3300046543 | Bacteria | 5666 |
| 827 | Ga0495622_0003053 | 3300046557 | Bacteria | 7947 |
| 828 | Ga0495622_0007020 | 3300046557 | Bacteria | 5227 |
| 829 | Ga0495622_0009952 | 3300046557 | Bacteria | 4398 |
| 830 | Ga0495622_0016648 | 3300046557 | Bacteria | 3424 |
| 831 | Ga0495622_0032661 | 3300046557 | Bacteria | 2430 |
| 832 | Ga0495633_0086169 | 3300046558 | Bacteria | 1461 |
| 833 | Ga0495633_0093318 | 3300046558 | Bacteria | 1399 |
| 834 | Ga0495667_0002368 | 3300046559 | Bacteria | 12591 |
| 835 | Ga0495667_0183036 | 3300046559 | Bacteria | 1344 |
| 836 | Ga0495656_0009822 | 3300046615 | Bacteria | 3456 |
| 837 | Ga0495656_0044210 | 3300046615 | Bacteria | 1874 |
| 838 | Ga0495656_0128563 | 3300046615 | Bacteria | 1203 |
| 839 | Ga0495656_0270940 | 3300046615 | Bacteria | 863 |
| 840 | Ga0495668_0034791 | 3300046616 | Bacteria | 2825 |
| 841 | Ga0495668_0158266 | 3300046616 | Bacteria | 1241 |
| 842 | Ga0495634_0022896 | 3300046642 | Bacteria | 4398 |
| 843 | Ga0495634_0023484 | 3300046642 | Bacteria | 4333 |
| 844 | Ga0495634_0038480 | 3300046642 | Bacteria | 3262 |
| 845 | Ga0495634_0262615 | 3300046642 | Bacteria | 1053 |
| 846 | Ga0495611_0040112 | 3300046648 | Bacteria | 2087 |
| 847 | Ga0495611_0046358 | 3300046648 | Bacteria | 1949 |
| 848 | Ga0495625_0059939 | 3300046660 | Bacteria | 2698 |
| 849 | Ga0495625_0068302 | 3300046660 | Bacteria | 2499 |
| 850 | Ga0495625_0157787 | 3300046660 | Bacteria | 1522 |
| 851 | Ga0495625_0169454 | 3300046660 | Bacteria | 1459 |
| 852 | Ga0495635_0000536 | 3300046663 | Bacteria | 24099 |
| 853 | Ga0495635_0003755 | 3300046663 | Bacteria | 10540 |
| 854 | Ga0495635_0005266 | 3300046663 | Bacteria | 8997 |
| 855 | Ga0495635_0035502 | 3300046663 | Bacteria | 3456 |
| 856 | Ga0495659_0005051 | 3300046664 | Bacteria | 4144 |
| 857 | Ga0495659_0054850 | 3300046664 | Bacteria | 1459 |
| 858 | Ga0495659_0149900 | 3300046664 | Bacteria | 936 |
| 859 | Ga0495588_0001317 | 3300046674 | Bacteria | 10602 |
| 860 | Ga0495588_0022249 | 3300046674 | Bacteria | 3132 |
| 861 | Ga0495588_0026723 | 3300046674 | Bacteria | 2883 |
| 862 | Ga0495588_0035133 | 3300046674 | Bacteria | 2539 |
| 863 | Ga0495657_0002815 | 3300046675 | Bacteria | 14455 |
| 864 | Ga0495657_0015183 | 3300046675 | Bacteria | 5640 |
| 865 | Ga0495599_0001740 | 3300046678 | Bacteria | 12596 |
| 866 | Ga0495599_0047987 | 3300046678 | Bacteria | 2677 |
| 867 | Ga0495599_0089347 | 3300046678 | Bacteria | 1923 |
| 868 | Ga0495623_0004997 | 3300046679 | Bacteria | 8700 |
| 869 | Ga0495623_0027880 | 3300046679 | Bacteria | 3635 |
| 870 | Ga0495623_0262244 | 3300046679 | Bacteria | 968 |
| 871 | Ga0495646_0005634 | 3300046680 | Bacteria | 7929 |
| 872 | Ga0495646_0044385 | 3300046680 | Bacteria | 2718 |
| 873 | Ga0495647_0047752 | 3300046681 | Bacteria | 1653 |
| 874 | Ga0495647_0240453 | 3300046681 | Bacteria | 804 |
| 875 | Ga0495658_0000481 | 3300046683 | Bacteria | 21948 |
| 876 | Ga0495658_0219938 | 3300046683 | Bacteria | 1189 |
| 877 | Ga0495669_0038689 | 3300046684 | Bacteria | 2112 |
| 878 | Ga0495669_0046434 | 3300046684 | Bacteria | 1938 |
| 879 | Ga0495669_0140829 | 3300046684 | Bacteria | 1139 |
| 880 | Ga0495669_0229813 | 3300046684 | Bacteria | 890 |
| 881 | Ga0495613_0002779 | 3300046689 | Bacteria | 13142 |
| 882 | Ga0495613_0020104 | 3300046689 | Bacteria | 4975 |
| 883 | Ga0495613_0032424 | 3300046689 | Bacteria | 3881 |
| 884 | Ga0495624_0002075 | 3300046690 | Bacteria | 15280 |
| 885 | Ga0495624_0091821 | 3300046690 | Bacteria | 1873 |
| 886 | Ga0495624_0141767 | 3300046690 | Bacteria | 1472 |
| 887 | Ga0495649_0166110 | 3300046694 | Bacteria | 1156 |
| 888 | Ga0495589_0016006 | 3300046794 | Bacteria | 3855 |
| 889 | Ga0495589_0153835 | 3300046794 | Bacteria | 1097 |
| 890 | Ga0495600_0001712 | 3300046809 | Bacteria | 12258 |
| 891 | Ga0495600_0008483 | 3300046809 | Bacteria | 6315 |
| 892 | Ga0495600_0009872 | 3300046809 | Bacteria | 5908 |
| 893 | Ga0495600_0013354 | 3300046809 | Bacteria | 5158 |
| 894 | Ga0495581_0000083 | 3300047315 | Bacteria | 38260 |
| 895 | Ga0495581_0117560 | 3300047315 | Bacteria | 1546 |
| 896 | Ga0495581_0141988 | 3300047315 | Bacteria | 1401 |
| 897 | Ga0495581_0178954 | 3300047315 | Bacteria | 1240 |
| 898 | Ga0495581_0273294 | 3300047315 | Bacteria | 988 |
| 899 | Ga0495581_0287819 | 3300047315 | Bacteria | 961 |
| 900 | Ga0495581_0382688 | 3300047315 | Bacteria | 821 |
| 901 | Ga0495604_0003351 | 3300047317 | Bacteria | 12770 |
| 902 | Ga0495604_0062119 | 3300047317 | Bacteria | 2855 |
| 903 | Ga0495604_0133745 | 3300047317 | Bacteria | 1779 |
| 904 | Ga0495674_0117011 | 3300047319 | Bacteria | 2255 |
| 905 | Ga0495674_0164032 | 3300047319 | Bacteria | 1858 |
| 906 | Ga0495676_0037885 | 3300047321 | Bacteria | 4009 |
| 907 | Ga0495676_0099181 | 3300047321 | Bacteria | 2159 |
| 908 | Ga0495676_0135213 | 3300047321 | Bacteria | 1774 |
| 909 | Ga0495676_0195381 | 3300047321 | Bacteria | 1409 |
| 910 | Ga0495680_0000920 | 3300047322 | Bacteria | 32673 |
| 911 | Ga0495680_0007831 | 3300047322 | Bacteria | 9752 |
| 912 | Ga0495680_0010833 | 3300047322 | Bacteria | 8114 |
| 913 | Ga0495683_0046253 | 3300047323 | Bacteria | 2184 |
| 914 | Ga0495675_0003454 | 3300047444 | Bacteria | 9520 |
| 915 | Ga0495675_0004477 | 3300047444 | Bacteria | 8464 |
| 916 | Ga0495675_0103343 | 3300047444 | Bacteria | 1781 |
| 917 | Ga0495675_0190080 | 3300047444 | Bacteria | 1254 |
| 918 | Ga0495673_0065337 | 3300047469 | Bacteria | 1545 |
| 919 | Ga0495673_0142280 | 3300047469 | Bacteria | 934 |
| 920 | Ga0495673_0179962 | 3300047469 | Bacteria | 801 |
| 921 | Ga0495681_0129795 | 3300047470 | Bacteria | 1074 |
| 922 | Ga0495684_0000470 | 3300047471 | Bacteria | 32869 |
| 923 | Ga0495684_0058333 | 3300047471 | Bacteria | 2941 |
| 924 | Ga0495684_0062879 | 3300047471 | Bacteria | 2823 |
| 925 | Ga0495686_0105241 | 3300047472 | Bacteria | 1698 |
| 926 | Ga0495686_0231918 | 3300047472 | Bacteria | 1045 |
| 927 | Ga0495686_0324494 | 3300047472 | Bacteria | 843 |
| 928 | Ga0495593_0000003 | 3300047673 | Bacteria | 120744 |
| 929 | Ga0495593_0001464 | 3300047673 | Bacteria | 13852 |
| 930 | Ga0495593_0138762 | 3300047673 | Bacteria | 1232 |
| 931 | Ga0495593_0148975 | 3300047673 | Bacteria | 1184 |
| 932 | Ga0495602_0003657 | 3300048088 | Bacteria | 15932 |
| 933 | Ga0495602_0008321 | 3300048088 | Bacteria | 10841 |
| 934 | Ga0495602_0113500 | 3300048088 | Bacteria | 2196 |
| 935 | Ga0495626_0024099 | 3300048091 | Bacteria | 2986 |
| 936 | Ga0496100_0035627 | 3300048903 | Bacteria | 3132 |
| 937 | Ga0496100_0104386 | 3300048903 | Bacteria | 1958 |
| 938 | Ga0496100_0148317 | 3300048903 | Bacteria | 1670 |
| 939 | Ga0496100_0151213 | 3300048903 | Bacteria | 1656 |
| 940 | Ga0496101_0002419 | 3300048904 | Bacteria | 11466 |
| 941 | Ga0496101_0059874 | 3300048904 | Bacteria | 2761 |
| 942 | Ga0496101_0082846 | 3300048904 | Bacteria | 2374 |
| 943 | Ga0496101_0175162 | 3300048904 | Bacteria | 1650 |
| 944 | Ga0496102_0007052 | 3300048905 | Bacteria | 9589 |
| 945 | Ga0496102_0061830 | 3300048905 | Bacteria | 3428 |
| 946 | Ga0496102_0127399 | 3300048905 | Bacteria | 2381 |
| 947 | Ga0496102_0299426 | 3300048905 | Bacteria | 1516 |
| 948 | Ga0496102_0372853 | 3300048905 | Bacteria | 1343 |
| 949 | Ga0496102_0596132 | 3300048905 | Bacteria | 1028 |
| 950 | Ga0496103_0286132 | 3300048906 | Bacteria | 1060 |
| 951 | Ga0496104_0007733 | 3300048907 | Bacteria | 9520 |
| 952 | Ga0496104_0008613 | 3300048907 | Bacteria | 9072 |
| 953 | Ga0496104_0008791 | 3300048907 | Bacteria | 8978 |
| 954 | Ga0496104_0041517 | 3300048907 | Bacteria | 4314 |
| 955 | Ga0496104_0045912 | 3300048907 | Bacteria | 4110 |
| 956 | Ga0496104_0148883 | 3300048907 | Bacteria | 2247 |
| 957 | Ga0496104_0159145 | 3300048907 | Bacteria | 2166 |
| 958 | Ga0496104_0520484 | 3300048907 | Bacteria | 1101 |
| 959 | Ga0496104_0568872 | 3300048907 | Bacteria | 1044 |
| 960 | Ga0496105_0009843 | 3300048908 | Bacteria | 7492 |
| 961 | Ga0496105_0013646 | 3300048908 | Bacteria | 6450 |
| 962 | Ga0496105_0021008 | 3300048908 | Bacteria | 5280 |
| 963 | Ga0496105_0047972 | 3300048908 | Bacteria | 3525 |
| 964 | Ga0496105_0049374 | 3300048908 | Bacteria | 3474 |
| 965 | Ga0496105_0097279 | 3300048908 | Bacteria | 2431 |
| 966 | Ga0496105_0188531 | 3300048908 | Bacteria | 1687 |
| 967 | Ga0496105_0214171 | 3300048908 | Bacteria | 1570 |
| 968 | Ga0496105_0392113 | 3300048908 | Bacteria | 1103 |
| 969 | Ga0496106_0000823 | 3300048909 | Bacteria | 22502 |
| 970 | Ga0496106_0009736 | 3300048909 | Bacteria | 7096 |
| 971 | Ga0496106_0262191 | 3300048909 | Bacteria | 1383 |
| 972 | Ga0496106_0326857 | 3300048909 | Bacteria | 1231 |
| 973 | Ga0496107_0003302 | 3300048910 | Bacteria | 10773 |
| 974 | Ga0496107_0145386 | 3300048910 | Bacteria | 1753 |
| 975 | Ga0496107_0443689 | 3300048910 | Bacteria | 964 |
| 976 | Ga0496108_0027381 | 3300048911 | Bacteria | 4706 |
| 977 | Ga0496108_0032526 | 3300048911 | Bacteria | 4333 |
| 978 | Ga0496108_0105828 | 3300048911 | Bacteria | 2402 |
| 979 | Ga0496108_0219976 | 3300048911 | Bacteria | 1650 |
| 980 | Ga0496108_0452091 | 3300048911 | Bacteria | 1122 |
| 981 | Ga0496109_0004082 | 3300048912 | Bacteria | 12205 |
| 982 | Ga0496109_0019860 | 3300048912 | Bacteria | 5930 |
| 983 | Ga0496109_0033050 | 3300048912 | Bacteria | 4653 |
| 984 | Ga0496109_0078684 | 3300048912 | Bacteria | 3036 |
| 985 | Ga0496109_0120180 | 3300048912 | Bacteria | 2447 |
| 986 | Ga0496110_0035920 | 3300048913 | Bacteria | 4303 |
| 987 | Ga0496110_0062958 | 3300048913 | Bacteria | 3277 |
| 988 | Ga0496110_0146604 | 3300048913 | Bacteria | 2135 |
| 989 | Ga0496110_0200613 | 3300048913 | Bacteria | 1812 |
| 990 | Ga0496110_0256100 | 3300048913 | Bacteria | 1593 |
| 991 | Ga0496110_0828990 | 3300048913 | Bacteria | 830 |
| 992 | Ga0496111_0071536 | 3300048914 | Bacteria | 2524 |
| 993 | Ga0496111_0091927 | 3300048914 | Bacteria | 2224 |
| 994 | Ga0496111_0407105 | 3300048914 | Bacteria | 1005 |
| 995 | Ga0496112_0000036 | 3300048915 | Bacteria | 106325 |
| 996 | Ga0496112_0004505 | 3300048915 | Bacteria | 11824 |
| 997 | Ga0496112_0017242 | 3300048915 | Bacteria | 6781 |
| 998 | Ga0496112_0025259 | 3300048915 | Bacteria | 5703 |
| 999 | Ga0496112_0026108 | 3300048915 | Bacteria | 5616 |
| 1000 | Ga0496112_0044309 | 3300048915 | Bacteria | 4359 |
| 1001 | Ga0496112_0114497 | 3300048915 | Bacteria | 2667 |
| 1002 | Ga0496113_0003004 | 3300048916 | Bacteria | 9989 |
| 1003 | Ga0496113_0027023 | 3300048916 | Bacteria | 4109 |
| 1004 | Ga0496113_0042869 | 3300048916 | Bacteria | 3345 |
| 1005 | Ga0496113_0056420 | 3300048916 | Bacteria | 2949 |
| 1006 | Ga0496113_0110683 | 3300048916 | Bacteria | 2137 |
| 1007 | Ga0496113_0171986 | 3300048916 | Bacteria | 1716 |
| 1008 | Ga0496113_0335056 | 3300048916 | Bacteria | 1213 |
| 1009 | Ga0496113_0369158 | 3300048916 | Bacteria | 1152 |
| 1010 | Ga0496113_0607136 | 3300048916 | Bacteria | 876 |
| 1011 | Ga0496114_0045844 | 3300048917 | Bacteria | 3633 |
| 1012 | Ga0496114_0070785 | 3300048917 | Bacteria | 2930 |
| 1013 | Ga0496114_0126328 | 3300048917 | Bacteria | 2205 |
| 1014 | Ga0496114_0390494 | 3300048917 | Bacteria | 1232 |
| 1015 | Ga0496114_0532233 | 3300048917 | Bacteria | 1039 |
| 1016 | Ga0496115_0002238 | 3300048918 | Bacteria | 13868 |
| 1017 | Ga0496115_0012292 | 3300048918 | Bacteria | 6438 |
| 1018 | Ga0496115_0069124 | 3300048918 | Bacteria | 2860 |
| 1019 | Ga0496115_0074639 | 3300048918 | Bacteria | 2754 |
| 1020 | Ga0496115_0168792 | 3300048918 | Bacteria | 1810 |
| 1021 | Ga0496115_0220835 | 3300048918 | Bacteria | 1564 |
| 1022 | Ga0496115_0225732 | 3300048918 | Bacteria | 1545 |
| 1023 | Ga0496115_0343562 | 3300048918 | Bacteria | 1218 |
| 1024 | Ga0496115_0393285 | 3300048918 | Bacteria | 1125 |
| 1025 | Ga0496115_0423297 | 3300048918 | Bacteria | 1078 |
| 1026 | Ga0496115_0645452 | 3300048918 | Bacteria | 837 |
| 1027 | Ga0496116_0037444 | 3300048919 | Bacteria | 3383 |
| 1028 | Ga0496117_0012131 | 3300048920 | Bacteria | 7639 |
| 1029 | Ga0496117_0138220 | 3300048920 | Bacteria | 1464 |
| 1030 | Ga0496117_0180844 | 3300048920 | Bacteria | 1212 |
| 1031 | Ga0496118_0003610 | 3300048921 | Bacteria | 19225 |
| 1032 | Ga0496118_0017368 | 3300048921 | Bacteria | 6551 |
| 1033 | Ga0496118_0083099 | 3300048921 | Bacteria | 2240 |
| 1034 | Ga0496118_0085444 | 3300048921 | Bacteria | 2197 |
| 1035 | Ga0496118_0115373 | 3300048921 | Bacteria | 1768 |
| 1036 | Ga0496119_0012861 | 3300048922 | Bacteria | 6745 |
| 1037 | Ga0496119_0098551 | 3300048922 | Bacteria | 1646 |
| 1038 | Ga0496119_0193775 | 3300048922 | Bacteria | 1057 |
| 1039 | Ga0496120_0165777 | 3300048923 | Bacteria | 1097 |
| 1040 | Ga0496120_0187027 | 3300048923 | Bacteria | 1012 |
| 1041 | Ga0496121_0000041 | 3300048924 | Bacteria | 346686 |
| 1042 | Ga0496121_0000225 | 3300048924 | Bacteria | 122351 |
| 1043 | Ga0496121_0002396 | 3300048924 | Bacteria | 28735 |
| 1044 | Ga0496121_0009113 | 3300048924 | Bacteria | 11485 |
| 1045 | Ga0496121_0061911 | 3300048924 | Bacteria | 3068 |
| 1046 | Ga0496121_0162930 | 3300048924 | Bacteria | 1628 |
| 1047 | Ga0496121_0171798 | 3300048924 | Bacteria | 1573 |
| 1048 | Ga0496121_0186166 | 3300048924 | Bacteria | 1493 |
| 1049 | Ga0496121_0223415 | 3300048924 | Bacteria | 1324 |
| 1050 | Ga0496121_0254014 | 3300048924 | Bacteria | 1217 |
| 1051 | Ga0496122_0053961 | 3300048925 | Bacteria | 3024 |
| 1052 | Ga0496122_0107848 | 3300048925 | Bacteria | 1839 |
| 1053 | Ga0496122_0136360 | 3300048925 | Bacteria | 1546 |
| 1054 | Ga0496122_0339071 | 3300048925 | Bacteria | 790 |
| 1055 | Ga0496124_0012074 | 3300048927 | Bacteria | 8573 |
| 1056 | Ga0496124_0029357 | 3300048927 | Bacteria | 4902 |
| 1057 | Ga0496124_0116507 | 3300048927 | Bacteria | 2142 |
| 1058 | Ga0496124_0130386 | 3300048927 | Bacteria | 1998 |
| 1059 | Ga0496125_0000048 | 3300048928 | Bacteria | 290651 |
| 1060 | Ga0496125_0006588 | 3300048928 | Bacteria | 12507 |
| 1061 | Ga0496125_0018399 | 3300048928 | Bacteria | 6637 |
| 1062 | Ga0496125_0081801 | 3300048928 | Bacteria | 2465 |
| 1063 | Ga0496125_0112310 | 3300048928 | Bacteria | 1969 |
| 1064 | Ga0496125_0240557 | 3300048928 | Bacteria | 1150 |
| 1065 | Ga0496126_0005875 | 3300048929 | Bacteria | 13844 |
| 1066 | Ga0496126_0014942 | 3300048929 | Bacteria | 7828 |
| 1067 | Ga0496126_0018558 | 3300048929 | Bacteria | 6887 |
| 1068 | Ga0496126_0022665 | 3300048929 | Bacteria | 6102 |
| 1069 | Ga0496126_0032666 | 3300048929 | Bacteria | 4901 |
| 1070 | Ga0496126_0049902 | 3300048929 | Bacteria | 3818 |
| 1071 | Ga0496126_0135931 | 3300048929 | Bacteria | 2121 |
| 1072 | Ga0496126_0197957 | 3300048929 | Bacteria | 1698 |
| 1073 | Ga0496126_0251227 | 3300048929 | Bacteria | 1473 |
| 1074 | Ga0496126_0355864 | 3300048929 | Bacteria | 1197 |
| 1075 | Ga0496126_0377783 | 3300048929 | Bacteria | 1154 |
| 1076 | Ga0496126_0452623 | 3300048929 | Bacteria | 1033 |
| 1077 | Ga0496126_0455158 | 3300048929 | Bacteria | 1029 |
| 1078 | Ga0495682_0035131 | 3300049460 | Bacteria | 1847 |
| 1079 | Ga0495682_0072640 | 3300049460 | Bacteria | 1238 |
| 1080 | Ga0501031_0091786 | 3300049568 | Bacteria | 1981 |
| 1081 | Ga0501031_0227518 | 3300049568 | Bacteria | 1214 |
| 1082 | Ga0501032_0239765 | 3300049569 | Bacteria | 1178 |
| 1083 | Ga0501033_0027180 | 3300049570 | Bacteria | 4303 |
| 1084 | Ga0501033_0357721 | 3300049570 | Bacteria | 1022 |
| 1085 | Ga0501034_0047447 | 3300049571 | Bacteria | 4337 |
| 1086 | Ga0501034_0087971 | 3300049571 | Bacteria | 3105 |
| 1087 | Ga0501036_0086884 | 3300049572 | Bacteria | 2643 |
| 1088 | Ga0501036_0229454 | 3300049572 | Bacteria | 1558 |
| 1089 | Ga0501037_0282654 | 3300049573 | Bacteria | 1156 |
| 1090 | Ga0501038_0116844 | 3300049574 | Bacteria | 2204 |
| 1091 | Ga0501039_0272180 | 3300049575 | Bacteria | 1331 |
| 1092 | Ga0501040_0150548 | 3300049576 | Bacteria | 1642 |
| 1093 | Ga0501043_0052885 | 3300049579 | Bacteria | 3189 |
| 1094 | Ga0501047_0006336 | 3300049581 | Bacteria | 11131 |
| 1095 | Ga0501047_0069896 | 3300049581 | Bacteria | 3380 |
| 1096 | Ga0501047_0686796 | 3300049581 | Unclassified | 842 |
| 1097 | Ga0501048_0166996 | 3300049582 | Bacteria | 1558 |
| 1098 | Ga0501048_0444954 | 3300049582 | Bacteria | 928 |
| 1099 | Ga0501067_0184227 | 3300049583 | Bacteria | 1163 |
| 1100 | Ga0501069_0441190 | 3300049585 | Bacteria | 773 |
| 1101 | Ga0501071_0058731 | 3300049587 | Bacteria | 2782 |
| 1102 | Ga0501076_0384800 | 3300049592 | Bacteria | 1153 |
| 1103 | Ga0501083_0106614 | 3300049744 | Bacteria | 1845 |
| 1104 | Ga0501035_0015948 | 3300049822 | Bacteria | 6934 |
| 1105 | Ga0501035_0052601 | 3300049822 | Bacteria | 3644 |
| 1106 | Ga0501044_0017591 | 3300049823 | Bacteria | 7667 |
| 1107 | Ga0501044_0039622 | 3300049823 | Bacteria | 4915 |
| 1108 | Ga0501044_0324363 | 3300049823 | Bacteria | 1464 |
| 1109 | nmdc:mga03683_204267_c1 | 3300050489 | Bacteria | 907 |
| 1110 | nmdc:mga03n38_251279_c1 | 3300050490 | Bacteria | 934 |
| 1111 | nmdc:mga03n38_42142_c1 | 3300050490 | Bacteria | 1994 |
| 1112 | nmdc:mga03n38_92549_c1 | 3300050490 | Bacteria | 1442 |
| 1113 | nmdc:mga00v17_16990_c1 | 3300050491 | Bacteria | 4110 |
| 1114 | nmdc:mga00v17_36445_c1 | 3300050491 | Bacteria | 2931 |
| 1115 | nmdc:mga00v17_40924_c1 | 3300050491 | Bacteria | 2781 |
| 1116 | nmdc:mga0yw44_1840_c1 | 3300050492 | Bacteria | 8709 |
| 1117 | nmdc:mga0yw44_225522_c1 | 3300050492 | Bacteria | 1243 |
| 1118 | nmdc:mga0yw44_25743_c1 | 3300050492 | Bacteria | 3351 |
| 1119 | nmdc:mga0yw44_38628_c1 | 3300050492 | Bacteria | 2826 |
| 1120 | nmdc:mga0yw44_397337_c1 | 3300050492 | Bacteria | 932 |
| 1121 | nmdc:mga0yw44_543633_c1 | 3300050492 | Bacteria | 789 |
| 1122 | nmdc:mga0yw44_68816_c1 | 3300050492 | Bacteria | 2191 |
| 1123 | nmdc:mga0yw44_88550_c1 | 3300050492 | Bacteria | 1952 |
| 1124 | nmdc:mga0k408_83414_c1 | 3300050493 | Bacteria | 1873 |
| 1125 | nmdc:mga06z11_129554_c1 | 3300050494 | Bacteria | 1415 |
| 1126 | nmdc:mga06z11_297123_c1 | 3300050494 | Bacteria | 960 |
| 1127 | nmdc:mga06z11_366921_c1 | 3300050494 | Bacteria | 864 |
| 1128 | nmdc:mga06z11_67614_c1 | 3300050494 | Bacteria | 1881 |
| 1129 | nmdc:mga06z11_81958_c1 | 3300050494 | Bacteria | 1733 |
| 1130 | nmdc:mga04h51_195069_c1 | 3300050495 | Bacteria | 793 |
| 1131 | nmdc:mga04h51_27833_c1 | 3300050495 | Bacteria | 1759 |
| 1132 | nmdc:mga07m45_156899_c1 | 3300050496 | Bacteria | 1320 |
| 1133 | nmdc:mga07m45_165349_c1 | 3300050496 | Bacteria | 1285 |
| 1134 | nmdc:mga07m45_24799_c1 | 3300050496 | Bacteria | 3287 |
| 1135 | nmdc:mga07m45_269014_c1 | 3300050496 | Bacteria | 992 |
| 1136 | nmdc:mga07m45_31562_c1 | 3300050496 | Bacteria | 2936 |
| 1137 | nmdc:mga07m45_43758_c1 | 3300050496 | Bacteria | 2511 |
| 1138 | nmdc:mga05p37_49010_c1 | 3300050507 | Bacteria | 5194 |
| 1139 | nmdc:mga0qj67_683685_c1 | 3300050509 | Bacteria | 817 |
| 1140 | nmdc:mga08y16_107272_c1 | 3300050511 | Bacteria | 2907 |
| 1141 | nmdc:mga08y16_611197_c1 | 3300050511 | Bacteria | 1098 |
| 1142 | nmdc:mga0n895_488727_c1 | 3300050512 | Bacteria | 1241 |
| 1143 | nmdc:mga0rr50_123844_c1 | 3300050513 | Bacteria | 2061 |
| 1144 | nmdc:mga0rr50_457685_c1 | 3300050513 | Bacteria | 1082 |
| 1145 | nmdc:mga0sz30_112720_c1 | 3300050516 | Bacteria | 1193 |
| 1146 | nmdc:mga0sz30_173081_c1 | 3300050516 | Bacteria | 957 |
| 1147 | nmdc:mga0sz30_189516_c1 | 3300050516 | Bacteria | 913 |
| 1148 | nmdc:mga0sz30_19694_c1 | 3300050516 | Bacteria | 2715 |
| 1149 | Ga0495601_0096803 | 3300053077 | Bacteria | 1904 |
| 1150 | Ga0495612_0087425 | 3300053078 | Bacteria | 1316 |
| 1151 | Ga0500635_0002038 | 3300053080 | Bacteria | 4940 |
| 1152 | Ga0500635_0007819 | 3300053080 | Bacteria | 2909 |
| 1153 | Ga0500635_0010446 | 3300053080 | Bacteria | 2609 |
| 1154 | Ga0495655_0058865 | 3300053083 | Bacteria | 1042 |
| 1155 | Ga0495595_0000452 | 3300053084 | Bacteria | 15495 |
| 1156 | Ga0495595_0151172 | 3300053084 | Bacteria | 1143 |
| 1157 | Ga0495595_0296178 | 3300053084 | Bacteria | 813 |
| 1158 | Ga0495619_0000590 | 3300053085 | Bacteria | 24089 |
| 1159 | Ga0495619_0104644 | 3300053085 | Bacteria | 1929 |
| 1160 | Ga0495619_0111363 | 3300053085 | Bacteria | 1871 |
| 1161 | Ga0500578_0175876 | 3300053086 | Bacteria | 1321 |
| 1162 | Ga0500643_000373 | 3300053087 | Bacteria | 35007 |
| 1163 | Ga0500583_0016219 | 3300053092 | Bacteria | 2969 |
| 1164 | Ga0500583_0056105 | 3300053092 | Bacteria | 1844 |
| 1165 | Ga0500651_0159844 | 3300053093 | Bacteria | 1348 |
| 1166 | Ga0500566_0000011 | 3300053094 | Bacteria | 118644 |
| 1167 | Ga0500566_0000174 | 3300053094 | Bacteria | 32668 |
| 1168 | Ga0500640_000891 | 3300053095 | Bacteria | 8309 |
| 1169 | Ga0500641_0005264 | 3300053096 | Bacteria | 4583 |
| 1170 | Ga0500641_0034882 | 3300053096 | Bacteria | 2005 |
| 1171 | Ga0500641_0045876 | 3300053096 | Bacteria | 1781 |
| 1172 | Ga0500648_227075 | 3300053097 | Bacteria | 907 |
| 1173 | Ga0500650_0127604 | 3300053098 | Bacteria | 1183 |
| 1174 | Ga0500654_085783 | 3300053099 | Bacteria | 1436 |
| 1175 | Ga0500554_057533 | 3300053102 | Bacteria | 1239 |
| 1176 | Ga0500555_005869 | 3300053103 | Bacteria | 3483 |
| 1177 | Ga0500556_0003645 | 3300053104 | Bacteria | 4486 |
| 1178 | Ga0500557_000062 | 3300053105 | Bacteria | 43893 |
| 1179 | Ga0500562_005901 | 3300053108 | Bacteria | 3083 |
| 1180 | Ga0500569_019888 | 3300053109 | Bacteria | 1754 |
| 1181 | Ga0500572_000437 | 3300053111 | Bacteria | 14662 |
| 1182 | Ga0500572_000563 | 3300053111 | Bacteria | 12656 |
| 1183 | Ga0500572_031118 | 3300053111 | Bacteria | 1489 |
| 1184 | Ga0500580_073784 | 3300053113 | Bacteria | 1399 |
| 1185 | Ga0500582_118168 | 3300053114 | Bacteria | 924 |
| 1186 | Ga0500591_071643 | 3300053115 | Bacteria | 1568 |
| 1187 | Ga0500594_0032729 | 3300053118 | Bacteria | 1379 |
| 1188 | Ga0500594_0068565 | 3300053118 | Bacteria | 1038 |
| 1189 | Ga0500595_000181 | 3300053119 | Bacteria | 42687 |
| 1190 | Ga0500595_000343 | 3300053119 | Bacteria | 30330 |
| 1191 | Ga0500595_000799 | 3300053119 | Bacteria | 18242 |
| 1192 | Ga0500595_001346 | 3300053119 | Bacteria | 13271 |
| 1193 | Ga0500595_017155 | 3300053119 | Bacteria | 2679 |
| 1194 | Ga0500595_038977 | 3300053119 | Bacteria | 1540 |
| 1195 | Ga0500595_051785 | 3300053119 | Bacteria | 1270 |
| 1196 | Ga0500614_003680 | 3300053123 | Bacteria | 3291 |
| 1197 | Ga0500642_0000138 | 3300053130 | Bacteria | 32489 |
| 1198 | Ga0500642_0298108 | 3300053130 | Bacteria | 728 |
| 1199 | Ga0500559_0001384 | 3300053136 | Bacteria | 13827 |
| 1200 | Ga0500559_0004964 | 3300053136 | Bacteria | 6183 |
| 1201 | Ga0500559_0005624 | 3300053136 | Bacteria | 5743 |
| 1202 | Ga0500559_0110611 | 3300053136 | Bacteria | 1272 |
| 1203 | Ga0500568_0029054 | 3300053139 | Bacteria | 2298 |
| 1204 | Ga0500568_0029907 | 3300053139 | Bacteria | 2257 |
| 1205 | Ga0500573_0005486 | 3300053140 | Bacteria | 6799 |
| 1206 | Ga0500577_0136134 | 3300053142 | Bacteria | 1033 |
| 1207 | Ga0500589_080908 | 3300053147 | Bacteria | 1450 |
| 1208 | Ga0500590_121153 | 3300053148 | Bacteria | 1226 |
| 1209 | Ga0500603_010619 | 3300053150 | Bacteria | 2082 |
| 1210 | Ga0500603_011044 | 3300053150 | Bacteria | 2048 |
| 1211 | Ga0500603_013809 | 3300053150 | Bacteria | 1878 |
| 1212 | Ga0500603_018233 | 3300053150 | Bacteria | 1688 |
| 1213 | Ga0500603_025504 | 3300053150 | Bacteria | 1487 |
| 1214 | Ga0500604_0044559 | 3300053151 | Bacteria | 1351 |
| 1215 | Ga0500616_0010044 | 3300053153 | Bacteria | 5688 |
| 1216 | Ga0500622_0001764 | 3300053156 | Bacteria | 16613 |
| 1217 | Ga0500627_0046267 | 3300053158 | Bacteria | 1885 |
| 1218 | Ga0500630_000927 | 3300053159 | Bacteria | 13690 |
| 1219 | Ga0500633_0038059 | 3300053160 | Bacteria | 1600 |
| 1220 | Ga0500638_002499 | 3300053162 | Bacteria | 6438 |
| 1221 | Ga0500638_020349 | 3300053162 | Bacteria | 3123 |
| 1222 | Ga0500638_098187 | 3300053162 | Bacteria | 1370 |
| 1223 | Ga0500638_109654 | 3300053162 | Bacteria | 1276 |
| 1224 | Ga0500638_142257 | 3300053162 | Bacteria | 1076 |
| 1225 | Ga0500639_001719 | 3300053163 | Bacteria | 11011 |
| 1226 | Ga0500639_018557 | 3300053163 | Bacteria | 3672 |
| 1227 | Ga0500636_0000608 | 3300053177 | Bacteria | 19428 |
| 1228 | Ga0500636_0042215 | 3300053177 | Bacteria | 2696 |
| 1229 | Ga0500636_0047584 | 3300053177 | Bacteria | 2526 |
| 1230 | Ga0500636_0072868 | 3300053177 | Bacteria | 1990 |
| 1231 | Ga0500636_0170448 | 3300053177 | Bacteria | 1177 |
| 1232 | Ga0500637_0001313 | 3300053178 | Bacteria | 10472 |
| 1233 | Ga0500637_0007702 | 3300053178 | Bacteria | 5399 |
| 1234 | Ga0500637_0130859 | 3300053178 | Bacteria | 1455 |
| 1235 | Ga0500637_0209086 | 3300053178 | Bacteria | 1107 |
| 1236 | Ga0500637_0291157 | 3300053178 | Bacteria | 894 |
| 1237 | Ga0500625_005743 | 3300053729 | Bacteria | 5220 |
| 1238 | Ga0500645_047689 | 3300053730 | Bacteria | 1255 |
| 1239 | Ga0500609_010779 | 3300053731 | Bacteria | 1233 |
| 1240 | Ga0500552_040614 | 3300053733 | Bacteria | 756 |
| 1241 | Ga0500596_000148 | 3300053735 | Bacteria | 10722 |
| 1242 | Ga0500596_001020 | 3300053735 | Bacteria | 5610 |
| 1243 | Ga0500596_003660 | 3300053735 | Bacteria | 2893 |
| 1244 | Ga0500601_000276 | 3300053737 | Bacteria | 9735 |
| 1245 | Ga0500601_002160 | 3300053737 | Bacteria | 2112 |
| 1246 | Ga0500661_000463 | 3300055283 | Bacteria | 7503 |
| 1247 | Ga0500661_006762 | 3300055283 | Bacteria | 2132 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005983 | Ga0081540_1183673 | Ga0081540_11836731 | 190 |
| 2 | 3300038443 | Ga0395901_0358871 | Ga0395901_0358871_695_1297 | 200 |
| 3 | 3300035111 | Ga0373923_0004069 | Ga0373923_0004069_4172_4777 | 201 |
| 4 | iso_pu_bacteria | 2881364244 | 2881370156 | 201 |
| 5 | 3300003659 | JGI25404J52841_10011426 | JGI25404J52841_100114263 | 202 |
| 6 | 3300006195 | Ga0075366_10184151 | Ga0075366_101841512 | 202 |
| 7 | 3300050494 | nmdc:mga06z11_67614_c1 | nmdc:mga06z11_67614_c1_956_1564 | 202 |
| 8 | 3300050495 | nmdc:mga04h51_27833_c1 | nmdc:mga04h51_27833_c1_351_959 | 202 |
| 9 | 3300050509 | nmdc:mga0qj67_683685_c1 | nmdc:mga0qj67_683685_c1_178_786 | 202 |
| 10 | 3300053130 | Ga0500642_0298108 | Ga0500642_0298108_58_666 | 202 |
| 11 | 3300006195 | Ga0075366_10224973 | Ga0075366_102249732 | 206 |
| 12 | 3300003752 | Ga0055539_1001910 | Ga0055539_10019101 | 208 |
| 13 | 3300025253 | Ga0209677_100502 | Ga0209677_10050210 | 208 |
| 14 | 3300025272 | Ga0209455_1030492 | Ga0209455_10304921 | 208 |
| 15 | 3300025910 | Ga0207684_10156077 | Ga0207684_101560771 | 208 |
| 16 | 3300044706 | Ga0466964_0028100 | Ga0466964_0028100_578_1273 | 208 |
| 17 | 3300047472 | Ga0495686_0324494 | Ga0495686_0324494_43_675 | 208 |
| 18 | 3300048920 | Ga0496117_0138220 | Ga0496117_0138220_264_959 | 208 |
| 19 | 3300048920 | Ga0496117_0180844 | Ga0496117_0180844_27_653 | 208 |
| 20 | 3300048921 | Ga0496118_0083099 | Ga0496118_0083099_1081_1776 | 208 |
| 21 | 3300048924 | Ga0496121_0223415 | Ga0496121_0223415_215_910 | 208 |
| 22 | 3300048928 | Ga0496125_0240557 | Ga0496125_0240557_99_794 | 208 |
| 23 | 3300048929 | Ga0496126_0377783 | Ga0496126_0377783_196_891 | 208 |
| 24 | 3300050494 | nmdc:mga06z11_297123_c1 | nmdc:mga06z11_297123_c1_313_939 | 208 |
| 25 | 3300053119 | Ga0500595_038977 | Ga0500595_038977_888_1514 | 208 |
| 26 | 3300045049 | Ga0466959_0167521 | Ga0466959_0167521_435_1094 | 210 |
| 27 | 3300005435 | Ga0070714_100628543 | Ga0070714_1006285431 | 212 |
| 28 | 3300005439 | Ga0070711_100046989 | Ga0070711_1000469892 | 212 |
| 29 | 3300006038 | Ga0075365_10001902 | Ga0075365_100019023 | 212 |
| 30 | 3300006051 | Ga0075364_10002061 | Ga0075364_100020615 | 212 |
| 31 | 3300025928 | Ga0207700_10252814 | Ga0207700_102528142 | 212 |
| 32 | 3300025929 | Ga0207664_10474688 | Ga0207664_104746882 | 212 |
| 33 | 3300050491 | nmdc:mga00v17_36445_c1 | nmdc:mga00v17_36445_c1_89_772 | 212 |
| 34 | 3300050492 | nmdc:mga0yw44_1840_c1 | nmdc:mga0yw44_1840_c1_7053_7736 | 212 |
| 35 | 3300050494 | nmdc:mga06z11_129554_c1 | nmdc:mga06z11_129554_c1_451_1134 | 212 |
| 36 | 3300005434 | Ga0070709_10008266 | Ga0070709_1000826611 | 213 |
| 37 | 3300005436 | Ga0070713_100184258 | Ga0070713_1001842581 | 213 |
| 38 | 3300006173 | Ga0070716_100133116 | Ga0070716_1001331161 | 213 |
| 39 | 3300006175 | Ga0070712_100162136 | Ga0070712_1001621362 | 213 |
| 40 | 3300025898 | Ga0207692_10088053 | Ga0207692_100880533 | 213 |
| 41 | 3300025905 | Ga0207685_10069996 | Ga0207685_100699962 | 213 |
| 42 | 3300025906 | Ga0207699_10322282 | Ga0207699_103222822 | 213 |
| 43 | 3300025915 | Ga0207693_10184221 | Ga0207693_101842212 | 213 |
| 44 | 3300025916 | Ga0207663_10046659 | Ga0207663_100466591 | 213 |
| 45 | iso_pu_bacteria | 2909042592 | 2909045427 | 214 |
| 46 | 3300025916 | Ga0207663_10156229 | Ga0207663_101562295 | 215 |
| 47 | 3300028379 | Ga0268266_10386034 | Ga0268266_103860342 | 215 |
| 48 | 3300006175 | Ga0070712_100075559 | Ga0070712_1000755592 | 216 |
| 49 | 3300025915 | Ga0207693_10001116 | Ga0207693_100011164 | 216 |
| 50 | 3300025904 | Ga0207647_10277469 | Ga0207647_102774691 | 217 |
| 51 | 3300025936 | Ga0207670_10536302 | Ga0207670_105363022 | 217 |
| 52 | 3300041512 | Ga0451853_3449489 | Ga0451853_3449489_214_885 | 217 |
| 53 | 3300045049 | Ga0466959_0084079 | Ga0466959_0084079_854_1522 | 218 |
| 54 | 3300046648 | Ga0495611_0046358 | Ga0495611_0046358_902_1588 | 218 |
| 55 | iso_pu_bacteria | 2876761206 | 2876770004 | 218 |
| 56 | 3300006175 | Ga0070712_100421594 | Ga0070712_1004215942 | 219 |
| 57 | 3300025935 | Ga0207709_10219030 | Ga0207709_102190302 | 219 |
| 58 | 3300044694 | Ga0466963_0341100 | Ga0466963_0341100_139_828 | 219 |
| 59 | 3300046455 | Ga0495603_0070565 | Ga0495603_0070565_783_1496 | 219 |
| 60 | 3300046459 | Ga0495629_0003982 | Ga0495629_0003982_6153_6863 | 219 |
| 61 | 3300046492 | Ga0495585_0045348 | Ga0495585_0045348_213_926 | 219 |
| 62 | 3300046514 | Ga0495618_0171842 | Ga0495618_0171842_145_855 | 219 |
| 63 | 3300046529 | Ga0495652_0220305 | Ga0495652_0220305_74_784 | 219 |
| 64 | 3300046533 | Ga0495640_0017549 | Ga0495640_0017549_3119_3829 | 219 |
| 65 | 3300046642 | Ga0495634_0038480 | Ga0495634_0038480_2413_3123 | 219 |
| 66 | 3300046663 | Ga0495635_0005266 | Ga0495635_0005266_7495_8205 | 219 |
| 67 | 3300046689 | Ga0495613_0020104 | Ga0495613_0020104_4072_4782 | 219 |
| 68 | 3300046809 | Ga0495600_0009872 | Ga0495600_0009872_2921_3631 | 219 |
| 69 | 3300047317 | Ga0495604_0133745 | Ga0495604_0133745_1010_1720 | 219 |
| 70 | 3300047673 | Ga0495593_0138762 | Ga0495593_0138762_454_1164 | 219 |
| 71 | 3300048907 | Ga0496104_0148883 | Ga0496104_0148883_187_897 | 219 |
| 72 | 3300048908 | Ga0496105_0021008 | Ga0496105_0021008_4383_5093 | 219 |
| 73 | 3300048918 | Ga0496115_0012292 | Ga0496115_0012292_355_1065 | 219 |
| 74 | 3300048923 | Ga0496120_0187027 | Ga0496120_0187027_243_953 | 219 |
| 75 | 3300048925 | Ga0496122_0136360 | Ga0496122_0136360_354_1064 | 219 |
| 76 | 3300048929 | Ga0496126_0022665 | Ga0496126_0022665_3015_3725 | 219 |
| 77 | 3300049569 | Ga0501032_0239765 | Ga0501032_0239765_359_1039 | 219 |
| 78 | 3300049571 | Ga0501034_0047447 | Ga0501034_0047447_3049_3729 | 219 |
| 79 | 3300049574 | Ga0501038_0116844 | Ga0501038_0116844_80_760 | 219 |
| 80 | 3300049581 | Ga0501047_0006336 | Ga0501047_0006336_2014_2694 | 219 |
| 81 | 3300049822 | Ga0501035_0052601 | Ga0501035_0052601_2854_3534 | 219 |
| 82 | 3300049823 | Ga0501044_0039622 | Ga0501044_0039622_2253_2933 | 219 |
| 83 | 3300053136 | Ga0500559_0110611 | Ga0500559_0110611_503_1213 | 219 |
| 84 | 3300053148 | Ga0500590_121153 | Ga0500590_121153_249_974 | 219 |
| 85 | iso_pu_bacteria | 2513237102 | 2513700692 | 219 |
| 86 | iso_pu_bacteria | 2824617872 | 2824621994 | 219 |
| 87 | iso_pu_bacteria | 2824626560 | 2824629258 | 219 |
| 88 | iso_pu_bacteria | 2824635225 | 2824639209 | 219 |
| 89 | iso_pu_bacteria | 2824644064 | 2824651348 | 219 |
| 90 | iso_pu_bacteria | 2824714736 | 2824720471 | 219 |
| 91 | iso_pu_bacteria | 2824723954 | 2824728455 | 219 |
| 92 | 3300005331 | Ga0070670_100419702 | Ga0070670_1004197022 | 220 |
| 93 | 3300005338 | Ga0068868_100009995 | Ga0068868_1000099959 | 220 |
| 94 | 3300005344 | Ga0070661_100169956 | Ga0070661_1001699562 | 220 |
| 95 | 3300005354 | Ga0070675_100513571 | Ga0070675_1005135712 | 220 |
| 96 | 3300005455 | Ga0070663_100349102 | Ga0070663_1003491022 | 220 |
| 97 | 3300005457 | Ga0070662_100330256 | Ga0070662_1003302562 | 220 |
| 98 | 3300005544 | Ga0070686_100094487 | Ga0070686_1000944873 | 220 |
| 99 | 3300005614 | Ga0068856_100255951 | Ga0068856_1002559512 | 220 |
| 100 | 3300005616 | Ga0068852_100803405 | Ga0068852_1008034051 | 220 |
| 101 | 3300005617 | Ga0068859_100749466 | Ga0068859_1007494661 | 220 |
| 102 | 3300005618 | Ga0068864_100140540 | Ga0068864_1001405403 | 220 |
| 103 | 3300005719 | Ga0068861_100226626 | Ga0068861_1002266263 | 220 |
| 104 | 3300005834 | Ga0068851_10091721 | Ga0068851_100917212 | 220 |
| 105 | 3300006042 | Ga0075368_10029327 | Ga0075368_100293273 | 220 |
| 106 | 3300006195 | Ga0075366_10217981 | Ga0075366_102179813 | 220 |
| 107 | 3300006871 | Ga0075434_100622146 | Ga0075434_1006221462 | 220 |
| 108 | 3300006931 | Ga0097620_100749440 | Ga0097620_1007494401 | 220 |
| 109 | 3300009148 | Ga0105243_10044783 | Ga0105243_100447835 | 220 |
| 110 | 3300009177 | Ga0105248_10298373 | Ga0105248_102983733 | 220 |
| 111 | 3300009551 | Ga0105238_10044483 | Ga0105238_100444835 | 220 |
| 112 | 3300013306 | Ga0163162_10511344 | Ga0163162_105113441 | 220 |
| 113 | 3300013307 | Ga0157372_10259451 | Ga0157372_102594513 | 220 |
| 114 | 3300014325 | Ga0163163_10588260 | Ga0163163_105882601 | 220 |
| 115 | 3300025911 | Ga0207654_10026270 | Ga0207654_100262704 | 220 |
| 116 | 3300025924 | Ga0207694_10383732 | Ga0207694_103837322 | 220 |
| 117 | 3300025925 | Ga0207650_10556215 | Ga0207650_105562151 | 220 |
| 118 | 3300025933 | Ga0207706_10158982 | Ga0207706_101589823 | 220 |
| 119 | 3300025942 | Ga0207689_10071057 | Ga0207689_100710573 | 220 |
| 120 | 3300026067 | Ga0207678_10020798 | Ga0207678_100207985 | 220 |
| 121 | 3300026116 | Ga0207674_10021271 | Ga0207674_100212712 | 220 |
| 122 | 3300026118 | Ga0207675_100338233 | Ga0207675_1003382332 | 220 |
| 123 | 3300028379 | Ga0268266_10259992 | Ga0268266_102599922 | 220 |
| 124 | 3300048911 | Ga0496108_0032526 | Ga0496108_0032526_3050_3754 | 220 |
| 125 | 3300048924 | Ga0496121_0254014 | Ga0496121_0254014_207_911 | 220 |
| 126 | 3300050490 | nmdc:mga03n38_92549_c1 | nmdc:mga03n38_92549_c1_125_829 | 220 |
| 127 | 3300050494 | nmdc:mga06z11_366921_c1 | nmdc:mga06z11_366921_c1_25_729 | 220 |
| 128 | 3300050496 | nmdc:mga07m45_269014_c1 | nmdc:mga07m45_269014_c1_251_955 | 220 |
| 129 | 3300053139 | Ga0500568_0029907 | Ga0500568_0029907_260_943 | 220 |
| 130 | 3300010375 | Ga0105239_10593912 | Ga0105239_105939121 | 221 |
| 131 | iso_pu_bacteria | 2513237101 | 2513695538 | 221 |
| 132 | iso_pu_bacteria | 2721755755 | 2723843933 | 221 |
| 133 | iso_pu_bacteria | 2874604998 | 2874612076 | 221 |
| 134 | iso_pu_bacteria | 2876808645 | 2876812706 | 221 |
| 135 | iso_pu_bacteria | 2879110137 | 2879114001 | 221 |
| 136 | iso_pu_bacteria | 2889033259 | 2889038786 | 221 |
| 137 | iso_pu_bacteria | 2922386360 | 2922386656 | 221 |
| 138 | iso_pu_bacteria | 8006964411 | 8006968054 | 221 |
| 139 | iso_pu_bacteria | 8006984368 | 8006992238 | 221 |
| 140 | iso_pu_bacteria | 8006994254 | 8006999371 | 221 |
| 141 | iso_pu_bacteria | 8056673599 | 8056680008 | 221 |
| 142 | 3300028381 | Ga0268264_10087254 | Ga0268264_100872543 | 222 |
| 143 | 3300032005 | Ga0307411_10106497 | Ga0307411_101064972 | 222 |
| 144 | 3300048929 | Ga0496126_0251227 | Ga0496126_0251227_508_1197 | 222 |
| 145 | iso_pu_bacteria | 2513237098 | 2513677722 | 222 |
| 146 | iso_pu_bacteria | 2524023210 | 2524463602 | 222 |
| 147 | iso_pu_bacteria | 2885383462 | 2885392211 | 222 |
| 148 | iso_pu_bacteria | 2903768456 | 2903777820 | 222 |
| 149 | iso_pu_bacteria | 8006933436 | 8006943649 | 222 |
| 150 | iso_pu_bacteria | 8006973647 | 8006983899 | 222 |
| 151 | iso_pu_bacteria | 8056681323 | 8056687695 | 222 |
| 152 | 3300005539 | Ga0068853_100350689 | Ga0068853_1003506892 | 223 |
| 153 | 3300006178 | Ga0075367_10167176 | Ga0075367_101671763 | 223 |
| 154 | 3300010159 | Ga0099796_10199126 | Ga0099796_101991261 | 223 |
| 155 | 3300021377 | Ga0213874_10090067 | Ga0213874_100900671 | 223 |
| 156 | 3300035241 | Ga0373961_0065076 | Ga0373961_0065076_74_757 | 223 |
| 157 | 3300039437 | Ga0436365_1283747 | Ga0436365_1283747_1953_2633 | 223 |
| 158 | 3300039450 | Ga0436363_1627615 | Ga0436363_1627615_702_1382 | 223 |
| 159 | 3300048918 | Ga0496115_0645452 | Ga0496115_0645452_78_770 | 223 |
| 160 | 3300048925 | Ga0496122_0339071 | Ga0496122_0339071_46_729 | 223 |
| 161 | 3300048929 | Ga0496126_0032666 | Ga0496126_0032666_3020_3703 | 223 |
| 162 | 3300049570 | Ga0501033_0357721 | Ga0501033_0357721_158_844 | 223 |
| 163 | 3300049823 | Ga0501044_0324363 | Ga0501044_0324363_446_1132 | 223 |
| 164 | 3300050516 | nmdc:mga0sz30_189516_c1 | nmdc:mga0sz30_189516_c1_178_861 | 223 |
| 165 | 3300053118 | Ga0500594_0032729 | Ga0500594_0032729_482_1183 | 223 |
| 166 | 3300053147 | Ga0500589_080908 | Ga0500589_080908_614_1315 | 223 |
| 167 | iso_pu_bacteria | 2513237101 | 2513691535 | 223 |
| 168 | iso_pu_bacteria | 2513237104 | 2513721490 | 223 |
| 169 | iso_pu_bacteria | 2721755755 | 2723845474 | 223 |
| 170 | iso_pu_bacteria | 2791355199 | 2793083333 | 223 |
| 171 | iso_pu_bacteria | 2874604998 | 2874607628 | 223 |
| 172 | iso_pu_bacteria | 2874604998 | 2874612470 | 223 |
| 173 | iso_pu_bacteria | 2876808645 | 2876812993 | 223 |
| 174 | iso_pu_bacteria | 2879110137 | 2879115367 | 223 |
| 175 | iso_pu_bacteria | 2889033259 | 2889040253 | 223 |
| 176 | iso_pu_bacteria | 8006926726 | 8006928619 | 223 |
| 177 | 3300003215 | JGI25153J46596_10004474 | JGI25153J46596_100044747 | 224 |
| 178 | 3300003775 | Ga0055524_1016563 | Ga0055524_10165634 | 224 |
| 179 | 3300003794 | Ga0055531_10002968 | Ga0055531_1000296811 | 224 |
| 180 | 3300003794 | Ga0055531_10004025 | Ga0055531_100040256 | 224 |
| 181 | 3300005262 | Ga0065165_1007237 | Ga0065165_10072374 | 224 |
| 182 | 3300005328 | Ga0070676_10202147 | Ga0070676_102021472 | 224 |
| 183 | 3300005329 | Ga0070683_100088893 | Ga0070683_1000888934 | 224 |
| 184 | 3300005331 | Ga0070670_100097365 | Ga0070670_1000973652 | 224 |
| 185 | 3300005336 | Ga0070680_100012857 | Ga0070680_1000128579 | 224 |
| 186 | 3300005337 | Ga0070682_100196475 | Ga0070682_1001964751 | 224 |
| 187 | 3300005338 | Ga0068868_100009489 | Ga0068868_1000094893 | 224 |
| 188 | 3300005339 | Ga0070660_100438439 | Ga0070660_1004384391 | 224 |
| 189 | 3300005347 | Ga0070668_100256230 | Ga0070668_1002562302 | 224 |
| 190 | 3300005356 | Ga0070674_100107344 | Ga0070674_1001073443 | 224 |
| 191 | 3300005435 | Ga0070714_100033282 | Ga0070714_1000332823 | 224 |
| 192 | 3300005455 | Ga0070663_100024348 | Ga0070663_1000243484 | 224 |
| 193 | 3300005456 | Ga0070678_100009842 | Ga0070678_1000098425 | 224 |
| 194 | 3300005456 | Ga0070678_100376752 | Ga0070678_1003767522 | 224 |
| 195 | 3300005457 | Ga0070662_100006982 | Ga0070662_1000069824 | 224 |
| 196 | 3300005458 | Ga0070681_10014127 | Ga0070681_100141275 | 224 |
| 197 | 3300005535 | Ga0070684_100557337 | Ga0070684_1005573372 | 224 |
| 198 | 3300005548 | Ga0070665_100041394 | Ga0070665_1000413945 | 224 |
| 199 | 3300005548 | Ga0070665_100351429 | Ga0070665_1003514293 | 224 |
| 200 | 3300005548 | Ga0070665_100443489 | Ga0070665_1004434892 | 224 |
| 201 | 3300005548 | Ga0070665_100742704 | Ga0070665_1007427041 | 224 |
| 202 | 3300005563 | Ga0068855_100012945 | Ga0068855_1000129459 | 224 |
| 203 | 3300005578 | Ga0068854_100463210 | Ga0068854_1004632102 | 224 |
| 204 | 3300005614 | Ga0068856_100172083 | Ga0068856_1001720833 | 224 |
| 205 | 3300005616 | Ga0068852_100106137 | Ga0068852_1001061373 | 224 |
| 206 | 3300005719 | Ga0068861_100013644 | Ga0068861_1000136444 | 224 |
| 207 | 3300005937 | Ga0081455_10001783 | Ga0081455_1000178310 | 224 |
| 208 | 3300006038 | Ga0075365_10093855 | Ga0075365_100938551 | 224 |
| 209 | 3300006038 | Ga0075365_10219570 | Ga0075365_102195702 | 224 |
| 210 | 3300006048 | Ga0075363_100281854 | Ga0075363_1002818542 | 224 |
| 211 | 3300006178 | Ga0075367_10193191 | Ga0075367_101931913 | 224 |
| 212 | 3300006178 | Ga0075367_10371991 | Ga0075367_103719912 | 224 |
| 213 | 3300006237 | Ga0097621_100127925 | Ga0097621_1001279253 | 224 |
| 214 | 3300006358 | Ga0068871_100233898 | Ga0068871_1002338983 | 224 |
| 215 | 3300006881 | Ga0068865_100112101 | Ga0068865_1001121013 | 224 |
| 216 | 3300006942 | Ga0099824_1023507 | Ga0099824_10235076 | 224 |
| 217 | 3300006943 | Ga0099822_1054190 | Ga0099822_10541902 | 224 |
| 218 | 3300009093 | Ga0105240_10031599 | Ga0105240_100315993 | 224 |
| 219 | 3300009098 | Ga0105245_10015268 | Ga0105245_100152684 | 224 |
| 220 | 3300009098 | Ga0105245_10070764 | Ga0105245_100707644 | 224 |
| 221 | 3300009177 | Ga0105248_10241458 | Ga0105248_102414581 | 224 |
| 222 | 3300009545 | Ga0105237_10170955 | Ga0105237_101709553 | 224 |
| 223 | 3300009551 | Ga0105238_10405076 | Ga0105238_104050762 | 224 |
| 224 | 3300009553 | Ga0105249_10045684 | Ga0105249_100456847 | 224 |
| 225 | 3300010375 | Ga0105239_10043843 | Ga0105239_100438435 | 224 |
| 226 | 3300010375 | Ga0105239_10102612 | Ga0105239_101026122 | 224 |
| 227 | 3300010375 | Ga0105239_10187191 | Ga0105239_101871915 | 224 |
| 228 | 3300011119 | Ga0105246_10007577 | Ga0105246_100075774 | 224 |
| 229 | 3300013296 | Ga0157374_10003708 | Ga0157374_100037086 | 224 |
| 230 | 3300013297 | Ga0157378_10000706 | Ga0157378_1000070612 | 224 |
| 231 | 3300013297 | Ga0157378_10009737 | Ga0157378_100097378 | 224 |
| 232 | 3300013297 | Ga0157378_10074982 | Ga0157378_100749823 | 224 |
| 233 | 3300013297 | Ga0157378_10187155 | Ga0157378_101871553 | 224 |
| 234 | 3300013306 | Ga0163162_10005573 | Ga0163162_1000557312 | 224 |
| 235 | 3300013306 | Ga0163162_10006254 | Ga0163162_100062548 | 224 |
| 236 | 3300013308 | Ga0157375_10240474 | Ga0157375_102404743 | 224 |
| 237 | 3300014325 | Ga0163163_10027833 | Ga0163163_100278334 | 224 |
| 238 | 3300014326 | Ga0157380_10022035 | Ga0157380_100220353 | 224 |
| 239 | 3300014969 | Ga0157376_10038827 | Ga0157376_100388275 | 224 |
| 240 | 3300017792 | Ga0163161_10358607 | Ga0163161_103586072 | 224 |
| 241 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011507 | 224 |
| 242 | 3300025299 | Ga0209256_1001013 | Ga0209256_100101310 | 224 |
| 243 | 3300025302 | Ga0207426_1020535 | Ga0207426_10205352 | 224 |
| 244 | 3300025304 | Ga0209257_1004704 | Ga0209257_10047047 | 224 |
| 245 | 3300025913 | Ga0207695_10024377 | Ga0207695_100243773 | 224 |
| 246 | 3300025914 | Ga0207671_10160589 | Ga0207671_101605893 | 224 |
| 247 | 3300025917 | Ga0207660_10146484 | Ga0207660_101464843 | 224 |
| 248 | 3300025921 | Ga0207652_10210825 | Ga0207652_102108253 | 224 |
| 249 | 3300025926 | Ga0207659_10081566 | Ga0207659_100815663 | 224 |
| 250 | 3300025927 | Ga0207687_10006921 | Ga0207687_100069215 | 224 |
| 251 | 3300025933 | Ga0207706_10169631 | Ga0207706_101696312 | 224 |
| 252 | 3300025934 | Ga0207686_10497615 | Ga0207686_104976152 | 224 |
| 253 | 3300025937 | Ga0207669_10029306 | Ga0207669_100293064 | 224 |
| 254 | 3300025938 | Ga0207704_10118053 | Ga0207704_101180532 | 224 |
| 255 | 3300025944 | Ga0207661_10074658 | Ga0207661_100746584 | 224 |
| 256 | 3300025949 | Ga0207667_10028236 | Ga0207667_100282363 | 224 |
| 257 | 3300025961 | Ga0207712_10076093 | Ga0207712_100760935 | 224 |
| 258 | 3300026023 | Ga0207677_10040545 | Ga0207677_100405454 | 224 |
| 259 | 3300026067 | Ga0207678_10040116 | Ga0207678_100401164 | 224 |
| 260 | 3300026067 | Ga0207678_10489274 | Ga0207678_104892741 | 224 |
| 261 | 3300026118 | Ga0207675_100026976 | Ga0207675_1000269763 | 224 |
| 262 | 3300026121 | Ga0207683_10024719 | Ga0207683_100247194 | 224 |
| 263 | 3300026142 | Ga0207698_10129425 | Ga0207698_101294253 | 224 |
| 264 | 3300027296 | Ga0209389_1000097 | Ga0209389_100009713 | 224 |
| 265 | 3300027357 | Ga0209589_1000132 | Ga0209589_100013213 | 224 |
| 266 | 3300027361 | Ga0209489_100368 | Ga0209489_10036875 | 224 |
| 267 | 3300028379 | Ga0268266_10029071 | Ga0268266_100290713 | 224 |
| 268 | 3300028379 | Ga0268266_10226857 | Ga0268266_102268572 | 224 |
| 269 | 3300028379 | Ga0268266_10390879 | Ga0268266_103908792 | 224 |
| 270 | 3300028786 | Ga0307517_10001951 | Ga0307517_1000195110 | 224 |
| 271 | 3300028786 | Ga0307517_10121022 | Ga0307517_101210223 | 224 |
| 272 | 3300028794 | Ga0307515_10023166 | Ga0307515_1002316612 | 224 |
| 273 | 3300031616 | Ga0307508_10087619 | Ga0307508_100876194 | 224 |
| 274 | 3300031616 | Ga0307508_10178537 | Ga0307508_101785372 | 224 |
| 275 | 3300041460 | Ga0451802_0592381 | Ga0451802_0592381_284_985 | 224 |
| 276 | 3300041494 | Ga0451837_0899558 | Ga0451837_0899558_27_722 | 224 |
| 277 | 3300041512 | Ga0451853_3998411 | Ga0451853_3998411_27_722 | 224 |
| 278 | 3300046476 | Ga0495662_0124596 | Ga0495662_0124596_98_793 | 224 |
| 279 | 3300046507 | Ga0495606_0006293 | Ga0495606_0006293_3275_3970 | 224 |
| 280 | 3300046557 | Ga0495622_0016648 | Ga0495622_0016648_2673_3383 | 224 |
| 281 | 3300046660 | Ga0495625_0157787 | Ga0495625_0157787_459_1160 | 224 |
| 282 | 3300047315 | Ga0495581_0141988 | Ga0495581_0141988_514_1224 | 224 |
| 283 | 3300047315 | Ga0495581_0273294 | Ga0495581_0273294_139_822 | 224 |
| 284 | 3300047469 | Ga0495673_0142280 | Ga0495673_0142280_29_739 | 224 |
| 285 | 3300048903 | Ga0496100_0104386 | Ga0496100_0104386_49_744 | 224 |
| 286 | 3300048904 | Ga0496101_0002419 | Ga0496101_0002419_5385_6080 | 224 |
| 287 | 3300048905 | Ga0496102_0007052 | Ga0496102_0007052_5392_6087 | 224 |
| 288 | 3300048907 | Ga0496104_0008791 | Ga0496104_0008791_5679_6374 | 224 |
| 289 | 3300048908 | Ga0496105_0013646 | Ga0496105_0013646_2750_3445 | 224 |
| 290 | 3300048909 | Ga0496106_0009736 | Ga0496106_0009736_3412_4107 | 224 |
| 291 | 3300048910 | Ga0496107_0003302 | Ga0496107_0003302_2750_3445 | 224 |
| 292 | 3300048911 | Ga0496108_0027381 | Ga0496108_0027381_3170_3865 | 224 |
| 293 | 3300048912 | Ga0496109_0004082 | Ga0496109_0004082_3006_3701 | 224 |
| 294 | 3300048915 | Ga0496112_0000036 | Ga0496112_0000036_22776_23471 | 224 |
| 295 | 3300048915 | Ga0496112_0026108 | Ga0496112_0026108_3006_3701 | 224 |
| 296 | 3300048916 | Ga0496113_0027023 | Ga0496113_0027023_586_1281 | 224 |
| 297 | 3300048916 | Ga0496113_0607136 | Ga0496113_0607136_26_721 | 224 |
| 298 | 3300048917 | Ga0496114_0045844 | Ga0496114_0045844_2899_3594 | 224 |
| 299 | 3300048918 | Ga0496115_0002238 | Ga0496115_0002238_9158_9853 | 224 |
| 300 | 3300048922 | Ga0496119_0193775 | Ga0496119_0193775_87_794 | 224 |
| 301 | 3300048929 | Ga0496126_0452623 | Ga0496126_0452623_153_848 | 224 |
| 302 | 3300050492 | nmdc:mga0yw44_397337_c1 | nmdc:mga0yw44_397337_c1_50_751 | 224 |
| 303 | 3300050492 | nmdc:mga0yw44_543633_c1 | nmdc:mga0yw44_543633_c1_47_742 | 224 |
| 304 | 3300050492 | nmdc:mga0yw44_88550_c1 | nmdc:mga0yw44_88550_c1_763_1458 | 224 |
| 305 | 3300050493 | nmdc:mga0k408_83414_c1 | nmdc:mga0k408_83414_c1_331_1026 | 224 |
| 306 | 3300050495 | nmdc:mga04h51_195069_c1 | nmdc:mga04h51_195069_c1_60_755 | 224 |
| 307 | 3300050496 | nmdc:mga07m45_24799_c1 | nmdc:mga07m45_24799_c1_1175_1870 | 224 |
| 308 | 3300053085 | Ga0495619_0104644 | Ga0495619_0104644_1147_1830 | 224 |
| 309 | 3300053096 | Ga0500641_0005264 | Ga0500641_0005264_524_1219 | 224 |
| 310 | 3300053096 | Ga0500641_0045876 | Ga0500641_0045876_913_1614 | 224 |
| 311 | 3300053102 | Ga0500554_057533 | Ga0500554_057533_67_762 | 224 |
| 312 | 3300053105 | Ga0500557_000062 | Ga0500557_000062_6010_6717 | 224 |
| 313 | 3300053119 | Ga0500595_000181 | Ga0500595_000181_7510_8205 | 224 |
| 314 | 3300053150 | Ga0500603_011044 | Ga0500603_011044_483_1178 | 224 |
| 315 | 3300053150 | Ga0500603_013809 | Ga0500603_013809_489_1184 | 224 |
| 316 | 3300053162 | Ga0500638_020349 | Ga0500638_020349_226_921 | 224 |
| 317 | 3300053162 | Ga0500638_142257 | Ga0500638_142257_60_755 | 224 |
| 318 | 3300053177 | Ga0500636_0072868 | Ga0500636_0072868_1177_1872 | 224 |
| 319 | 3300053178 | Ga0500637_0001313 | Ga0500637_0001313_1950_2645 | 224 |
| 320 | 3300053178 | Ga0500637_0007702 | Ga0500637_0007702_3422_4117 | 224 |
| 321 | 3300053729 | Ga0500625_005743 | Ga0500625_005743_3211_3918 | 224 |
| 322 | 3300055283 | Ga0500661_000463 | Ga0500661_000463_1687_2382 | 224 |
| 323 | iso_pu_bacteria | 2508501128 | 2509152269 | 224 |
| 324 | iso_pu_bacteria | 2513237141 | 2513892533 | 224 |
| 325 | 3300003215 | JGI25153J46596_10039897 | JGI25153J46596_100398971 | 225 |
| 326 | 3300003354 | JGI25160J50197_1005535 | JGI25160J50197_10055352 | 225 |
| 327 | 3300005355 | Ga0070671_100191982 | Ga0070671_1001919822 | 225 |
| 328 | 3300005456 | Ga0070678_100457902 | Ga0070678_1004579021 | 225 |
| 329 | 3300005841 | Ga0068863_100832382 | Ga0068863_1008323821 | 225 |
| 330 | 3300006173 | Ga0070716_100137205 | Ga0070716_1001372052 | 225 |
| 331 | 3300006195 | Ga0075366_10302222 | Ga0075366_103022222 | 225 |
| 332 | 3300006237 | Ga0097621_100151163 | Ga0097621_1001511632 | 225 |
| 333 | 3300006358 | Ga0068871_100232424 | Ga0068871_1002324242 | 225 |
| 334 | 3300007265 | Ga0099794_10024766 | Ga0099794_100247662 | 225 |
| 335 | 3300009177 | Ga0105248_10026062 | Ga0105248_100260624 | 225 |
| 336 | 3300009551 | Ga0105238_10076894 | Ga0105238_100768943 | 225 |
| 337 | 3300010375 | Ga0105239_10235261 | Ga0105239_102352614 | 225 |
| 338 | 3300025254 | Ga0209148_1008698 | Ga0209148_10086981 | 225 |
| 339 | 3300025272 | Ga0209455_1004461 | Ga0209455_10044614 | 225 |
| 340 | 3300025297 | Ga0209758_1010292 | Ga0209758_10102926 | 225 |
| 341 | 3300025297 | Ga0209758_1018402 | Ga0209758_10184025 | 225 |
| 342 | 3300025297 | Ga0209758_1022083 | Ga0209758_10220833 | 225 |
| 343 | 3300025302 | Ga0207426_1004317 | Ga0207426_10043173 | 225 |
| 344 | 3300025898 | Ga0207692_10000790 | Ga0207692_100007908 | 225 |
| 345 | 3300025931 | Ga0207644_10240604 | Ga0207644_102406042 | 225 |
| 346 | 3300025939 | Ga0207665_10101547 | Ga0207665_101015474 | 225 |
| 347 | 3300025941 | Ga0207711_10476850 | Ga0207711_104768501 | 225 |
| 348 | 3300026078 | Ga0207702_10299862 | Ga0207702_102998622 | 225 |
| 349 | 3300028556 | Ga0265337_1002404 | Ga0265337_10024047 | 225 |
| 350 | 3300028573 | Ga0265334_10012351 | Ga0265334_100123514 | 225 |
| 351 | 3300028653 | Ga0265323_10000276 | Ga0265323_1000027619 | 225 |
| 352 | 3300028666 | Ga0265336_10000268 | Ga0265336_1000026817 | 225 |
| 353 | 3300028800 | Ga0265338_10000280 | Ga0265338_1000028070 | 225 |
| 354 | 3300029957 | Ga0265324_10003108 | Ga0265324_100031085 | 225 |
| 355 | 3300031247 | Ga0265340_10219543 | Ga0265340_102195431 | 225 |
| 356 | 3300031824 | Ga0307413_10006217 | Ga0307413_100062174 | 225 |
| 357 | 3300031995 | Ga0307409_100163143 | Ga0307409_1001631432 | 225 |
| 358 | 3300032005 | Ga0307411_10113700 | Ga0307411_101137003 | 225 |
| 359 | 3300034957 | Ga0373938_0008929 | Ga0373938_0008929_1040_1726 | 225 |
| 360 | 3300035691 | Ga0373931_0246647 | Ga0373931_0246647_210_896 | 225 |
| 361 | 3300035695 | Ga0373927_0032437 | Ga0373927_0032437_2449_3135 | 225 |
| 362 | 3300037466 | Ga0395898_0040336 | Ga0395898_0040336_2150_2842 | 225 |
| 363 | 3300038443 | Ga0395901_0399117 | Ga0395901_0399117_374_1066 | 225 |
| 364 | 3300039437 | Ga0436365_0100896 | Ga0436365_0100896_39_734 | 225 |
| 365 | 3300042438 | Ga0439459_0052452 | Ga0439459_0052452_189_872 | 225 |
| 366 | 3300044683 | Ga0466965_0228744 | Ga0466965_0228744_280_972 | 225 |
| 367 | 3300044842 | Ga0466957_0056414 | Ga0466957_0056414_888_1577 | 225 |
| 368 | 3300046477 | Ga0495664_0367982 | Ga0495664_0367982_49_735 | 225 |
| 369 | 3300046674 | Ga0495588_0035133 | Ga0495588_0035133_1210_1893 | 225 |
| 370 | 3300046679 | Ga0495623_0262244 | Ga0495623_0262244_11_718 | 225 |
| 371 | 3300047321 | Ga0495676_0099181 | Ga0495676_0099181_1414_2121 | 225 |
| 372 | 3300048904 | Ga0496101_0059874 | Ga0496101_0059874_1423_2109 | 225 |
| 373 | 3300048906 | Ga0496103_0286132 | Ga0496103_0286132_213_899 | 225 |
| 374 | 3300048907 | Ga0496104_0008613 | Ga0496104_0008613_7187_7873 | 225 |
| 375 | 3300048908 | Ga0496105_0009843 | Ga0496105_0009843_1570_2256 | 225 |
| 376 | 3300048912 | Ga0496109_0019860 | Ga0496109_0019860_4002_4688 | 225 |
| 377 | 3300048913 | Ga0496110_0062958 | Ga0496110_0062958_2296_2982 | 225 |
| 378 | 3300048915 | Ga0496112_0044309 | Ga0496112_0044309_755_1441 | 225 |
| 379 | 3300048916 | Ga0496113_0042869 | Ga0496113_0042869_872_1558 | 225 |
| 380 | 3300048917 | Ga0496114_0070785 | Ga0496114_0070785_1685_2371 | 225 |
| 381 | 3300048918 | Ga0496115_0069124 | Ga0496115_0069124_49_735 | 225 |
| 382 | 3300048924 | Ga0496121_0061911 | Ga0496121_0061911_708_1403 | 225 |
| 383 | 3300048927 | Ga0496124_0029357 | Ga0496124_0029357_3993_4739 | 225 |
| 384 | 3300048928 | Ga0496125_0081801 | Ga0496125_0081801_1398_2144 | 225 |
| 385 | 3300048929 | Ga0496126_0014942 | Ga0496126_0014942_564_1265 | 225 |
| 386 | 3300050516 | nmdc:mga0sz30_173081_c1 | nmdc:mga0sz30_173081_c1_41_724 | 225 |
| 387 | 3300050516 | nmdc:mga0sz30_19694_c1 | nmdc:mga0sz30_19694_c1_847_1575 | 225 |
| 388 | 3300053080 | Ga0500635_0002038 | Ga0500635_0002038_4238_4930 | 225 |
| 389 | 3300053087 | Ga0500643_000373 | Ga0500643_000373_18627_19334 | 225 |
| 390 | 3300053092 | Ga0500583_0016219 | Ga0500583_0016219_192_899 | 225 |
| 391 | 3300053094 | Ga0500566_0000011 | Ga0500566_0000011_112002_112694 | 225 |
| 392 | 3300053095 | Ga0500640_000891 | Ga0500640_000891_2125_2817 | 225 |
| 393 | 3300053096 | Ga0500641_0034882 | Ga0500641_0034882_944_1651 | 225 |
| 394 | 3300053098 | Ga0500650_0127604 | Ga0500650_0127604_316_1023 | 225 |
| 395 | 3300053103 | Ga0500555_005869 | Ga0500555_005869_2084_2791 | 225 |
| 396 | 3300053111 | Ga0500572_000563 | Ga0500572_000563_9278_9970 | 225 |
| 397 | 3300053113 | Ga0500580_073784 | Ga0500580_073784_304_996 | 225 |
| 398 | 3300053115 | Ga0500591_071643 | Ga0500591_071643_69_761 | 225 |
| 399 | 3300053118 | Ga0500594_0068565 | Ga0500594_0068565_74_781 | 225 |
| 400 | 3300053123 | Ga0500614_003680 | Ga0500614_003680_1215_1907 | 225 |
| 401 | 3300053139 | Ga0500568_0029054 | Ga0500568_0029054_1193_1900 | 225 |
| 402 | 3300053150 | Ga0500603_010619 | Ga0500603_010619_303_995 | 225 |
| 403 | 3300053151 | Ga0500604_0044559 | Ga0500604_0044559_265_972 | 225 |
| 404 | 3300053158 | Ga0500627_0046267 | Ga0500627_0046267_1134_1841 | 225 |
| 405 | 3300053159 | Ga0500630_000927 | Ga0500630_000927_5664_6356 | 225 |
| 406 | 3300053162 | Ga0500638_002499 | Ga0500638_002499_1982_2674 | 225 |
| 407 | 3300053163 | Ga0500639_001719 | Ga0500639_001719_8712_9404 | 225 |
| 408 | 3300053177 | Ga0500636_0047584 | Ga0500636_0047584_1634_2320 | 225 |
| 409 | 3300053178 | Ga0500637_0291157 | Ga0500637_0291157_82_774 | 225 |
| 410 | 3300053735 | Ga0500596_000148 | Ga0500596_000148_710_1402 | 225 |
| 411 | 3300053737 | Ga0500601_002160 | Ga0500601_002160_1215_1907 | 225 |
| 412 | 3300055283 | Ga0500661_006762 | Ga0500661_006762_962_1669 | 225 |
| 413 | iso_pu_bacteria | 2879099564 | 2879107895 | 225 |
| 414 | iso_pu_bacteria | 2922361189 | 2922366280 | 225 |
| 415 | iso_pu_bacteria | 2932809354 | 2932810194 | 225 |
| 416 | iso_pu_bacteria | 2932818245 | 2932821767 | 225 |
| 417 | iso_pu_bacteria | 2935760218 | 2935760754 | 225 |
| 418 | iso_pu_bacteria | 2935810662 | 2935814884 | 225 |
| 419 | iso_pu_bacteria | 2936037263 | 2936040473 | 225 |
| 420 | iso_pu_bacteria | 8006984368 | 8006985595 | 225 |
| 421 | 3300005327 | Ga0070658_10759682 | Ga0070658_107596821 | 226 |
| 422 | 3300005339 | Ga0070660_100280599 | Ga0070660_1002805992 | 226 |
| 423 | 3300005347 | Ga0070668_100029750 | Ga0070668_1000297504 | 226 |
| 424 | 3300005367 | Ga0070667_100619249 | Ga0070667_1006192491 | 226 |
| 425 | 3300005434 | Ga0070709_10002525 | Ga0070709_100025254 | 226 |
| 426 | 3300005434 | Ga0070709_10185738 | Ga0070709_101857381 | 226 |
| 427 | 3300005436 | Ga0070713_100020912 | Ga0070713_1000209124 | 226 |
| 428 | 3300005436 | Ga0070713_100027548 | Ga0070713_1000275485 | 226 |
| 429 | 3300005436 | Ga0070713_101060488 | Ga0070713_1010604881 | 226 |
| 430 | 3300005437 | Ga0070710_10001024 | Ga0070710_1000102411 | 226 |
| 431 | 3300005439 | Ga0070711_100009683 | Ga0070711_1000096834 | 226 |
| 432 | 3300005439 | Ga0070711_100018449 | Ga0070711_1000184493 | 226 |
| 433 | 3300005439 | Ga0070711_100445136 | Ga0070711_1004451361 | 226 |
| 434 | 3300005457 | Ga0070662_100275940 | Ga0070662_1002759403 | 226 |
| 435 | 3300005459 | Ga0068867_100040366 | Ga0068867_1000403661 | 226 |
| 436 | 3300005471 | Ga0070698_100010278 | Ga0070698_1000102785 | 226 |
| 437 | 3300005536 | Ga0070697_100080748 | Ga0070697_1000807484 | 226 |
| 438 | 3300005548 | Ga0070665_100228640 | Ga0070665_1002286403 | 226 |
| 439 | 3300005617 | Ga0068859_100051874 | Ga0068859_1000518745 | 226 |
| 440 | 3300005617 | Ga0068859_100079164 | Ga0068859_1000791643 | 226 |
| 441 | 3300005617 | Ga0068859_100806373 | Ga0068859_1008063732 | 226 |
| 442 | 3300005719 | Ga0068861_100011495 | Ga0068861_1000114955 | 226 |
| 443 | 3300005842 | Ga0068858_100091005 | Ga0068858_1000910054 | 226 |
| 444 | 3300005843 | Ga0068860_100000360 | Ga0068860_10000036031 | 226 |
| 445 | 3300005844 | Ga0068862_100042542 | Ga0068862_1000425424 | 226 |
| 446 | 3300006028 | Ga0070717_10004019 | Ga0070717_100040195 | 226 |
| 447 | 3300006028 | Ga0070717_10515197 | Ga0070717_105151972 | 226 |
| 448 | 3300006163 | Ga0070715_10057725 | Ga0070715_100577251 | 226 |
| 449 | 3300006175 | Ga0070712_100072062 | Ga0070712_1000720624 | 226 |
| 450 | 3300006175 | Ga0070712_100101369 | Ga0070712_1001013692 | 226 |
| 451 | 3300006175 | Ga0070712_100449471 | Ga0070712_1004494712 | 226 |
| 452 | 3300006178 | Ga0075367_10078657 | Ga0075367_100786572 | 226 |
| 453 | 3300006237 | Ga0097621_100511638 | Ga0097621_1005116381 | 226 |
| 454 | 3300006931 | Ga0097620_100051875 | Ga0097620_1000518755 | 226 |
| 455 | 3300006931 | Ga0097620_100079166 | Ga0097620_1000791663 | 226 |
| 456 | 3300006931 | Ga0097620_100806340 | Ga0097620_1008063401 | 226 |
| 457 | 3300009094 | Ga0111539_10279995 | Ga0111539_102799953 | 226 |
| 458 | 3300009098 | Ga0105245_10082045 | Ga0105245_100820453 | 226 |
| 459 | 3300009101 | Ga0105247_10023373 | Ga0105247_100233734 | 226 |
| 460 | 3300009176 | Ga0105242_10089119 | Ga0105242_100891191 | 226 |
| 461 | 3300009177 | Ga0105248_10090673 | Ga0105248_100906733 | 226 |
| 462 | 3300009545 | Ga0105237_10006317 | Ga0105237_1000631711 | 226 |
| 463 | 3300009545 | Ga0105237_10059054 | Ga0105237_100590543 | 226 |
| 464 | 3300009553 | Ga0105249_10129091 | Ga0105249_101290911 | 226 |
| 465 | 3300010375 | Ga0105239_10101961 | Ga0105239_101019612 | 226 |
| 466 | 3300013306 | Ga0163162_10444229 | Ga0163162_104442292 | 226 |
| 467 | 3300013308 | Ga0157375_10255052 | Ga0157375_102550522 | 226 |
| 468 | 3300014326 | Ga0157380_10191261 | Ga0157380_101912612 | 226 |
| 469 | 3300014968 | Ga0157379_10122531 | Ga0157379_101225314 | 226 |
| 470 | 3300014969 | Ga0157376_10346721 | Ga0157376_103467212 | 226 |
| 471 | 3300017792 | Ga0163161_10653284 | Ga0163161_106532841 | 226 |
| 472 | 3300021358 | Ga0213873_10001201 | Ga0213873_100012014 | 226 |
| 473 | 3300021384 | Ga0213876_10000880 | Ga0213876_100008806 | 226 |
| 474 | 3300025302 | Ga0207426_1003017 | Ga0207426_100301711 | 226 |
| 475 | 3300025899 | Ga0207642_10098867 | Ga0207642_100988671 | 226 |
| 476 | 3300025905 | Ga0207685_10118488 | Ga0207685_101184882 | 226 |
| 477 | 3300025906 | Ga0207699_10101858 | Ga0207699_101018581 | 226 |
| 478 | 3300025910 | Ga0207684_10167474 | Ga0207684_101674742 | 226 |
| 479 | 3300025915 | Ga0207693_10034331 | Ga0207693_100343315 | 226 |
| 480 | 3300025915 | Ga0207693_10094297 | Ga0207693_100942971 | 226 |
| 481 | 3300025916 | Ga0207663_10018614 | Ga0207663_100186144 | 226 |
| 482 | 3300025916 | Ga0207663_10024383 | Ga0207663_100243833 | 226 |
| 483 | 3300025916 | Ga0207663_10390662 | Ga0207663_103906622 | 226 |
| 484 | 3300025927 | Ga0207687_10039149 | Ga0207687_100391494 | 226 |
| 485 | 3300025928 | Ga0207700_10012013 | Ga0207700_100120135 | 226 |
| 486 | 3300025928 | Ga0207700_10170688 | Ga0207700_101706882 | 226 |
| 487 | 3300025928 | Ga0207700_10486708 | Ga0207700_104867081 | 226 |
| 488 | 3300025928 | Ga0207700_10891748 | Ga0207700_108917481 | 226 |
| 489 | 3300025935 | Ga0207709_10105981 | Ga0207709_101059813 | 226 |
| 490 | 3300025939 | Ga0207665_10002524 | Ga0207665_1000252410 | 226 |
| 491 | 3300025939 | Ga0207665_10046557 | Ga0207665_100465574 | 226 |
| 492 | 3300025940 | Ga0207691_10179571 | Ga0207691_101795713 | 226 |
| 493 | 3300025941 | Ga0207711_10044329 | Ga0207711_100443296 | 226 |
| 494 | 3300025972 | Ga0207668_10003594 | Ga0207668_1000359411 | 226 |
| 495 | 3300025972 | Ga0207668_10679568 | Ga0207668_106795681 | 226 |
| 496 | 3300026035 | Ga0207703_10447117 | Ga0207703_104471172 | 226 |
| 497 | 3300026035 | Ga0207703_11011197 | Ga0207703_110111971 | 226 |
| 498 | 3300026089 | Ga0207648_10023917 | Ga0207648_100239174 | 226 |
| 499 | 3300026118 | Ga0207675_100013202 | Ga0207675_1000132028 | 226 |
| 500 | 3300026118 | Ga0207675_101131000 | Ga0207675_1011310001 | 226 |
| 501 | 3300026121 | Ga0207683_10737527 | Ga0207683_107375271 | 226 |
| 502 | 3300028380 | Ga0268265_10027618 | Ga0268265_100276184 | 226 |
| 503 | 3300028381 | Ga0268264_10000030 | Ga0268264_10000030252 | 226 |
| 504 | 3300030763 | Ga0265763_1003008 | Ga0265763_10030082 | 226 |
| 505 | 3300031616 | Ga0307508_10000015 | Ga0307508_1000001541 | 226 |
| 506 | 3300031730 | Ga0307516_10005336 | Ga0307516_100053364 | 226 |
| 507 | 3300031730 | Ga0307516_10018310 | Ga0307516_100183108 | 226 |
| 508 | 3300031730 | Ga0307516_10024596 | Ga0307516_100245965 | 226 |
| 509 | 3300031730 | Ga0307516_10102338 | Ga0307516_101023383 | 226 |
| 510 | 3300033179 | Ga0307507_10047307 | Ga0307507_100473073 | 226 |
| 511 | 3300035083 | Ga0373926_0110107 | Ga0373926_0110107_247_936 | 226 |
| 512 | 3300035083 | Ga0373926_0125307 | Ga0373926_0125307_223_912 | 226 |
| 513 | 3300035111 | Ga0373923_0182118 | Ga0373923_0182118_34_723 | 226 |
| 514 | 3300035112 | Ga0373932_0058953 | Ga0373932_0058953_157_846 | 226 |
| 515 | 3300035113 | Ga0373936_0002506 | Ga0373936_0002506_38_727 | 226 |
| 516 | 3300035113 | Ga0373936_0089117 | Ga0373936_0089117_269_970 | 226 |
| 517 | 3300035116 | Ga0373945_0086052 | Ga0373945_0086052_216_908 | 226 |
| 518 | 3300035170 | Ga0373943_0008846 | Ga0373943_0008846_962_1651 | 226 |
| 519 | 3300035171 | Ga0373946_0001786 | Ga0373946_0001786_1925_2614 | 226 |
| 520 | 3300035171 | Ga0373946_0024266 | Ga0373946_0024266_94_786 | 226 |
| 521 | 3300035172 | Ga0373955_0150337 | Ga0373955_0150337_402_1091 | 226 |
| 522 | 3300035172 | Ga0373955_0271840 | Ga0373955_0271840_249_938 | 226 |
| 523 | 3300035410 | Ga0373924_0030132 | Ga0373924_0030132_1135_1824 | 226 |
| 524 | 3300035691 | Ga0373931_0028275 | Ga0373931_0028275_329_1018 | 226 |
| 525 | 3300035691 | Ga0373931_0361629 | Ga0373931_0361629_141_830 | 226 |
| 526 | 3300035692 | Ga0373935_0000803 | Ga0373935_0000803_3678_4367 | 226 |
| 527 | 3300035692 | Ga0373935_0012593 | Ga0373935_0012593_558_1247 | 226 |
| 528 | 3300035695 | Ga0373927_0001990 | Ga0373927_0001990_1950_2639 | 226 |
| 529 | 3300035695 | Ga0373927_0021017 | Ga0373927_0021017_3222_3908 | 226 |
| 530 | 3300035695 | Ga0373927_0051578 | Ga0373927_0051578_418_1107 | 226 |
| 531 | 3300035695 | Ga0373927_0236123 | Ga0373927_0236123_304_993 | 226 |
| 532 | 3300035725 | Ga0373947_0000647 | Ga0373947_0000647_13542_14231 | 226 |
| 533 | 3300035725 | Ga0373947_0166529 | Ga0373947_0166529_71_757 | 226 |
| 534 | 3300036242 | Ga0310104_05893 | Ga0310104_05893_13_702 | 226 |
| 535 | 3300036459 | Ga0372808_010828 | Ga0372808_010828_432_1121 | 226 |
| 536 | 3300037068 | Ga0373925_0001112 | Ga0373925_0001112_19951_20640 | 226 |
| 537 | 3300037068 | Ga0373925_0007023 | Ga0373925_0007023_6350_7039 | 226 |
| 538 | 3300037068 | Ga0373925_0141227 | Ga0373925_0141227_145_834 | 226 |
| 539 | 3300037068 | Ga0373925_0148316 | Ga0373925_0148316_854_1540 | 226 |
| 540 | 3300037068 | Ga0373925_0286347 | Ga0373925_0286347_303_995 | 226 |
| 541 | 3300039437 | Ga0436365_1236739 | Ga0436365_1236739_5446_6141 | 226 |
| 542 | 3300039453 | Ga0436362_0970189 | Ga0436362_0970189_1362_2057 | 226 |
| 543 | 3300041503 | Ga0451847_0671333 | Ga0451847_0671333_84_836 | 226 |
| 544 | 3300041512 | Ga0451853_3581848 | Ga0451853_3581848_446_1195 | 226 |
| 545 | 3300046454 | Ga0495592_0019732 | Ga0495592_0019732_3513_4202 | 226 |
| 546 | 3300046455 | Ga0495603_0002274 | Ga0495603_0002274_6424_7113 | 226 |
| 547 | 3300046455 | Ga0495603_0063119 | Ga0495603_0063119_1380_2066 | 226 |
| 548 | 3300046455 | Ga0495603_0192505 | Ga0495603_0192505_341_1033 | 226 |
| 549 | 3300046459 | Ga0495629_0000585 | Ga0495629_0000585_12794_13483 | 226 |
| 550 | 3300046461 | Ga0495641_0007833 | Ga0495641_0007833_329_1018 | 226 |
| 551 | 3300046462 | Ga0495651_0380230 | Ga0495651_0380230_54_743 | 226 |
| 552 | 3300046463 | Ga0495653_0143676 | Ga0495653_0143676_952_1641 | 226 |
| 553 | 3300046472 | Ga0495580_0000166 | Ga0495580_0000166_13096_13785 | 226 |
| 554 | 3300046472 | Ga0495580_0285655 | Ga0495580_0285655_131_817 | 226 |
| 555 | 3300046473 | Ga0495582_0002361 | Ga0495582_0002361_6573_7262 | 226 |
| 556 | 3300046475 | Ga0495639_0000075 | Ga0495639_0000075_39484_40173 | 226 |
| 557 | 3300046475 | Ga0495639_0048742 | Ga0495639_0048742_488_1177 | 226 |
| 558 | 3300046475 | Ga0495639_0096815 | Ga0495639_0096815_268_954 | 226 |
| 559 | 3300046475 | Ga0495639_0146958 | Ga0495639_0146958_347_1033 | 226 |
| 560 | 3300046476 | Ga0495662_0000356 | Ga0495662_0000356_7570_8259 | 226 |
| 561 | 3300046491 | Ga0495584_0106574 | Ga0495584_0106574_481_1182 | 226 |
| 562 | 3300046492 | Ga0495585_0079894 | Ga0495585_0079894_86_775 | 226 |
| 563 | 3300046499 | Ga0495594_0000120 | Ga0495594_0000120_32377_33066 | 226 |
| 564 | 3300046499 | Ga0495594_0016464 | Ga0495594_0016464_2196_2885 | 226 |
| 565 | 3300046506 | Ga0495583_0084632 | Ga0495583_0084632_268_975 | 226 |
| 566 | 3300046507 | Ga0495606_0040781 | Ga0495606_0040781_124_831 | 226 |
| 567 | 3300046514 | Ga0495618_0163946 | Ga0495618_0163946_555_1244 | 226 |
| 568 | 3300046517 | Ga0495630_0001903 | Ga0495630_0001903_5282_5971 | 226 |
| 569 | 3300046518 | Ga0495631_0176444 | Ga0495631_0176444_56_745 | 226 |
| 570 | 3300046523 | Ga0495644_0032459 | Ga0495644_0032459_717_1406 | 226 |
| 571 | 3300046524 | Ga0495648_0003336 | Ga0495648_0003336_3946_4653 | 226 |
| 572 | 3300046525 | Ga0495663_0036772 | Ga0495663_0036772_245_934 | 226 |
| 573 | 3300046526 | Ga0495666_0138142 | Ga0495666_0138142_179_868 | 226 |
| 574 | 3300046529 | Ga0495652_0019231 | Ga0495652_0019231_5273_5962 | 226 |
| 575 | 3300046531 | Ga0495665_0000085 | Ga0495665_0000085_12838_13527 | 226 |
| 576 | 3300046533 | Ga0495640_0000210 | Ga0495640_0000210_8223_8912 | 226 |
| 577 | 3300046536 | Ga0495587_0172064 | Ga0495587_0172064_319_1008 | 226 |
| 578 | 3300046537 | Ga0495598_0005668 | Ga0495598_0005668_1984_2673 | 226 |
| 579 | 3300046557 | Ga0495622_0003053 | Ga0495622_0003053_6979_7668 | 226 |
| 580 | 3300046557 | Ga0495622_0009952 | Ga0495622_0009952_1487_2176 | 226 |
| 581 | 3300046557 | Ga0495622_0032661 | Ga0495622_0032661_1145_1834 | 226 |
| 582 | 3300046559 | Ga0495667_0183036 | Ga0495667_0183036_235_924 | 226 |
| 583 | 3300046615 | Ga0495656_0009822 | Ga0495656_0009822_2105_2794 | 226 |
| 584 | 3300046642 | Ga0495634_0022896 | Ga0495634_0022896_825_1514 | 226 |
| 585 | 3300046642 | Ga0495634_0262615 | Ga0495634_0262615_65_754 | 226 |
| 586 | 3300046663 | Ga0495635_0003755 | Ga0495635_0003755_5591_6280 | 226 |
| 587 | 3300046664 | Ga0495659_0005051 | Ga0495659_0005051_239_928 | 226 |
| 588 | 3300046674 | Ga0495588_0001317 | Ga0495588_0001317_3935_4624 | 226 |
| 589 | 3300046674 | Ga0495588_0026723 | Ga0495588_0026723_1835_2524 | 226 |
| 590 | 3300046678 | Ga0495599_0089347 | Ga0495599_0089347_89_778 | 226 |
| 591 | 3300046681 | Ga0495647_0047752 | Ga0495647_0047752_204_893 | 226 |
| 592 | 3300046683 | Ga0495658_0000481 | Ga0495658_0000481_8640_9329 | 226 |
| 593 | 3300046683 | Ga0495658_0219938 | Ga0495658_0219938_235_924 | 226 |
| 594 | 3300046689 | Ga0495613_0002779 | Ga0495613_0002779_5685_6374 | 226 |
| 595 | 3300046690 | Ga0495624_0002075 | Ga0495624_0002075_1783_2472 | 226 |
| 596 | 3300046690 | Ga0495624_0091821 | Ga0495624_0091821_432_1121 | 226 |
| 597 | 3300046694 | Ga0495649_0166110 | Ga0495649_0166110_71_778 | 226 |
| 598 | 3300046809 | Ga0495600_0013354 | Ga0495600_0013354_116_805 | 226 |
| 599 | 3300047315 | Ga0495581_0000083 | Ga0495581_0000083_5668_6357 | 226 |
| 600 | 3300047315 | Ga0495581_0117560 | Ga0495581_0117560_809_1498 | 226 |
| 601 | 3300047315 | Ga0495581_0287819 | Ga0495581_0287819_68_754 | 226 |
| 602 | 3300047319 | Ga0495674_0164032 | Ga0495674_0164032_1110_1799 | 226 |
| 603 | 3300047321 | Ga0495676_0037885 | Ga0495676_0037885_3099_3788 | 226 |
| 604 | 3300047321 | Ga0495676_0135213 | Ga0495676_0135213_937_1629 | 226 |
| 605 | 3300047444 | Ga0495675_0190080 | Ga0495675_0190080_291_1007 | 226 |
| 606 | 3300047471 | Ga0495684_0058333 | Ga0495684_0058333_1567_2256 | 226 |
| 607 | 3300047472 | Ga0495686_0105241 | Ga0495686_0105241_31_720 | 226 |
| 608 | 3300047673 | Ga0495593_0000003 | Ga0495593_0000003_22410_23099 | 226 |
| 609 | 3300048088 | Ga0495602_0113500 | Ga0495602_0113500_939_1628 | 226 |
| 610 | 3300048903 | Ga0496100_0148317 | Ga0496100_0148317_567_1256 | 226 |
| 611 | 3300048905 | Ga0496102_0372853 | Ga0496102_0372853_81_770 | 226 |
| 612 | 3300048907 | Ga0496104_0041517 | Ga0496104_0041517_218_907 | 226 |
| 613 | 3300048907 | Ga0496104_0159145 | Ga0496104_0159145_517_1206 | 226 |
| 614 | 3300048908 | Ga0496105_0188531 | Ga0496105_0188531_307_996 | 226 |
| 615 | 3300048908 | Ga0496105_0392113 | Ga0496105_0392113_367_1056 | 226 |
| 616 | 3300048909 | Ga0496106_0000823 | Ga0496106_0000823_11469_12158 | 226 |
| 617 | 3300048910 | Ga0496107_0145386 | Ga0496107_0145386_800_1489 | 226 |
| 618 | 3300048911 | Ga0496108_0105828 | Ga0496108_0105828_1157_1846 | 226 |
| 619 | 3300048912 | Ga0496109_0078684 | Ga0496109_0078684_420_1109 | 226 |
| 620 | 3300048913 | Ga0496110_0200613 | Ga0496110_0200613_420_1109 | 226 |
| 621 | 3300048914 | Ga0496111_0071536 | Ga0496111_0071536_161_850 | 226 |
| 622 | 3300048914 | Ga0496111_0407105 | Ga0496111_0407105_251_940 | 226 |
| 623 | 3300048915 | Ga0496112_0017242 | Ga0496112_0017242_2707_3402 | 226 |
| 624 | 3300048915 | Ga0496112_0114497 | Ga0496112_0114497_634_1323 | 226 |
| 625 | 3300048916 | Ga0496113_0110683 | Ga0496113_0110683_244_933 | 226 |
| 626 | 3300048917 | Ga0496114_0126328 | Ga0496114_0126328_983_1672 | 226 |
| 627 | 3300048918 | Ga0496115_0168792 | Ga0496115_0168792_488_1174 | 226 |
| 628 | 3300048918 | Ga0496115_0423297 | Ga0496115_0423297_65_754 | 226 |
| 629 | 3300048920 | Ga0496117_0012131 | Ga0496117_0012131_1797_2486 | 226 |
| 630 | 3300048921 | Ga0496118_0003610 | Ga0496118_0003610_9862_10551 | 226 |
| 631 | 3300048921 | Ga0496118_0115373 | Ga0496118_0115373_1035_1724 | 226 |
| 632 | 3300048922 | Ga0496119_0098551 | Ga0496119_0098551_64_753 | 226 |
| 633 | 3300048924 | Ga0496121_0000041 | Ga0496121_0000041_7692_8381 | 226 |
| 634 | 3300048924 | Ga0496121_0000225 | Ga0496121_0000225_1984_2673 | 226 |
| 635 | 3300048924 | Ga0496121_0002396 | Ga0496121_0002396_6164_6853 | 226 |
| 636 | 3300048924 | Ga0496121_0186166 | Ga0496121_0186166_398_1087 | 226 |
| 637 | 3300048927 | Ga0496124_0012074 | Ga0496124_0012074_2378_3067 | 226 |
| 638 | 3300048928 | Ga0496125_0018399 | Ga0496125_0018399_3874_4563 | 226 |
| 639 | 3300048929 | Ga0496126_0005875 | Ga0496126_0005875_5927_6616 | 226 |
| 640 | 3300048929 | Ga0496126_0049902 | Ga0496126_0049902_2732_3421 | 226 |
| 641 | 3300048929 | Ga0496126_0135931 | Ga0496126_0135931_1065_1754 | 226 |
| 642 | 3300049460 | Ga0495682_0072640 | Ga0495682_0072640_12_701 | 226 |
| 643 | 3300049572 | Ga0501036_0229454 | Ga0501036_0229454_628_1317 | 226 |
| 644 | 3300049583 | Ga0501067_0184227 | Ga0501067_0184227_119_820 | 226 |
| 645 | 3300050494 | nmdc:mga06z11_81958_c1 | nmdc:mga06z11_81958_c1_659_1348 | 226 |
| 646 | 3300050512 | nmdc:mga0n895_488727_c1 | nmdc:mga0n895_488727_c1_48_737 | 226 |
| 647 | 3300050513 | nmdc:mga0rr50_457685_c1 | nmdc:mga0rr50_457685_c1_312_1001 | 226 |
| 648 | 3300053077 | Ga0495601_0096803 | Ga0495601_0096803_442_1131 | 226 |
| 649 | 3300053078 | Ga0495612_0087425 | Ga0495612_0087425_41_730 | 226 |
| 650 | 3300053080 | Ga0500635_0010446 | Ga0500635_0010446_237_926 | 226 |
| 651 | 3300053084 | Ga0495595_0151172 | Ga0495595_0151172_11_703 | 226 |
| 652 | 3300053084 | Ga0495595_0296178 | Ga0495595_0296178_12_701 | 226 |
| 653 | 3300053093 | Ga0500651_0159844 | Ga0500651_0159844_46_735 | 226 |
| 654 | 3300053097 | Ga0500648_227075 | Ga0500648_227075_179_868 | 226 |
| 655 | 3300053111 | Ga0500572_000437 | Ga0500572_000437_5674_6375 | 226 |
| 656 | 3300053119 | Ga0500595_000343 | Ga0500595_000343_20505_21194 | 226 |
| 657 | 3300053119 | Ga0500595_000799 | Ga0500595_000799_11260_11949 | 226 |
| 658 | 3300053136 | Ga0500559_0001384 | Ga0500559_0001384_7348_8049 | 226 |
| 659 | 3300053136 | Ga0500559_0004964 | Ga0500559_0004964_2578_3267 | 226 |
| 660 | 3300053140 | Ga0500573_0005486 | Ga0500573_0005486_115_804 | 226 |
| 661 | 3300053150 | Ga0500603_025504 | Ga0500603_025504_176_865 | 226 |
| 662 | 3300053163 | Ga0500639_018557 | Ga0500639_018557_439_1140 | 226 |
| 663 | 3300053177 | Ga0500636_0170448 | Ga0500636_0170448_67_756 | 226 |
| 664 | 3300053733 | Ga0500552_040614 | Ga0500552_040614_40_729 | 226 |
| 665 | 3300053735 | Ga0500596_001020 | Ga0500596_001020_4819_5508 | 226 |
| 666 | 3300053735 | Ga0500596_003660 | Ga0500596_003660_1863_2564 | 226 |
| 667 | iso_pu_bacteria | 2881665667 | 2881667002 | 226 |
| 668 | 3300003322 | rootL2_10276112 | rootL2_102761123 | 227 |
| 669 | 3300003659 | JGI25404J52841_10002046 | JGI25404J52841_100020464 | 227 |
| 670 | 3300003659 | JGI25404J52841_10008625 | JGI25404J52841_100086252 | 227 |
| 671 | 3300003659 | JGI25404J52841_10010725 | JGI25404J52841_100107253 | 227 |
| 672 | 3300005289 | Ga0065704_10016712 | Ga0065704_100167122 | 227 |
| 673 | 3300005328 | Ga0070676_10163900 | Ga0070676_101639003 | 227 |
| 674 | 3300005330 | Ga0070690_100170840 | Ga0070690_1001708402 | 227 |
| 675 | 3300005334 | Ga0068869_100183941 | Ga0068869_1001839412 | 227 |
| 676 | 3300005337 | Ga0070682_100563442 | Ga0070682_1005634421 | 227 |
| 677 | 3300005340 | Ga0070689_100199048 | Ga0070689_1001990482 | 227 |
| 678 | 3300005347 | Ga0070668_100071526 | Ga0070668_1000715263 | 227 |
| 679 | 3300005347 | Ga0070668_100322200 | Ga0070668_1003222001 | 227 |
| 680 | 3300005347 | Ga0070668_100465296 | Ga0070668_1004652962 | 227 |
| 681 | 3300005353 | Ga0070669_100051698 | Ga0070669_1000516983 | 227 |
| 682 | 3300005353 | Ga0070669_100262863 | Ga0070669_1002628633 | 227 |
| 683 | 3300005354 | Ga0070675_100143451 | Ga0070675_1001434512 | 227 |
| 684 | 3300005354 | Ga0070675_100716780 | Ga0070675_1007167801 | 227 |
| 685 | 3300005355 | Ga0070671_100178580 | Ga0070671_1001785801 | 227 |
| 686 | 3300005366 | Ga0070659_100320582 | Ga0070659_1003205822 | 227 |
| 687 | 3300005367 | Ga0070667_100137772 | Ga0070667_1001377723 | 227 |
| 688 | 3300005367 | Ga0070667_100582975 | Ga0070667_1005829752 | 227 |
| 689 | 3300005434 | Ga0070709_10001978 | Ga0070709_100019787 | 227 |
| 690 | 3300005435 | Ga0070714_100001459 | Ga0070714_10000145912 | 227 |
| 691 | 3300005436 | Ga0070713_100017039 | Ga0070713_1000170392 | 227 |
| 692 | 3300005436 | Ga0070713_100115555 | Ga0070713_1001155551 | 227 |
| 693 | 3300005437 | Ga0070710_10000316 | Ga0070710_1000031617 | 227 |
| 694 | 3300005438 | Ga0070701_10013117 | Ga0070701_100131174 | 227 |
| 695 | 3300005439 | Ga0070711_100000617 | Ga0070711_1000006177 | 227 |
| 696 | 3300005439 | Ga0070711_100535735 | Ga0070711_1005357351 | 227 |
| 697 | 3300005441 | Ga0070700_100188768 | Ga0070700_1001887682 | 227 |
| 698 | 3300005441 | Ga0070700_100599842 | Ga0070700_1005998421 | 227 |
| 699 | 3300005445 | Ga0070708_100294553 | Ga0070708_1002945532 | 227 |
| 700 | 3300005455 | Ga0070663_100007753 | Ga0070663_1000077536 | 227 |
| 701 | 3300005455 | Ga0070663_100014812 | Ga0070663_1000148124 | 227 |
| 702 | 3300005455 | Ga0070663_100293301 | Ga0070663_1002933012 | 227 |
| 703 | 3300005456 | Ga0070678_100662807 | Ga0070678_1006628071 | 227 |
| 704 | 3300005457 | Ga0070662_100171985 | Ga0070662_1001719852 | 227 |
| 705 | 3300005468 | Ga0070707_100639019 | Ga0070707_1006390192 | 227 |
| 706 | 3300005471 | Ga0070698_100220007 | Ga0070698_1002200073 | 227 |
| 707 | 3300005518 | Ga0070699_100189658 | Ga0070699_1001896581 | 227 |
| 708 | 3300005543 | Ga0070672_100184840 | Ga0070672_1001848403 | 227 |
| 709 | 3300005545 | Ga0070695_100060185 | Ga0070695_1000601854 | 227 |
| 710 | 3300005548 | Ga0070665_100032680 | Ga0070665_1000326806 | 227 |
| 711 | 3300005548 | Ga0070665_100061161 | Ga0070665_1000611611 | 227 |
| 712 | 3300005548 | Ga0070665_100218358 | Ga0070665_1002183582 | 227 |
| 713 | 3300005564 | Ga0070664_100468042 | Ga0070664_1004680423 | 227 |
| 714 | 3300005577 | Ga0068857_100761507 | Ga0068857_1007615072 | 227 |
| 715 | 3300005614 | Ga0068856_100144639 | Ga0068856_1001446393 | 227 |
| 716 | 3300005615 | Ga0070702_100021410 | Ga0070702_1000214102 | 227 |
| 717 | 3300005617 | Ga0068859_100022345 | Ga0068859_1000223453 | 227 |
| 718 | 3300005617 | Ga0068859_100022663 | Ga0068859_1000226632 | 227 |
| 719 | 3300005718 | Ga0068866_10040264 | Ga0068866_100402642 | 227 |
| 720 | 3300005719 | Ga0068861_100079787 | Ga0068861_1000797872 | 227 |
| 721 | 3300005719 | Ga0068861_100559370 | Ga0068861_1005593702 | 227 |
| 722 | 3300005719 | Ga0068861_100618353 | Ga0068861_1006183531 | 227 |
| 723 | 3300005840 | Ga0068870_10055148 | Ga0068870_100551482 | 227 |
| 724 | 3300005840 | Ga0068870_10277536 | Ga0068870_102775362 | 227 |
| 725 | 3300005841 | Ga0068863_100452352 | Ga0068863_1004523522 | 227 |
| 726 | 3300005843 | Ga0068860_100456806 | Ga0068860_1004568062 | 227 |
| 727 | 3300005937 | Ga0081455_10009563 | Ga0081455_100095639 | 227 |
| 728 | 3300005937 | Ga0081455_10046046 | Ga0081455_100460464 | 227 |
| 729 | 3300005937 | Ga0081455_10241042 | Ga0081455_102410422 | 227 |
| 730 | 3300005981 | Ga0081538_10071617 | Ga0081538_100716172 | 227 |
| 731 | 3300005983 | Ga0081540_1000585 | Ga0081540_10005858 | 227 |
| 732 | 3300005983 | Ga0081540_1000629 | Ga0081540_100062920 | 227 |
| 733 | 3300005983 | Ga0081540_1004181 | Ga0081540_100418112 | 227 |
| 734 | 3300005983 | Ga0081540_1004785 | Ga0081540_10047855 | 227 |
| 735 | 3300005983 | Ga0081540_1007022 | Ga0081540_10070222 | 227 |
| 736 | 3300005983 | Ga0081540_1015840 | Ga0081540_10158403 | 227 |
| 737 | 3300005983 | Ga0081540_1044598 | Ga0081540_10445982 | 227 |
| 738 | 3300006028 | Ga0070717_10019302 | Ga0070717_100193024 | 227 |
| 739 | 3300006038 | Ga0075365_10013729 | Ga0075365_100137295 | 227 |
| 740 | 3300006038 | Ga0075365_10095876 | Ga0075365_100958762 | 227 |
| 741 | 3300006038 | Ga0075365_10138146 | Ga0075365_101381464 | 227 |
| 742 | 3300006042 | Ga0075368_10080404 | Ga0075368_100804042 | 227 |
| 743 | 3300006048 | Ga0075363_100032501 | Ga0075363_1000325014 | 227 |
| 744 | 3300006048 | Ga0075363_100159775 | Ga0075363_1001597752 | 227 |
| 745 | 3300006051 | Ga0075364_10049387 | Ga0075364_100493873 | 227 |
| 746 | 3300006163 | Ga0070715_10000563 | Ga0070715_100005634 | 227 |
| 747 | 3300006173 | Ga0070716_100003783 | Ga0070716_1000037834 | 227 |
| 748 | 3300006175 | Ga0070712_100001723 | Ga0070712_1000017235 | 227 |
| 749 | 3300006175 | Ga0070712_100064359 | Ga0070712_1000643594 | 227 |
| 750 | 3300006177 | Ga0075362_10076290 | Ga0075362_100762902 | 227 |
| 751 | 3300006177 | Ga0075362_10219354 | Ga0075362_102193542 | 227 |
| 752 | 3300006186 | Ga0075369_10030412 | Ga0075369_100304124 | 227 |
| 753 | 3300006237 | Ga0097621_100109570 | Ga0097621_1001095704 | 227 |
| 754 | 3300006237 | Ga0097621_100261013 | Ga0097621_1002610132 | 227 |
| 755 | 3300006237 | Ga0097621_100448750 | Ga0097621_1004487502 | 227 |
| 756 | 3300006353 | Ga0075370_10016919 | Ga0075370_100169194 | 227 |
| 757 | 3300006358 | Ga0068871_100326793 | Ga0068871_1003267931 | 227 |
| 758 | 3300006358 | Ga0068871_100807853 | Ga0068871_1008078532 | 227 |
| 759 | 3300006844 | Ga0075428_100065933 | Ga0075428_1000659334 | 227 |
| 760 | 3300006871 | Ga0075434_100094092 | Ga0075434_1000940923 | 227 |
| 761 | 3300006881 | Ga0068865_100220213 | Ga0068865_1002202132 | 227 |
| 762 | 3300006931 | Ga0097620_100022345 | Ga0097620_1000223453 | 227 |
| 763 | 3300006931 | Ga0097620_100022663 | Ga0097620_1000226638 | 227 |
| 764 | 3300007076 | Ga0075435_100236741 | Ga0075435_1002367412 | 227 |
| 765 | 3300007265 | Ga0099794_10034930 | Ga0099794_100349303 | 227 |
| 766 | 3300007788 | Ga0099795_10111393 | Ga0099795_101113932 | 227 |
| 767 | 3300009092 | Ga0105250_10033561 | Ga0105250_100335613 | 227 |
| 768 | 3300009093 | Ga0105240_10210792 | Ga0105240_102107923 | 227 |
| 769 | 3300009093 | Ga0105240_11069458 | Ga0105240_110694581 | 227 |
| 770 | 3300009094 | Ga0111539_10319964 | Ga0111539_103199643 | 227 |
| 771 | 3300009098 | Ga0105245_10044536 | Ga0105245_100445361 | 227 |
| 772 | 3300009147 | Ga0114129_10045050 | Ga0114129_100450505 | 227 |
| 773 | 3300009147 | Ga0114129_11856830 | Ga0114129_118568301 | 227 |
| 774 | 3300009148 | Ga0105243_10020983 | Ga0105243_100209835 | 227 |
| 775 | 3300009148 | Ga0105243_10076810 | Ga0105243_100768103 | 227 |
| 776 | 3300009148 | Ga0105243_10567541 | Ga0105243_105675411 | 227 |
| 777 | 3300009174 | Ga0105241_10010573 | Ga0105241_100105732 | 227 |
| 778 | 3300009176 | Ga0105242_10057194 | Ga0105242_100571943 | 227 |
| 779 | 3300009176 | Ga0105242_10984324 | Ga0105242_109843241 | 227 |
| 780 | 3300009551 | Ga0105238_10275422 | Ga0105238_102754223 | 227 |
| 781 | 3300009553 | Ga0105249_10144812 | Ga0105249_101448122 | 227 |
| 782 | 3300009553 | Ga0105249_10258619 | Ga0105249_102586193 | 227 |
| 783 | 3300009553 | Ga0105249_10764859 | Ga0105249_107648592 | 227 |
| 784 | 3300011119 | Ga0105246_10301879 | Ga0105246_103018791 | 227 |
| 785 | 3300013297 | Ga0157378_10036769 | Ga0157378_100367696 | 227 |
| 786 | 3300013308 | Ga0157375_10452476 | Ga0157375_104524762 | 227 |
| 787 | 3300013308 | Ga0157375_10779039 | Ga0157375_107790391 | 227 |
| 788 | 3300014325 | Ga0163163_10095731 | Ga0163163_100957312 | 227 |
| 789 | 3300014325 | Ga0163163_10677597 | Ga0163163_106775971 | 227 |
| 790 | 3300014326 | Ga0157380_10384866 | Ga0157380_103848662 | 227 |
| 791 | 3300014968 | Ga0157379_10545095 | Ga0157379_105450952 | 227 |
| 792 | 3300017792 | Ga0163161_10106416 | Ga0163161_101064163 | 227 |
| 793 | 3300021320 | Ga0214544_1000001 | Ga0214544_1000001571 | 227 |
| 794 | 3300021321 | Ga0214542_1000606 | Ga0214542_100060619 | 227 |
| 795 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003190 | 227 |
| 796 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002575 | 227 |
| 797 | 3300025297 | Ga0209758_1053333 | Ga0209758_10533331 | 227 |
| 798 | 3300025315 | Ga0207697_10083591 | Ga0207697_100835912 | 227 |
| 799 | 3300025885 | Ga0207653_10080280 | Ga0207653_100802802 | 227 |
| 800 | 3300025898 | Ga0207692_10001383 | Ga0207692_100013834 | 227 |
| 801 | 3300025899 | Ga0207642_10025888 | Ga0207642_100258884 | 227 |
| 802 | 3300025900 | Ga0207710_10212420 | Ga0207710_102124202 | 227 |
| 803 | 3300025901 | Ga0207688_10005552 | Ga0207688_1000555210 | 227 |
| 804 | 3300025901 | Ga0207688_10110563 | Ga0207688_101105632 | 227 |
| 805 | 3300025901 | Ga0207688_10496014 | Ga0207688_104960141 | 227 |
| 806 | 3300025903 | Ga0207680_10319535 | Ga0207680_103195352 | 227 |
| 807 | 3300025905 | Ga0207685_10013251 | Ga0207685_100132512 | 227 |
| 808 | 3300025906 | Ga0207699_10018415 | Ga0207699_100184155 | 227 |
| 809 | 3300025906 | Ga0207699_10038002 | Ga0207699_100380024 | 227 |
| 810 | 3300025907 | Ga0207645_10079819 | Ga0207645_100798193 | 227 |
| 811 | 3300025907 | Ga0207645_10162395 | Ga0207645_101623953 | 227 |
| 812 | 3300025908 | Ga0207643_10057555 | Ga0207643_100575552 | 227 |
| 813 | 3300025914 | Ga0207671_10178443 | Ga0207671_101784432 | 227 |
| 814 | 3300025915 | Ga0207693_10000259 | Ga0207693_1000025918 | 227 |
| 815 | 3300025915 | Ga0207693_10080664 | Ga0207693_100806641 | 227 |
| 816 | 3300025916 | Ga0207663_10001316 | Ga0207663_100013164 | 227 |
| 817 | 3300025916 | Ga0207663_10109442 | Ga0207663_101094423 | 227 |
| 818 | 3300025924 | Ga0207694_10581223 | Ga0207694_105812231 | 227 |
| 819 | 3300025924 | Ga0207694_10784059 | Ga0207694_107840591 | 227 |
| 820 | 3300025926 | Ga0207659_10878950 | Ga0207659_108789501 | 227 |
| 821 | 3300025927 | Ga0207687_10217950 | Ga0207687_102179502 | 227 |
| 822 | 3300025928 | Ga0207700_10010667 | Ga0207700_100106674 | 227 |
| 823 | 3300025928 | Ga0207700_10120282 | Ga0207700_101202823 | 227 |
| 824 | 3300025929 | Ga0207664_10008672 | Ga0207664_100086725 | 227 |
| 825 | 3300025931 | Ga0207644_10228671 | Ga0207644_102286712 | 227 |
| 826 | 3300025931 | Ga0207644_10679375 | Ga0207644_106793751 | 227 |
| 827 | 3300025932 | Ga0207690_10284874 | Ga0207690_102848742 | 227 |
| 828 | 3300025933 | Ga0207706_10188478 | Ga0207706_101884781 | 227 |
| 829 | 3300025935 | Ga0207709_10050566 | Ga0207709_100505664 | 227 |
| 830 | 3300025936 | Ga0207670_10138034 | Ga0207670_101380343 | 227 |
| 831 | 3300025938 | Ga0207704_10143723 | Ga0207704_101437233 | 227 |
| 832 | 3300025939 | Ga0207665_10000974 | Ga0207665_1000097414 | 227 |
| 833 | 3300025940 | Ga0207691_10025071 | Ga0207691_100250718 | 227 |
| 834 | 3300025940 | Ga0207691_10136529 | Ga0207691_101365293 | 227 |
| 835 | 3300025942 | Ga0207689_10007828 | Ga0207689_100078286 | 227 |
| 836 | 3300025942 | Ga0207689_10199445 | Ga0207689_101994452 | 227 |
| 837 | 3300025945 | Ga0207679_10283829 | Ga0207679_102838293 | 227 |
| 838 | 3300025960 | Ga0207651_10095089 | Ga0207651_100950892 | 227 |
| 839 | 3300025960 | Ga0207651_10652301 | Ga0207651_106523012 | 227 |
| 840 | 3300025961 | Ga0207712_10029555 | Ga0207712_100295553 | 227 |
| 841 | 3300025961 | Ga0207712_10127903 | Ga0207712_101279033 | 227 |
| 842 | 3300025972 | Ga0207668_10124817 | Ga0207668_101248173 | 227 |
| 843 | 3300025981 | Ga0207640_10159619 | Ga0207640_101596192 | 227 |
| 844 | 3300025986 | Ga0207658_10148644 | Ga0207658_101486444 | 227 |
| 845 | 3300026035 | Ga0207703_10565312 | Ga0207703_105653122 | 227 |
| 846 | 3300026035 | Ga0207703_10577006 | Ga0207703_105770061 | 227 |
| 847 | 3300026067 | Ga0207678_10010880 | Ga0207678_100108803 | 227 |
| 848 | 3300026067 | Ga0207678_10013604 | Ga0207678_100136046 | 227 |
| 849 | 3300026067 | Ga0207678_10019226 | Ga0207678_100192266 | 227 |
| 850 | 3300026067 | Ga0207678_10033429 | Ga0207678_100334293 | 227 |
| 851 | 3300026067 | Ga0207678_10364503 | Ga0207678_103645031 | 227 |
| 852 | 3300026075 | Ga0207708_10084208 | Ga0207708_100842083 | 227 |
| 853 | 3300026075 | Ga0207708_10140832 | Ga0207708_101408322 | 227 |
| 854 | 3300026089 | Ga0207648_10218683 | Ga0207648_102186833 | 227 |
| 855 | 3300026095 | Ga0207676_10551609 | Ga0207676_105516091 | 227 |
| 856 | 3300026118 | Ga0207675_100024684 | Ga0207675_1000246843 | 227 |
| 857 | 3300026118 | Ga0207675_100326577 | Ga0207675_1003265771 | 227 |
| 858 | 3300026118 | Ga0207675_100383865 | Ga0207675_1003838652 | 227 |
| 859 | 3300026121 | Ga0207683_10074586 | Ga0207683_100745864 | 227 |
| 860 | 3300026121 | Ga0207683_10257376 | Ga0207683_102573763 | 227 |
| 861 | 3300026121 | Ga0207683_10297532 | Ga0207683_102975323 | 227 |
| 862 | 3300026121 | Ga0207683_10378775 | Ga0207683_103787751 | 227 |
| 863 | 3300026121 | Ga0207683_10435442 | Ga0207683_104354422 | 227 |
| 864 | 3300026142 | Ga0207698_10115985 | Ga0207698_101159851 | 227 |
| 865 | 3300027512 | Ga0209179_1058156 | Ga0209179_10581562 | 227 |
| 866 | 3300027671 | Ga0209588_1001815 | Ga0209588_10018153 | 227 |
| 867 | 3300027907 | Ga0207428_10169993 | Ga0207428_101699933 | 227 |
| 868 | 3300028379 | Ga0268266_10000857 | Ga0268266_100008573 | 227 |
| 869 | 3300028379 | Ga0268266_10007117 | Ga0268266_1000711712 | 227 |
| 870 | 3300028379 | Ga0268266_10378623 | Ga0268266_103786232 | 227 |
| 871 | 3300028380 | Ga0268265_10215720 | Ga0268265_102157202 | 227 |
| 872 | 3300028380 | Ga0268265_10223949 | Ga0268265_102239491 | 227 |
| 873 | 3300028380 | Ga0268265_10355229 | Ga0268265_103552292 | 227 |
| 874 | 3300028381 | Ga0268264_10171755 | Ga0268264_101717553 | 227 |
| 875 | 3300028573 | Ga0265334_10008556 | Ga0265334_100085562 | 227 |
| 876 | 3300028573 | Ga0265334_10009569 | Ga0265334_100095692 | 227 |
| 877 | 3300028786 | Ga0307517_10208587 | Ga0307517_102085872 | 227 |
| 878 | 3300031235 | Ga0265330_10020175 | Ga0265330_100201752 | 227 |
| 879 | 3300031238 | Ga0265332_10071251 | Ga0265332_100712512 | 227 |
| 880 | 3300031238 | Ga0265332_10082669 | Ga0265332_100826691 | 227 |
| 881 | 3300031247 | Ga0265340_10083545 | Ga0265340_100835452 | 227 |
| 882 | 3300031344 | Ga0265316_10513737 | Ga0265316_105137371 | 227 |
| 883 | 3300031616 | Ga0307508_10501094 | Ga0307508_105010941 | 227 |
| 884 | 3300031712 | Ga0265342_10049653 | Ga0265342_100496532 | 227 |
| 885 | 3300031731 | Ga0307405_10418501 | Ga0307405_104185011 | 227 |
| 886 | 3300031852 | Ga0307410_10612720 | Ga0307410_106127201 | 227 |
| 887 | 3300032002 | Ga0307416_100523804 | Ga0307416_1005238042 | 227 |
| 888 | 3300033180 | Ga0307510_10006778 | Ga0307510_1000677815 | 227 |
| 889 | 3300033180 | Ga0307510_10162952 | Ga0307510_101629522 | 227 |
| 890 | 3300035086 | Ga0373934_0001348 | Ga0373934_0001348_1796_2488 | 227 |
| 891 | 3300035111 | Ga0373923_0019072 | Ga0373923_0019072_1689_2384 | 227 |
| 892 | 3300035112 | Ga0373932_0039456 | Ga0373932_0039456_360_1052 | 227 |
| 893 | 3300035113 | Ga0373936_0032337 | Ga0373936_0032337_1135_1830 | 227 |
| 894 | 3300035117 | Ga0373953_0000092 | Ga0373953_0000092_2902_3594 | 227 |
| 895 | 3300035118 | Ga0373954_0000223 | Ga0373954_0000223_19431_20123 | 227 |
| 896 | 3300035119 | Ga0373956_0002691 | Ga0373956_0002691_6475_7167 | 227 |
| 897 | 3300035120 | Ga0373957_0002000 | Ga0373957_0002000_2319_3011 | 227 |
| 898 | 3300035172 | Ga0373955_0001089 | Ga0373955_0001089_4464_5156 | 227 |
| 899 | 3300035410 | Ga0373924_0001415 | Ga0373924_0001415_4728_5420 | 227 |
| 900 | 3300035691 | Ga0373931_0423484 | Ga0373931_0423484_119_823 | 227 |
| 901 | 3300035695 | Ga0373927_0021697 | Ga0373927_0021697_1859_2554 | 227 |
| 902 | 3300035724 | Ga0373933_0000758 | Ga0373933_0000758_3166_3858 | 227 |
| 903 | 3300036401 | Ga0373937_0011287 | Ga0373937_0011287_161_853 | 227 |
| 904 | 3300036401 | Ga0373937_0610044 | Ga0373937_0610044_201_902 | 227 |
| 905 | 3300037068 | Ga0373925_0330287 | Ga0373925_0330287_403_1098 | 227 |
| 906 | 3300037418 | Ga0395900_0001310 | Ga0395900_0001310_15125_15823 | 227 |
| 907 | 3300037466 | Ga0395898_0008958 | Ga0395898_0008958_955_1653 | 227 |
| 908 | 3300037471 | Ga0395905_0103015 | Ga0395905_0103015_18_716 | 227 |
| 909 | 3300037471 | Ga0395905_0565963 | Ga0395905_0565963_131_835 | 227 |
| 910 | 3300038443 | Ga0395901_0376709 | Ga0395901_0376709_552_1250 | 227 |
| 911 | 3300044765 | Ga0466970_0060878 | Ga0466970_0060878_337_1032 | 227 |
| 912 | 3300046452 | Ga0495617_046188 | Ga0495617_046188_516_1220 | 227 |
| 913 | 3300046454 | Ga0495592_0000714 | Ga0495592_0000714_19448_20140 | 227 |
| 914 | 3300046455 | Ga0495603_0050885 | Ga0495603_0050885_1623_2327 | 227 |
| 915 | 3300046455 | Ga0495603_0058358 | Ga0495603_0058358_1451_2143 | 227 |
| 916 | 3300046459 | Ga0495629_0000533 | Ga0495629_0000533_25231_25923 | 227 |
| 917 | 3300046462 | Ga0495651_0003125 | Ga0495651_0003125_12046_12738 | 227 |
| 918 | 3300046463 | Ga0495653_0000404 | Ga0495653_0000404_19254_19946 | 227 |
| 919 | 3300046471 | Ga0495650_0027735 | Ga0495650_0027735_1644_2348 | 227 |
| 920 | 3300046472 | Ga0495580_0148068 | Ga0495580_0148068_391_1086 | 227 |
| 921 | 3300046474 | Ga0495605_0059460 | Ga0495605_0059460_882_1586 | 227 |
| 922 | 3300046475 | Ga0495639_0082956 | Ga0495639_0082956_346_1038 | 227 |
| 923 | 3300046477 | Ga0495664_0057062 | Ga0495664_0057062_1596_2288 | 227 |
| 924 | 3300046492 | Ga0495585_0078928 | Ga0495585_0078928_34_738 | 227 |
| 925 | 3300046499 | Ga0495594_0112587 | Ga0495594_0112587_764_1468 | 227 |
| 926 | 3300046499 | Ga0495594_0196800 | Ga0495594_0196800_225_920 | 227 |
| 927 | 3300046511 | Ga0495608_0000932 | Ga0495608_0000932_2175_2867 | 227 |
| 928 | 3300046514 | Ga0495618_0012136 | Ga0495618_0012136_114_806 | 227 |
| 929 | 3300046515 | Ga0495620_0076224 | Ga0495620_0076224_626_1330 | 227 |
| 930 | 3300046516 | Ga0495628_0031051 | Ga0495628_0031051_3012_3704 | 227 |
| 931 | 3300046524 | Ga0495648_0204606 | Ga0495648_0204606_173_877 | 227 |
| 932 | 3300046526 | Ga0495666_0170416 | Ga0495666_0170416_170_871 | 227 |
| 933 | 3300046528 | Ga0495642_0050354 | Ga0495642_0050354_877_1581 | 227 |
| 934 | 3300046529 | Ga0495652_0013257 | Ga0495652_0013257_1310_2002 | 227 |
| 935 | 3300046533 | Ga0495640_0007521 | Ga0495640_0007521_2196_2888 | 227 |
| 936 | 3300046536 | Ga0495587_0003370 | Ga0495587_0003370_6764_7456 | 227 |
| 937 | 3300046538 | Ga0495609_0143707 | Ga0495609_0143707_253_948 | 227 |
| 938 | 3300046542 | Ga0495597_0102447 | Ga0495597_0102447_221_925 | 227 |
| 939 | 3300046558 | Ga0495633_0086169 | Ga0495633_0086169_722_1426 | 227 |
| 940 | 3300046558 | Ga0495633_0093318 | Ga0495633_0093318_579_1283 | 227 |
| 941 | 3300046559 | Ga0495667_0002368 | Ga0495667_0002368_5424_6116 | 227 |
| 942 | 3300046615 | Ga0495656_0044210 | Ga0495656_0044210_307_1011 | 227 |
| 943 | 3300046615 | Ga0495656_0128563 | Ga0495656_0128563_126_830 | 227 |
| 944 | 3300046615 | Ga0495656_0270940 | Ga0495656_0270940_42_734 | 227 |
| 945 | 3300046616 | Ga0495668_0034791 | Ga0495668_0034791_1376_2071 | 227 |
| 946 | 3300046616 | Ga0495668_0158266 | Ga0495668_0158266_128_820 | 227 |
| 947 | 3300046642 | Ga0495634_0023484 | Ga0495634_0023484_1801_2493 | 227 |
| 948 | 3300046648 | Ga0495611_0040112 | Ga0495611_0040112_747_1451 | 227 |
| 949 | 3300046660 | Ga0495625_0059939 | Ga0495625_0059939_1408_2112 | 227 |
| 950 | 3300046663 | Ga0495635_0000536 | Ga0495635_0000536_2705_3397 | 227 |
| 951 | 3300046664 | Ga0495659_0054850 | Ga0495659_0054850_505_1209 | 227 |
| 952 | 3300046664 | Ga0495659_0149900 | Ga0495659_0149900_72_776 | 227 |
| 953 | 3300046674 | Ga0495588_0022249 | Ga0495588_0022249_1797_2501 | 227 |
| 954 | 3300046675 | Ga0495657_0002815 | Ga0495657_0002815_6983_7675 | 227 |
| 955 | 3300046678 | Ga0495599_0001740 | Ga0495599_0001740_9702_10394 | 227 |
| 956 | 3300046679 | Ga0495623_0004997 | Ga0495623_0004997_6225_6917 | 227 |
| 957 | 3300046680 | Ga0495646_0005634 | Ga0495646_0005634_4533_5225 | 227 |
| 958 | 3300046681 | Ga0495647_0240453 | Ga0495647_0240453_81_776 | 227 |
| 959 | 3300046684 | Ga0495669_0038689 | Ga0495669_0038689_627_1331 | 227 |
| 960 | 3300046684 | Ga0495669_0046434 | Ga0495669_0046434_881_1585 | 227 |
| 961 | 3300046684 | Ga0495669_0140829 | Ga0495669_0140829_377_1069 | 227 |
| 962 | 3300046684 | Ga0495669_0229813 | Ga0495669_0229813_69_773 | 227 |
| 963 | 3300046689 | Ga0495613_0032424 | Ga0495613_0032424_2040_2732 | 227 |
| 964 | 3300046690 | Ga0495624_0141767 | Ga0495624_0141767_425_1117 | 227 |
| 965 | 3300046794 | Ga0495589_0016006 | Ga0495589_0016006_831_1535 | 227 |
| 966 | 3300046794 | Ga0495589_0153835 | Ga0495589_0153835_214_918 | 227 |
| 967 | 3300046809 | Ga0495600_0001712 | Ga0495600_0001712_4584_5276 | 227 |
| 968 | 3300047315 | Ga0495581_0178954 | Ga0495581_0178954_191_895 | 227 |
| 969 | 3300047315 | Ga0495581_0382688 | Ga0495581_0382688_47_742 | 227 |
| 970 | 3300047317 | Ga0495604_0003351 | Ga0495604_0003351_33_725 | 227 |
| 971 | 3300047319 | Ga0495674_0117011 | Ga0495674_0117011_605_1297 | 227 |
| 972 | 3300047322 | Ga0495680_0007831 | Ga0495680_0007831_3072_3764 | 227 |
| 973 | 3300047323 | Ga0495683_0046253 | Ga0495683_0046253_783_1487 | 227 |
| 974 | 3300047444 | Ga0495675_0004477 | Ga0495675_0004477_5989_6681 | 227 |
| 975 | 3300047469 | Ga0495673_0065337 | Ga0495673_0065337_783_1478 | 227 |
| 976 | 3300047470 | Ga0495681_0129795 | Ga0495681_0129795_119_823 | 227 |
| 977 | 3300047471 | Ga0495684_0000470 | Ga0495684_0000470_18971_19663 | 227 |
| 978 | 3300047673 | Ga0495593_0001464 | Ga0495593_0001464_10492_11184 | 227 |
| 979 | 3300047673 | Ga0495593_0148975 | Ga0495593_0148975_315_1010 | 227 |
| 980 | 3300048088 | Ga0495602_0008321 | Ga0495602_0008321_3167_3859 | 227 |
| 981 | 3300048091 | Ga0495626_0024099 | Ga0495626_0024099_320_1024 | 227 |
| 982 | 3300048904 | Ga0496101_0082846 | Ga0496101_0082846_1522_2226 | 227 |
| 983 | 3300048904 | Ga0496101_0175162 | Ga0496101_0175162_329_1033 | 227 |
| 984 | 3300048905 | Ga0496102_0299426 | Ga0496102_0299426_734_1438 | 227 |
| 985 | 3300048905 | Ga0496102_0596132 | Ga0496102_0596132_121_819 | 227 |
| 986 | 3300048907 | Ga0496104_0520484 | Ga0496104_0520484_385_1089 | 227 |
| 987 | 3300048907 | Ga0496104_0568872 | Ga0496104_0568872_166_870 | 227 |
| 988 | 3300048908 | Ga0496105_0214171 | Ga0496105_0214171_822_1526 | 227 |
| 989 | 3300048909 | Ga0496106_0262191 | Ga0496106_0262191_193_897 | 227 |
| 990 | 3300048909 | Ga0496106_0326857 | Ga0496106_0326857_365_1069 | 227 |
| 991 | 3300048910 | Ga0496107_0443689 | Ga0496107_0443689_80_784 | 227 |
| 992 | 3300048911 | Ga0496108_0452091 | Ga0496108_0452091_147_845 | 227 |
| 993 | 3300048913 | Ga0496110_0256100 | Ga0496110_0256100_260_958 | 227 |
| 994 | 3300048914 | Ga0496111_0091927 | Ga0496111_0091927_1044_1742 | 227 |
| 995 | 3300048915 | Ga0496112_0025259 | Ga0496112_0025259_3065_3763 | 227 |
| 996 | 3300048916 | Ga0496113_0171986 | Ga0496113_0171986_17_721 | 227 |
| 997 | 3300048916 | Ga0496113_0369158 | Ga0496113_0369158_50_754 | 227 |
| 998 | 3300048917 | Ga0496114_0390494 | Ga0496114_0390494_112_816 | 227 |
| 999 | 3300048918 | Ga0496115_0074639 | Ga0496115_0074639_68_772 | 227 |
| 1000 | 3300048918 | Ga0496115_0343562 | Ga0496115_0343562_270_974 | 227 |
| 1001 | 3300048918 | Ga0496115_0393285 | Ga0496115_0393285_216_920 | 227 |
| 1002 | 3300048924 | Ga0496121_0162930 | Ga0496121_0162930_905_1609 | 227 |
| 1003 | 3300048925 | Ga0496122_0053961 | Ga0496122_0053961_606_1310 | 227 |
| 1004 | 3300048927 | Ga0496124_0130386 | Ga0496124_0130386_1265_1969 | 227 |
| 1005 | 3300048928 | Ga0496125_0000048 | Ga0496125_0000048_14471_15175 | 227 |
| 1006 | 3300048928 | Ga0496125_0006588 | Ga0496125_0006588_4468_5172 | 227 |
| 1007 | 3300048929 | Ga0496126_0018558 | Ga0496126_0018558_4978_5682 | 227 |
| 1008 | 3300048929 | Ga0496126_0355864 | Ga0496126_0355864_258_962 | 227 |
| 1009 | 3300048929 | Ga0496126_0455158 | Ga0496126_0455158_110_814 | 227 |
| 1010 | 3300049568 | Ga0501031_0227518 | Ga0501031_0227518_172_876 | 227 |
| 1011 | 3300049573 | Ga0501037_0282654 | Ga0501037_0282654_35_739 | 227 |
| 1012 | 3300049576 | Ga0501040_0150548 | Ga0501040_0150548_405_1109 | 227 |
| 1013 | 3300049582 | Ga0501048_0444954 | Ga0501048_0444954_212_916 | 227 |
| 1014 | 3300049587 | Ga0501071_0058731 | Ga0501071_0058731_375_1079 | 227 |
| 1015 | 3300049592 | Ga0501076_0384800 | Ga0501076_0384800_64_768 | 227 |
| 1016 | 3300049744 | Ga0501083_0106614 | Ga0501083_0106614_590_1282 | 227 |
| 1017 | 3300050489 | nmdc:mga03683_204267_c1 | nmdc:mga03683_204267_c1_127_831 | 227 |
| 1018 | 3300050490 | nmdc:mga03n38_251279_c1 | nmdc:mga03n38_251279_c1_34_738 | 227 |
| 1019 | 3300050490 | nmdc:mga03n38_42142_c1 | nmdc:mga03n38_42142_c1_67_771 | 227 |
| 1020 | 3300050491 | nmdc:mga00v17_40924_c1 | nmdc:mga00v17_40924_c1_912_1616 | 227 |
| 1021 | 3300050492 | nmdc:mga0yw44_225522_c1 | nmdc:mga0yw44_225522_c1_460_1170 | 227 |
| 1022 | 3300050492 | nmdc:mga0yw44_25743_c1 | nmdc:mga0yw44_25743_c1_954_1658 | 227 |
| 1023 | 3300050496 | nmdc:mga07m45_156899_c1 | nmdc:mga07m45_156899_c1_536_1240 | 227 |
| 1024 | 3300050496 | nmdc:mga07m45_31562_c1 | nmdc:mga07m45_31562_c1_625_1329 | 227 |
| 1025 | 3300050496 | nmdc:mga07m45_43758_c1 | nmdc:mga07m45_43758_c1_1099_1803 | 227 |
| 1026 | 3300050507 | nmdc:mga05p37_49010_c1 | nmdc:mga05p37_49010_c1_1613_2317 | 227 |
| 1027 | 3300050511 | nmdc:mga08y16_107272_c1 | nmdc:mga08y16_107272_c1_493_1197 | 227 |
| 1028 | 3300050511 | nmdc:mga08y16_611197_c1 | nmdc:mga08y16_611197_c1_377_1081 | 227 |
| 1029 | 3300050513 | nmdc:mga0rr50_123844_c1 | nmdc:mga0rr50_123844_c1_597_1289 | 227 |
| 1030 | 3300053084 | Ga0495595_0000452 | Ga0495595_0000452_14373_15065 | 227 |
| 1031 | 3300053085 | Ga0495619_0000590 | Ga0495619_0000590_21614_22306 | 227 |
| 1032 | 3300053085 | Ga0495619_0111363 | Ga0495619_0111363_944_1651 | 227 |
| 1033 | 3300053092 | Ga0500583_0056105 | Ga0500583_0056105_611_1315 | 227 |
| 1034 | 3300053094 | Ga0500566_0000174 | Ga0500566_0000174_17216_17923 | 227 |
| 1035 | 3300053099 | Ga0500654_085783 | Ga0500654_085783_70_774 | 227 |
| 1036 | 3300053109 | Ga0500569_019888 | Ga0500569_019888_88_792 | 227 |
| 1037 | 3300053114 | Ga0500582_118168 | Ga0500582_118168_12_716 | 227 |
| 1038 | 3300053119 | Ga0500595_001346 | Ga0500595_001346_7184_7888 | 227 |
| 1039 | 3300053119 | Ga0500595_017155 | Ga0500595_017155_210_902 | 227 |
| 1040 | 3300053119 | Ga0500595_051785 | Ga0500595_051785_102_794 | 227 |
| 1041 | 3300053142 | Ga0500577_0136134 | Ga0500577_0136134_264_968 | 227 |
| 1042 | 3300053150 | Ga0500603_018233 | Ga0500603_018233_740_1441 | 227 |
| 1043 | 3300053162 | Ga0500638_098187 | Ga0500638_098187_547_1251 | 227 |
| 1044 | 3300053178 | Ga0500637_0130859 | Ga0500637_0130859_328_1032 | 227 |
| 1045 | 3300053178 | Ga0500637_0209086 | Ga0500637_0209086_164_871 | 227 |
| 1046 | iso_pu_bacteria | 2791355196 | 2793061058 | 227 |
| 1047 | iso_pu_bacteria | 2874628541 | 2874630145 | 227 |
| 1048 | 3300021361 | Ga0213872_10141816 | Ga0213872_101418162 | 228 |
| 1049 | 3300037418 | Ga0395900_0055509 | Ga0395900_0055509_3139_3837 | 228 |
| 1050 | 3300037471 | Ga0395905_0008401 | Ga0395905_0008401_2016_2708 | 228 |
| 1051 | 3300038443 | Ga0395901_0013467 | Ga0395901_0013467_4830_5528 | 228 |
| 1052 | 3300038443 | Ga0395901_0025727 | Ga0395901_0025727_2897_3589 | 228 |
| 1053 | 3300039447 | Ga0436361_0573481 | Ga0436361_0573481_1567_2292 | 228 |
| 1054 | 3300039447 | Ga0436361_1064158 | Ga0436361_1064158_2196_2900 | 228 |
| 1055 | 3300039453 | Ga0436362_0031186 | Ga0436362_0031186_4525_5250 | 228 |
| 1056 | 3300044656 | Ga0466969_0194011 | Ga0466969_0194011_132_830 | 228 |
| 1057 | 3300044684 | Ga0466966_0093402 | Ga0466966_0093402_147_845 | 228 |
| 1058 | 3300046524 | Ga0495648_0003484 | Ga0495648_0003484_5924_6619 | 228 |
| 1059 | 3300049568 | Ga0501031_0091786 | Ga0501031_0091786_752_1450 | 228 |
| 1060 | 3300049570 | Ga0501033_0027180 | Ga0501033_0027180_1976_2674 | 228 |
| 1061 | 3300049571 | Ga0501034_0087971 | Ga0501034_0087971_1660_2358 | 228 |
| 1062 | 3300049572 | Ga0501036_0086884 | Ga0501036_0086884_1557_2255 | 228 |
| 1063 | 3300049575 | Ga0501039_0272180 | Ga0501039_0272180_515_1213 | 228 |
| 1064 | 3300049579 | Ga0501043_0052885 | Ga0501043_0052885_2480_3178 | 228 |
| 1065 | 3300049581 | Ga0501047_0069896 | Ga0501047_0069896_1441_2139 | 228 |
| 1066 | 3300049581 | Ga0501047_0686796 | Ga0501047_0686796_126_821 | 228 |
| 1067 | 3300049582 | Ga0501048_0166996 | Ga0501048_0166996_237_935 | 228 |
| 1068 | 3300049585 | Ga0501069_0441190 | Ga0501069_0441190_43_741 | 228 |
| 1069 | 3300049822 | Ga0501035_0015948 | Ga0501035_0015948_3855_4553 | 228 |
| 1070 | 3300049823 | Ga0501044_0017591 | Ga0501044_0017591_4509_5207 | 228 |
| 1071 | iso_pu_bacteria | 2507262055 | 2507506133 | 228 |
| 1072 | iso_pu_bacteria | 2508501009 | 2508541597 | 228 |
| 1073 | iso_pu_bacteria | 2508501042 | 2508692861 | 228 |
| 1074 | iso_pu_bacteria | 2511231028 | 2511398107 | 228 |
| 1075 | iso_pu_bacteria | 2513237092 | 2513623846 | 228 |
| 1076 | iso_pu_bacteria | 2513237094 | 2513636876 | 228 |
| 1077 | iso_pu_bacteria | 2513237095 | 2513651178 | 228 |
| 1078 | iso_pu_bacteria | 2513237102 | 2513702692 | 228 |
| 1079 | iso_pu_bacteria | 2513237139 | 2513878333 | 228 |
| 1080 | iso_pu_bacteria | 2513237161 | 2514011739 | 228 |
| 1081 | iso_pu_bacteria | 2515154112 | 2515626254 | 228 |
| 1082 | iso_pu_bacteria | 2517093001 | 2517108211 | 228 |
| 1083 | iso_pu_bacteria | 2524023205 | 2524436101 | 228 |
| 1084 | iso_pu_bacteria | 2528768022 | 2528852842 | 228 |
| 1085 | iso_pu_bacteria | 2528768022 | 2528856737 | 228 |
| 1086 | iso_pu_bacteria | 2528768022 | 2528858578 | 228 |
| 1087 | iso_pu_bacteria | 2617270735 | 2617352741 | 228 |
| 1088 | iso_pu_bacteria | 2617270741 | 2617372917 | 228 |
| 1089 | iso_pu_bacteria | 2744054633 | 2745080943 | 228 |
| 1090 | iso_pu_bacteria | 2802429603 | 2805920556 | 228 |
| 1091 | iso_pu_bacteria | 2816332527 | 2818236744 | 228 |
| 1092 | iso_pu_bacteria | 2824600985 | 2824602972 | 228 |
| 1093 | iso_pu_bacteria | 2824609381 | 2824611805 | 228 |
| 1094 | iso_pu_bacteria | 2824617872 | 2824621561 | 228 |
| 1095 | iso_pu_bacteria | 2824626560 | 2824630673 | 228 |
| 1096 | iso_pu_bacteria | 2824635225 | 2824641109 | 228 |
| 1097 | iso_pu_bacteria | 2824644064 | 2824650673 | 228 |
| 1098 | iso_pu_bacteria | 2824653114 | 2824655041 | 228 |
| 1099 | iso_pu_bacteria | 2824661429 | 2824664425 | 228 |
| 1100 | iso_pu_bacteria | 2824671348 | 2824672299 | 228 |
| 1101 | iso_pu_bacteria | 2824679649 | 2824682293 | 228 |
| 1102 | iso_pu_bacteria | 2824687955 | 2824688818 | 228 |
| 1103 | iso_pu_bacteria | 2824696289 | 2824697659 | 228 |
| 1104 | iso_pu_bacteria | 2824704595 | 2824707876 | 228 |
| 1105 | iso_pu_bacteria | 2824714736 | 2824720305 | 228 |
| 1106 | iso_pu_bacteria | 2824723954 | 2824730784 | 228 |
| 1107 | iso_pu_bacteria | 2824732956 | 2824739286 | 228 |
| 1108 | iso_pu_bacteria | 2824746037 | 2824748435 | 228 |
| 1109 | iso_pu_bacteria | 2824753945 | 2824757935 | 228 |
| 1110 | iso_pu_bacteria | 2824763712 | 2824766530 | 228 |
| 1111 | iso_pu_bacteria | 2824773399 | 2824776653 | 228 |
| 1112 | iso_pu_bacteria | 2838122688 | 2838129410 | 228 |
| 1113 | iso_pu_bacteria | 2841941048 | 2841946418 | 228 |
| 1114 | iso_pu_bacteria | 2841949485 | 2841953667 | 228 |
| 1115 | iso_pu_bacteria | 2841957949 | 2841962727 | 228 |
| 1116 | iso_pu_bacteria | 2841966195 | 2841972928 | 228 |
| 1117 | iso_pu_bacteria | 2841974524 | 2841978400 | 228 |
| 1118 | iso_pu_bacteria | 2841983080 | 2841990615 | 228 |
| 1119 | iso_pu_bacteria | 2842038055 | 2842040833 | 228 |
| 1120 | iso_pu_bacteria | 2842045827 | 2842046222 | 228 |
| 1121 | iso_pu_bacteria | 2844315083 | 2844320195 | 228 |
| 1122 | iso_pu_bacteria | 2847930680 | 2847937514 | 228 |
| 1123 | iso_pu_bacteria | 2847939898 | 2847947937 | 228 |
| 1124 | iso_pu_bacteria | 2849076700 | 2849078216 | 228 |
| 1125 | iso_pu_bacteria | 2857509624 | 2857511371 | 228 |
| 1126 | iso_pu_bacteria | 2874590934 | 2874598596 | 228 |
| 1127 | iso_pu_bacteria | 2874612657 | 2874619251 | 228 |
| 1128 | iso_pu_bacteria | 2874620515 | 2874628261 | 228 |
| 1129 | iso_pu_bacteria | 2874645413 | 2874652050 | 228 |
| 1130 | iso_pu_bacteria | 2876761206 | 2876768273 | 228 |
| 1131 | iso_pu_bacteria | 2876771140 | 2876778635 | 228 |
| 1132 | iso_pu_bacteria | 2876818435 | 2876823439 | 228 |
| 1133 | iso_pu_bacteria | 2879074833 | 2879082428 | 228 |
| 1134 | iso_pu_bacteria | 2879083081 | 2879084927 | 228 |
| 1135 | iso_pu_bacteria | 2879099564 | 2879101923 | 228 |
| 1136 | iso_pu_bacteria | 2879127579 | 2879131791 | 228 |
| 1137 | iso_pu_bacteria | 2879142872 | 2879150127 | 228 |
| 1138 | iso_pu_bacteria | 2881364244 | 2881370091 | 228 |
| 1139 | iso_pu_bacteria | 2885366525 | 2885370151 | 228 |
| 1140 | iso_pu_bacteria | 2885409591 | 2885414342 | 228 |
| 1141 | iso_pu_bacteria | 2888378607 | 2888385666 | 228 |
| 1142 | iso_pu_bacteria | 2888388044 | 2888392602 | 228 |
| 1143 | iso_pu_bacteria | 2888419890 | 2888425786 | 228 |
| 1144 | iso_pu_bacteria | 2903727486 | 2903731215 | 228 |
| 1145 | iso_pu_bacteria | 2904666416 | 2904674120 | 228 |
| 1146 | iso_pu_bacteria | 2904711408 | 2904711772 | 228 |
| 1147 | iso_pu_bacteria | 2906602504 | 2906610018 | 228 |
| 1148 | iso_pu_bacteria | 2906626472 | 2906629353 | 228 |
| 1149 | iso_pu_bacteria | 2906626472 | 2906634975 | 228 |
| 1150 | iso_pu_bacteria | 2906643746 | 2906645531 | 228 |
| 1151 | iso_pu_bacteria | 2908775508 | 2908781366 | 228 |
| 1152 | iso_pu_bacteria | 2922368715 | 2922375902 | 228 |
| 1153 | iso_pu_bacteria | 2922393267 | 2922396885 | 228 |
| 1154 | iso_pu_bacteria | 2929615660 | 2929621226 | 228 |
| 1155 | iso_pu_bacteria | 2929624759 | 2929625943 | 228 |
| 1156 | iso_pu_bacteria | 2932784394 | 2932785167 | 228 |
| 1157 | iso_pu_bacteria | 2932784394 | 2932789340 | 228 |
| 1158 | iso_pu_bacteria | 2932794094 | 2932801339 | 228 |
| 1159 | iso_pu_bacteria | 2932801729 | 2932806282 | 228 |
| 1160 | iso_pu_bacteria | 2932828146 | 2932829003 | 228 |
| 1161 | iso_pu_bacteria | 2933577622 | 2933582905 | 228 |
| 1162 | iso_pu_bacteria | 2935608549 | 2935610013 | 228 |
| 1163 | iso_pu_bacteria | 2935616580 | 2935619577 | 228 |
| 1164 | iso_pu_bacteria | 2935638405 | 2935638557 | 228 |
| 1165 | iso_pu_bacteria | 2935648319 | 2935651959 | 228 |
| 1166 | iso_pu_bacteria | 2935656913 | 2935660068 | 228 |
| 1167 | iso_pu_bacteria | 2935665750 | 2935666591 | 228 |
| 1168 | iso_pu_bacteria | 2935675223 | 2935676364 | 228 |
| 1169 | iso_pu_bacteria | 2935684952 | 2935691119 | 228 |
| 1170 | iso_pu_bacteria | 2935694250 | 2935694450 | 228 |
| 1171 | iso_pu_bacteria | 2935694250 | 2935702739 | 228 |
| 1172 | iso_pu_bacteria | 2935703347 | 2935703563 | 228 |
| 1173 | iso_pu_bacteria | 2935713505 | 2935718500 | 228 |
| 1174 | iso_pu_bacteria | 2935722832 | 2935727520 | 228 |
| 1175 | iso_pu_bacteria | 2935732158 | 2935736223 | 228 |
| 1176 | iso_pu_bacteria | 2935741537 | 2935745603 | 228 |
| 1177 | iso_pu_bacteria | 2935750917 | 2935755984 | 228 |
| 1178 | iso_pu_bacteria | 2935769743 | 2935776214 | 228 |
| 1179 | iso_pu_bacteria | 2935777560 | 2935784923 | 228 |
| 1180 | iso_pu_bacteria | 2935785616 | 2935792092 | 228 |
| 1181 | iso_pu_bacteria | 2935793552 | 2935798067 | 228 |
| 1182 | iso_pu_bacteria | 2935801545 | 2935801700 | 228 |
| 1183 | iso_pu_bacteria | 2935819856 | 2935823173 | 228 |
| 1184 | iso_pu_bacteria | 2935819856 | 2935826977 | 228 |
| 1185 | iso_pu_bacteria | 2935827899 | 2935828051 | 228 |
| 1186 | iso_pu_bacteria | 2935837841 | 2935842257 | 228 |
| 1187 | iso_pu_bacteria | 2935847175 | 2935848755 | 228 |
| 1188 | iso_pu_bacteria | 2935847175 | 2935854155 | 228 |
| 1189 | iso_pu_bacteria | 2935855204 | 2935858107 | 228 |
| 1190 | iso_pu_bacteria | 2935864058 | 2935868012 | 228 |
| 1191 | iso_pu_bacteria | 2935873716 | 2935873965 | 228 |
| 1192 | iso_pu_bacteria | 2935883170 | 2935889952 | 228 |
| 1193 | iso_pu_bacteria | 2935908558 | 2935909440 | 228 |
| 1194 | iso_pu_bacteria | 2935916978 | 2935917164 | 228 |
| 1195 | iso_pu_bacteria | 2935926038 | 2935926921 | 228 |
| 1196 | iso_pu_bacteria | 2935934488 | 2935937235 | 228 |
| 1197 | iso_pu_bacteria | 2935942939 | 2935944462 | 228 |
| 1198 | iso_pu_bacteria | 2935951376 | 2935952899 | 228 |
| 1199 | iso_pu_bacteria | 2935959822 | 2935965212 | 228 |
| 1200 | iso_pu_bacteria | 2935967501 | 2935969739 | 228 |
| 1201 | iso_pu_bacteria | 2935975950 | 2935976349 | 228 |
| 1202 | iso_pu_bacteria | 2935975950 | 2935982862 | 228 |
| 1203 | iso_pu_bacteria | 2935984226 | 2935987213 | 228 |
| 1204 | iso_pu_bacteria | 2935992306 | 2935993111 | 228 |
| 1205 | iso_pu_bacteria | 2936002035 | 2936003023 | 228 |
| 1206 | iso_pu_bacteria | 2936011229 | 2936014484 | 228 |
| 1207 | iso_pu_bacteria | 2936019824 | 2936023676 | 228 |
| 1208 | iso_pu_bacteria | 2936028420 | 2936031319 | 228 |
| 1209 | iso_pu_bacteria | 2936046547 | 2936049590 | 228 |
| 1210 | iso_pu_bacteria | 2936055302 | 2936061194 | 228 |
| 1211 | iso_pu_bacteria | 2936055302 | 2936062658 | 228 |
| 1212 | iso_pu_bacteria | 2940556831 | 2940562041 | 228 |
| 1213 | iso_pu_bacteria | 2941531003 | 2941537143 | 228 |
| 1214 | iso_pu_bacteria | 2941538514 | 2941542305 | 228 |
| 1215 | iso_pu_bacteria | 2941538514 | 2941546548 | 228 |
| 1216 | iso_pu_bacteria | 3005483717 | 3005485584 | 228 |
| 1217 | iso_pu_bacteria | 3005506211 | 3005508249 | 228 |
| 1218 | iso_pu_bacteria | 3005587118 | 3005588247 | 228 |
| 1219 | iso_pu_bacteria | 3005594810 | 3005600508 | 228 |
| 1220 | iso_pu_bacteria | 3005710791 | 3005715981 | 228 |
| 1221 | iso_pu_bacteria | 3005718088 | 3005723336 | 228 |
| 1222 | iso_pu_bacteria | 8016511872 | 8016520458 | 228 |
| 1223 | iso_pu_bacteria | 8016522445 | 8016527647 | 228 |
| 1224 | iso_pu_bacteria | 8016530956 | 8016532744 | 228 |
| 1225 | iso_pu_bacteria | 8016539877 | 8016545974 | 228 |
| 1226 | iso_pu_bacteria | 8016548790 | 8016556138 | 228 |
| 1227 | iso_pu_bacteria | 8016557553 | 8016564503 | 228 |
| 1228 | iso_pu_bacteria | 8016566248 | 8016571052 | 228 |
| 1229 | iso_pu_bacteria | 8016575299 | 8016583554 | 228 |
| 1230 | iso_pu_bacteria | 8016583857 | 8016594568 | 228 |
| 1231 | iso_pu_bacteria | 8016595262 | 8016602164 | 228 |
| 1232 | iso_pu_bacteria | 8016603502 | 8016605149 | 228 |
| 1233 | iso_pu_bacteria | 8016613128 | 8016616944 | 228 |
| 1234 | iso_pu_bacteria | 8016622563 | 8016630734 | 228 |
| 1235 | iso_pu_bacteria | 8016630954 | 8016638973 | 228 |
| 1236 | iso_pu_bacteria | 8017057580 | 8017065117 | 228 |
| 1237 | iso_pu_bacteria | 8019538911 | 8019542222 | 228 |
| 1238 | iso_pu_bacteria | 8019547302 | 8019547402 | 228 |
| 1239 | iso_pu_bacteria | 8019576017 | 8019584505 | 228 |
| 1240 | iso_pu_bacteria | 8019586578 | 8019592277 | 228 |
| 1241 | iso_pu_bacteria | 8019597564 | 8019599010 | 228 |
| 1242 | iso_pu_bacteria | 8019608314 | 8019609363 | 228 |
| 1243 | iso_pu_bacteria | 8019629233 | 8019632249 | 228 |
| 1244 | iso_pu_bacteria | 8019629233 | 8019633102 | 228 |
| 1245 | iso_pu_bacteria | 8019638758 | 8019646797 | 228 |
| 1246 | iso_pu_bacteria | 8019648815 | 8019649566 | 228 |
| 1247 | iso_pu_bacteria | 8019648815 | 8019654375 | 228 |
| 1248 | iso_pu_bacteria | 8019659431 | 8019660168 | 228 |
| 1249 | iso_pu_bacteria | 8019659431 | 8019660986 | 228 |
| 1250 | iso_pu_bacteria | 8019668869 | 8019669600 | 228 |
| 1251 | iso_pu_bacteria | 8019668869 | 8019670545 | 228 |
| 1252 | iso_pu_bacteria | 8019678201 | 8019685690 | 228 |
| 1253 | iso_pu_bacteria | 8019687851 | 8019691266 | 228 |
| 1254 | iso_pu_bacteria | 8055742211 | 8055744912 | 228 |
| 1255 | iso_pu_bacteria | 8056967851 | 8056974886 | 228 |
| 1256 | 3300005367 | Ga0070667_100464305 | Ga0070667_1004643051 | 229 |
| 1257 | 3300005455 | Ga0070663_100033723 | Ga0070663_1000337233 | 229 |
| 1258 | 3300005547 | Ga0070693_100304043 | Ga0070693_1003040431 | 229 |
| 1259 | 3300005577 | Ga0068857_100169751 | Ga0068857_1001697512 | 229 |
| 1260 | 3300005614 | Ga0068856_100188519 | Ga0068856_1001885193 | 229 |
| 1261 | 3300005617 | Ga0068859_100695716 | Ga0068859_1006957161 | 229 |
| 1262 | 3300005618 | Ga0068864_100365528 | Ga0068864_1003655282 | 229 |
| 1263 | 3300005842 | Ga0068858_100824898 | Ga0068858_1008248981 | 229 |
| 1264 | 3300006931 | Ga0097620_100695825 | Ga0097620_1006958252 | 229 |
| 1265 | 3300009101 | Ga0105247_10099588 | Ga0105247_100995882 | 229 |
| 1266 | 3300009545 | Ga0105237_10139841 | Ga0105237_101398414 | 229 |
| 1267 | 3300009553 | Ga0105249_10350444 | Ga0105249_103504442 | 229 |
| 1268 | 3300010375 | Ga0105239_10688587 | Ga0105239_106885872 | 229 |
| 1269 | 3300013308 | Ga0157375_10329718 | Ga0157375_103297183 | 229 |
| 1270 | 3300013308 | Ga0157375_10511498 | Ga0157375_105114982 | 229 |
| 1271 | 3300014325 | Ga0163163_10372665 | Ga0163163_103726652 | 229 |
| 1272 | 3300025927 | Ga0207687_10690745 | Ga0207687_106907452 | 229 |
| 1273 | 3300026035 | Ga0207703_10798815 | Ga0207703_107988151 | 229 |
| 1274 | 3300026041 | Ga0207639_10492971 | Ga0207639_104929712 | 229 |
| 1275 | 3300026078 | Ga0207702_10143887 | Ga0207702_101438872 | 229 |
| 1276 | 3300026095 | Ga0207676_10220663 | Ga0207676_102206632 | 229 |
| 1277 | 3300026095 | Ga0207676_10477062 | Ga0207676_104770622 | 229 |
| 1278 | 3300035172 | Ga0373955_0059739 | Ga0373955_0059739_257_961 | 229 |
| 1279 | 3300035692 | Ga0373935_0079641 | Ga0373935_0079641_229_933 | 229 |
| 1280 | 3300035724 | Ga0373933_0027558 | Ga0373933_0027558_2322_3026 | 229 |
| 1281 | 3300036401 | Ga0373937_0174880 | Ga0373937_0174880_620_1318 | 229 |
| 1282 | 3300036401 | Ga0373937_0279464 | Ga0373937_0279464_236_940 | 229 |
| 1283 | 3300046454 | Ga0495592_0009461 | Ga0495592_0009461_5212_5916 | 229 |
| 1284 | 3300046462 | Ga0495651_0119678 | Ga0495651_0119678_101_805 | 229 |
| 1285 | 3300046477 | Ga0495664_0207672 | Ga0495664_0207672_333_1037 | 229 |
| 1286 | 3300046516 | Ga0495628_0221072 | Ga0495628_0221072_72_776 | 229 |
| 1287 | 3300046517 | Ga0495630_0059141 | Ga0495630_0059141_1029_1733 | 229 |
| 1288 | 3300046536 | Ga0495587_0029262 | Ga0495587_0029262_2213_2917 | 229 |
| 1289 | 3300046543 | Ga0495645_0014090 | Ga0495645_0014090_1695_2399 | 229 |
| 1290 | 3300046557 | Ga0495622_0007020 | Ga0495622_0007020_3416_4114 | 229 |
| 1291 | 3300046663 | Ga0495635_0035502 | Ga0495635_0035502_1164_1868 | 229 |
| 1292 | 3300046680 | Ga0495646_0044385 | Ga0495646_0044385_50_754 | 229 |
| 1293 | 3300047317 | Ga0495604_0062119 | Ga0495604_0062119_51_755 | 229 |
| 1294 | 3300047321 | Ga0495676_0195381 | Ga0495676_0195381_484_1182 | 229 |
| 1295 | 3300047322 | Ga0495680_0010833 | Ga0495680_0010833_4043_4747 | 229 |
| 1296 | 3300047444 | Ga0495675_0103343 | Ga0495675_0103343_95_799 | 229 |
| 1297 | 3300047471 | Ga0495684_0062879 | Ga0495684_0062879_1266_1970 | 229 |
| 1298 | 3300048903 | Ga0496100_0151213 | Ga0496100_0151213_866_1564 | 229 |
| 1299 | 3300048907 | Ga0496104_0007733 | Ga0496104_0007733_8313_9011 | 229 |
| 1300 | 3300048908 | Ga0496105_0049374 | Ga0496105_0049374_90_788 | 229 |
| 1301 | 3300048908 | Ga0496105_0097279 | Ga0496105_0097279_1150_1848 | 229 |
| 1302 | 3300048912 | Ga0496109_0033050 | Ga0496109_0033050_3372_4070 | 229 |
| 1303 | 3300048913 | Ga0496110_0035920 | Ga0496110_0035920_73_771 | 229 |
| 1304 | 3300048915 | Ga0496112_0004505 | Ga0496112_0004505_4231_4929 | 229 |
| 1305 | 3300048916 | Ga0496113_0056420 | Ga0496113_0056420_570_1268 | 229 |
| 1306 | 3300048918 | Ga0496115_0225732 | Ga0496115_0225732_495_1193 | 229 |
| 1307 | 3300048919 | Ga0496116_0037444 | Ga0496116_0037444_221_919 | 229 |
| 1308 | 3300048921 | Ga0496118_0017368 | Ga0496118_0017368_1450_2148 | 229 |
| 1309 | 3300048924 | Ga0496121_0009113 | Ga0496121_0009113_5663_6361 | 229 |
| 1310 | 3300048923 | Ga0496120_0165777 | Ga0496120_0165777_39_746 | 231 |
| 1311 | iso_pu_bacteria | 8016583857 | 8016587442 | 231 |
| 1312 | 3300003215 | JGI25153J46596_10004382 | JGI25153J46596_100043822 | 232 |
| 1313 | 3300003215 | JGI25153J46596_10023126 | JGI25153J46596_100231262 | 232 |
| 1314 | 3300003354 | JGI25160J50197_1001088 | JGI25160J50197_10010887 | 232 |
| 1315 | 3300003354 | JGI25160J50197_1012990 | JGI25160J50197_10129904 | 232 |
| 1316 | 3300003762 | Ga0055542_1003299 | Ga0055542_10032994 | 232 |
| 1317 | 3300005262 | Ga0065165_1001485 | Ga0065165_100148517 | 232 |
| 1318 | 3300005262 | Ga0065165_1003538 | Ga0065165_10035386 | 232 |
| 1319 | 3300005327 | Ga0070658_10232430 | Ga0070658_102324301 | 232 |
| 1320 | 3300005331 | Ga0070670_100079423 | Ga0070670_1000794232 | 232 |
| 1321 | 3300005338 | Ga0068868_100116950 | Ga0068868_1001169502 | 232 |
| 1322 | 3300005345 | Ga0070692_10057416 | Ga0070692_100574162 | 232 |
| 1323 | 3300005347 | Ga0070668_100131339 | Ga0070668_1001313393 | 232 |
| 1324 | 3300005354 | Ga0070675_100845270 | Ga0070675_1008452701 | 232 |
| 1325 | 3300005355 | Ga0070671_100011809 | Ga0070671_1000118094 | 232 |
| 1326 | 3300005367 | Ga0070667_100032529 | Ga0070667_1000325294 | 232 |
| 1327 | 3300005455 | Ga0070663_100013684 | Ga0070663_1000136844 | 232 |
| 1328 | 3300005455 | Ga0070663_100438289 | Ga0070663_1004382892 | 232 |
| 1329 | 3300005539 | Ga0068853_100251795 | Ga0068853_1002517952 | 232 |
| 1330 | 3300005548 | Ga0070665_100061786 | Ga0070665_1000617864 | 232 |
| 1331 | 3300005563 | Ga0068855_100361321 | Ga0068855_1003613212 | 232 |
| 1332 | 3300005563 | Ga0068855_100571113 | Ga0068855_1005711132 | 232 |
| 1333 | 3300005564 | Ga0070664_100337338 | Ga0070664_1003373381 | 232 |
| 1334 | 3300005578 | Ga0068854_100171225 | Ga0068854_1001712251 | 232 |
| 1335 | 3300005614 | Ga0068856_100233436 | Ga0068856_1002334362 | 232 |
| 1336 | 3300005616 | Ga0068852_100060941 | Ga0068852_1000609414 | 232 |
| 1337 | 3300005842 | Ga0068858_100592630 | Ga0068858_1005926302 | 232 |
| 1338 | 3300005937 | Ga0081455_10157595 | Ga0081455_101575952 | 232 |
| 1339 | 3300005983 | Ga0081540_1058435 | Ga0081540_10584352 | 232 |
| 1340 | 3300006038 | Ga0075365_10118909 | Ga0075365_101189092 | 232 |
| 1341 | 3300006177 | Ga0075362_10010036 | Ga0075362_100100364 | 232 |
| 1342 | 3300006353 | Ga0075370_10043907 | Ga0075370_100439072 | 232 |
| 1343 | 3300006944 | Ga0099823_1056087 | Ga0099823_10560872 | 232 |
| 1344 | 3300009093 | Ga0105240_10015188 | Ga0105240_100151887 | 232 |
| 1345 | 3300009098 | Ga0105245_10175532 | Ga0105245_101755321 | 232 |
| 1346 | 3300009148 | Ga0105243_10417760 | Ga0105243_104177602 | 232 |
| 1347 | 3300009174 | Ga0105241_10013936 | Ga0105241_100139362 | 232 |
| 1348 | 3300009174 | Ga0105241_10038188 | Ga0105241_100381882 | 232 |
| 1349 | 3300009177 | Ga0105248_10158216 | Ga0105248_101582164 | 232 |
| 1350 | 3300009545 | Ga0105237_10004211 | Ga0105237_100042117 | 232 |
| 1351 | 3300009545 | Ga0105237_10264365 | Ga0105237_102643653 | 232 |
| 1352 | 3300010375 | Ga0105239_10007324 | Ga0105239_100073241 | 232 |
| 1353 | 3300010375 | Ga0105239_10186840 | Ga0105239_101868403 | 232 |
| 1354 | 3300011119 | Ga0105246_10074364 | Ga0105246_100743643 | 232 |
| 1355 | 3300013104 | Ga0157370_10561219 | Ga0157370_105612191 | 232 |
| 1356 | 3300013105 | Ga0157369_10355444 | Ga0157369_103554442 | 232 |
| 1357 | 3300013297 | Ga0157378_10548319 | Ga0157378_105483191 | 232 |
| 1358 | 3300013306 | Ga0163162_10124380 | Ga0163162_101243802 | 232 |
| 1359 | 3300014325 | Ga0163163_10073241 | Ga0163163_100732414 | 232 |
| 1360 | 3300014969 | Ga0157376_10346421 | Ga0157376_103464212 | 232 |
| 1361 | 3300015261 | Ga0182006_1120839 | Ga0182006_11208391 | 232 |
| 1362 | 3300021321 | Ga0214542_1031903 | Ga0214542_10319032 | 232 |
| 1363 | 3300021324 | Ga0214545_1024560 | Ga0214545_10245604 | 232 |
| 1364 | 3300021327 | Ga0214543_1026447 | Ga0214543_10264474 | 232 |
| 1365 | 3300025230 | Ga0209563_101250 | Ga0209563_1012505 | 232 |
| 1366 | 3300025253 | Ga0209677_104007 | Ga0209677_1040072 | 232 |
| 1367 | 3300025254 | Ga0209148_1000479 | Ga0209148_100047914 | 232 |
| 1368 | 3300025261 | Ga0209233_1010455 | Ga0209233_10104553 | 232 |
| 1369 | 3300025261 | Ga0209233_1016085 | Ga0209233_10160853 | 232 |
| 1370 | 3300025272 | Ga0209455_1001925 | Ga0209455_10019252 | 232 |
| 1371 | 3300025295 | Ga0209564_1007279 | Ga0209564_10072792 | 232 |
| 1372 | 3300025297 | Ga0209758_1000120 | Ga0209758_10001207 | 232 |
| 1373 | 3300025297 | Ga0209758_1002106 | Ga0209758_10021067 | 232 |
| 1374 | 3300025297 | Ga0209758_1002858 | Ga0209758_10028588 | 232 |
| 1375 | 3300025297 | Ga0209758_1037364 | Ga0209758_10373642 | 232 |
| 1376 | 3300025297 | Ga0209758_1039361 | Ga0209758_10393612 | 232 |
| 1377 | 3300025302 | Ga0207426_1000458 | Ga0207426_100045845 | 232 |
| 1378 | 3300025302 | Ga0207426_1001218 | Ga0207426_100121815 | 232 |
| 1379 | 3300025304 | Ga0209257_1016464 | Ga0209257_10164643 | 232 |
| 1380 | 3300025304 | Ga0209257_1017778 | Ga0209257_10177782 | 232 |
| 1381 | 3300025904 | Ga0207647_10001853 | Ga0207647_1000185310 | 232 |
| 1382 | 3300025911 | Ga0207654_10156360 | Ga0207654_101563601 | 232 |
| 1383 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008974 | 232 |
| 1384 | 3300025914 | Ga0207671_10011583 | Ga0207671_100115834 | 232 |
| 1385 | 3300025920 | Ga0207649_10060907 | Ga0207649_100609074 | 232 |
| 1386 | 3300025923 | Ga0207681_10047012 | Ga0207681_100470122 | 232 |
| 1387 | 3300025924 | Ga0207694_10243554 | Ga0207694_102435541 | 232 |
| 1388 | 3300025927 | Ga0207687_10046631 | Ga0207687_100466313 | 232 |
| 1389 | 3300025949 | Ga0207667_10255377 | Ga0207667_102553772 | 232 |
| 1390 | 3300025981 | Ga0207640_10028073 | Ga0207640_100280733 | 232 |
| 1391 | 3300025981 | Ga0207640_10326608 | Ga0207640_103266082 | 232 |
| 1392 | 3300025986 | Ga0207658_10825971 | Ga0207658_108259711 | 232 |
| 1393 | 3300026023 | Ga0207677_10164390 | Ga0207677_101643902 | 232 |
| 1394 | 3300026035 | Ga0207703_10051105 | Ga0207703_100511051 | 232 |
| 1395 | 3300026041 | Ga0207639_10166335 | Ga0207639_101663353 | 232 |
| 1396 | 3300026041 | Ga0207639_10612664 | Ga0207639_106126641 | 232 |
| 1397 | 3300026067 | Ga0207678_10012486 | Ga0207678_100124863 | 232 |
| 1398 | 3300026067 | Ga0207678_10018553 | Ga0207678_100185534 | 232 |
| 1399 | 3300026067 | Ga0207678_10044384 | Ga0207678_100443842 | 232 |
| 1400 | 3300026078 | Ga0207702_10123822 | Ga0207702_101238222 | 232 |
| 1401 | 3300026089 | Ga0207648_10235485 | Ga0207648_102354852 | 232 |
| 1402 | 3300026142 | Ga0207698_10025711 | Ga0207698_100257113 | 232 |
| 1403 | 3300027296 | Ga0209389_1000077 | Ga0209389_100007761 | 232 |
| 1404 | 3300027361 | Ga0209489_100251 | Ga0209489_10025161 | 232 |
| 1405 | 3300027363 | Ga0209700_100271 | Ga0209700_10027160 | 232 |
| 1406 | 3300027866 | Ga0209813_10024797 | Ga0209813_100247972 | 232 |
| 1407 | 3300033180 | Ga0307510_10014911 | Ga0307510_1001491110 | 232 |
| 1408 | 3300033180 | Ga0307510_10044432 | Ga0307510_100444322 | 232 |
| 1409 | 3300033180 | Ga0307510_10400293 | Ga0307510_104002931 | 232 |
| 1410 | 3300037418 | Ga0395900_0280357 | Ga0395900_0280357_138_845 | 232 |
| 1411 | 3300037471 | Ga0395905_0093170 | Ga0395905_0093170_1296_2003 | 232 |
| 1412 | 3300041492 | Ga0451835_0015839 | Ga0451835_0015839_23_733 | 232 |
| 1413 | 3300044656 | Ga0466969_0129516 | Ga0466969_0129516_18_725 | 232 |
| 1414 | 3300044658 | Ga0466972_0001031 | Ga0466972_0001031_6035_6742 | 232 |
| 1415 | 3300044684 | Ga0466966_0000191 | Ga0466966_0000191_2339_3046 | 232 |
| 1416 | 3300044693 | Ga0466961_0000005 | Ga0466961_0000005_42365_43072 | 232 |
| 1417 | 3300044765 | Ga0466970_0278525 | Ga0466970_0278525_97_804 | 232 |
| 1418 | 3300045049 | Ga0466959_0000654 | Ga0466959_0000654_1043_1750 | 232 |
| 1419 | 3300046460 | Ga0495638_0002117 | Ga0495638_0002117_1562_2269 | 232 |
| 1420 | 3300046463 | Ga0495653_0042601 | Ga0495653_0042601_2310_3020 | 232 |
| 1421 | 3300046507 | Ga0495606_0186378 | Ga0495606_0186378_118_825 | 232 |
| 1422 | 3300046511 | Ga0495608_0017146 | Ga0495608_0017146_3036_3746 | 232 |
| 1423 | 3300046515 | Ga0495620_0071298 | Ga0495620_0071298_618_1325 | 232 |
| 1424 | 3300046516 | Ga0495628_0453242 | Ga0495628_0453242_175_885 | 232 |
| 1425 | 3300046524 | Ga0495648_0043575 | Ga0495648_0043575_53_760 | 232 |
| 1426 | 3300046524 | Ga0495648_0052682 | Ga0495648_0052682_1577_2284 | 232 |
| 1427 | 3300046529 | Ga0495652_0006289 | Ga0495652_0006289_1747_2457 | 232 |
| 1428 | 3300046533 | Ga0495640_0019283 | Ga0495640_0019283_1303_2013 | 232 |
| 1429 | 3300046536 | Ga0495587_0092400 | Ga0495587_0092400_398_1108 | 232 |
| 1430 | 3300046538 | Ga0495609_0029919 | Ga0495609_0029919_1719_2426 | 232 |
| 1431 | 3300046660 | Ga0495625_0068302 | Ga0495625_0068302_1405_2112 | 232 |
| 1432 | 3300046660 | Ga0495625_0169454 | Ga0495625_0169454_621_1328 | 232 |
| 1433 | 3300046675 | Ga0495657_0015183 | Ga0495657_0015183_4264_4974 | 232 |
| 1434 | 3300046678 | Ga0495599_0047987 | Ga0495599_0047987_1130_1840 | 232 |
| 1435 | 3300046679 | Ga0495623_0027880 | Ga0495623_0027880_1542_2252 | 232 |
| 1436 | 3300046809 | Ga0495600_0008483 | Ga0495600_0008483_4174_4884 | 232 |
| 1437 | 3300047322 | Ga0495680_0000920 | Ga0495680_0000920_10045_10755 | 232 |
| 1438 | 3300047444 | Ga0495675_0003454 | Ga0495675_0003454_604_1314 | 232 |
| 1439 | 3300047469 | Ga0495673_0179962 | Ga0495673_0179962_46_753 | 232 |
| 1440 | 3300047472 | Ga0495686_0231918 | Ga0495686_0231918_247_954 | 232 |
| 1441 | 3300048088 | Ga0495602_0003657 | Ga0495602_0003657_5396_6106 | 232 |
| 1442 | 3300048903 | Ga0496100_0035627 | Ga0496100_0035627_1425_2132 | 232 |
| 1443 | 3300048905 | Ga0496102_0061830 | Ga0496102_0061830_1391_2101 | 232 |
| 1444 | 3300048905 | Ga0496102_0127399 | Ga0496102_0127399_1068_1775 | 232 |
| 1445 | 3300048907 | Ga0496104_0045912 | Ga0496104_0045912_1245_1952 | 232 |
| 1446 | 3300048908 | Ga0496105_0047972 | Ga0496105_0047972_401_1111 | 232 |
| 1447 | 3300048911 | Ga0496108_0219976 | Ga0496108_0219976_852_1562 | 232 |
| 1448 | 3300048912 | Ga0496109_0120180 | Ga0496109_0120180_95_805 | 232 |
| 1449 | 3300048913 | Ga0496110_0146604 | Ga0496110_0146604_1015_1725 | 232 |
| 1450 | 3300048913 | Ga0496110_0828990 | Ga0496110_0828990_89_796 | 232 |
| 1451 | 3300048916 | Ga0496113_0003004 | Ga0496113_0003004_1851_2561 | 232 |
| 1452 | 3300048916 | Ga0496113_0335056 | Ga0496113_0335056_142_849 | 232 |
| 1453 | 3300048917 | Ga0496114_0532233 | Ga0496114_0532233_65_772 | 232 |
| 1454 | 3300048918 | Ga0496115_0220835 | Ga0496115_0220835_716_1426 | 232 |
| 1455 | 3300048921 | Ga0496118_0085444 | Ga0496118_0085444_734_1441 | 232 |
| 1456 | 3300048922 | Ga0496119_0012861 | Ga0496119_0012861_4688_5398 | 232 |
| 1457 | 3300048924 | Ga0496121_0171798 | Ga0496121_0171798_721_1428 | 232 |
| 1458 | 3300048925 | Ga0496122_0107848 | Ga0496122_0107848_1001_1711 | 232 |
| 1459 | 3300048927 | Ga0496124_0116507 | Ga0496124_0116507_262_972 | 232 |
| 1460 | 3300048928 | Ga0496125_0112310 | Ga0496125_0112310_826_1533 | 232 |
| 1461 | 3300048929 | Ga0496126_0197957 | Ga0496126_0197957_736_1443 | 232 |
| 1462 | 3300049460 | Ga0495682_0035131 | Ga0495682_0035131_38_745 | 232 |
| 1463 | 3300050491 | nmdc:mga00v17_16990_c1 | nmdc:mga00v17_16990_c1_1722_2429 | 232 |
| 1464 | 3300050492 | nmdc:mga0yw44_38628_c1 | nmdc:mga0yw44_38628_c1_319_1026 | 232 |
| 1465 | 3300050492 | nmdc:mga0yw44_68816_c1 | nmdc:mga0yw44_68816_c1_815_1522 | 232 |
| 1466 | 3300050496 | nmdc:mga07m45_165349_c1 | nmdc:mga07m45_165349_c1_324_1031 | 232 |
| 1467 | 3300050516 | nmdc:mga0sz30_112720_c1 | nmdc:mga0sz30_112720_c1_353_1060 | 232 |
| 1468 | 3300053080 | Ga0500635_0007819 | Ga0500635_0007819_1043_1750 | 232 |
| 1469 | 3300053083 | Ga0495655_0058865 | Ga0495655_0058865_154_864 | 232 |
| 1470 | 3300053086 | Ga0500578_0175876 | Ga0500578_0175876_451_1158 | 232 |
| 1471 | 3300053104 | Ga0500556_0003645 | Ga0500556_0003645_2101_2808 | 232 |
| 1472 | 3300053108 | Ga0500562_005901 | Ga0500562_005901_601_1308 | 232 |
| 1473 | 3300053111 | Ga0500572_031118 | Ga0500572_031118_297_1004 | 232 |
| 1474 | 3300053130 | Ga0500642_0000138 | Ga0500642_0000138_11565_12272 | 232 |
| 1475 | 3300053136 | Ga0500559_0005624 | Ga0500559_0005624_2786_3493 | 232 |
| 1476 | 3300053153 | Ga0500616_0010044 | Ga0500616_0010044_1651_2358 | 232 |
| 1477 | 3300053156 | Ga0500622_0001764 | Ga0500622_0001764_8482_9189 | 232 |
| 1478 | 3300053160 | Ga0500633_0038059 | Ga0500633_0038059_538_1245 | 232 |
| 1479 | 3300053162 | Ga0500638_109654 | Ga0500638_109654_82_789 | 232 |
| 1480 | 3300053177 | Ga0500636_0000608 | Ga0500636_0000608_13289_13996 | 232 |
| 1481 | 3300053177 | Ga0500636_0042215 | Ga0500636_0042215_249_959 | 232 |
| 1482 | 3300053730 | Ga0500645_047689 | Ga0500645_047689_313_1020 | 232 |
| 1483 | 3300053731 | Ga0500609_010779 | Ga0500609_010779_23_730 | 232 |
| 1484 | 3300053737 | Ga0500601_000276 | Ga0500601_000276_888_1598 | 232 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4i2o-assembly1.cif.gz_B | the structure of fixk2 from bradyrhizobium japonicum | 0.9305 | 38 | 232 |
| 5e44-assembly1.cif.gz_A-2 | crystal structure of holo-fnr of a. fischeri | 0.9174 | 44 | 231 |
| 4i2o-assembly1.cif.gz_B | the structure of fixk2 from bradyrhizobium japonicum | 0.9126 | 38 | 232 |
| 5j3u-assembly1.cif.gz_A | co-crystal structure of the regulatory domain of toxoplasma gondii pka with camp | 0.9075 | 40 | 122 |
| 5cvr-assembly1.cif.gz_A-2 | crystal structure of fnr of a. fischeri in a partially degraded form | 0.9045 | 42 | 230 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4i2oB01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9519 | 38 | 155 | 2.60.120.10 |
| 5e44A01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9446 | 44 | 155 | 2.60.120.10 |
| 4i2oB01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9442 | 38 | 155 | 2.60.120.10 |
| 5cvrA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9326 | 42 | 155 | 2.60.120.10 |
| 4jqfA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9239 | 192 | 222 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V6JIQ5-F1-model_v4 | Fumarate and nitrate reduction regulatory protein | 0.9634 | 44 | 171 |
GO:0003700
GO:0005829 GO:0051539 |
| AF-A0A454D2S9-F1-model_v4 | Fumarate and nitrate reduction regulatory protein | 0.9548 | 44 | 176 |
GO:0003677
GO:0003700 GO:0005829 |
| AF-A0A376KUT7-F1-model_v4 | Fumarate and nitrate reduction regulatory protein | 0.9447 | 39 | 192 |
GO:0003677
GO:0003700 GO:0005829 GO:0051539 |
| AF-A0A3D5Q3P1-F1-model_v4 | Crp/Fnr family transcriptional regulator | 0.943 | 42 | 122 |
GO:0003700
GO:0005829 |
| AF-A0A840RBY8-F1-model_v4 | CRP/FNR family transcriptional regulator | 0.9383 | 38 | 231 |
GO:0003677
GO:0003700 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar