F494294

General Info

Members Datasets Scaffolds Average Seq Length
1484 684 1247 230

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100051874|Ga0068859_1000518745
Length 249
Sequence MSLTAAAVYHITIRRKEMVMLNQSITHSVVSTNTTHTVPSPAANPFAEITGHAGLIATEFSYKKDEEIYGEDEPAEYVYQVISGAVRSYKLLSDGRRQIGAFHLPGDVFGLEFGSAHRLAAEAIIDTTVRLVKRRSLEQAAGVDVAVARKLWTMTAGDLRHAEDHMLLLGRKTAMERVATFLLEMDRRLAVAGMMALPMCRRDIGDYLGLTLETVSRALSQLQSQGVLGFSGARQIVLRNRQRLRSMDA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
10 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
11 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
12 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
13 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
14 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
15 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
16 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
17 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
18 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
19 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
20 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
21 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
22 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
23 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
24 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
25 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
26 2791355199
27 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
28 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
29 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
30 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
31 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
32 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
33 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
34 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
35 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
36 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
37 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
38 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
39 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
40 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
41 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
42 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
43 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
44 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
45 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
46 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
47 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
48 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
49 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
50 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
51 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
52 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
53 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
54 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
55 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
56 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
57 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
58 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
59 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
60 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
61 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
62 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
63 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
64 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
65 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
66 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
67 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
68 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
69 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
70 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
71 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
72 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
73 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
74 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
75 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
76 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
77 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
78 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
79 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
80 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
81 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
82 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
83 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
84 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
85 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
86 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
87 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
88 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
89 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
90 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
91 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
92 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
93 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
94 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
95 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
96 2909042592 Labrys sp. LIt4 Isolate Nodule
97 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
98 2922368715
99 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
100 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
101 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
102 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
103 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
104 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
105 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
106 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
107 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
108 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
109 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
110 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
111 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
112 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
113 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
114 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
115 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
116 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
117 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
118 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
119 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
120 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
121 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
122 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
123 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
124 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
125 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
126 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
127 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
128 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
129 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
130 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
131 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
132 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
133 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
134 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
135 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
136 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
137 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
138 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
139 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
140 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
141 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
142 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
143 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
144 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
145 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
146 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
147 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
148 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
149 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
150 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
151 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
152 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
153 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
154 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
155 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
156 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
157 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
158 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
159 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
160 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
161 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
162 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
163 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
164 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
165 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
166 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
167 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
168 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
169 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
170 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
171 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
172 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
173 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
174 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
175 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
176 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
177 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
178 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
179 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
180 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
181 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
182 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
183 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
184 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
185 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
186 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
187 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
188 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
189 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
190 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
191 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
192 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
193 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
194 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
195 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
196 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
197 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
198 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
199 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
200 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
201 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
202 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
203 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
204 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
205 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
206 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
207 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
208 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
209 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
210 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
211 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
212 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
213 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
214 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
215 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
216 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
217 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
218 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
219 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
220 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
221 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
222 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
223 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
224 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
225 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
226 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
227 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
228 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
229 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
230 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
231 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
232 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
233 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
234 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
235 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
236 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
237 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
238 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
239 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
240 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
241 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
242 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
243 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
244 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
245 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
246 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
247 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
248 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
249 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
250 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
251 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
252 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
253 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
254 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
255 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
256 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
257 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
258 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
259 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
260 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
261 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
262 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
263 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
264 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
265 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
266 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
267 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
268 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
269 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
270 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
271 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
272 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
273 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
274 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
275 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
276 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
277 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
278 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
279 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
280 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
281 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
282 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
283 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
284 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
285 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
286 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
287 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
288 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
289 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
290 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
291 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
292 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
293 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
294 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
295 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
296 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
297 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
298 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
299 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
300 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
301 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
302 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
303 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
304 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
307 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
308 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
309 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
310 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
311 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
312 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
313 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
374 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
375 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
376 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
377 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
378 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
380 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
381 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
385 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
386 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
387 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
388 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
389 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
390 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
391 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
392 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
394 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
395 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
396 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
397 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
398 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
399 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
400 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
401 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
402 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
403 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
404 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
405 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
406 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
407 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
408 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
409 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
410 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
411 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
412 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
413 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
414 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
415 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
416 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
417 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
418 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
419 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
420 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
421 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
422 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
423 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
424 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
425 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
426 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
427 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
428 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
429 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
430 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
431 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
432 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
433 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
434 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
435 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
436 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
437 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
438 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
439 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
440 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
441 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
442 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
443 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
444 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
445 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
446 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
447 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
448 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
449 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
450 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
451 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
452 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
453 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
454 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
455 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
456 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
457 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
458 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
459 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
460 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
461 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
462 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
463 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
464 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
465 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
466 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
467 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
468 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
469 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
470 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
471 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
472 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
473 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
474 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
475 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
476 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
477 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
478 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
479 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
480 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
481 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
482 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
483 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
484 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
485 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
486 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
487 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
488 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
489 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
490 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
491 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
492 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
493 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
494 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
495 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
496 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
497 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
498 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
499 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
500 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
501 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
502 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
503 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
504 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
505 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
506 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
507 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
508 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
509 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
510 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
511 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
512 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
513 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
514 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
515 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
516 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
517 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
518 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
519 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
520 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
521 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
522 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
523 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
524 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
525 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
526 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
527 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
528 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
529 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
530 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
531 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
532 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
533 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
534 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
535 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
536 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
537 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
538 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
539 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
540 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
541 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
542 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
543 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
544 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
545 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
546 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
547 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
548 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
549 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
550 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
551 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
552 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
553 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
554 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
555 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
556 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
557 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
558 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
559 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
560 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
561 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
562 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
563 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
564 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
565 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
566 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
567 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
568 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
569 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
570 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
571 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
572 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
573 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
574 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
575 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
576 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
577 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
578 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
579 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
580 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
581 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
582 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
583 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
584 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
585 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
586 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
587 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
588 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
589 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
590 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
591 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
592 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
593 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
594 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
595 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
596 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
597 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
598 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
599 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
600 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
601 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
602 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
603 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
604 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
605 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
606 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
607 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
608 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
609 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
610 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
611 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
612 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
613 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
614 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
615 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
616 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
617 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
618 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
619 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
620 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
621 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
622 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
623 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
624 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
625 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
626 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
627 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
628 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
629 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
630 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
631 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
632 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
633 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
634 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
635 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
636 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
637 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
638 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
639 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
640 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
641 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
642 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
643 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
644 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
645 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
646 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
647 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
648 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
649 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
650 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
651 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
652 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
653 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
654 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
655 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
656 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
657 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
658 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
659 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
660 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
661 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
662 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
663 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
664 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
665 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
666 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
667 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
668 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
669 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
670 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
671 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
672 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
673 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
674 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
675 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
676 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
677 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
678 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
679 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
680 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
681 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
682 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
683 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
684 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.94
Metatranscriptomes 0.2
Isolates 15.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.27
Nodule 12.53
Rhizoplane 6.2
Rhizosphere 57.88
Stem 0
Stem Tuber 0
Unclassified 10.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10004382 3300003215 Bacteria 7617
2 JGI25153J46596_10004474 3300003215 Bacteria 7534
3 JGI25153J46596_10023126 3300003215 Bacteria 2272
4 JGI25153J46596_10039897 3300003215 Bacteria 1462
5 rootL2_10276112 3300003322 Bacteria 1490
6 JGI25160J50197_1001088 3300003354 Bacteria 13913
7 JGI25160J50197_1005535 3300003354 Bacteria 5241
8 JGI25160J50197_1012990 3300003354 Bacteria 2859
9 JGI25404J52841_10002046 3300003659 Bacteria 3732
10 JGI25404J52841_10008625 3300003659 Bacteria 2175
11 JGI25404J52841_10010725 3300003659 Bacteria 1971
12 JGI25404J52841_10011426 3300003659 Bacteria 1914
13 Ga0055539_1001910 3300003752 Bacteria 3491
14 Ga0055542_1003299 3300003762 Bacteria 4474
15 Ga0055524_1016563 3300003775 Bacteria 2638
16 Ga0055531_10002968 3300003794 Bacteria 11025
17 Ga0055531_10004025 3300003794 Bacteria 9119
18 Ga0065165_1001485 3300005262 Bacteria 24928
19 Ga0065165_1003538 3300005262 Bacteria 10812
20 Ga0065165_1007237 3300005262 Bacteria 5523
21 Ga0065704_10016712 3300005289 Bacteria 1715
22 Ga0070658_10232430 3300005327 Bacteria 1561
23 Ga0070658_10759682 3300005327 Bacteria 842
24 Ga0070676_10163900 3300005328 Bacteria 1433
25 Ga0070676_10202147 3300005328 Bacteria 1303
26 Ga0070683_100088893 3300005329 Bacteria 2899
27 Ga0070690_100170840 3300005330 Bacteria 1496
28 Ga0070670_100079423 3300005331 Bacteria 2819
29 Ga0070670_100097365 3300005331 Bacteria 2531
30 Ga0070670_100419702 3300005331 Bacteria 1183
31 Ga0068869_100183941 3300005334 Bacteria 1639
32 Ga0070680_100012857 3300005336 Bacteria 6512
33 Ga0070682_100196475 3300005337 Bacteria 1420
34 Ga0070682_100563442 3300005337 Bacteria 893
35 Ga0068868_100009489 3300005338 Bacteria 7007
36 Ga0068868_100009995 3300005338 Bacteria 6856
37 Ga0068868_100116950 3300005338 Bacteria 2172
38 Ga0070660_100280599 3300005339 Bacteria 1363
39 Ga0070660_100438439 3300005339 Bacteria 1083
40 Ga0070689_100199048 3300005340 Bacteria 1635
41 Ga0070661_100169956 3300005344 Bacteria 1655
42 Ga0070692_10057416 3300005345 Bacteria 2041
43 Ga0070668_100029750 3300005347 Bacteria 4149
44 Ga0070668_100071526 3300005347 Bacteria 2702
45 Ga0070668_100131339 3300005347 Bacteria 2010
46 Ga0070668_100256230 3300005347 Bacteria 1454
47 Ga0070668_100322200 3300005347 Bacteria 1301
48 Ga0070668_100465296 3300005347 Bacteria 1089
49 Ga0070669_100051698 3300005353 Bacteria 3004
50 Ga0070669_100262863 3300005353 Bacteria 1378
51 Ga0070675_100143451 3300005354 Bacteria 2043
52 Ga0070675_100513571 3300005354 Bacteria 1081
53 Ga0070675_100716780 3300005354 Bacteria 912
54 Ga0070675_100845270 3300005354 Bacteria 837
55 Ga0070671_100011809 3300005355 Bacteria 7026
56 Ga0070671_100178580 3300005355 Bacteria 1797
57 Ga0070671_100191982 3300005355 Bacteria 1731
58 Ga0070674_100107344 3300005356 Bacteria 2044
59 Ga0070659_100320582 3300005366 Bacteria 1295
60 Ga0070667_100032529 3300005367 Bacteria 4350
61 Ga0070667_100137772 3300005367 Bacteria 2135
62 Ga0070667_100464305 3300005367 Bacteria 1158
63 Ga0070667_100582975 3300005367 Bacteria 1030
64 Ga0070667_100619249 3300005367 Bacteria 998
65 Ga0070709_10001978 3300005434 Bacteria 11170
66 Ga0070709_10002525 3300005434 Bacteria 9903
67 Ga0070709_10008266 3300005434 Bacteria 5715
68 Ga0070709_10185738 3300005434 Bacteria 1463
69 Ga0070714_100001459 3300005435 Bacteria 17220
70 Ga0070714_100033282 3300005435 Bacteria 4308
71 Ga0070714_100628543 3300005435 Bacteria 1033
72 Ga0070713_100017039 3300005436 Bacteria 5481
73 Ga0070713_100020912 3300005436 Bacteria 5024
74 Ga0070713_100027548 3300005436 Bacteria 4475
75 Ga0070713_100115555 3300005436 Bacteria 2345
76 Ga0070713_100184258 3300005436 Bacteria 1878
77 Ga0070713_101060488 3300005436 Bacteria 783
78 Ga0070710_10000316 3300005437 Bacteria 23048
79 Ga0070710_10001024 3300005437 Bacteria 13270
80 Ga0070701_10013117 3300005438 Bacteria 3760
81 Ga0070711_100000617 3300005439 Bacteria 18550
82 Ga0070711_100009683 3300005439 Bacteria 5938
83 Ga0070711_100018449 3300005439 Bacteria 4456
84 Ga0070711_100046989 3300005439 Bacteria 2944
85 Ga0070711_100445136 3300005439 Bacteria 1060
86 Ga0070711_100535735 3300005439 Bacteria 970
87 Ga0070700_100188768 3300005441 Bacteria 1439
88 Ga0070700_100599842 3300005441 Bacteria 863
89 Ga0070708_100294553 3300005445 Bacteria 1528
90 Ga0070663_100007753 3300005455 Bacteria 6556
91 Ga0070663_100013684 3300005455 Bacteria 5184
92 Ga0070663_100014812 3300005455 Bacteria 5013
93 Ga0070663_100024348 3300005455 Bacteria 4073
94 Ga0070663_100033723 3300005455 Bacteria 3539
95 Ga0070663_100293301 3300005455 Bacteria 1300
96 Ga0070663_100349102 3300005455 Bacteria 1197
97 Ga0070663_100438289 3300005455 Bacteria 1075
98 Ga0070678_100009842 3300005456 Bacteria 5813
99 Ga0070678_100376752 3300005456 Bacteria 1227
100 Ga0070678_100457902 3300005456 Bacteria 1118
101 Ga0070678_100662807 3300005456 Bacteria 937
102 Ga0070662_100006982 3300005457 Bacteria 7307
103 Ga0070662_100171985 3300005457 Bacteria 1702
104 Ga0070662_100275940 3300005457 Bacteria 1359
105 Ga0070662_100330256 3300005457 Bacteria 1246
106 Ga0070681_10014127 3300005458 Bacteria 7948
107 Ga0068867_100040366 3300005459 Bacteria 3406
108 Ga0070707_100639019 3300005468 Bacteria 1027
109 Ga0070698_100010278 3300005471 Bacteria 9997
110 Ga0070698_100220007 3300005471 Bacteria 1833
111 Ga0070699_100189658 3300005518 Bacteria 1826
112 Ga0070684_100557337 3300005535 Bacteria 1064
113 Ga0070697_100080748 3300005536 Bacteria 2679
114 Ga0068853_100251795 3300005539 Bacteria 1621
115 Ga0068853_100350689 3300005539 Unclassified 1373
116 Ga0070672_100184840 3300005543 Bacteria 1738
117 Ga0070686_100094487 3300005544 Bacteria 2007
118 Ga0070695_100060185 3300005545 Bacteria 2461
119 Ga0070693_100304043 3300005547 Bacteria 1076
120 Ga0070665_100032680 3300005548 Bacteria 5236
121 Ga0070665_100041394 3300005548 Bacteria 4631
122 Ga0070665_100061161 3300005548 Bacteria 3775
123 Ga0070665_100061786 3300005548 Bacteria 3756
124 Ga0070665_100218358 3300005548 Bacteria 1907
125 Ga0070665_100228640 3300005548 Bacteria 1860
126 Ga0070665_100351429 3300005548 Bacteria 1480
127 Ga0070665_100443489 3300005548 Bacteria 1307
128 Ga0070665_100742704 3300005548 Bacteria 994
129 Ga0068855_100012945 3300005563 Bacteria 10063
130 Ga0068855_100361321 3300005563 Bacteria 1597
131 Ga0068855_100571113 3300005563 Bacteria 1222
132 Ga0070664_100337338 3300005564 Bacteria 1368
133 Ga0070664_100468042 3300005564 Bacteria 1159
134 Ga0068857_100169751 3300005577 Bacteria 1982
135 Ga0068857_100761507 3300005577 Bacteria 923
136 Ga0068854_100171225 3300005578 Bacteria 1690
137 Ga0068854_100463210 3300005578 Bacteria 1061
138 Ga0068856_100144639 3300005614 Bacteria 2385
139 Ga0068856_100172083 3300005614 Bacteria 2178
140 Ga0068856_100188519 3300005614 Bacteria 2076
141 Ga0068856_100233436 3300005614 Bacteria 1855
142 Ga0068856_100255951 3300005614 Bacteria 1766
143 Ga0070702_100021410 3300005615 Bacteria 3401
144 Ga0068852_100060941 3300005616 Bacteria 3277
145 Ga0068852_100106137 3300005616 Bacteria 2546
146 Ga0068852_100803405 3300005616 Bacteria 955
147 Ga0068859_100022345 3300005617 Bacteria 6342
148 Ga0068859_100022663 3300005617 Bacteria 6296
149 Ga0068859_100051874 3300005617 Bacteria 4124
150 Ga0068859_100079164 3300005617 Bacteria 3326
151 Ga0068859_100695716 3300005617 Bacteria 1107
152 Ga0068859_100749466 3300005617 Bacteria 1065
153 Ga0068859_100806373 3300005617 Bacteria 1026
154 Ga0068864_100140540 3300005618 Bacteria 2178
155 Ga0068864_100365528 3300005618 Bacteria 1364
156 Ga0068866_10040264 3300005718 Bacteria 2312
157 Ga0068861_100011495 3300005719 Bacteria 6158
158 Ga0068861_100013644 3300005719 Bacteria 5688
159 Ga0068861_100079787 3300005719 Bacteria 2559
160 Ga0068861_100226626 3300005719 Bacteria 1583
161 Ga0068861_100559370 3300005719 Bacteria 1043
162 Ga0068861_100618353 3300005719 Bacteria 996
163 Ga0068851_10091721 3300005834 Bacteria 1600
164 Ga0068870_10055148 3300005840 Bacteria 2117
165 Ga0068870_10277536 3300005840 Bacteria 1049
166 Ga0068863_100452352 3300005841 Bacteria 1260
167 Ga0068863_100832382 3300005841 Bacteria 921
168 Ga0068858_100091005 3300005842 Bacteria 2839
169 Ga0068858_100592630 3300005842 Bacteria 1075
170 Ga0068858_100824898 3300005842 Bacteria 905
171 Ga0068860_100000360 3300005843 Bacteria 60297
172 Ga0068860_100456806 3300005843 Bacteria 1270
173 Ga0068862_100042542 3300005844 Bacteria 3870
174 Ga0081455_10001783 3300005937 Bacteria 26011
175 Ga0081455_10009563 3300005937 Bacteria 9956
176 Ga0081455_10046046 3300005937 Bacteria 3789
177 Ga0081455_10157595 3300005937 Bacteria 1743
178 Ga0081455_10241042 3300005937 Bacteria 1329
179 Ga0081538_10071617 3300005981 Bacteria 1905
180 Ga0081540_1000585 3300005983 Bacteria 35126
181 Ga0081540_1000629 3300005983 Bacteria 33549
182 Ga0081540_1004181 3300005983 Bacteria 11108
183 Ga0081540_1004785 3300005983 Bacteria 10207
184 Ga0081540_1007022 3300005983 Bacteria 8100
185 Ga0081540_1015840 3300005983 Bacteria 4752
186 Ga0081540_1044598 3300005983 Bacteria 2262
187 Ga0081540_1058435 3300005983 Bacteria 1858
188 Ga0081540_1183673 3300005983 Bacteria 779
189 Ga0070717_10004019 3300006028 Bacteria 10592
190 Ga0070717_10019302 3300006028 Bacteria 5345
191 Ga0070717_10515197 3300006028 Bacteria 1082
192 Ga0075365_10001902 3300006038 Bacteria 9838
193 Ga0075365_10013729 3300006038 Bacteria 4857
194 Ga0075365_10093855 3300006038 Bacteria 2047
195 Ga0075365_10095876 3300006038 Bacteria 2027
196 Ga0075365_10118909 3300006038 Bacteria 1821
197 Ga0075365_10138146 3300006038 Bacteria 1690
198 Ga0075365_10219570 3300006038 Bacteria 1333
199 Ga0075368_10029327 3300006042 Bacteria 2127
200 Ga0075368_10080404 3300006042 Bacteria 1326
201 Ga0075363_100032501 3300006048 Bacteria 2711
202 Ga0075363_100159775 3300006048 Bacteria 1275
203 Ga0075363_100281854 3300006048 Bacteria 962
204 Ga0075364_10002061 3300006051 Bacteria 11221
205 Ga0075364_10049387 3300006051 Bacteria 2743
206 Ga0070715_10000563 3300006163 Bacteria 9759
207 Ga0070715_10057725 3300006163 Bacteria 1692
208 Ga0070716_100003783 3300006173 Bacteria 7174
209 Ga0070716_100133116 3300006173 Bacteria 1575
210 Ga0070716_100137205 3300006173 Bacteria 1555
211 Ga0070712_100001723 3300006175 Bacteria 13377
212 Ga0070712_100064359 3300006175 Bacteria 2600
213 Ga0070712_100072062 3300006175 Bacteria 2474
214 Ga0070712_100075559 3300006175 Bacteria 2423
215 Ga0070712_100101369 3300006175 Bacteria 2130
216 Ga0070712_100162136 3300006175 Bacteria 1727
217 Ga0070712_100421594 3300006175 Bacteria 1106
218 Ga0070712_100449471 3300006175 Bacteria 1073
219 Ga0075362_10010036 3300006177 Bacteria 3684
220 Ga0075362_10076290 3300006177 Bacteria 1539
221 Ga0075362_10219354 3300006177 Bacteria 929
222 Ga0075367_10078657 3300006178 Bacteria 1992
223 Ga0075367_10167176 3300006178 Bacteria 1369
224 Ga0075367_10193191 3300006178 Bacteria 1270
225 Ga0075367_10371991 3300006178 Bacteria 903
226 Ga0075369_10030412 3300006186 Bacteria 2274
227 Ga0075366_10184151 3300006195 Bacteria 1269
228 Ga0075366_10217981 3300006195 Bacteria 1162
229 Ga0075366_10224973 3300006195 Bacteria 1143
230 Ga0075366_10302222 3300006195 Bacteria 979
231 Ga0097621_100109570 3300006237 Bacteria 2332
232 Ga0097621_100127925 3300006237 Bacteria 2159
233 Ga0097621_100151163 3300006237 Bacteria 1991
234 Ga0097621_100261013 3300006237 Bacteria 1520
235 Ga0097621_100448750 3300006237 Bacteria 1162
236 Ga0097621_100511638 3300006237 Bacteria 1089
237 Ga0075370_10016919 3300006353 Bacteria 3932
238 Ga0075370_10043907 3300006353 Bacteria 2526
239 Ga0068871_100232424 3300006358 Bacteria 1600
240 Ga0068871_100233898 3300006358 Bacteria 1596
241 Ga0068871_100326793 3300006358 Bacteria 1352
242 Ga0068871_100807853 3300006358 Bacteria 865
243 Ga0075428_100065933 3300006844 Bacteria 3965
244 Ga0075434_100094092 3300006871 Bacteria 3001
245 Ga0075434_100622146 3300006871 Bacteria 1098
246 Ga0068865_100112101 3300006881 Bacteria 2014
247 Ga0068865_100220213 3300006881 Bacteria 1483
248 Ga0097620_100022345 3300006931 Bacteria 6342
249 Ga0097620_100022663 3300006931 Bacteria 6296
250 Ga0097620_100051875 3300006931 Bacteria 4124
251 Ga0097620_100079166 3300006931 Bacteria 3326
252 Ga0097620_100695825 3300006931 Bacteria 1107
253 Ga0097620_100749440 3300006931 Bacteria 1065
254 Ga0097620_100806340 3300006931 Bacteria 1026
255 Ga0099824_1023507 3300006942 Bacteria 3807
256 Ga0099822_1054190 3300006943 Bacteria 1532
257 Ga0099823_1056087 3300006944 Bacteria 2211
258 Ga0075435_100236741 3300007076 Bacteria 1552
259 Ga0099794_10024766 3300007265 Bacteria 2758
260 Ga0099794_10034930 3300007265 Bacteria 2371
261 Ga0099795_10111393 3300007788 Bacteria 1085
262 Ga0105250_10033561 3300009092 Bacteria 2061
263 Ga0105240_10015188 3300009093 Bacteria 10478
264 Ga0105240_10031599 3300009093 Bacteria 6863
265 Ga0105240_10210792 3300009093 Bacteria 2270
266 Ga0105240_11069458 3300009093 Bacteria 860
267 Ga0111539_10279995 3300009094 Bacteria 1941
268 Ga0111539_10319964 3300009094 Bacteria 1805
269 Ga0105245_10015268 3300009098 Bacteria 6692
270 Ga0105245_10044536 3300009098 Bacteria 3961
271 Ga0105245_10070764 3300009098 Bacteria 3167
272 Ga0105245_10082045 3300009098 Bacteria 2949
273 Ga0105245_10175532 3300009098 Bacteria 2043
274 Ga0105247_10023373 3300009101 Bacteria 3724
275 Ga0105247_10099588 3300009101 Bacteria 1857
276 Ga0114129_10045050 3300009147 Bacteria 6202
277 Ga0114129_11856830 3300009147 Bacteria 731
278 Ga0105243_10020983 3300009148 Bacteria 4957
279 Ga0105243_10044783 3300009148 Bacteria 3474
280 Ga0105243_10076810 3300009148 Bacteria 2715
281 Ga0105243_10417760 3300009148 Bacteria 1250
282 Ga0105243_10567541 3300009148 Bacteria 1087
283 Ga0105241_10010573 3300009174 Bacteria 6771
284 Ga0105241_10013936 3300009174 Bacteria 5892
285 Ga0105241_10038188 3300009174 Bacteria 3620
286 Ga0105242_10057194 3300009176 Bacteria 3192
287 Ga0105242_10089119 3300009176 Bacteria 2592
288 Ga0105242_10984324 3300009176 Bacteria 850
289 Ga0105248_10026062 3300009177 Bacteria 6505
290 Ga0105248_10090673 3300009177 Bacteria 3442
291 Ga0105248_10158216 3300009177 Bacteria 2556
292 Ga0105248_10241458 3300009177 Bacteria 2034
293 Ga0105248_10298373 3300009177 Bacteria 1815
294 Ga0105237_10004211 3300009545 Bacteria 16746
295 Ga0105237_10006317 3300009545 Bacteria 13172
296 Ga0105237_10059054 3300009545 Bacteria 3838
297 Ga0105237_10139841 3300009545 Bacteria 2415
298 Ga0105237_10170955 3300009545 Bacteria 2173
299 Ga0105237_10264365 3300009545 Bacteria 1723
300 Ga0105238_10044483 3300009551 Bacteria 4488
301 Ga0105238_10076894 3300009551 Bacteria 3330
302 Ga0105238_10275422 3300009551 Bacteria 1663
303 Ga0105238_10405076 3300009551 Bacteria 1358
304 Ga0105249_10045684 3300009553 Bacteria 3984
305 Ga0105249_10129091 3300009553 Bacteria 2411
306 Ga0105249_10144812 3300009553 Bacteria 2282
307 Ga0105249_10258619 3300009553 Bacteria 1729
308 Ga0105249_10350444 3300009553 Bacteria 1496
309 Ga0105249_10764859 3300009553 Bacteria 1029
310 Ga0099796_10199126 3300010159 Bacteria 812
311 Ga0105239_10007324 3300010375 Bacteria 12668
312 Ga0105239_10043843 3300010375 Bacteria 4905
313 Ga0105239_10101961 3300010375 Bacteria 3176
314 Ga0105239_10102612 3300010375 Bacteria 3165
315 Ga0105239_10186840 3300010375 Bacteria 2319
316 Ga0105239_10187191 3300010375 Bacteria 2317
317 Ga0105239_10235261 3300010375 Bacteria 2056
318 Ga0105239_10593912 3300010375 Bacteria 1263
319 Ga0105239_10688587 3300010375 Bacteria 1169
320 Ga0105246_10007577 3300011119 Bacteria 6660
321 Ga0105246_10074364 3300011119 Bacteria 2402
322 Ga0105246_10301879 3300011119 Bacteria 1293
323 Ga0157370_10561219 3300013104 Bacteria 1046
324 Ga0157369_10355444 3300013105 Bacteria 1521
325 Ga0157374_10003708 3300013296 Bacteria 12840
326 Ga0157378_10000706 3300013297 Bacteria 31286
327 Ga0157378_10009737 3300013297 Bacteria 8373
328 Ga0157378_10036769 3300013297 Bacteria 4333
329 Ga0157378_10074982 3300013297 Bacteria 3045
330 Ga0157378_10187155 3300013297 Bacteria 1951
331 Ga0157378_10548319 3300013297 Bacteria 1161
332 Ga0163162_10005573 3300013306 Bacteria 12181
333 Ga0163162_10006254 3300013306 Bacteria 11543
334 Ga0163162_10124380 3300013306 Bacteria 2685
335 Ga0163162_10444229 3300013306 Bacteria 1429
336 Ga0163162_10511344 3300013306 Bacteria 1331
337 Ga0157372_10259451 3300013307 Bacteria 2018
338 Ga0157375_10240474 3300013308 Bacteria 1970
339 Ga0157375_10255052 3300013308 Bacteria 1915
340 Ga0157375_10329718 3300013308 Bacteria 1691
341 Ga0157375_10452476 3300013308 Bacteria 1450
342 Ga0157375_10511498 3300013308 Bacteria 1364
343 Ga0157375_10779039 3300013308 Bacteria 1106
344 Ga0163163_10027833 3300014325 Bacteria 5420
345 Ga0163163_10073241 3300014325 Bacteria 3416
346 Ga0163163_10095731 3300014325 Bacteria 2989
347 Ga0163163_10372665 3300014325 Bacteria 1485
348 Ga0163163_10588260 3300014325 Bacteria 1176
349 Ga0163163_10677597 3300014325 Bacteria 1095
350 Ga0157380_10022035 3300014326 Bacteria 4787
351 Ga0157380_10191261 3300014326 Bacteria 1807
352 Ga0157380_10384866 3300014326 Bacteria 1325
353 Ga0157379_10122531 3300014968 Bacteria 2339
354 Ga0157379_10545095 3300014968 Bacteria 1079
355 Ga0157376_10038827 3300014969 Bacteria 3877
356 Ga0157376_10346421 3300014969 Bacteria 1420
357 Ga0157376_10346721 3300014969 Bacteria 1420
358 Ga0182006_1120839 3300015261 Bacteria 910
359 Ga0163161_10106416 3300017792 Bacteria 2093
360 Ga0163161_10358607 3300017792 Bacteria 1161
361 Ga0163161_10653284 3300017792 Bacteria 872
362 Ga0214544_1000001 3300021320 Bacteria 783667
363 Ga0214542_1000606 3300021321 Bacteria 66272
364 Ga0214542_1031903 3300021321 Bacteria 1914
365 Ga0214545_1000003 3300021324 Bacteria 720274
366 Ga0214545_1024560 3300021324 Bacteria 3687
367 Ga0214543_1000002 3300021327 Bacteria 712733
368 Ga0214543_1026447 3300021327 Bacteria 3119
369 Ga0213873_10001201 3300021358 Bacteria 4249
370 Ga0213872_10141816 3300021361 Bacteria 1054
371 Ga0213874_10090067 3300021377 Bacteria 1006
372 Ga0213876_10000880 3300021384 Bacteria 20080
373 Ga0209563_101250 3300025230 Bacteria 6974
374 Ga0209677_100502 3300025253 Bacteria 22034
375 Ga0209677_104007 3300025253 Bacteria 4448
376 Ga0209148_1000479 3300025254 Bacteria 42062
377 Ga0209148_1008698 3300025254 Bacteria 2026
378 Ga0209233_1010455 3300025261 Bacteria 2780
379 Ga0209233_1016085 3300025261 Bacteria 2068
380 Ga0209455_1001925 3300025272 Bacteria 8587
381 Ga0209455_1004461 3300025272 Bacteria 4574
382 Ga0209455_1030492 3300025272 Bacteria 918
383 Ga0209564_1007279 3300025295 Bacteria 5745
384 Ga0209758_1000011 3300025297 Bacteria 1049685
385 Ga0209758_1000120 3300025297 Bacteria 192212
386 Ga0209758_1002106 3300025297 Bacteria 21111
387 Ga0209758_1002858 3300025297 Bacteria 16762
388 Ga0209758_1010292 3300025297 Bacteria 5623
389 Ga0209758_1018402 3300025297 Bacteria 3424
390 Ga0209758_1022083 3300025297 Bacteria 2936
391 Ga0209758_1037364 3300025297 Bacteria 1878
392 Ga0209758_1039361 3300025297 Bacteria 1799
393 Ga0209758_1053333 3300025297 Bacteria 1390
394 Ga0209256_1001013 3300025299 Bacteria 33164
395 Ga0207426_1000458 3300025302 Bacteria 64019
396 Ga0207426_1001218 3300025302 Bacteria 22703
397 Ga0207426_1003017 3300025302 Bacteria 9768
398 Ga0207426_1004317 3300025302 Bacteria 7004
399 Ga0207426_1020535 3300025302 Bacteria 2294
400 Ga0209257_1004704 3300025304 Bacteria 10245
401 Ga0209257_1016464 3300025304 Bacteria 2990
402 Ga0209257_1017778 3300025304 Bacteria 2779
403 Ga0207697_10083591 3300025315 Bacteria 1347
404 Ga0207653_10080280 3300025885 Bacteria 1128
405 Ga0207692_10000790 3300025898 Bacteria 11241
406 Ga0207692_10001383 3300025898 Bacteria 9068
407 Ga0207692_10088053 3300025898 Bacteria 1677
408 Ga0207642_10025888 3300025899 Bacteria 2380
409 Ga0207642_10098867 3300025899 Bacteria 1460
410 Ga0207710_10212420 3300025900 Bacteria 958
411 Ga0207688_10005552 3300025901 Bacteria 6859
412 Ga0207688_10110563 3300025901 Bacteria 1595
413 Ga0207688_10496014 3300025901 Bacteria 764
414 Ga0207680_10319535 3300025903 Bacteria 1085
415 Ga0207647_10001853 3300025904 Bacteria 16209
416 Ga0207647_10277469 3300025904 Bacteria 957
417 Ga0207685_10013251 3300025905 Bacteria 2545
418 Ga0207685_10069996 3300025905 Bacteria 1419
419 Ga0207685_10118488 3300025905 Bacteria 1158
420 Ga0207699_10018415 3300025906 Bacteria 3700
421 Ga0207699_10038002 3300025906 Bacteria 2755
422 Ga0207699_10101858 3300025906 Bacteria 1824
423 Ga0207699_10322282 3300025906 Bacteria 1084
424 Ga0207645_10079819 3300025907 Bacteria 2097
425 Ga0207645_10162395 3300025907 Bacteria 1462
426 Ga0207643_10057555 3300025908 Bacteria 2213
427 Ga0207684_10156077 3300025910 Bacteria 1964
428 Ga0207684_10167474 3300025910 Bacteria 1894
429 Ga0207654_10026270 3300025911 Bacteria 3151
430 Ga0207654_10156360 3300025911 Bacteria 1469
431 Ga0207695_10000008 3300025913 Bacteria 1058268
432 Ga0207695_10024377 3300025913 Bacteria 6810
433 Ga0207671_10011583 3300025914 Bacteria 7163
434 Ga0207671_10160589 3300025914 Bacteria 1740
435 Ga0207671_10178443 3300025914 Bacteria 1652
436 Ga0207693_10000259 3300025915 Bacteria 48819
437 Ga0207693_10001116 3300025915 Bacteria 24102
438 Ga0207693_10034331 3300025915 Bacteria 4001
439 Ga0207693_10080664 3300025915 Bacteria 2547
440 Ga0207693_10094297 3300025915 Bacteria 2346
441 Ga0207693_10184221 3300025915 Bacteria 1644
442 Ga0207663_10001316 3300025916 Bacteria 11488
443 Ga0207663_10018614 3300025916 Bacteria 3896
444 Ga0207663_10024383 3300025916 Bacteria 3483
445 Ga0207663_10046659 3300025916 Bacteria 2670
446 Ga0207663_10109442 3300025916 Bacteria 1873
447 Ga0207663_10156229 3300025916 Bacteria 1605
448 Ga0207663_10390662 3300025916 Bacteria 1062
449 Ga0207660_10146484 3300025917 Bacteria 1810
450 Ga0207649_10060907 3300025920 Bacteria 2373
451 Ga0207652_10210825 3300025921 Bacteria 1749
452 Ga0207681_10047012 3300025923 Bacteria 2905
453 Ga0207694_10243554 3300025924 Bacteria 1470
454 Ga0207694_10383732 3300025924 Bacteria 1166
455 Ga0207694_10581223 3300025924 Bacteria 941
456 Ga0207694_10784059 3300025924 Bacteria 805
457 Ga0207650_10556215 3300025925 Bacteria 962
458 Ga0207659_10081566 3300025926 Bacteria 2392
459 Ga0207659_10878950 3300025926 Bacteria 771
460 Ga0207687_10006921 3300025927 Bacteria 7470
461 Ga0207687_10039149 3300025927 Bacteria 3244
462 Ga0207687_10046631 3300025927 Bacteria 3001
463 Ga0207687_10217950 3300025927 Bacteria 1501
464 Ga0207687_10690745 3300025927 Bacteria 865
465 Ga0207700_10010667 3300025928 Bacteria 5812
466 Ga0207700_10012013 3300025928 Bacteria 5558
467 Ga0207700_10120282 3300025928 Bacteria 2128
468 Ga0207700_10170688 3300025928 Bacteria 1814
469 Ga0207700_10252814 3300025928 Bacteria 1506
470 Ga0207700_10486708 3300025928 Bacteria 1091
471 Ga0207700_10891748 3300025928 Bacteria 796
472 Ga0207664_10008672 3300025929 Bacteria 7109
473 Ga0207664_10474688 3300025929 Bacteria 1118
474 Ga0207644_10228671 3300025931 Bacteria 1477
475 Ga0207644_10240604 3300025931 Bacteria 1441
476 Ga0207644_10679375 3300025931 Bacteria 858
477 Ga0207690_10284874 3300025932 Bacteria 1288
478 Ga0207706_10158982 3300025933 Bacteria 1987
479 Ga0207706_10169631 3300025933 Bacteria 1918
480 Ga0207706_10188478 3300025933 Bacteria 1811
481 Ga0207686_10497615 3300025934 Bacteria 945
482 Ga0207709_10050566 3300025935 Bacteria 2543
483 Ga0207709_10105981 3300025935 Bacteria 1869
484 Ga0207709_10219030 3300025935 Bacteria 1371
485 Ga0207670_10138034 3300025936 Bacteria 1795
486 Ga0207670_10536302 3300025936 Bacteria 954
487 Ga0207669_10029306 3300025937 Bacteria 3042
488 Ga0207704_10118053 3300025938 Bacteria 1808
489 Ga0207704_10143723 3300025938 Bacteria 1673
490 Ga0207665_10000974 3300025939 Bacteria 19386
491 Ga0207665_10002524 3300025939 Bacteria 12316
492 Ga0207665_10046557 3300025939 Bacteria 2906
493 Ga0207665_10101547 3300025939 Bacteria 2009
494 Ga0207691_10025071 3300025940 Bacteria 5602
495 Ga0207691_10136529 3300025940 Bacteria 2163
496 Ga0207691_10179571 3300025940 Bacteria 1850
497 Ga0207711_10044329 3300025941 Bacteria 3797
498 Ga0207711_10476850 3300025941 Bacteria 1162
499 Ga0207689_10007828 3300025942 Bacteria 9342
500 Ga0207689_10071057 3300025942 Bacteria 2859
501 Ga0207689_10199445 3300025942 Bacteria 1652
502 Ga0207661_10074658 3300025944 Bacteria 2780
503 Ga0207679_10283829 3300025945 Bacteria 1421
504 Ga0207667_10028236 3300025949 Bacteria 6096
505 Ga0207667_10255377 3300025949 Bacteria 1793
506 Ga0207651_10095089 3300025960 Bacteria 2193
507 Ga0207651_10652301 3300025960 Bacteria 924
508 Ga0207712_10029555 3300025961 Bacteria 3678
509 Ga0207712_10076093 3300025961 Bacteria 2428
510 Ga0207712_10127903 3300025961 Bacteria 1932
511 Ga0207668_10003594 3300025972 Bacteria 9112
512 Ga0207668_10124817 3300025972 Bacteria 1955
513 Ga0207668_10679568 3300025972 Bacteria 903
514 Ga0207640_10028073 3300025981 Bacteria 3436
515 Ga0207640_10159619 3300025981 Bacteria 1667
516 Ga0207640_10326608 3300025981 Bacteria 1223
517 Ga0207658_10148644 3300025986 Bacteria 1906
518 Ga0207658_10825971 3300025986 Bacteria 842
519 Ga0207677_10040545 3300026023 Bacteria 3071
520 Ga0207677_10164390 3300026023 Bacteria 1728
521 Ga0207703_10051105 3300026035 Bacteria 3348
522 Ga0207703_10447117 3300026035 Bacteria 1206
523 Ga0207703_10565312 3300026035 Bacteria 1073
524 Ga0207703_10577006 3300026035 Bacteria 1062
525 Ga0207703_10798815 3300026035 Bacteria 901
526 Ga0207703_11011197 3300026035 Bacteria 798
527 Ga0207639_10166335 3300026041 Bacteria 1863
528 Ga0207639_10492971 3300026041 Bacteria 1118
529 Ga0207639_10612664 3300026041 Bacteria 1005
530 Ga0207678_10010880 3300026067 Bacteria 7995
531 Ga0207678_10012486 3300026067 Bacteria 7459
532 Ga0207678_10013604 3300026067 Bacteria 7148
533 Ga0207678_10018553 3300026067 Bacteria 6108
534 Ga0207678_10019226 3300026067 Bacteria 5999
535 Ga0207678_10020798 3300026067 Bacteria 5751
536 Ga0207678_10033429 3300026067 Bacteria 4480
537 Ga0207678_10040116 3300026067 Bacteria 4061
538 Ga0207678_10044384 3300026067 Bacteria 3845
539 Ga0207678_10364503 3300026067 Bacteria 1247
540 Ga0207678_10489274 3300026067 Bacteria 1072
541 Ga0207708_10084208 3300026075 Bacteria 2445
542 Ga0207708_10140832 3300026075 Bacteria 1892
543 Ga0207702_10123822 3300026078 Bacteria 2317
544 Ga0207702_10143887 3300026078 Bacteria 2161
545 Ga0207702_10299862 3300026078 Bacteria 1525
546 Ga0207648_10023917 3300026089 Bacteria 5461
547 Ga0207648_10218683 3300026089 Bacteria 1693
548 Ga0207648_10235485 3300026089 Bacteria 1629
549 Ga0207676_10220663 3300026095 Bacteria 1688
550 Ga0207676_10477062 3300026095 Bacteria 1181
551 Ga0207676_10551609 3300026095 Bacteria 1101
552 Ga0207674_10021271 3300026116 Bacteria 6992
553 Ga0207675_100013202 3300026118 Bacteria 7709
554 Ga0207675_100024684 3300026118 Bacteria 5590
555 Ga0207675_100026976 3300026118 Bacteria 5348
556 Ga0207675_100326577 3300026118 Bacteria 1499
557 Ga0207675_100338233 3300026118 Bacteria 1473
558 Ga0207675_100383865 3300026118 Bacteria 1382
559 Ga0207675_101131000 3300026118 Bacteria 803
560 Ga0207683_10024719 3300026121 Bacteria 5176
561 Ga0207683_10074586 3300026121 Bacteria 3001
562 Ga0207683_10257376 3300026121 Bacteria 1593
563 Ga0207683_10297532 3300026121 Bacteria 1476
564 Ga0207683_10378775 3300026121 Bacteria 1300
565 Ga0207683_10435442 3300026121 Bacteria 1208
566 Ga0207683_10737527 3300026121 Bacteria 914
567 Ga0207698_10025711 3300026142 Bacteria 4152
568 Ga0207698_10115985 3300026142 Bacteria 2256
569 Ga0207698_10129425 3300026142 Bacteria 2154
570 Ga0209389_1000077 3300027296 Bacteria 91273
571 Ga0209389_1000097 3300027296 Bacteria 80338
572 Ga0209589_1000132 3300027357 Bacteria 80338
573 Ga0209489_100251 3300027361 Bacteria 91273
574 Ga0209489_100368 3300027361 Bacteria 80342
575 Ga0209700_100271 3300027363 Bacteria 91215
576 Ga0209179_1058156 3300027512 Bacteria 837
577 Ga0209588_1001815 3300027671 Bacteria 5681
578 Ga0209813_10024797 3300027866 Bacteria 1719
579 Ga0207428_10169993 3300027907 Bacteria 1651
580 Ga0268266_10000857 3300028379 Bacteria 39606
581 Ga0268266_10007117 3300028379 Bacteria 10147
582 Ga0268266_10029071 3300028379 Bacteria 4698
583 Ga0268266_10226857 3300028379 Bacteria 1719
584 Ga0268266_10259992 3300028379 Bacteria 1608
585 Ga0268266_10378623 3300028379 Bacteria 1334
586 Ga0268266_10386034 3300028379 Bacteria 1322
587 Ga0268266_10390879 3300028379 Bacteria 1313
588 Ga0268265_10027618 3300028380 Bacteria 4053
589 Ga0268265_10215720 3300028380 Bacteria 1675
590 Ga0268265_10223949 3300028380 Bacteria 1648
591 Ga0268265_10355229 3300028380 Bacteria 1339
592 Ga0268264_10000030 3300028381 Bacteria 418542
593 Ga0268264_10087254 3300028381 Bacteria 2682
594 Ga0268264_10171755 3300028381 Bacteria 1961
595 Ga0265337_1002404 3300028556 Bacteria 8612
596 Ga0265334_10008556 3300028573 Bacteria 4346
597 Ga0265334_10009569 3300028573 Bacteria 4100
598 Ga0265334_10012351 3300028573 Bacteria 3590
599 Ga0265323_10000276 3300028653 Bacteria 29667
600 Ga0265336_10000268 3300028666 Bacteria 36633
601 Ga0307517_10001951 3300028786 Bacteria 33688
602 Ga0307517_10121022 3300028786 Bacteria 1935
603 Ga0307517_10208587 3300028786 Bacteria 1208
604 Ga0307515_10023166 3300028794 Bacteria 10898
605 Ga0265338_10000280 3300028800 Bacteria 91942
606 Ga0265324_10003108 3300029957 Bacteria 8093
607 Ga0265763_1003008 3300030763 Bacteria 1319
608 Ga0265330_10020175 3300031235 Bacteria 3046
609 Ga0265332_10071251 3300031238 Bacteria 1480
610 Ga0265332_10082669 3300031238 Bacteria 1362
611 Ga0265340_10083545 3300031247 Bacteria 1500
612 Ga0265340_10219543 3300031247 Bacteria 852
613 Ga0265316_10513737 3300031344 Bacteria 855
614 Ga0307508_10000015 3300031616 Bacteria 210182
615 Ga0307508_10087619 3300031616 Bacteria 2697
616 Ga0307508_10178537 3300031616 Bacteria 1726
617 Ga0307508_10501094 3300031616 Bacteria 809
618 Ga0265342_10049653 3300031712 Bacteria 2510
619 Ga0307516_10005336 3300031730 Bacteria 15451
620 Ga0307516_10018310 3300031730 Bacteria 7282
621 Ga0307516_10024596 3300031730 Bacteria 6150
622 Ga0307516_10102338 3300031730 Bacteria 2679
623 Ga0307405_10418501 3300031731 Bacteria 1054
624 Ga0307413_10006217 3300031824 Bacteria 5426
625 Ga0307410_10612720 3300031852 Bacteria 909
626 Ga0307409_100163143 3300031995 Bacteria 1952
627 Ga0307416_100523804 3300032002 Bacteria 1254
628 Ga0307411_10106497 3300032005 Bacteria 1996
629 Ga0307411_10113700 3300032005 Bacteria 1943
630 Ga0307507_10047307 3300033179 Bacteria 4203
631 Ga0307510_10006778 3300033180 Bacteria 13657
632 Ga0307510_10014911 3300033180 Bacteria 9191
633 Ga0307510_10044432 3300033180 Bacteria 4812
634 Ga0307510_10162952 3300033180 Bacteria 1823
635 Ga0307510_10400293 3300033180 Bacteria 816
636 Ga0373938_0008929 3300034957 Bacteria 1802
637 Ga0373926_0110107 3300035083 Bacteria 1034
638 Ga0373926_0125307 3300035083 Bacteria 970
639 Ga0373934_0001348 3300035086 Bacteria 8949
640 Ga0373923_0004069 3300035111 Bacteria 4805
641 Ga0373923_0019072 3300035111 Bacteria 2650
642 Ga0373923_0182118 3300035111 Bacteria 966
643 Ga0373932_0039456 3300035112 Bacteria 1354
644 Ga0373932_0058953 3300035112 Bacteria 1161
645 Ga0373936_0002506 3300035113 Bacteria 6885
646 Ga0373936_0032337 3300035113 Bacteria 2069
647 Ga0373936_0089117 3300035113 Bacteria 1292
648 Ga0373945_0086052 3300035116 Bacteria 1211
649 Ga0373953_0000092 3300035117 Bacteria 21395
650 Ga0373954_0000223 3300035118 Bacteria 20807
651 Ga0373956_0002691 3300035119 Bacteria 7194
652 Ga0373957_0002000 3300035120 Bacteria 5693
653 Ga0373943_0008846 3300035170 Bacteria 4509
654 Ga0373946_0001786 3300035171 Bacteria 7501
655 Ga0373946_0024266 3300035171 Bacteria 2375
656 Ga0373955_0001089 3300035172 Bacteria 11546
657 Ga0373955_0059739 3300035172 Bacteria 2100
658 Ga0373955_0150337 3300035172 Bacteria 1370
659 Ga0373955_0271840 3300035172 Bacteria 1019
660 Ga0373961_0065076 3300035241 Bacteria 1116
661 Ga0373924_0001415 3300035410 Bacteria 7773
662 Ga0373924_0030132 3300035410 Bacteria 2173
663 Ga0373931_0028275 3300035691 Bacteria 2869
664 Ga0373931_0246647 3300035691 Bacteria 1084
665 Ga0373931_0361629 3300035691 Bacteria 911
666 Ga0373931_0423484 3300035691 Bacteria 847
667 Ga0373935_0000803 3300035692 Bacteria 16787
668 Ga0373935_0012593 3300035692 Bacteria 5088
669 Ga0373935_0079641 3300035692 Bacteria 2127
670 Ga0373927_0001990 3300035695 Bacteria 15058
671 Ga0373927_0021017 3300035695 Bacteria 4278
672 Ga0373927_0021697 3300035695 Bacteria 4208
673 Ga0373927_0032437 3300035695 Bacteria 3402
674 Ga0373927_0051578 3300035695 Bacteria 2660
675 Ga0373927_0236123 3300035695 Bacteria 1201
676 Ga0373933_0000758 3300035724 Bacteria 19787
677 Ga0373933_0027558 3300035724 Bacteria 3273
678 Ga0373947_0000647 3300035725 Bacteria 20623
679 Ga0373947_0166529 3300035725 Bacteria 1428
680 Ga0310104_05893 3300036242 Bacteria 1046
681 Ga0373937_0011287 3300036401 Bacteria 7835
682 Ga0373937_0174880 3300036401 Bacteria 2015
683 Ga0373937_0279464 3300036401 Bacteria 1576
684 Ga0373937_0610044 3300036401 Bacteria 1036
685 Ga0372808_010828 3300036459 Bacteria 1287
686 Ga0373925_0001112 3300037068 Bacteria 23957
687 Ga0373925_0007023 3300037068 Bacteria 8225
688 Ga0373925_0141227 3300037068 Bacteria 1885
689 Ga0373925_0148316 3300037068 Bacteria 1840
690 Ga0373925_0286347 3300037068 Bacteria 1328
691 Ga0373925_0330287 3300037068 Bacteria 1235
692 Ga0395900_0001310 3300037418 Bacteria 30209
693 Ga0395900_0055509 3300037418 Bacteria 4079
694 Ga0395900_0280357 3300037418 Bacteria 1659
695 Ga0395898_0008958 3300037466 Bacteria 10537
696 Ga0395898_0040336 3300037466 Bacteria 4617
697 Ga0395905_0008401 3300037471 Bacteria 10182
698 Ga0395905_0093170 3300037471 Bacteria 2825
699 Ga0395905_0103015 3300037471 Bacteria 2680
700 Ga0395905_0565963 3300037471 Bacteria 1038
701 Ga0395901_0013467 3300038443 Bacteria 8315
702 Ga0395901_0025727 3300038443 Bacteria 6042
703 Ga0395901_0358871 3300038443 Bacteria 1503
704 Ga0395901_0376709 3300038443 Bacteria 1461
705 Ga0395901_0399117 3300038443 Bacteria 1413
706 Ga0436365_0100896 3300039437 Bacteria 2615
707 Ga0436365_1236739 3300039437 Bacteria 30341
708 Ga0436365_1283747 3300039437 Bacteria 4018
709 Ga0436361_0573481 3300039447 Bacteria 3919
710 Ga0436361_1064158 3300039447 Bacteria 2934
711 Ga0436363_1627615 3300039450 Bacteria 3231
712 Ga0436362_0031186 3300039453 Bacteria 7569
713 Ga0436362_0970189 3300039453 Bacteria 4268
714 Ga0451802_0592381 3300041460 Bacteria 1243
715 Ga0451835_0015839 3300041492 Bacteria 812
716 Ga0451837_0899558 3300041494 Bacteria 803
717 Ga0451847_0671333 3300041503 Bacteria 1125
718 Ga0451853_3449489 3300041512 Bacteria 962
719 Ga0451853_3581848 3300041512 Bacteria 1211
720 Ga0451853_3998411 3300041512 Bacteria 1354
721 Ga0439459_0052452 3300042438 Bacteria 900
722 Ga0466969_0129516 3300044656 Bacteria 1170
723 Ga0466969_0194011 3300044656 Bacteria 927
724 Ga0466972_0001031 3300044658 Bacteria 13361
725 Ga0466965_0228744 3300044683 Bacteria 993
726 Ga0466966_0000191 3300044684 Bacteria 40906
727 Ga0466966_0093402 3300044684 Bacteria 1866
728 Ga0466961_0000005 3300044693 Bacteria 173105
729 Ga0466963_0341100 3300044694 Bacteria 1055
730 Ga0466964_0028100 3300044706 Bacteria 2214
731 Ga0466970_0060878 3300044765 Bacteria 2022
732 Ga0466970_0278525 3300044765 Bacteria 940
733 Ga0466957_0056414 3300044842 Bacteria 2402
734 Ga0466959_0000654 3300045049 Bacteria 20198
735 Ga0466959_0084079 3300045049 Bacteria 2291
736 Ga0466959_0167521 3300045049 Bacteria 1542
737 Ga0495617_046188 3300046452 Bacteria 1451
738 Ga0495592_0000714 3300046454 Bacteria 23202
739 Ga0495592_0009461 3300046454 Bacteria 7327
740 Ga0495592_0019732 3300046454 Bacteria 5128
741 Ga0495603_0002274 3300046455 Bacteria 11278
742 Ga0495603_0050885 3300046455 Bacteria 2463
743 Ga0495603_0058358 3300046455 Bacteria 2282
744 Ga0495603_0063119 3300046455 Bacteria 2186
745 Ga0495603_0070565 3300046455 Bacteria 2053
746 Ga0495603_0192505 3300046455 Bacteria 1179
747 Ga0495629_0000533 3300046459 Bacteria 31488
748 Ga0495629_0000585 3300046459 Bacteria 29571
749 Ga0495629_0003982 3300046459 Bacteria 11105
750 Ga0495638_0002117 3300046460 Bacteria 16743
751 Ga0495641_0007833 3300046461 Bacteria 6612
752 Ga0495651_0003125 3300046462 Bacteria 12770
753 Ga0495651_0119678 3300046462 Bacteria 1936
754 Ga0495651_0380230 3300046462 Bacteria 926
755 Ga0495653_0000404 3300046463 Bacteria 34649
756 Ga0495653_0042601 3300046463 Bacteria 3535
757 Ga0495653_0143676 3300046463 Bacteria 1675
758 Ga0495650_0027735 3300046471 Bacteria 2612
759 Ga0495580_0000166 3300046472 Bacteria 48913
760 Ga0495580_0148068 3300046472 Bacteria 1627
761 Ga0495580_0285655 3300046472 Bacteria 1125
762 Ga0495582_0002361 3300046473 Bacteria 10558
763 Ga0495605_0059460 3300046474 Bacteria 1835
764 Ga0495639_0000075 3300046475 Bacteria 46617
765 Ga0495639_0048742 3300046475 Bacteria 1922
766 Ga0495639_0082956 3300046475 Bacteria 1495
767 Ga0495639_0096815 3300046475 Bacteria 1390
768 Ga0495639_0146958 3300046475 Bacteria 1135
769 Ga0495662_0000356 3300046476 Bacteria 20088
770 Ga0495662_0124596 3300046476 Bacteria 1265
771 Ga0495664_0057062 3300046477 Bacteria 2323
772 Ga0495664_0207672 3300046477 Bacteria 1186
773 Ga0495664_0367982 3300046477 Bacteria 865
774 Ga0495584_0106574 3300046491 Bacteria 1417
775 Ga0495585_0045348 3300046492 Bacteria 2454
776 Ga0495585_0078928 3300046492 Bacteria 1785
777 Ga0495585_0079894 3300046492 Bacteria 1773
778 Ga0495594_0000120 3300046499 Bacteria 36823
779 Ga0495594_0016464 3300046499 Bacteria 3895
780 Ga0495594_0112587 3300046499 Bacteria 1535
781 Ga0495594_0196800 3300046499 Bacteria 1149
782 Ga0495583_0084632 3300046506 Bacteria 1374
783 Ga0495606_0006293 3300046507 Bacteria 11004
784 Ga0495606_0040781 3300046507 Bacteria 3118
785 Ga0495606_0186378 3300046507 Bacteria 1192
786 Ga0495608_0000932 3300046511 Bacteria 20541
787 Ga0495608_0017146 3300046511 Bacteria 5013
788 Ga0495618_0012136 3300046514 Bacteria 5229
789 Ga0495618_0163946 3300046514 Bacteria 1416
790 Ga0495618_0171842 3300046514 Bacteria 1379
791 Ga0495620_0071298 3300046515 Bacteria 1421
792 Ga0495620_0076224 3300046515 Bacteria 1363
793 Ga0495628_0031051 3300046516 Bacteria 4321
794 Ga0495628_0221072 3300046516 Bacteria 1422
795 Ga0495628_0453242 3300046516 Bacteria 931
796 Ga0495630_0001903 3300046517 Bacteria 14540
797 Ga0495630_0059141 3300046517 Bacteria 2875
798 Ga0495631_0176444 3300046518 Bacteria 916
799 Ga0495644_0032459 3300046523 Bacteria 1973
800 Ga0495648_0003336 3300046524 Bacteria 14161
801 Ga0495648_0003484 3300046524 Bacteria 13806
802 Ga0495648_0043575 3300046524 Bacteria 2811
803 Ga0495648_0052682 3300046524 Bacteria 2470
804 Ga0495648_0204606 3300046524 Bacteria 985
805 Ga0495663_0036772 3300046525 Bacteria 1475
806 Ga0495666_0138142 3300046526 Bacteria 1137
807 Ga0495666_0170416 3300046526 Bacteria 1007
808 Ga0495642_0050354 3300046528 Bacteria 1713
809 Ga0495652_0006289 3300046529 Bacteria 11063
810 Ga0495652_0013257 3300046529 Bacteria 7421
811 Ga0495652_0019231 3300046529 Bacteria 6083
812 Ga0495652_0220305 3300046529 Bacteria 1426
813 Ga0495665_0000085 3300046531 Bacteria 41455
814 Ga0495640_0000210 3300046533 Bacteria 38945
815 Ga0495640_0007521 3300046533 Bacteria 8561
816 Ga0495640_0017549 3300046533 Bacteria 5331
817 Ga0495640_0019283 3300046533 Bacteria 5037
818 Ga0495587_0003370 3300046536 Bacteria 10651
819 Ga0495587_0029262 3300046536 Bacteria 3344
820 Ga0495587_0092400 3300046536 Bacteria 1747
821 Ga0495587_0172064 3300046536 Bacteria 1230
822 Ga0495598_0005668 3300046537 Bacteria 2783
823 Ga0495609_0029919 3300046538 Bacteria 2478
824 Ga0495609_0143707 3300046538 Bacteria 1017
825 Ga0495597_0102447 3300046542 Bacteria 1206
826 Ga0495645_0014090 3300046543 Bacteria 5666
827 Ga0495622_0003053 3300046557 Bacteria 7947
828 Ga0495622_0007020 3300046557 Bacteria 5227
829 Ga0495622_0009952 3300046557 Bacteria 4398
830 Ga0495622_0016648 3300046557 Bacteria 3424
831 Ga0495622_0032661 3300046557 Bacteria 2430
832 Ga0495633_0086169 3300046558 Bacteria 1461
833 Ga0495633_0093318 3300046558 Bacteria 1399
834 Ga0495667_0002368 3300046559 Bacteria 12591
835 Ga0495667_0183036 3300046559 Bacteria 1344
836 Ga0495656_0009822 3300046615 Bacteria 3456
837 Ga0495656_0044210 3300046615 Bacteria 1874
838 Ga0495656_0128563 3300046615 Bacteria 1203
839 Ga0495656_0270940 3300046615 Bacteria 863
840 Ga0495668_0034791 3300046616 Bacteria 2825
841 Ga0495668_0158266 3300046616 Bacteria 1241
842 Ga0495634_0022896 3300046642 Bacteria 4398
843 Ga0495634_0023484 3300046642 Bacteria 4333
844 Ga0495634_0038480 3300046642 Bacteria 3262
845 Ga0495634_0262615 3300046642 Bacteria 1053
846 Ga0495611_0040112 3300046648 Bacteria 2087
847 Ga0495611_0046358 3300046648 Bacteria 1949
848 Ga0495625_0059939 3300046660 Bacteria 2698
849 Ga0495625_0068302 3300046660 Bacteria 2499
850 Ga0495625_0157787 3300046660 Bacteria 1522
851 Ga0495625_0169454 3300046660 Bacteria 1459
852 Ga0495635_0000536 3300046663 Bacteria 24099
853 Ga0495635_0003755 3300046663 Bacteria 10540
854 Ga0495635_0005266 3300046663 Bacteria 8997
855 Ga0495635_0035502 3300046663 Bacteria 3456
856 Ga0495659_0005051 3300046664 Bacteria 4144
857 Ga0495659_0054850 3300046664 Bacteria 1459
858 Ga0495659_0149900 3300046664 Bacteria 936
859 Ga0495588_0001317 3300046674 Bacteria 10602
860 Ga0495588_0022249 3300046674 Bacteria 3132
861 Ga0495588_0026723 3300046674 Bacteria 2883
862 Ga0495588_0035133 3300046674 Bacteria 2539
863 Ga0495657_0002815 3300046675 Bacteria 14455
864 Ga0495657_0015183 3300046675 Bacteria 5640
865 Ga0495599_0001740 3300046678 Bacteria 12596
866 Ga0495599_0047987 3300046678 Bacteria 2677
867 Ga0495599_0089347 3300046678 Bacteria 1923
868 Ga0495623_0004997 3300046679 Bacteria 8700
869 Ga0495623_0027880 3300046679 Bacteria 3635
870 Ga0495623_0262244 3300046679 Bacteria 968
871 Ga0495646_0005634 3300046680 Bacteria 7929
872 Ga0495646_0044385 3300046680 Bacteria 2718
873 Ga0495647_0047752 3300046681 Bacteria 1653
874 Ga0495647_0240453 3300046681 Bacteria 804
875 Ga0495658_0000481 3300046683 Bacteria 21948
876 Ga0495658_0219938 3300046683 Bacteria 1189
877 Ga0495669_0038689 3300046684 Bacteria 2112
878 Ga0495669_0046434 3300046684 Bacteria 1938
879 Ga0495669_0140829 3300046684 Bacteria 1139
880 Ga0495669_0229813 3300046684 Bacteria 890
881 Ga0495613_0002779 3300046689 Bacteria 13142
882 Ga0495613_0020104 3300046689 Bacteria 4975
883 Ga0495613_0032424 3300046689 Bacteria 3881
884 Ga0495624_0002075 3300046690 Bacteria 15280
885 Ga0495624_0091821 3300046690 Bacteria 1873
886 Ga0495624_0141767 3300046690 Bacteria 1472
887 Ga0495649_0166110 3300046694 Bacteria 1156
888 Ga0495589_0016006 3300046794 Bacteria 3855
889 Ga0495589_0153835 3300046794 Bacteria 1097
890 Ga0495600_0001712 3300046809 Bacteria 12258
891 Ga0495600_0008483 3300046809 Bacteria 6315
892 Ga0495600_0009872 3300046809 Bacteria 5908
893 Ga0495600_0013354 3300046809 Bacteria 5158
894 Ga0495581_0000083 3300047315 Bacteria 38260
895 Ga0495581_0117560 3300047315 Bacteria 1546
896 Ga0495581_0141988 3300047315 Bacteria 1401
897 Ga0495581_0178954 3300047315 Bacteria 1240
898 Ga0495581_0273294 3300047315 Bacteria 988
899 Ga0495581_0287819 3300047315 Bacteria 961
900 Ga0495581_0382688 3300047315 Bacteria 821
901 Ga0495604_0003351 3300047317 Bacteria 12770
902 Ga0495604_0062119 3300047317 Bacteria 2855
903 Ga0495604_0133745 3300047317 Bacteria 1779
904 Ga0495674_0117011 3300047319 Bacteria 2255
905 Ga0495674_0164032 3300047319 Bacteria 1858
906 Ga0495676_0037885 3300047321 Bacteria 4009
907 Ga0495676_0099181 3300047321 Bacteria 2159
908 Ga0495676_0135213 3300047321 Bacteria 1774
909 Ga0495676_0195381 3300047321 Bacteria 1409
910 Ga0495680_0000920 3300047322 Bacteria 32673
911 Ga0495680_0007831 3300047322 Bacteria 9752
912 Ga0495680_0010833 3300047322 Bacteria 8114
913 Ga0495683_0046253 3300047323 Bacteria 2184
914 Ga0495675_0003454 3300047444 Bacteria 9520
915 Ga0495675_0004477 3300047444 Bacteria 8464
916 Ga0495675_0103343 3300047444 Bacteria 1781
917 Ga0495675_0190080 3300047444 Bacteria 1254
918 Ga0495673_0065337 3300047469 Bacteria 1545
919 Ga0495673_0142280 3300047469 Bacteria 934
920 Ga0495673_0179962 3300047469 Bacteria 801
921 Ga0495681_0129795 3300047470 Bacteria 1074
922 Ga0495684_0000470 3300047471 Bacteria 32869
923 Ga0495684_0058333 3300047471 Bacteria 2941
924 Ga0495684_0062879 3300047471 Bacteria 2823
925 Ga0495686_0105241 3300047472 Bacteria 1698
926 Ga0495686_0231918 3300047472 Bacteria 1045
927 Ga0495686_0324494 3300047472 Bacteria 843
928 Ga0495593_0000003 3300047673 Bacteria 120744
929 Ga0495593_0001464 3300047673 Bacteria 13852
930 Ga0495593_0138762 3300047673 Bacteria 1232
931 Ga0495593_0148975 3300047673 Bacteria 1184
932 Ga0495602_0003657 3300048088 Bacteria 15932
933 Ga0495602_0008321 3300048088 Bacteria 10841
934 Ga0495602_0113500 3300048088 Bacteria 2196
935 Ga0495626_0024099 3300048091 Bacteria 2986
936 Ga0496100_0035627 3300048903 Bacteria 3132
937 Ga0496100_0104386 3300048903 Bacteria 1958
938 Ga0496100_0148317 3300048903 Bacteria 1670
939 Ga0496100_0151213 3300048903 Bacteria 1656
940 Ga0496101_0002419 3300048904 Bacteria 11466
941 Ga0496101_0059874 3300048904 Bacteria 2761
942 Ga0496101_0082846 3300048904 Bacteria 2374
943 Ga0496101_0175162 3300048904 Bacteria 1650
944 Ga0496102_0007052 3300048905 Bacteria 9589
945 Ga0496102_0061830 3300048905 Bacteria 3428
946 Ga0496102_0127399 3300048905 Bacteria 2381
947 Ga0496102_0299426 3300048905 Bacteria 1516
948 Ga0496102_0372853 3300048905 Bacteria 1343
949 Ga0496102_0596132 3300048905 Bacteria 1028
950 Ga0496103_0286132 3300048906 Bacteria 1060
951 Ga0496104_0007733 3300048907 Bacteria 9520
952 Ga0496104_0008613 3300048907 Bacteria 9072
953 Ga0496104_0008791 3300048907 Bacteria 8978
954 Ga0496104_0041517 3300048907 Bacteria 4314
955 Ga0496104_0045912 3300048907 Bacteria 4110
956 Ga0496104_0148883 3300048907 Bacteria 2247
957 Ga0496104_0159145 3300048907 Bacteria 2166
958 Ga0496104_0520484 3300048907 Bacteria 1101
959 Ga0496104_0568872 3300048907 Bacteria 1044
960 Ga0496105_0009843 3300048908 Bacteria 7492
961 Ga0496105_0013646 3300048908 Bacteria 6450
962 Ga0496105_0021008 3300048908 Bacteria 5280
963 Ga0496105_0047972 3300048908 Bacteria 3525
964 Ga0496105_0049374 3300048908 Bacteria 3474
965 Ga0496105_0097279 3300048908 Bacteria 2431
966 Ga0496105_0188531 3300048908 Bacteria 1687
967 Ga0496105_0214171 3300048908 Bacteria 1570
968 Ga0496105_0392113 3300048908 Bacteria 1103
969 Ga0496106_0000823 3300048909 Bacteria 22502
970 Ga0496106_0009736 3300048909 Bacteria 7096
971 Ga0496106_0262191 3300048909 Bacteria 1383
972 Ga0496106_0326857 3300048909 Bacteria 1231
973 Ga0496107_0003302 3300048910 Bacteria 10773
974 Ga0496107_0145386 3300048910 Bacteria 1753
975 Ga0496107_0443689 3300048910 Bacteria 964
976 Ga0496108_0027381 3300048911 Bacteria 4706
977 Ga0496108_0032526 3300048911 Bacteria 4333
978 Ga0496108_0105828 3300048911 Bacteria 2402
979 Ga0496108_0219976 3300048911 Bacteria 1650
980 Ga0496108_0452091 3300048911 Bacteria 1122
981 Ga0496109_0004082 3300048912 Bacteria 12205
982 Ga0496109_0019860 3300048912 Bacteria 5930
983 Ga0496109_0033050 3300048912 Bacteria 4653
984 Ga0496109_0078684 3300048912 Bacteria 3036
985 Ga0496109_0120180 3300048912 Bacteria 2447
986 Ga0496110_0035920 3300048913 Bacteria 4303
987 Ga0496110_0062958 3300048913 Bacteria 3277
988 Ga0496110_0146604 3300048913 Bacteria 2135
989 Ga0496110_0200613 3300048913 Bacteria 1812
990 Ga0496110_0256100 3300048913 Bacteria 1593
991 Ga0496110_0828990 3300048913 Bacteria 830
992 Ga0496111_0071536 3300048914 Bacteria 2524
993 Ga0496111_0091927 3300048914 Bacteria 2224
994 Ga0496111_0407105 3300048914 Bacteria 1005
995 Ga0496112_0000036 3300048915 Bacteria 106325
996 Ga0496112_0004505 3300048915 Bacteria 11824
997 Ga0496112_0017242 3300048915 Bacteria 6781
998 Ga0496112_0025259 3300048915 Bacteria 5703
999 Ga0496112_0026108 3300048915 Bacteria 5616
1000 Ga0496112_0044309 3300048915 Bacteria 4359
1001 Ga0496112_0114497 3300048915 Bacteria 2667
1002 Ga0496113_0003004 3300048916 Bacteria 9989
1003 Ga0496113_0027023 3300048916 Bacteria 4109
1004 Ga0496113_0042869 3300048916 Bacteria 3345
1005 Ga0496113_0056420 3300048916 Bacteria 2949
1006 Ga0496113_0110683 3300048916 Bacteria 2137
1007 Ga0496113_0171986 3300048916 Bacteria 1716
1008 Ga0496113_0335056 3300048916 Bacteria 1213
1009 Ga0496113_0369158 3300048916 Bacteria 1152
1010 Ga0496113_0607136 3300048916 Bacteria 876
1011 Ga0496114_0045844 3300048917 Bacteria 3633
1012 Ga0496114_0070785 3300048917 Bacteria 2930
1013 Ga0496114_0126328 3300048917 Bacteria 2205
1014 Ga0496114_0390494 3300048917 Bacteria 1232
1015 Ga0496114_0532233 3300048917 Bacteria 1039
1016 Ga0496115_0002238 3300048918 Bacteria 13868
1017 Ga0496115_0012292 3300048918 Bacteria 6438
1018 Ga0496115_0069124 3300048918 Bacteria 2860
1019 Ga0496115_0074639 3300048918 Bacteria 2754
1020 Ga0496115_0168792 3300048918 Bacteria 1810
1021 Ga0496115_0220835 3300048918 Bacteria 1564
1022 Ga0496115_0225732 3300048918 Bacteria 1545
1023 Ga0496115_0343562 3300048918 Bacteria 1218
1024 Ga0496115_0393285 3300048918 Bacteria 1125
1025 Ga0496115_0423297 3300048918 Bacteria 1078
1026 Ga0496115_0645452 3300048918 Bacteria 837
1027 Ga0496116_0037444 3300048919 Bacteria 3383
1028 Ga0496117_0012131 3300048920 Bacteria 7639
1029 Ga0496117_0138220 3300048920 Bacteria 1464
1030 Ga0496117_0180844 3300048920 Bacteria 1212
1031 Ga0496118_0003610 3300048921 Bacteria 19225
1032 Ga0496118_0017368 3300048921 Bacteria 6551
1033 Ga0496118_0083099 3300048921 Bacteria 2240
1034 Ga0496118_0085444 3300048921 Bacteria 2197
1035 Ga0496118_0115373 3300048921 Bacteria 1768
1036 Ga0496119_0012861 3300048922 Bacteria 6745
1037 Ga0496119_0098551 3300048922 Bacteria 1646
1038 Ga0496119_0193775 3300048922 Bacteria 1057
1039 Ga0496120_0165777 3300048923 Bacteria 1097
1040 Ga0496120_0187027 3300048923 Bacteria 1012
1041 Ga0496121_0000041 3300048924 Bacteria 346686
1042 Ga0496121_0000225 3300048924 Bacteria 122351
1043 Ga0496121_0002396 3300048924 Bacteria 28735
1044 Ga0496121_0009113 3300048924 Bacteria 11485
1045 Ga0496121_0061911 3300048924 Bacteria 3068
1046 Ga0496121_0162930 3300048924 Bacteria 1628
1047 Ga0496121_0171798 3300048924 Bacteria 1573
1048 Ga0496121_0186166 3300048924 Bacteria 1493
1049 Ga0496121_0223415 3300048924 Bacteria 1324
1050 Ga0496121_0254014 3300048924 Bacteria 1217
1051 Ga0496122_0053961 3300048925 Bacteria 3024
1052 Ga0496122_0107848 3300048925 Bacteria 1839
1053 Ga0496122_0136360 3300048925 Bacteria 1546
1054 Ga0496122_0339071 3300048925 Bacteria 790
1055 Ga0496124_0012074 3300048927 Bacteria 8573
1056 Ga0496124_0029357 3300048927 Bacteria 4902
1057 Ga0496124_0116507 3300048927 Bacteria 2142
1058 Ga0496124_0130386 3300048927 Bacteria 1998
1059 Ga0496125_0000048 3300048928 Bacteria 290651
1060 Ga0496125_0006588 3300048928 Bacteria 12507
1061 Ga0496125_0018399 3300048928 Bacteria 6637
1062 Ga0496125_0081801 3300048928 Bacteria 2465
1063 Ga0496125_0112310 3300048928 Bacteria 1969
1064 Ga0496125_0240557 3300048928 Bacteria 1150
1065 Ga0496126_0005875 3300048929 Bacteria 13844
1066 Ga0496126_0014942 3300048929 Bacteria 7828
1067 Ga0496126_0018558 3300048929 Bacteria 6887
1068 Ga0496126_0022665 3300048929 Bacteria 6102
1069 Ga0496126_0032666 3300048929 Bacteria 4901
1070 Ga0496126_0049902 3300048929 Bacteria 3818
1071 Ga0496126_0135931 3300048929 Bacteria 2121
1072 Ga0496126_0197957 3300048929 Bacteria 1698
1073 Ga0496126_0251227 3300048929 Bacteria 1473
1074 Ga0496126_0355864 3300048929 Bacteria 1197
1075 Ga0496126_0377783 3300048929 Bacteria 1154
1076 Ga0496126_0452623 3300048929 Bacteria 1033
1077 Ga0496126_0455158 3300048929 Bacteria 1029
1078 Ga0495682_0035131 3300049460 Bacteria 1847
1079 Ga0495682_0072640 3300049460 Bacteria 1238
1080 Ga0501031_0091786 3300049568 Bacteria 1981
1081 Ga0501031_0227518 3300049568 Bacteria 1214
1082 Ga0501032_0239765 3300049569 Bacteria 1178
1083 Ga0501033_0027180 3300049570 Bacteria 4303
1084 Ga0501033_0357721 3300049570 Bacteria 1022
1085 Ga0501034_0047447 3300049571 Bacteria 4337
1086 Ga0501034_0087971 3300049571 Bacteria 3105
1087 Ga0501036_0086884 3300049572 Bacteria 2643
1088 Ga0501036_0229454 3300049572 Bacteria 1558
1089 Ga0501037_0282654 3300049573 Bacteria 1156
1090 Ga0501038_0116844 3300049574 Bacteria 2204
1091 Ga0501039_0272180 3300049575 Bacteria 1331
1092 Ga0501040_0150548 3300049576 Bacteria 1642
1093 Ga0501043_0052885 3300049579 Bacteria 3189
1094 Ga0501047_0006336 3300049581 Bacteria 11131
1095 Ga0501047_0069896 3300049581 Bacteria 3380
1096 Ga0501047_0686796 3300049581 Unclassified 842
1097 Ga0501048_0166996 3300049582 Bacteria 1558
1098 Ga0501048_0444954 3300049582 Bacteria 928
1099 Ga0501067_0184227 3300049583 Bacteria 1163
1100 Ga0501069_0441190 3300049585 Bacteria 773
1101 Ga0501071_0058731 3300049587 Bacteria 2782
1102 Ga0501076_0384800 3300049592 Bacteria 1153
1103 Ga0501083_0106614 3300049744 Bacteria 1845
1104 Ga0501035_0015948 3300049822 Bacteria 6934
1105 Ga0501035_0052601 3300049822 Bacteria 3644
1106 Ga0501044_0017591 3300049823 Bacteria 7667
1107 Ga0501044_0039622 3300049823 Bacteria 4915
1108 Ga0501044_0324363 3300049823 Bacteria 1464
1109 nmdc:mga03683_204267_c1 3300050489 Bacteria 907
1110 nmdc:mga03n38_251279_c1 3300050490 Bacteria 934
1111 nmdc:mga03n38_42142_c1 3300050490 Bacteria 1994
1112 nmdc:mga03n38_92549_c1 3300050490 Bacteria 1442
1113 nmdc:mga00v17_16990_c1 3300050491 Bacteria 4110
1114 nmdc:mga00v17_36445_c1 3300050491 Bacteria 2931
1115 nmdc:mga00v17_40924_c1 3300050491 Bacteria 2781
1116 nmdc:mga0yw44_1840_c1 3300050492 Bacteria 8709
1117 nmdc:mga0yw44_225522_c1 3300050492 Bacteria 1243
1118 nmdc:mga0yw44_25743_c1 3300050492 Bacteria 3351
1119 nmdc:mga0yw44_38628_c1 3300050492 Bacteria 2826
1120 nmdc:mga0yw44_397337_c1 3300050492 Bacteria 932
1121 nmdc:mga0yw44_543633_c1 3300050492 Bacteria 789
1122 nmdc:mga0yw44_68816_c1 3300050492 Bacteria 2191
1123 nmdc:mga0yw44_88550_c1 3300050492 Bacteria 1952
1124 nmdc:mga0k408_83414_c1 3300050493 Bacteria 1873
1125 nmdc:mga06z11_129554_c1 3300050494 Bacteria 1415
1126 nmdc:mga06z11_297123_c1 3300050494 Bacteria 960
1127 nmdc:mga06z11_366921_c1 3300050494 Bacteria 864
1128 nmdc:mga06z11_67614_c1 3300050494 Bacteria 1881
1129 nmdc:mga06z11_81958_c1 3300050494 Bacteria 1733
1130 nmdc:mga04h51_195069_c1 3300050495 Bacteria 793
1131 nmdc:mga04h51_27833_c1 3300050495 Bacteria 1759
1132 nmdc:mga07m45_156899_c1 3300050496 Bacteria 1320
1133 nmdc:mga07m45_165349_c1 3300050496 Bacteria 1285
1134 nmdc:mga07m45_24799_c1 3300050496 Bacteria 3287
1135 nmdc:mga07m45_269014_c1 3300050496 Bacteria 992
1136 nmdc:mga07m45_31562_c1 3300050496 Bacteria 2936
1137 nmdc:mga07m45_43758_c1 3300050496 Bacteria 2511
1138 nmdc:mga05p37_49010_c1 3300050507 Bacteria 5194
1139 nmdc:mga0qj67_683685_c1 3300050509 Bacteria 817
1140 nmdc:mga08y16_107272_c1 3300050511 Bacteria 2907
1141 nmdc:mga08y16_611197_c1 3300050511 Bacteria 1098
1142 nmdc:mga0n895_488727_c1 3300050512 Bacteria 1241
1143 nmdc:mga0rr50_123844_c1 3300050513 Bacteria 2061
1144 nmdc:mga0rr50_457685_c1 3300050513 Bacteria 1082
1145 nmdc:mga0sz30_112720_c1 3300050516 Bacteria 1193
1146 nmdc:mga0sz30_173081_c1 3300050516 Bacteria 957
1147 nmdc:mga0sz30_189516_c1 3300050516 Bacteria 913
1148 nmdc:mga0sz30_19694_c1 3300050516 Bacteria 2715
1149 Ga0495601_0096803 3300053077 Bacteria 1904
1150 Ga0495612_0087425 3300053078 Bacteria 1316
1151 Ga0500635_0002038 3300053080 Bacteria 4940
1152 Ga0500635_0007819 3300053080 Bacteria 2909
1153 Ga0500635_0010446 3300053080 Bacteria 2609
1154 Ga0495655_0058865 3300053083 Bacteria 1042
1155 Ga0495595_0000452 3300053084 Bacteria 15495
1156 Ga0495595_0151172 3300053084 Bacteria 1143
1157 Ga0495595_0296178 3300053084 Bacteria 813
1158 Ga0495619_0000590 3300053085 Bacteria 24089
1159 Ga0495619_0104644 3300053085 Bacteria 1929
1160 Ga0495619_0111363 3300053085 Bacteria 1871
1161 Ga0500578_0175876 3300053086 Bacteria 1321
1162 Ga0500643_000373 3300053087 Bacteria 35007
1163 Ga0500583_0016219 3300053092 Bacteria 2969
1164 Ga0500583_0056105 3300053092 Bacteria 1844
1165 Ga0500651_0159844 3300053093 Bacteria 1348
1166 Ga0500566_0000011 3300053094 Bacteria 118644
1167 Ga0500566_0000174 3300053094 Bacteria 32668
1168 Ga0500640_000891 3300053095 Bacteria 8309
1169 Ga0500641_0005264 3300053096 Bacteria 4583
1170 Ga0500641_0034882 3300053096 Bacteria 2005
1171 Ga0500641_0045876 3300053096 Bacteria 1781
1172 Ga0500648_227075 3300053097 Bacteria 907
1173 Ga0500650_0127604 3300053098 Bacteria 1183
1174 Ga0500654_085783 3300053099 Bacteria 1436
1175 Ga0500554_057533 3300053102 Bacteria 1239
1176 Ga0500555_005869 3300053103 Bacteria 3483
1177 Ga0500556_0003645 3300053104 Bacteria 4486
1178 Ga0500557_000062 3300053105 Bacteria 43893
1179 Ga0500562_005901 3300053108 Bacteria 3083
1180 Ga0500569_019888 3300053109 Bacteria 1754
1181 Ga0500572_000437 3300053111 Bacteria 14662
1182 Ga0500572_000563 3300053111 Bacteria 12656
1183 Ga0500572_031118 3300053111 Bacteria 1489
1184 Ga0500580_073784 3300053113 Bacteria 1399
1185 Ga0500582_118168 3300053114 Bacteria 924
1186 Ga0500591_071643 3300053115 Bacteria 1568
1187 Ga0500594_0032729 3300053118 Bacteria 1379
1188 Ga0500594_0068565 3300053118 Bacteria 1038
1189 Ga0500595_000181 3300053119 Bacteria 42687
1190 Ga0500595_000343 3300053119 Bacteria 30330
1191 Ga0500595_000799 3300053119 Bacteria 18242
1192 Ga0500595_001346 3300053119 Bacteria 13271
1193 Ga0500595_017155 3300053119 Bacteria 2679
1194 Ga0500595_038977 3300053119 Bacteria 1540
1195 Ga0500595_051785 3300053119 Bacteria 1270
1196 Ga0500614_003680 3300053123 Bacteria 3291
1197 Ga0500642_0000138 3300053130 Bacteria 32489
1198 Ga0500642_0298108 3300053130 Bacteria 728
1199 Ga0500559_0001384 3300053136 Bacteria 13827
1200 Ga0500559_0004964 3300053136 Bacteria 6183
1201 Ga0500559_0005624 3300053136 Bacteria 5743
1202 Ga0500559_0110611 3300053136 Bacteria 1272
1203 Ga0500568_0029054 3300053139 Bacteria 2298
1204 Ga0500568_0029907 3300053139 Bacteria 2257
1205 Ga0500573_0005486 3300053140 Bacteria 6799
1206 Ga0500577_0136134 3300053142 Bacteria 1033
1207 Ga0500589_080908 3300053147 Bacteria 1450
1208 Ga0500590_121153 3300053148 Bacteria 1226
1209 Ga0500603_010619 3300053150 Bacteria 2082
1210 Ga0500603_011044 3300053150 Bacteria 2048
1211 Ga0500603_013809 3300053150 Bacteria 1878
1212 Ga0500603_018233 3300053150 Bacteria 1688
1213 Ga0500603_025504 3300053150 Bacteria 1487
1214 Ga0500604_0044559 3300053151 Bacteria 1351
1215 Ga0500616_0010044 3300053153 Bacteria 5688
1216 Ga0500622_0001764 3300053156 Bacteria 16613
1217 Ga0500627_0046267 3300053158 Bacteria 1885
1218 Ga0500630_000927 3300053159 Bacteria 13690
1219 Ga0500633_0038059 3300053160 Bacteria 1600
1220 Ga0500638_002499 3300053162 Bacteria 6438
1221 Ga0500638_020349 3300053162 Bacteria 3123
1222 Ga0500638_098187 3300053162 Bacteria 1370
1223 Ga0500638_109654 3300053162 Bacteria 1276
1224 Ga0500638_142257 3300053162 Bacteria 1076
1225 Ga0500639_001719 3300053163 Bacteria 11011
1226 Ga0500639_018557 3300053163 Bacteria 3672
1227 Ga0500636_0000608 3300053177 Bacteria 19428
1228 Ga0500636_0042215 3300053177 Bacteria 2696
1229 Ga0500636_0047584 3300053177 Bacteria 2526
1230 Ga0500636_0072868 3300053177 Bacteria 1990
1231 Ga0500636_0170448 3300053177 Bacteria 1177
1232 Ga0500637_0001313 3300053178 Bacteria 10472
1233 Ga0500637_0007702 3300053178 Bacteria 5399
1234 Ga0500637_0130859 3300053178 Bacteria 1455
1235 Ga0500637_0209086 3300053178 Bacteria 1107
1236 Ga0500637_0291157 3300053178 Bacteria 894
1237 Ga0500625_005743 3300053729 Bacteria 5220
1238 Ga0500645_047689 3300053730 Bacteria 1255
1239 Ga0500609_010779 3300053731 Bacteria 1233
1240 Ga0500552_040614 3300053733 Bacteria 756
1241 Ga0500596_000148 3300053735 Bacteria 10722
1242 Ga0500596_001020 3300053735 Bacteria 5610
1243 Ga0500596_003660 3300053735 Bacteria 2893
1244 Ga0500601_000276 3300053737 Bacteria 9735
1245 Ga0500601_002160 3300053737 Bacteria 2112
1246 Ga0500661_000463 3300055283 Bacteria 7503
1247 Ga0500661_006762 3300055283 Bacteria 2132

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005983 Ga0081540_1183673 Ga0081540_11836731 190
2 3300038443 Ga0395901_0358871 Ga0395901_0358871_695_1297 200
3 3300035111 Ga0373923_0004069 Ga0373923_0004069_4172_4777 201
4 iso_pu_bacteria 2881364244 2881370156 201
5 3300003659 JGI25404J52841_10011426 JGI25404J52841_100114263 202
6 3300006195 Ga0075366_10184151 Ga0075366_101841512 202
7 3300050494 nmdc:mga06z11_67614_c1 nmdc:mga06z11_67614_c1_956_1564 202
8 3300050495 nmdc:mga04h51_27833_c1 nmdc:mga04h51_27833_c1_351_959 202
9 3300050509 nmdc:mga0qj67_683685_c1 nmdc:mga0qj67_683685_c1_178_786 202
10 3300053130 Ga0500642_0298108 Ga0500642_0298108_58_666 202
11 3300006195 Ga0075366_10224973 Ga0075366_102249732 206
12 3300003752 Ga0055539_1001910 Ga0055539_10019101 208
13 3300025253 Ga0209677_100502 Ga0209677_10050210 208
14 3300025272 Ga0209455_1030492 Ga0209455_10304921 208
15 3300025910 Ga0207684_10156077 Ga0207684_101560771 208
16 3300044706 Ga0466964_0028100 Ga0466964_0028100_578_1273 208
17 3300047472 Ga0495686_0324494 Ga0495686_0324494_43_675 208
18 3300048920 Ga0496117_0138220 Ga0496117_0138220_264_959 208
19 3300048920 Ga0496117_0180844 Ga0496117_0180844_27_653 208
20 3300048921 Ga0496118_0083099 Ga0496118_0083099_1081_1776 208
21 3300048924 Ga0496121_0223415 Ga0496121_0223415_215_910 208
22 3300048928 Ga0496125_0240557 Ga0496125_0240557_99_794 208
23 3300048929 Ga0496126_0377783 Ga0496126_0377783_196_891 208
24 3300050494 nmdc:mga06z11_297123_c1 nmdc:mga06z11_297123_c1_313_939 208
25 3300053119 Ga0500595_038977 Ga0500595_038977_888_1514 208
26 3300045049 Ga0466959_0167521 Ga0466959_0167521_435_1094 210
27 3300005435 Ga0070714_100628543 Ga0070714_1006285431 212
28 3300005439 Ga0070711_100046989 Ga0070711_1000469892 212
29 3300006038 Ga0075365_10001902 Ga0075365_100019023 212
30 3300006051 Ga0075364_10002061 Ga0075364_100020615 212
31 3300025928 Ga0207700_10252814 Ga0207700_102528142 212
32 3300025929 Ga0207664_10474688 Ga0207664_104746882 212
33 3300050491 nmdc:mga00v17_36445_c1 nmdc:mga00v17_36445_c1_89_772 212
34 3300050492 nmdc:mga0yw44_1840_c1 nmdc:mga0yw44_1840_c1_7053_7736 212
35 3300050494 nmdc:mga06z11_129554_c1 nmdc:mga06z11_129554_c1_451_1134 212
36 3300005434 Ga0070709_10008266 Ga0070709_1000826611 213
37 3300005436 Ga0070713_100184258 Ga0070713_1001842581 213
38 3300006173 Ga0070716_100133116 Ga0070716_1001331161 213
39 3300006175 Ga0070712_100162136 Ga0070712_1001621362 213
40 3300025898 Ga0207692_10088053 Ga0207692_100880533 213
41 3300025905 Ga0207685_10069996 Ga0207685_100699962 213
42 3300025906 Ga0207699_10322282 Ga0207699_103222822 213
43 3300025915 Ga0207693_10184221 Ga0207693_101842212 213
44 3300025916 Ga0207663_10046659 Ga0207663_100466591 213
45 iso_pu_bacteria 2909042592 2909045427 214
46 3300025916 Ga0207663_10156229 Ga0207663_101562295 215
47 3300028379 Ga0268266_10386034 Ga0268266_103860342 215
48 3300006175 Ga0070712_100075559 Ga0070712_1000755592 216
49 3300025915 Ga0207693_10001116 Ga0207693_100011164 216
50 3300025904 Ga0207647_10277469 Ga0207647_102774691 217
51 3300025936 Ga0207670_10536302 Ga0207670_105363022 217
52 3300041512 Ga0451853_3449489 Ga0451853_3449489_214_885 217
53 3300045049 Ga0466959_0084079 Ga0466959_0084079_854_1522 218
54 3300046648 Ga0495611_0046358 Ga0495611_0046358_902_1588 218
55 iso_pu_bacteria 2876761206 2876770004 218
56 3300006175 Ga0070712_100421594 Ga0070712_1004215942 219
57 3300025935 Ga0207709_10219030 Ga0207709_102190302 219
58 3300044694 Ga0466963_0341100 Ga0466963_0341100_139_828 219
59 3300046455 Ga0495603_0070565 Ga0495603_0070565_783_1496 219
60 3300046459 Ga0495629_0003982 Ga0495629_0003982_6153_6863 219
61 3300046492 Ga0495585_0045348 Ga0495585_0045348_213_926 219
62 3300046514 Ga0495618_0171842 Ga0495618_0171842_145_855 219
63 3300046529 Ga0495652_0220305 Ga0495652_0220305_74_784 219
64 3300046533 Ga0495640_0017549 Ga0495640_0017549_3119_3829 219
65 3300046642 Ga0495634_0038480 Ga0495634_0038480_2413_3123 219
66 3300046663 Ga0495635_0005266 Ga0495635_0005266_7495_8205 219
67 3300046689 Ga0495613_0020104 Ga0495613_0020104_4072_4782 219
68 3300046809 Ga0495600_0009872 Ga0495600_0009872_2921_3631 219
69 3300047317 Ga0495604_0133745 Ga0495604_0133745_1010_1720 219
70 3300047673 Ga0495593_0138762 Ga0495593_0138762_454_1164 219
71 3300048907 Ga0496104_0148883 Ga0496104_0148883_187_897 219
72 3300048908 Ga0496105_0021008 Ga0496105_0021008_4383_5093 219
73 3300048918 Ga0496115_0012292 Ga0496115_0012292_355_1065 219
74 3300048923 Ga0496120_0187027 Ga0496120_0187027_243_953 219
75 3300048925 Ga0496122_0136360 Ga0496122_0136360_354_1064 219
76 3300048929 Ga0496126_0022665 Ga0496126_0022665_3015_3725 219
77 3300049569 Ga0501032_0239765 Ga0501032_0239765_359_1039 219
78 3300049571 Ga0501034_0047447 Ga0501034_0047447_3049_3729 219
79 3300049574 Ga0501038_0116844 Ga0501038_0116844_80_760 219
80 3300049581 Ga0501047_0006336 Ga0501047_0006336_2014_2694 219
81 3300049822 Ga0501035_0052601 Ga0501035_0052601_2854_3534 219
82 3300049823 Ga0501044_0039622 Ga0501044_0039622_2253_2933 219
83 3300053136 Ga0500559_0110611 Ga0500559_0110611_503_1213 219
84 3300053148 Ga0500590_121153 Ga0500590_121153_249_974 219
85 iso_pu_bacteria 2513237102 2513700692 219
86 iso_pu_bacteria 2824617872 2824621994 219
87 iso_pu_bacteria 2824626560 2824629258 219
88 iso_pu_bacteria 2824635225 2824639209 219
89 iso_pu_bacteria 2824644064 2824651348 219
90 iso_pu_bacteria 2824714736 2824720471 219
91 iso_pu_bacteria 2824723954 2824728455 219
92 3300005331 Ga0070670_100419702 Ga0070670_1004197022 220
93 3300005338 Ga0068868_100009995 Ga0068868_1000099959 220
94 3300005344 Ga0070661_100169956 Ga0070661_1001699562 220
95 3300005354 Ga0070675_100513571 Ga0070675_1005135712 220
96 3300005455 Ga0070663_100349102 Ga0070663_1003491022 220
97 3300005457 Ga0070662_100330256 Ga0070662_1003302562 220
98 3300005544 Ga0070686_100094487 Ga0070686_1000944873 220
99 3300005614 Ga0068856_100255951 Ga0068856_1002559512 220
100 3300005616 Ga0068852_100803405 Ga0068852_1008034051 220
101 3300005617 Ga0068859_100749466 Ga0068859_1007494661 220
102 3300005618 Ga0068864_100140540 Ga0068864_1001405403 220
103 3300005719 Ga0068861_100226626 Ga0068861_1002266263 220
104 3300005834 Ga0068851_10091721 Ga0068851_100917212 220
105 3300006042 Ga0075368_10029327 Ga0075368_100293273 220
106 3300006195 Ga0075366_10217981 Ga0075366_102179813 220
107 3300006871 Ga0075434_100622146 Ga0075434_1006221462 220
108 3300006931 Ga0097620_100749440 Ga0097620_1007494401 220
109 3300009148 Ga0105243_10044783 Ga0105243_100447835 220
110 3300009177 Ga0105248_10298373 Ga0105248_102983733 220
111 3300009551 Ga0105238_10044483 Ga0105238_100444835 220
112 3300013306 Ga0163162_10511344 Ga0163162_105113441 220
113 3300013307 Ga0157372_10259451 Ga0157372_102594513 220
114 3300014325 Ga0163163_10588260 Ga0163163_105882601 220
115 3300025911 Ga0207654_10026270 Ga0207654_100262704 220
116 3300025924 Ga0207694_10383732 Ga0207694_103837322 220
117 3300025925 Ga0207650_10556215 Ga0207650_105562151 220
118 3300025933 Ga0207706_10158982 Ga0207706_101589823 220
119 3300025942 Ga0207689_10071057 Ga0207689_100710573 220
120 3300026067 Ga0207678_10020798 Ga0207678_100207985 220
121 3300026116 Ga0207674_10021271 Ga0207674_100212712 220
122 3300026118 Ga0207675_100338233 Ga0207675_1003382332 220
123 3300028379 Ga0268266_10259992 Ga0268266_102599922 220
124 3300048911 Ga0496108_0032526 Ga0496108_0032526_3050_3754 220
125 3300048924 Ga0496121_0254014 Ga0496121_0254014_207_911 220
126 3300050490 nmdc:mga03n38_92549_c1 nmdc:mga03n38_92549_c1_125_829 220
127 3300050494 nmdc:mga06z11_366921_c1 nmdc:mga06z11_366921_c1_25_729 220
128 3300050496 nmdc:mga07m45_269014_c1 nmdc:mga07m45_269014_c1_251_955 220
129 3300053139 Ga0500568_0029907 Ga0500568_0029907_260_943 220
130 3300010375 Ga0105239_10593912 Ga0105239_105939121 221
131 iso_pu_bacteria 2513237101 2513695538 221
132 iso_pu_bacteria 2721755755 2723843933 221
133 iso_pu_bacteria 2874604998 2874612076 221
134 iso_pu_bacteria 2876808645 2876812706 221
135 iso_pu_bacteria 2879110137 2879114001 221
136 iso_pu_bacteria 2889033259 2889038786 221
137 iso_pu_bacteria 2922386360 2922386656 221
138 iso_pu_bacteria 8006964411 8006968054 221
139 iso_pu_bacteria 8006984368 8006992238 221
140 iso_pu_bacteria 8006994254 8006999371 221
141 iso_pu_bacteria 8056673599 8056680008 221
142 3300028381 Ga0268264_10087254 Ga0268264_100872543 222
143 3300032005 Ga0307411_10106497 Ga0307411_101064972 222
144 3300048929 Ga0496126_0251227 Ga0496126_0251227_508_1197 222
145 iso_pu_bacteria 2513237098 2513677722 222
146 iso_pu_bacteria 2524023210 2524463602 222
147 iso_pu_bacteria 2885383462 2885392211 222
148 iso_pu_bacteria 2903768456 2903777820 222
149 iso_pu_bacteria 8006933436 8006943649 222
150 iso_pu_bacteria 8006973647 8006983899 222
151 iso_pu_bacteria 8056681323 8056687695 222
152 3300005539 Ga0068853_100350689 Ga0068853_1003506892 223
153 3300006178 Ga0075367_10167176 Ga0075367_101671763 223
154 3300010159 Ga0099796_10199126 Ga0099796_101991261 223
155 3300021377 Ga0213874_10090067 Ga0213874_100900671 223
156 3300035241 Ga0373961_0065076 Ga0373961_0065076_74_757 223
157 3300039437 Ga0436365_1283747 Ga0436365_1283747_1953_2633 223
158 3300039450 Ga0436363_1627615 Ga0436363_1627615_702_1382 223
159 3300048918 Ga0496115_0645452 Ga0496115_0645452_78_770 223
160 3300048925 Ga0496122_0339071 Ga0496122_0339071_46_729 223
161 3300048929 Ga0496126_0032666 Ga0496126_0032666_3020_3703 223
162 3300049570 Ga0501033_0357721 Ga0501033_0357721_158_844 223
163 3300049823 Ga0501044_0324363 Ga0501044_0324363_446_1132 223
164 3300050516 nmdc:mga0sz30_189516_c1 nmdc:mga0sz30_189516_c1_178_861 223
165 3300053118 Ga0500594_0032729 Ga0500594_0032729_482_1183 223
166 3300053147 Ga0500589_080908 Ga0500589_080908_614_1315 223
167 iso_pu_bacteria 2513237101 2513691535 223
168 iso_pu_bacteria 2513237104 2513721490 223
169 iso_pu_bacteria 2721755755 2723845474 223
170 iso_pu_bacteria 2791355199 2793083333 223
171 iso_pu_bacteria 2874604998 2874607628 223
172 iso_pu_bacteria 2874604998 2874612470 223
173 iso_pu_bacteria 2876808645 2876812993 223
174 iso_pu_bacteria 2879110137 2879115367 223
175 iso_pu_bacteria 2889033259 2889040253 223
176 iso_pu_bacteria 8006926726 8006928619 223
177 3300003215 JGI25153J46596_10004474 JGI25153J46596_100044747 224
178 3300003775 Ga0055524_1016563 Ga0055524_10165634 224
179 3300003794 Ga0055531_10002968 Ga0055531_1000296811 224
180 3300003794 Ga0055531_10004025 Ga0055531_100040256 224
181 3300005262 Ga0065165_1007237 Ga0065165_10072374 224
182 3300005328 Ga0070676_10202147 Ga0070676_102021472 224
183 3300005329 Ga0070683_100088893 Ga0070683_1000888934 224
184 3300005331 Ga0070670_100097365 Ga0070670_1000973652 224
185 3300005336 Ga0070680_100012857 Ga0070680_1000128579 224
186 3300005337 Ga0070682_100196475 Ga0070682_1001964751 224
187 3300005338 Ga0068868_100009489 Ga0068868_1000094893 224
188 3300005339 Ga0070660_100438439 Ga0070660_1004384391 224
189 3300005347 Ga0070668_100256230 Ga0070668_1002562302 224
190 3300005356 Ga0070674_100107344 Ga0070674_1001073443 224
191 3300005435 Ga0070714_100033282 Ga0070714_1000332823 224
192 3300005455 Ga0070663_100024348 Ga0070663_1000243484 224
193 3300005456 Ga0070678_100009842 Ga0070678_1000098425 224
194 3300005456 Ga0070678_100376752 Ga0070678_1003767522 224
195 3300005457 Ga0070662_100006982 Ga0070662_1000069824 224
196 3300005458 Ga0070681_10014127 Ga0070681_100141275 224
197 3300005535 Ga0070684_100557337 Ga0070684_1005573372 224
198 3300005548 Ga0070665_100041394 Ga0070665_1000413945 224
199 3300005548 Ga0070665_100351429 Ga0070665_1003514293 224
200 3300005548 Ga0070665_100443489 Ga0070665_1004434892 224
201 3300005548 Ga0070665_100742704 Ga0070665_1007427041 224
202 3300005563 Ga0068855_100012945 Ga0068855_1000129459 224
203 3300005578 Ga0068854_100463210 Ga0068854_1004632102 224
204 3300005614 Ga0068856_100172083 Ga0068856_1001720833 224
205 3300005616 Ga0068852_100106137 Ga0068852_1001061373 224
206 3300005719 Ga0068861_100013644 Ga0068861_1000136444 224
207 3300005937 Ga0081455_10001783 Ga0081455_1000178310 224
208 3300006038 Ga0075365_10093855 Ga0075365_100938551 224
209 3300006038 Ga0075365_10219570 Ga0075365_102195702 224
210 3300006048 Ga0075363_100281854 Ga0075363_1002818542 224
211 3300006178 Ga0075367_10193191 Ga0075367_101931913 224
212 3300006178 Ga0075367_10371991 Ga0075367_103719912 224
213 3300006237 Ga0097621_100127925 Ga0097621_1001279253 224
214 3300006358 Ga0068871_100233898 Ga0068871_1002338983 224
215 3300006881 Ga0068865_100112101 Ga0068865_1001121013 224
216 3300006942 Ga0099824_1023507 Ga0099824_10235076 224
217 3300006943 Ga0099822_1054190 Ga0099822_10541902 224
218 3300009093 Ga0105240_10031599 Ga0105240_100315993 224
219 3300009098 Ga0105245_10015268 Ga0105245_100152684 224
220 3300009098 Ga0105245_10070764 Ga0105245_100707644 224
221 3300009177 Ga0105248_10241458 Ga0105248_102414581 224
222 3300009545 Ga0105237_10170955 Ga0105237_101709553 224
223 3300009551 Ga0105238_10405076 Ga0105238_104050762 224
224 3300009553 Ga0105249_10045684 Ga0105249_100456847 224
225 3300010375 Ga0105239_10043843 Ga0105239_100438435 224
226 3300010375 Ga0105239_10102612 Ga0105239_101026122 224
227 3300010375 Ga0105239_10187191 Ga0105239_101871915 224
228 3300011119 Ga0105246_10007577 Ga0105246_100075774 224
229 3300013296 Ga0157374_10003708 Ga0157374_100037086 224
230 3300013297 Ga0157378_10000706 Ga0157378_1000070612 224
231 3300013297 Ga0157378_10009737 Ga0157378_100097378 224
232 3300013297 Ga0157378_10074982 Ga0157378_100749823 224
233 3300013297 Ga0157378_10187155 Ga0157378_101871553 224
234 3300013306 Ga0163162_10005573 Ga0163162_1000557312 224
235 3300013306 Ga0163162_10006254 Ga0163162_100062548 224
236 3300013308 Ga0157375_10240474 Ga0157375_102404743 224
237 3300014325 Ga0163163_10027833 Ga0163163_100278334 224
238 3300014326 Ga0157380_10022035 Ga0157380_100220353 224
239 3300014969 Ga0157376_10038827 Ga0157376_100388275 224
240 3300017792 Ga0163161_10358607 Ga0163161_103586072 224
241 3300025297 Ga0209758_1000011 Ga0209758_1000011507 224
242 3300025299 Ga0209256_1001013 Ga0209256_100101310 224
243 3300025302 Ga0207426_1020535 Ga0207426_10205352 224
244 3300025304 Ga0209257_1004704 Ga0209257_10047047 224
245 3300025913 Ga0207695_10024377 Ga0207695_100243773 224
246 3300025914 Ga0207671_10160589 Ga0207671_101605893 224
247 3300025917 Ga0207660_10146484 Ga0207660_101464843 224
248 3300025921 Ga0207652_10210825 Ga0207652_102108253 224
249 3300025926 Ga0207659_10081566 Ga0207659_100815663 224
250 3300025927 Ga0207687_10006921 Ga0207687_100069215 224
251 3300025933 Ga0207706_10169631 Ga0207706_101696312 224
252 3300025934 Ga0207686_10497615 Ga0207686_104976152 224
253 3300025937 Ga0207669_10029306 Ga0207669_100293064 224
254 3300025938 Ga0207704_10118053 Ga0207704_101180532 224
255 3300025944 Ga0207661_10074658 Ga0207661_100746584 224
256 3300025949 Ga0207667_10028236 Ga0207667_100282363 224
257 3300025961 Ga0207712_10076093 Ga0207712_100760935 224
258 3300026023 Ga0207677_10040545 Ga0207677_100405454 224
259 3300026067 Ga0207678_10040116 Ga0207678_100401164 224
260 3300026067 Ga0207678_10489274 Ga0207678_104892741 224
261 3300026118 Ga0207675_100026976 Ga0207675_1000269763 224
262 3300026121 Ga0207683_10024719 Ga0207683_100247194 224
263 3300026142 Ga0207698_10129425 Ga0207698_101294253 224
264 3300027296 Ga0209389_1000097 Ga0209389_100009713 224
265 3300027357 Ga0209589_1000132 Ga0209589_100013213 224
266 3300027361 Ga0209489_100368 Ga0209489_10036875 224
267 3300028379 Ga0268266_10029071 Ga0268266_100290713 224
268 3300028379 Ga0268266_10226857 Ga0268266_102268572 224
269 3300028379 Ga0268266_10390879 Ga0268266_103908792 224
270 3300028786 Ga0307517_10001951 Ga0307517_1000195110 224
271 3300028786 Ga0307517_10121022 Ga0307517_101210223 224
272 3300028794 Ga0307515_10023166 Ga0307515_1002316612 224
273 3300031616 Ga0307508_10087619 Ga0307508_100876194 224
274 3300031616 Ga0307508_10178537 Ga0307508_101785372 224
275 3300041460 Ga0451802_0592381 Ga0451802_0592381_284_985 224
276 3300041494 Ga0451837_0899558 Ga0451837_0899558_27_722 224
277 3300041512 Ga0451853_3998411 Ga0451853_3998411_27_722 224
278 3300046476 Ga0495662_0124596 Ga0495662_0124596_98_793 224
279 3300046507 Ga0495606_0006293 Ga0495606_0006293_3275_3970 224
280 3300046557 Ga0495622_0016648 Ga0495622_0016648_2673_3383 224
281 3300046660 Ga0495625_0157787 Ga0495625_0157787_459_1160 224
282 3300047315 Ga0495581_0141988 Ga0495581_0141988_514_1224 224
283 3300047315 Ga0495581_0273294 Ga0495581_0273294_139_822 224
284 3300047469 Ga0495673_0142280 Ga0495673_0142280_29_739 224
285 3300048903 Ga0496100_0104386 Ga0496100_0104386_49_744 224
286 3300048904 Ga0496101_0002419 Ga0496101_0002419_5385_6080 224
287 3300048905 Ga0496102_0007052 Ga0496102_0007052_5392_6087 224
288 3300048907 Ga0496104_0008791 Ga0496104_0008791_5679_6374 224
289 3300048908 Ga0496105_0013646 Ga0496105_0013646_2750_3445 224
290 3300048909 Ga0496106_0009736 Ga0496106_0009736_3412_4107 224
291 3300048910 Ga0496107_0003302 Ga0496107_0003302_2750_3445 224
292 3300048911 Ga0496108_0027381 Ga0496108_0027381_3170_3865 224
293 3300048912 Ga0496109_0004082 Ga0496109_0004082_3006_3701 224
294 3300048915 Ga0496112_0000036 Ga0496112_0000036_22776_23471 224
295 3300048915 Ga0496112_0026108 Ga0496112_0026108_3006_3701 224
296 3300048916 Ga0496113_0027023 Ga0496113_0027023_586_1281 224
297 3300048916 Ga0496113_0607136 Ga0496113_0607136_26_721 224
298 3300048917 Ga0496114_0045844 Ga0496114_0045844_2899_3594 224
299 3300048918 Ga0496115_0002238 Ga0496115_0002238_9158_9853 224
300 3300048922 Ga0496119_0193775 Ga0496119_0193775_87_794 224
301 3300048929 Ga0496126_0452623 Ga0496126_0452623_153_848 224
302 3300050492 nmdc:mga0yw44_397337_c1 nmdc:mga0yw44_397337_c1_50_751 224
303 3300050492 nmdc:mga0yw44_543633_c1 nmdc:mga0yw44_543633_c1_47_742 224
304 3300050492 nmdc:mga0yw44_88550_c1 nmdc:mga0yw44_88550_c1_763_1458 224
305 3300050493 nmdc:mga0k408_83414_c1 nmdc:mga0k408_83414_c1_331_1026 224
306 3300050495 nmdc:mga04h51_195069_c1 nmdc:mga04h51_195069_c1_60_755 224
307 3300050496 nmdc:mga07m45_24799_c1 nmdc:mga07m45_24799_c1_1175_1870 224
308 3300053085 Ga0495619_0104644 Ga0495619_0104644_1147_1830 224
309 3300053096 Ga0500641_0005264 Ga0500641_0005264_524_1219 224
310 3300053096 Ga0500641_0045876 Ga0500641_0045876_913_1614 224
311 3300053102 Ga0500554_057533 Ga0500554_057533_67_762 224
312 3300053105 Ga0500557_000062 Ga0500557_000062_6010_6717 224
313 3300053119 Ga0500595_000181 Ga0500595_000181_7510_8205 224
314 3300053150 Ga0500603_011044 Ga0500603_011044_483_1178 224
315 3300053150 Ga0500603_013809 Ga0500603_013809_489_1184 224
316 3300053162 Ga0500638_020349 Ga0500638_020349_226_921 224
317 3300053162 Ga0500638_142257 Ga0500638_142257_60_755 224
318 3300053177 Ga0500636_0072868 Ga0500636_0072868_1177_1872 224
319 3300053178 Ga0500637_0001313 Ga0500637_0001313_1950_2645 224
320 3300053178 Ga0500637_0007702 Ga0500637_0007702_3422_4117 224
321 3300053729 Ga0500625_005743 Ga0500625_005743_3211_3918 224
322 3300055283 Ga0500661_000463 Ga0500661_000463_1687_2382 224
323 iso_pu_bacteria 2508501128 2509152269 224
324 iso_pu_bacteria 2513237141 2513892533 224
325 3300003215 JGI25153J46596_10039897 JGI25153J46596_100398971 225
326 3300003354 JGI25160J50197_1005535 JGI25160J50197_10055352 225
327 3300005355 Ga0070671_100191982 Ga0070671_1001919822 225
328 3300005456 Ga0070678_100457902 Ga0070678_1004579021 225
329 3300005841 Ga0068863_100832382 Ga0068863_1008323821 225
330 3300006173 Ga0070716_100137205 Ga0070716_1001372052 225
331 3300006195 Ga0075366_10302222 Ga0075366_103022222 225
332 3300006237 Ga0097621_100151163 Ga0097621_1001511632 225
333 3300006358 Ga0068871_100232424 Ga0068871_1002324242 225
334 3300007265 Ga0099794_10024766 Ga0099794_100247662 225
335 3300009177 Ga0105248_10026062 Ga0105248_100260624 225
336 3300009551 Ga0105238_10076894 Ga0105238_100768943 225
337 3300010375 Ga0105239_10235261 Ga0105239_102352614 225
338 3300025254 Ga0209148_1008698 Ga0209148_10086981 225
339 3300025272 Ga0209455_1004461 Ga0209455_10044614 225
340 3300025297 Ga0209758_1010292 Ga0209758_10102926 225
341 3300025297 Ga0209758_1018402 Ga0209758_10184025 225
342 3300025297 Ga0209758_1022083 Ga0209758_10220833 225
343 3300025302 Ga0207426_1004317 Ga0207426_10043173 225
344 3300025898 Ga0207692_10000790 Ga0207692_100007908 225
345 3300025931 Ga0207644_10240604 Ga0207644_102406042 225
346 3300025939 Ga0207665_10101547 Ga0207665_101015474 225
347 3300025941 Ga0207711_10476850 Ga0207711_104768501 225
348 3300026078 Ga0207702_10299862 Ga0207702_102998622 225
349 3300028556 Ga0265337_1002404 Ga0265337_10024047 225
350 3300028573 Ga0265334_10012351 Ga0265334_100123514 225
351 3300028653 Ga0265323_10000276 Ga0265323_1000027619 225
352 3300028666 Ga0265336_10000268 Ga0265336_1000026817 225
353 3300028800 Ga0265338_10000280 Ga0265338_1000028070 225
354 3300029957 Ga0265324_10003108 Ga0265324_100031085 225
355 3300031247 Ga0265340_10219543 Ga0265340_102195431 225
356 3300031824 Ga0307413_10006217 Ga0307413_100062174 225
357 3300031995 Ga0307409_100163143 Ga0307409_1001631432 225
358 3300032005 Ga0307411_10113700 Ga0307411_101137003 225
359 3300034957 Ga0373938_0008929 Ga0373938_0008929_1040_1726 225
360 3300035691 Ga0373931_0246647 Ga0373931_0246647_210_896 225
361 3300035695 Ga0373927_0032437 Ga0373927_0032437_2449_3135 225
362 3300037466 Ga0395898_0040336 Ga0395898_0040336_2150_2842 225
363 3300038443 Ga0395901_0399117 Ga0395901_0399117_374_1066 225
364 3300039437 Ga0436365_0100896 Ga0436365_0100896_39_734 225
365 3300042438 Ga0439459_0052452 Ga0439459_0052452_189_872 225
366 3300044683 Ga0466965_0228744 Ga0466965_0228744_280_972 225
367 3300044842 Ga0466957_0056414 Ga0466957_0056414_888_1577 225
368 3300046477 Ga0495664_0367982 Ga0495664_0367982_49_735 225
369 3300046674 Ga0495588_0035133 Ga0495588_0035133_1210_1893 225
370 3300046679 Ga0495623_0262244 Ga0495623_0262244_11_718 225
371 3300047321 Ga0495676_0099181 Ga0495676_0099181_1414_2121 225
372 3300048904 Ga0496101_0059874 Ga0496101_0059874_1423_2109 225
373 3300048906 Ga0496103_0286132 Ga0496103_0286132_213_899 225
374 3300048907 Ga0496104_0008613 Ga0496104_0008613_7187_7873 225
375 3300048908 Ga0496105_0009843 Ga0496105_0009843_1570_2256 225
376 3300048912 Ga0496109_0019860 Ga0496109_0019860_4002_4688 225
377 3300048913 Ga0496110_0062958 Ga0496110_0062958_2296_2982 225
378 3300048915 Ga0496112_0044309 Ga0496112_0044309_755_1441 225
379 3300048916 Ga0496113_0042869 Ga0496113_0042869_872_1558 225
380 3300048917 Ga0496114_0070785 Ga0496114_0070785_1685_2371 225
381 3300048918 Ga0496115_0069124 Ga0496115_0069124_49_735 225
382 3300048924 Ga0496121_0061911 Ga0496121_0061911_708_1403 225
383 3300048927 Ga0496124_0029357 Ga0496124_0029357_3993_4739 225
384 3300048928 Ga0496125_0081801 Ga0496125_0081801_1398_2144 225
385 3300048929 Ga0496126_0014942 Ga0496126_0014942_564_1265 225
386 3300050516 nmdc:mga0sz30_173081_c1 nmdc:mga0sz30_173081_c1_41_724 225
387 3300050516 nmdc:mga0sz30_19694_c1 nmdc:mga0sz30_19694_c1_847_1575 225
388 3300053080 Ga0500635_0002038 Ga0500635_0002038_4238_4930 225
389 3300053087 Ga0500643_000373 Ga0500643_000373_18627_19334 225
390 3300053092 Ga0500583_0016219 Ga0500583_0016219_192_899 225
391 3300053094 Ga0500566_0000011 Ga0500566_0000011_112002_112694 225
392 3300053095 Ga0500640_000891 Ga0500640_000891_2125_2817 225
393 3300053096 Ga0500641_0034882 Ga0500641_0034882_944_1651 225
394 3300053098 Ga0500650_0127604 Ga0500650_0127604_316_1023 225
395 3300053103 Ga0500555_005869 Ga0500555_005869_2084_2791 225
396 3300053111 Ga0500572_000563 Ga0500572_000563_9278_9970 225
397 3300053113 Ga0500580_073784 Ga0500580_073784_304_996 225
398 3300053115 Ga0500591_071643 Ga0500591_071643_69_761 225
399 3300053118 Ga0500594_0068565 Ga0500594_0068565_74_781 225
400 3300053123 Ga0500614_003680 Ga0500614_003680_1215_1907 225
401 3300053139 Ga0500568_0029054 Ga0500568_0029054_1193_1900 225
402 3300053150 Ga0500603_010619 Ga0500603_010619_303_995 225
403 3300053151 Ga0500604_0044559 Ga0500604_0044559_265_972 225
404 3300053158 Ga0500627_0046267 Ga0500627_0046267_1134_1841 225
405 3300053159 Ga0500630_000927 Ga0500630_000927_5664_6356 225
406 3300053162 Ga0500638_002499 Ga0500638_002499_1982_2674 225
407 3300053163 Ga0500639_001719 Ga0500639_001719_8712_9404 225
408 3300053177 Ga0500636_0047584 Ga0500636_0047584_1634_2320 225
409 3300053178 Ga0500637_0291157 Ga0500637_0291157_82_774 225
410 3300053735 Ga0500596_000148 Ga0500596_000148_710_1402 225
411 3300053737 Ga0500601_002160 Ga0500601_002160_1215_1907 225
412 3300055283 Ga0500661_006762 Ga0500661_006762_962_1669 225
413 iso_pu_bacteria 2879099564 2879107895 225
414 iso_pu_bacteria 2922361189 2922366280 225
415 iso_pu_bacteria 2932809354 2932810194 225
416 iso_pu_bacteria 2932818245 2932821767 225
417 iso_pu_bacteria 2935760218 2935760754 225
418 iso_pu_bacteria 2935810662 2935814884 225
419 iso_pu_bacteria 2936037263 2936040473 225
420 iso_pu_bacteria 8006984368 8006985595 225
421 3300005327 Ga0070658_10759682 Ga0070658_107596821 226
422 3300005339 Ga0070660_100280599 Ga0070660_1002805992 226
423 3300005347 Ga0070668_100029750 Ga0070668_1000297504 226
424 3300005367 Ga0070667_100619249 Ga0070667_1006192491 226
425 3300005434 Ga0070709_10002525 Ga0070709_100025254 226
426 3300005434 Ga0070709_10185738 Ga0070709_101857381 226
427 3300005436 Ga0070713_100020912 Ga0070713_1000209124 226
428 3300005436 Ga0070713_100027548 Ga0070713_1000275485 226
429 3300005436 Ga0070713_101060488 Ga0070713_1010604881 226
430 3300005437 Ga0070710_10001024 Ga0070710_1000102411 226
431 3300005439 Ga0070711_100009683 Ga0070711_1000096834 226
432 3300005439 Ga0070711_100018449 Ga0070711_1000184493 226
433 3300005439 Ga0070711_100445136 Ga0070711_1004451361 226
434 3300005457 Ga0070662_100275940 Ga0070662_1002759403 226
435 3300005459 Ga0068867_100040366 Ga0068867_1000403661 226
436 3300005471 Ga0070698_100010278 Ga0070698_1000102785 226
437 3300005536 Ga0070697_100080748 Ga0070697_1000807484 226
438 3300005548 Ga0070665_100228640 Ga0070665_1002286403 226
439 3300005617 Ga0068859_100051874 Ga0068859_1000518745 226
440 3300005617 Ga0068859_100079164 Ga0068859_1000791643 226
441 3300005617 Ga0068859_100806373 Ga0068859_1008063732 226
442 3300005719 Ga0068861_100011495 Ga0068861_1000114955 226
443 3300005842 Ga0068858_100091005 Ga0068858_1000910054 226
444 3300005843 Ga0068860_100000360 Ga0068860_10000036031 226
445 3300005844 Ga0068862_100042542 Ga0068862_1000425424 226
446 3300006028 Ga0070717_10004019 Ga0070717_100040195 226
447 3300006028 Ga0070717_10515197 Ga0070717_105151972 226
448 3300006163 Ga0070715_10057725 Ga0070715_100577251 226
449 3300006175 Ga0070712_100072062 Ga0070712_1000720624 226
450 3300006175 Ga0070712_100101369 Ga0070712_1001013692 226
451 3300006175 Ga0070712_100449471 Ga0070712_1004494712 226
452 3300006178 Ga0075367_10078657 Ga0075367_100786572 226
453 3300006237 Ga0097621_100511638 Ga0097621_1005116381 226
454 3300006931 Ga0097620_100051875 Ga0097620_1000518755 226
455 3300006931 Ga0097620_100079166 Ga0097620_1000791663 226
456 3300006931 Ga0097620_100806340 Ga0097620_1008063401 226
457 3300009094 Ga0111539_10279995 Ga0111539_102799953 226
458 3300009098 Ga0105245_10082045 Ga0105245_100820453 226
459 3300009101 Ga0105247_10023373 Ga0105247_100233734 226
460 3300009176 Ga0105242_10089119 Ga0105242_100891191 226
461 3300009177 Ga0105248_10090673 Ga0105248_100906733 226
462 3300009545 Ga0105237_10006317 Ga0105237_1000631711 226
463 3300009545 Ga0105237_10059054 Ga0105237_100590543 226
464 3300009553 Ga0105249_10129091 Ga0105249_101290911 226
465 3300010375 Ga0105239_10101961 Ga0105239_101019612 226
466 3300013306 Ga0163162_10444229 Ga0163162_104442292 226
467 3300013308 Ga0157375_10255052 Ga0157375_102550522 226
468 3300014326 Ga0157380_10191261 Ga0157380_101912612 226
469 3300014968 Ga0157379_10122531 Ga0157379_101225314 226
470 3300014969 Ga0157376_10346721 Ga0157376_103467212 226
471 3300017792 Ga0163161_10653284 Ga0163161_106532841 226
472 3300021358 Ga0213873_10001201 Ga0213873_100012014 226
473 3300021384 Ga0213876_10000880 Ga0213876_100008806 226
474 3300025302 Ga0207426_1003017 Ga0207426_100301711 226
475 3300025899 Ga0207642_10098867 Ga0207642_100988671 226
476 3300025905 Ga0207685_10118488 Ga0207685_101184882 226
477 3300025906 Ga0207699_10101858 Ga0207699_101018581 226
478 3300025910 Ga0207684_10167474 Ga0207684_101674742 226
479 3300025915 Ga0207693_10034331 Ga0207693_100343315 226
480 3300025915 Ga0207693_10094297 Ga0207693_100942971 226
481 3300025916 Ga0207663_10018614 Ga0207663_100186144 226
482 3300025916 Ga0207663_10024383 Ga0207663_100243833 226
483 3300025916 Ga0207663_10390662 Ga0207663_103906622 226
484 3300025927 Ga0207687_10039149 Ga0207687_100391494 226
485 3300025928 Ga0207700_10012013 Ga0207700_100120135 226
486 3300025928 Ga0207700_10170688 Ga0207700_101706882 226
487 3300025928 Ga0207700_10486708 Ga0207700_104867081 226
488 3300025928 Ga0207700_10891748 Ga0207700_108917481 226
489 3300025935 Ga0207709_10105981 Ga0207709_101059813 226
490 3300025939 Ga0207665_10002524 Ga0207665_1000252410 226
491 3300025939 Ga0207665_10046557 Ga0207665_100465574 226
492 3300025940 Ga0207691_10179571 Ga0207691_101795713 226
493 3300025941 Ga0207711_10044329 Ga0207711_100443296 226
494 3300025972 Ga0207668_10003594 Ga0207668_1000359411 226
495 3300025972 Ga0207668_10679568 Ga0207668_106795681 226
496 3300026035 Ga0207703_10447117 Ga0207703_104471172 226
497 3300026035 Ga0207703_11011197 Ga0207703_110111971 226
498 3300026089 Ga0207648_10023917 Ga0207648_100239174 226
499 3300026118 Ga0207675_100013202 Ga0207675_1000132028 226
500 3300026118 Ga0207675_101131000 Ga0207675_1011310001 226
501 3300026121 Ga0207683_10737527 Ga0207683_107375271 226
502 3300028380 Ga0268265_10027618 Ga0268265_100276184 226
503 3300028381 Ga0268264_10000030 Ga0268264_10000030252 226
504 3300030763 Ga0265763_1003008 Ga0265763_10030082 226
505 3300031616 Ga0307508_10000015 Ga0307508_1000001541 226
506 3300031730 Ga0307516_10005336 Ga0307516_100053364 226
507 3300031730 Ga0307516_10018310 Ga0307516_100183108 226
508 3300031730 Ga0307516_10024596 Ga0307516_100245965 226
509 3300031730 Ga0307516_10102338 Ga0307516_101023383 226
510 3300033179 Ga0307507_10047307 Ga0307507_100473073 226
511 3300035083 Ga0373926_0110107 Ga0373926_0110107_247_936 226
512 3300035083 Ga0373926_0125307 Ga0373926_0125307_223_912 226
513 3300035111 Ga0373923_0182118 Ga0373923_0182118_34_723 226
514 3300035112 Ga0373932_0058953 Ga0373932_0058953_157_846 226
515 3300035113 Ga0373936_0002506 Ga0373936_0002506_38_727 226
516 3300035113 Ga0373936_0089117 Ga0373936_0089117_269_970 226
517 3300035116 Ga0373945_0086052 Ga0373945_0086052_216_908 226
518 3300035170 Ga0373943_0008846 Ga0373943_0008846_962_1651 226
519 3300035171 Ga0373946_0001786 Ga0373946_0001786_1925_2614 226
520 3300035171 Ga0373946_0024266 Ga0373946_0024266_94_786 226
521 3300035172 Ga0373955_0150337 Ga0373955_0150337_402_1091 226
522 3300035172 Ga0373955_0271840 Ga0373955_0271840_249_938 226
523 3300035410 Ga0373924_0030132 Ga0373924_0030132_1135_1824 226
524 3300035691 Ga0373931_0028275 Ga0373931_0028275_329_1018 226
525 3300035691 Ga0373931_0361629 Ga0373931_0361629_141_830 226
526 3300035692 Ga0373935_0000803 Ga0373935_0000803_3678_4367 226
527 3300035692 Ga0373935_0012593 Ga0373935_0012593_558_1247 226
528 3300035695 Ga0373927_0001990 Ga0373927_0001990_1950_2639 226
529 3300035695 Ga0373927_0021017 Ga0373927_0021017_3222_3908 226
530 3300035695 Ga0373927_0051578 Ga0373927_0051578_418_1107 226
531 3300035695 Ga0373927_0236123 Ga0373927_0236123_304_993 226
532 3300035725 Ga0373947_0000647 Ga0373947_0000647_13542_14231 226
533 3300035725 Ga0373947_0166529 Ga0373947_0166529_71_757 226
534 3300036242 Ga0310104_05893 Ga0310104_05893_13_702 226
535 3300036459 Ga0372808_010828 Ga0372808_010828_432_1121 226
536 3300037068 Ga0373925_0001112 Ga0373925_0001112_19951_20640 226
537 3300037068 Ga0373925_0007023 Ga0373925_0007023_6350_7039 226
538 3300037068 Ga0373925_0141227 Ga0373925_0141227_145_834 226
539 3300037068 Ga0373925_0148316 Ga0373925_0148316_854_1540 226
540 3300037068 Ga0373925_0286347 Ga0373925_0286347_303_995 226
541 3300039437 Ga0436365_1236739 Ga0436365_1236739_5446_6141 226
542 3300039453 Ga0436362_0970189 Ga0436362_0970189_1362_2057 226
543 3300041503 Ga0451847_0671333 Ga0451847_0671333_84_836 226
544 3300041512 Ga0451853_3581848 Ga0451853_3581848_446_1195 226
545 3300046454 Ga0495592_0019732 Ga0495592_0019732_3513_4202 226
546 3300046455 Ga0495603_0002274 Ga0495603_0002274_6424_7113 226
547 3300046455 Ga0495603_0063119 Ga0495603_0063119_1380_2066 226
548 3300046455 Ga0495603_0192505 Ga0495603_0192505_341_1033 226
549 3300046459 Ga0495629_0000585 Ga0495629_0000585_12794_13483 226
550 3300046461 Ga0495641_0007833 Ga0495641_0007833_329_1018 226
551 3300046462 Ga0495651_0380230 Ga0495651_0380230_54_743 226
552 3300046463 Ga0495653_0143676 Ga0495653_0143676_952_1641 226
553 3300046472 Ga0495580_0000166 Ga0495580_0000166_13096_13785 226
554 3300046472 Ga0495580_0285655 Ga0495580_0285655_131_817 226
555 3300046473 Ga0495582_0002361 Ga0495582_0002361_6573_7262 226
556 3300046475 Ga0495639_0000075 Ga0495639_0000075_39484_40173 226
557 3300046475 Ga0495639_0048742 Ga0495639_0048742_488_1177 226
558 3300046475 Ga0495639_0096815 Ga0495639_0096815_268_954 226
559 3300046475 Ga0495639_0146958 Ga0495639_0146958_347_1033 226
560 3300046476 Ga0495662_0000356 Ga0495662_0000356_7570_8259 226
561 3300046491 Ga0495584_0106574 Ga0495584_0106574_481_1182 226
562 3300046492 Ga0495585_0079894 Ga0495585_0079894_86_775 226
563 3300046499 Ga0495594_0000120 Ga0495594_0000120_32377_33066 226
564 3300046499 Ga0495594_0016464 Ga0495594_0016464_2196_2885 226
565 3300046506 Ga0495583_0084632 Ga0495583_0084632_268_975 226
566 3300046507 Ga0495606_0040781 Ga0495606_0040781_124_831 226
567 3300046514 Ga0495618_0163946 Ga0495618_0163946_555_1244 226
568 3300046517 Ga0495630_0001903 Ga0495630_0001903_5282_5971 226
569 3300046518 Ga0495631_0176444 Ga0495631_0176444_56_745 226
570 3300046523 Ga0495644_0032459 Ga0495644_0032459_717_1406 226
571 3300046524 Ga0495648_0003336 Ga0495648_0003336_3946_4653 226
572 3300046525 Ga0495663_0036772 Ga0495663_0036772_245_934 226
573 3300046526 Ga0495666_0138142 Ga0495666_0138142_179_868 226
574 3300046529 Ga0495652_0019231 Ga0495652_0019231_5273_5962 226
575 3300046531 Ga0495665_0000085 Ga0495665_0000085_12838_13527 226
576 3300046533 Ga0495640_0000210 Ga0495640_0000210_8223_8912 226
577 3300046536 Ga0495587_0172064 Ga0495587_0172064_319_1008 226
578 3300046537 Ga0495598_0005668 Ga0495598_0005668_1984_2673 226
579 3300046557 Ga0495622_0003053 Ga0495622_0003053_6979_7668 226
580 3300046557 Ga0495622_0009952 Ga0495622_0009952_1487_2176 226
581 3300046557 Ga0495622_0032661 Ga0495622_0032661_1145_1834 226
582 3300046559 Ga0495667_0183036 Ga0495667_0183036_235_924 226
583 3300046615 Ga0495656_0009822 Ga0495656_0009822_2105_2794 226
584 3300046642 Ga0495634_0022896 Ga0495634_0022896_825_1514 226
585 3300046642 Ga0495634_0262615 Ga0495634_0262615_65_754 226
586 3300046663 Ga0495635_0003755 Ga0495635_0003755_5591_6280 226
587 3300046664 Ga0495659_0005051 Ga0495659_0005051_239_928 226
588 3300046674 Ga0495588_0001317 Ga0495588_0001317_3935_4624 226
589 3300046674 Ga0495588_0026723 Ga0495588_0026723_1835_2524 226
590 3300046678 Ga0495599_0089347 Ga0495599_0089347_89_778 226
591 3300046681 Ga0495647_0047752 Ga0495647_0047752_204_893 226
592 3300046683 Ga0495658_0000481 Ga0495658_0000481_8640_9329 226
593 3300046683 Ga0495658_0219938 Ga0495658_0219938_235_924 226
594 3300046689 Ga0495613_0002779 Ga0495613_0002779_5685_6374 226
595 3300046690 Ga0495624_0002075 Ga0495624_0002075_1783_2472 226
596 3300046690 Ga0495624_0091821 Ga0495624_0091821_432_1121 226
597 3300046694 Ga0495649_0166110 Ga0495649_0166110_71_778 226
598 3300046809 Ga0495600_0013354 Ga0495600_0013354_116_805 226
599 3300047315 Ga0495581_0000083 Ga0495581_0000083_5668_6357 226
600 3300047315 Ga0495581_0117560 Ga0495581_0117560_809_1498 226
601 3300047315 Ga0495581_0287819 Ga0495581_0287819_68_754 226
602 3300047319 Ga0495674_0164032 Ga0495674_0164032_1110_1799 226
603 3300047321 Ga0495676_0037885 Ga0495676_0037885_3099_3788 226
604 3300047321 Ga0495676_0135213 Ga0495676_0135213_937_1629 226
605 3300047444 Ga0495675_0190080 Ga0495675_0190080_291_1007 226
606 3300047471 Ga0495684_0058333 Ga0495684_0058333_1567_2256 226
607 3300047472 Ga0495686_0105241 Ga0495686_0105241_31_720 226
608 3300047673 Ga0495593_0000003 Ga0495593_0000003_22410_23099 226
609 3300048088 Ga0495602_0113500 Ga0495602_0113500_939_1628 226
610 3300048903 Ga0496100_0148317 Ga0496100_0148317_567_1256 226
611 3300048905 Ga0496102_0372853 Ga0496102_0372853_81_770 226
612 3300048907 Ga0496104_0041517 Ga0496104_0041517_218_907 226
613 3300048907 Ga0496104_0159145 Ga0496104_0159145_517_1206 226
614 3300048908 Ga0496105_0188531 Ga0496105_0188531_307_996 226
615 3300048908 Ga0496105_0392113 Ga0496105_0392113_367_1056 226
616 3300048909 Ga0496106_0000823 Ga0496106_0000823_11469_12158 226
617 3300048910 Ga0496107_0145386 Ga0496107_0145386_800_1489 226
618 3300048911 Ga0496108_0105828 Ga0496108_0105828_1157_1846 226
619 3300048912 Ga0496109_0078684 Ga0496109_0078684_420_1109 226
620 3300048913 Ga0496110_0200613 Ga0496110_0200613_420_1109 226
621 3300048914 Ga0496111_0071536 Ga0496111_0071536_161_850 226
622 3300048914 Ga0496111_0407105 Ga0496111_0407105_251_940 226
623 3300048915 Ga0496112_0017242 Ga0496112_0017242_2707_3402 226
624 3300048915 Ga0496112_0114497 Ga0496112_0114497_634_1323 226
625 3300048916 Ga0496113_0110683 Ga0496113_0110683_244_933 226
626 3300048917 Ga0496114_0126328 Ga0496114_0126328_983_1672 226
627 3300048918 Ga0496115_0168792 Ga0496115_0168792_488_1174 226
628 3300048918 Ga0496115_0423297 Ga0496115_0423297_65_754 226
629 3300048920 Ga0496117_0012131 Ga0496117_0012131_1797_2486 226
630 3300048921 Ga0496118_0003610 Ga0496118_0003610_9862_10551 226
631 3300048921 Ga0496118_0115373 Ga0496118_0115373_1035_1724 226
632 3300048922 Ga0496119_0098551 Ga0496119_0098551_64_753 226
633 3300048924 Ga0496121_0000041 Ga0496121_0000041_7692_8381 226
634 3300048924 Ga0496121_0000225 Ga0496121_0000225_1984_2673 226
635 3300048924 Ga0496121_0002396 Ga0496121_0002396_6164_6853 226
636 3300048924 Ga0496121_0186166 Ga0496121_0186166_398_1087 226
637 3300048927 Ga0496124_0012074 Ga0496124_0012074_2378_3067 226
638 3300048928 Ga0496125_0018399 Ga0496125_0018399_3874_4563 226
639 3300048929 Ga0496126_0005875 Ga0496126_0005875_5927_6616 226
640 3300048929 Ga0496126_0049902 Ga0496126_0049902_2732_3421 226
641 3300048929 Ga0496126_0135931 Ga0496126_0135931_1065_1754 226
642 3300049460 Ga0495682_0072640 Ga0495682_0072640_12_701 226
643 3300049572 Ga0501036_0229454 Ga0501036_0229454_628_1317 226
644 3300049583 Ga0501067_0184227 Ga0501067_0184227_119_820 226
645 3300050494 nmdc:mga06z11_81958_c1 nmdc:mga06z11_81958_c1_659_1348 226
646 3300050512 nmdc:mga0n895_488727_c1 nmdc:mga0n895_488727_c1_48_737 226
647 3300050513 nmdc:mga0rr50_457685_c1 nmdc:mga0rr50_457685_c1_312_1001 226
648 3300053077 Ga0495601_0096803 Ga0495601_0096803_442_1131 226
649 3300053078 Ga0495612_0087425 Ga0495612_0087425_41_730 226
650 3300053080 Ga0500635_0010446 Ga0500635_0010446_237_926 226
651 3300053084 Ga0495595_0151172 Ga0495595_0151172_11_703 226
652 3300053084 Ga0495595_0296178 Ga0495595_0296178_12_701 226
653 3300053093 Ga0500651_0159844 Ga0500651_0159844_46_735 226
654 3300053097 Ga0500648_227075 Ga0500648_227075_179_868 226
655 3300053111 Ga0500572_000437 Ga0500572_000437_5674_6375 226
656 3300053119 Ga0500595_000343 Ga0500595_000343_20505_21194 226
657 3300053119 Ga0500595_000799 Ga0500595_000799_11260_11949 226
658 3300053136 Ga0500559_0001384 Ga0500559_0001384_7348_8049 226
659 3300053136 Ga0500559_0004964 Ga0500559_0004964_2578_3267 226
660 3300053140 Ga0500573_0005486 Ga0500573_0005486_115_804 226
661 3300053150 Ga0500603_025504 Ga0500603_025504_176_865 226
662 3300053163 Ga0500639_018557 Ga0500639_018557_439_1140 226
663 3300053177 Ga0500636_0170448 Ga0500636_0170448_67_756 226
664 3300053733 Ga0500552_040614 Ga0500552_040614_40_729 226
665 3300053735 Ga0500596_001020 Ga0500596_001020_4819_5508 226
666 3300053735 Ga0500596_003660 Ga0500596_003660_1863_2564 226
667 iso_pu_bacteria 2881665667 2881667002 226
668 3300003322 rootL2_10276112 rootL2_102761123 227
669 3300003659 JGI25404J52841_10002046 JGI25404J52841_100020464 227
670 3300003659 JGI25404J52841_10008625 JGI25404J52841_100086252 227
671 3300003659 JGI25404J52841_10010725 JGI25404J52841_100107253 227
672 3300005289 Ga0065704_10016712 Ga0065704_100167122 227
673 3300005328 Ga0070676_10163900 Ga0070676_101639003 227
674 3300005330 Ga0070690_100170840 Ga0070690_1001708402 227
675 3300005334 Ga0068869_100183941 Ga0068869_1001839412 227
676 3300005337 Ga0070682_100563442 Ga0070682_1005634421 227
677 3300005340 Ga0070689_100199048 Ga0070689_1001990482 227
678 3300005347 Ga0070668_100071526 Ga0070668_1000715263 227
679 3300005347 Ga0070668_100322200 Ga0070668_1003222001 227
680 3300005347 Ga0070668_100465296 Ga0070668_1004652962 227
681 3300005353 Ga0070669_100051698 Ga0070669_1000516983 227
682 3300005353 Ga0070669_100262863 Ga0070669_1002628633 227
683 3300005354 Ga0070675_100143451 Ga0070675_1001434512 227
684 3300005354 Ga0070675_100716780 Ga0070675_1007167801 227
685 3300005355 Ga0070671_100178580 Ga0070671_1001785801 227
686 3300005366 Ga0070659_100320582 Ga0070659_1003205822 227
687 3300005367 Ga0070667_100137772 Ga0070667_1001377723 227
688 3300005367 Ga0070667_100582975 Ga0070667_1005829752 227
689 3300005434 Ga0070709_10001978 Ga0070709_100019787 227
690 3300005435 Ga0070714_100001459 Ga0070714_10000145912 227
691 3300005436 Ga0070713_100017039 Ga0070713_1000170392 227
692 3300005436 Ga0070713_100115555 Ga0070713_1001155551 227
693 3300005437 Ga0070710_10000316 Ga0070710_1000031617 227
694 3300005438 Ga0070701_10013117 Ga0070701_100131174 227
695 3300005439 Ga0070711_100000617 Ga0070711_1000006177 227
696 3300005439 Ga0070711_100535735 Ga0070711_1005357351 227
697 3300005441 Ga0070700_100188768 Ga0070700_1001887682 227
698 3300005441 Ga0070700_100599842 Ga0070700_1005998421 227
699 3300005445 Ga0070708_100294553 Ga0070708_1002945532 227
700 3300005455 Ga0070663_100007753 Ga0070663_1000077536 227
701 3300005455 Ga0070663_100014812 Ga0070663_1000148124 227
702 3300005455 Ga0070663_100293301 Ga0070663_1002933012 227
703 3300005456 Ga0070678_100662807 Ga0070678_1006628071 227
704 3300005457 Ga0070662_100171985 Ga0070662_1001719852 227
705 3300005468 Ga0070707_100639019 Ga0070707_1006390192 227
706 3300005471 Ga0070698_100220007 Ga0070698_1002200073 227
707 3300005518 Ga0070699_100189658 Ga0070699_1001896581 227
708 3300005543 Ga0070672_100184840 Ga0070672_1001848403 227
709 3300005545 Ga0070695_100060185 Ga0070695_1000601854 227
710 3300005548 Ga0070665_100032680 Ga0070665_1000326806 227
711 3300005548 Ga0070665_100061161 Ga0070665_1000611611 227
712 3300005548 Ga0070665_100218358 Ga0070665_1002183582 227
713 3300005564 Ga0070664_100468042 Ga0070664_1004680423 227
714 3300005577 Ga0068857_100761507 Ga0068857_1007615072 227
715 3300005614 Ga0068856_100144639 Ga0068856_1001446393 227
716 3300005615 Ga0070702_100021410 Ga0070702_1000214102 227
717 3300005617 Ga0068859_100022345 Ga0068859_1000223453 227
718 3300005617 Ga0068859_100022663 Ga0068859_1000226632 227
719 3300005718 Ga0068866_10040264 Ga0068866_100402642 227
720 3300005719 Ga0068861_100079787 Ga0068861_1000797872 227
721 3300005719 Ga0068861_100559370 Ga0068861_1005593702 227
722 3300005719 Ga0068861_100618353 Ga0068861_1006183531 227
723 3300005840 Ga0068870_10055148 Ga0068870_100551482 227
724 3300005840 Ga0068870_10277536 Ga0068870_102775362 227
725 3300005841 Ga0068863_100452352 Ga0068863_1004523522 227
726 3300005843 Ga0068860_100456806 Ga0068860_1004568062 227
727 3300005937 Ga0081455_10009563 Ga0081455_100095639 227
728 3300005937 Ga0081455_10046046 Ga0081455_100460464 227
729 3300005937 Ga0081455_10241042 Ga0081455_102410422 227
730 3300005981 Ga0081538_10071617 Ga0081538_100716172 227
731 3300005983 Ga0081540_1000585 Ga0081540_10005858 227
732 3300005983 Ga0081540_1000629 Ga0081540_100062920 227
733 3300005983 Ga0081540_1004181 Ga0081540_100418112 227
734 3300005983 Ga0081540_1004785 Ga0081540_10047855 227
735 3300005983 Ga0081540_1007022 Ga0081540_10070222 227
736 3300005983 Ga0081540_1015840 Ga0081540_10158403 227
737 3300005983 Ga0081540_1044598 Ga0081540_10445982 227
738 3300006028 Ga0070717_10019302 Ga0070717_100193024 227
739 3300006038 Ga0075365_10013729 Ga0075365_100137295 227
740 3300006038 Ga0075365_10095876 Ga0075365_100958762 227
741 3300006038 Ga0075365_10138146 Ga0075365_101381464 227
742 3300006042 Ga0075368_10080404 Ga0075368_100804042 227
743 3300006048 Ga0075363_100032501 Ga0075363_1000325014 227
744 3300006048 Ga0075363_100159775 Ga0075363_1001597752 227
745 3300006051 Ga0075364_10049387 Ga0075364_100493873 227
746 3300006163 Ga0070715_10000563 Ga0070715_100005634 227
747 3300006173 Ga0070716_100003783 Ga0070716_1000037834 227
748 3300006175 Ga0070712_100001723 Ga0070712_1000017235 227
749 3300006175 Ga0070712_100064359 Ga0070712_1000643594 227
750 3300006177 Ga0075362_10076290 Ga0075362_100762902 227
751 3300006177 Ga0075362_10219354 Ga0075362_102193542 227
752 3300006186 Ga0075369_10030412 Ga0075369_100304124 227
753 3300006237 Ga0097621_100109570 Ga0097621_1001095704 227
754 3300006237 Ga0097621_100261013 Ga0097621_1002610132 227
755 3300006237 Ga0097621_100448750 Ga0097621_1004487502 227
756 3300006353 Ga0075370_10016919 Ga0075370_100169194 227
757 3300006358 Ga0068871_100326793 Ga0068871_1003267931 227
758 3300006358 Ga0068871_100807853 Ga0068871_1008078532 227
759 3300006844 Ga0075428_100065933 Ga0075428_1000659334 227
760 3300006871 Ga0075434_100094092 Ga0075434_1000940923 227
761 3300006881 Ga0068865_100220213 Ga0068865_1002202132 227
762 3300006931 Ga0097620_100022345 Ga0097620_1000223453 227
763 3300006931 Ga0097620_100022663 Ga0097620_1000226638 227
764 3300007076 Ga0075435_100236741 Ga0075435_1002367412 227
765 3300007265 Ga0099794_10034930 Ga0099794_100349303 227
766 3300007788 Ga0099795_10111393 Ga0099795_101113932 227
767 3300009092 Ga0105250_10033561 Ga0105250_100335613 227
768 3300009093 Ga0105240_10210792 Ga0105240_102107923 227
769 3300009093 Ga0105240_11069458 Ga0105240_110694581 227
770 3300009094 Ga0111539_10319964 Ga0111539_103199643 227
771 3300009098 Ga0105245_10044536 Ga0105245_100445361 227
772 3300009147 Ga0114129_10045050 Ga0114129_100450505 227
773 3300009147 Ga0114129_11856830 Ga0114129_118568301 227
774 3300009148 Ga0105243_10020983 Ga0105243_100209835 227
775 3300009148 Ga0105243_10076810 Ga0105243_100768103 227
776 3300009148 Ga0105243_10567541 Ga0105243_105675411 227
777 3300009174 Ga0105241_10010573 Ga0105241_100105732 227
778 3300009176 Ga0105242_10057194 Ga0105242_100571943 227
779 3300009176 Ga0105242_10984324 Ga0105242_109843241 227
780 3300009551 Ga0105238_10275422 Ga0105238_102754223 227
781 3300009553 Ga0105249_10144812 Ga0105249_101448122 227
782 3300009553 Ga0105249_10258619 Ga0105249_102586193 227
783 3300009553 Ga0105249_10764859 Ga0105249_107648592 227
784 3300011119 Ga0105246_10301879 Ga0105246_103018791 227
785 3300013297 Ga0157378_10036769 Ga0157378_100367696 227
786 3300013308 Ga0157375_10452476 Ga0157375_104524762 227
787 3300013308 Ga0157375_10779039 Ga0157375_107790391 227
788 3300014325 Ga0163163_10095731 Ga0163163_100957312 227
789 3300014325 Ga0163163_10677597 Ga0163163_106775971 227
790 3300014326 Ga0157380_10384866 Ga0157380_103848662 227
791 3300014968 Ga0157379_10545095 Ga0157379_105450952 227
792 3300017792 Ga0163161_10106416 Ga0163161_101064163 227
793 3300021320 Ga0214544_1000001 Ga0214544_1000001571 227
794 3300021321 Ga0214542_1000606 Ga0214542_100060619 227
795 3300021324 Ga0214545_1000003 Ga0214545_1000003190 227
796 3300021327 Ga0214543_1000002 Ga0214543_1000002575 227
797 3300025297 Ga0209758_1053333 Ga0209758_10533331 227
798 3300025315 Ga0207697_10083591 Ga0207697_100835912 227
799 3300025885 Ga0207653_10080280 Ga0207653_100802802 227
800 3300025898 Ga0207692_10001383 Ga0207692_100013834 227
801 3300025899 Ga0207642_10025888 Ga0207642_100258884 227
802 3300025900 Ga0207710_10212420 Ga0207710_102124202 227
803 3300025901 Ga0207688_10005552 Ga0207688_1000555210 227
804 3300025901 Ga0207688_10110563 Ga0207688_101105632 227
805 3300025901 Ga0207688_10496014 Ga0207688_104960141 227
806 3300025903 Ga0207680_10319535 Ga0207680_103195352 227
807 3300025905 Ga0207685_10013251 Ga0207685_100132512 227
808 3300025906 Ga0207699_10018415 Ga0207699_100184155 227
809 3300025906 Ga0207699_10038002 Ga0207699_100380024 227
810 3300025907 Ga0207645_10079819 Ga0207645_100798193 227
811 3300025907 Ga0207645_10162395 Ga0207645_101623953 227
812 3300025908 Ga0207643_10057555 Ga0207643_100575552 227
813 3300025914 Ga0207671_10178443 Ga0207671_101784432 227
814 3300025915 Ga0207693_10000259 Ga0207693_1000025918 227
815 3300025915 Ga0207693_10080664 Ga0207693_100806641 227
816 3300025916 Ga0207663_10001316 Ga0207663_100013164 227
817 3300025916 Ga0207663_10109442 Ga0207663_101094423 227
818 3300025924 Ga0207694_10581223 Ga0207694_105812231 227
819 3300025924 Ga0207694_10784059 Ga0207694_107840591 227
820 3300025926 Ga0207659_10878950 Ga0207659_108789501 227
821 3300025927 Ga0207687_10217950 Ga0207687_102179502 227
822 3300025928 Ga0207700_10010667 Ga0207700_100106674 227
823 3300025928 Ga0207700_10120282 Ga0207700_101202823 227
824 3300025929 Ga0207664_10008672 Ga0207664_100086725 227
825 3300025931 Ga0207644_10228671 Ga0207644_102286712 227
826 3300025931 Ga0207644_10679375 Ga0207644_106793751 227
827 3300025932 Ga0207690_10284874 Ga0207690_102848742 227
828 3300025933 Ga0207706_10188478 Ga0207706_101884781 227
829 3300025935 Ga0207709_10050566 Ga0207709_100505664 227
830 3300025936 Ga0207670_10138034 Ga0207670_101380343 227
831 3300025938 Ga0207704_10143723 Ga0207704_101437233 227
832 3300025939 Ga0207665_10000974 Ga0207665_1000097414 227
833 3300025940 Ga0207691_10025071 Ga0207691_100250718 227
834 3300025940 Ga0207691_10136529 Ga0207691_101365293 227
835 3300025942 Ga0207689_10007828 Ga0207689_100078286 227
836 3300025942 Ga0207689_10199445 Ga0207689_101994452 227
837 3300025945 Ga0207679_10283829 Ga0207679_102838293 227
838 3300025960 Ga0207651_10095089 Ga0207651_100950892 227
839 3300025960 Ga0207651_10652301 Ga0207651_106523012 227
840 3300025961 Ga0207712_10029555 Ga0207712_100295553 227
841 3300025961 Ga0207712_10127903 Ga0207712_101279033 227
842 3300025972 Ga0207668_10124817 Ga0207668_101248173 227
843 3300025981 Ga0207640_10159619 Ga0207640_101596192 227
844 3300025986 Ga0207658_10148644 Ga0207658_101486444 227
845 3300026035 Ga0207703_10565312 Ga0207703_105653122 227
846 3300026035 Ga0207703_10577006 Ga0207703_105770061 227
847 3300026067 Ga0207678_10010880 Ga0207678_100108803 227
848 3300026067 Ga0207678_10013604 Ga0207678_100136046 227
849 3300026067 Ga0207678_10019226 Ga0207678_100192266 227
850 3300026067 Ga0207678_10033429 Ga0207678_100334293 227
851 3300026067 Ga0207678_10364503 Ga0207678_103645031 227
852 3300026075 Ga0207708_10084208 Ga0207708_100842083 227
853 3300026075 Ga0207708_10140832 Ga0207708_101408322 227
854 3300026089 Ga0207648_10218683 Ga0207648_102186833 227
855 3300026095 Ga0207676_10551609 Ga0207676_105516091 227
856 3300026118 Ga0207675_100024684 Ga0207675_1000246843 227
857 3300026118 Ga0207675_100326577 Ga0207675_1003265771 227
858 3300026118 Ga0207675_100383865 Ga0207675_1003838652 227
859 3300026121 Ga0207683_10074586 Ga0207683_100745864 227
860 3300026121 Ga0207683_10257376 Ga0207683_102573763 227
861 3300026121 Ga0207683_10297532 Ga0207683_102975323 227
862 3300026121 Ga0207683_10378775 Ga0207683_103787751 227
863 3300026121 Ga0207683_10435442 Ga0207683_104354422 227
864 3300026142 Ga0207698_10115985 Ga0207698_101159851 227
865 3300027512 Ga0209179_1058156 Ga0209179_10581562 227
866 3300027671 Ga0209588_1001815 Ga0209588_10018153 227
867 3300027907 Ga0207428_10169993 Ga0207428_101699933 227
868 3300028379 Ga0268266_10000857 Ga0268266_100008573 227
869 3300028379 Ga0268266_10007117 Ga0268266_1000711712 227
870 3300028379 Ga0268266_10378623 Ga0268266_103786232 227
871 3300028380 Ga0268265_10215720 Ga0268265_102157202 227
872 3300028380 Ga0268265_10223949 Ga0268265_102239491 227
873 3300028380 Ga0268265_10355229 Ga0268265_103552292 227
874 3300028381 Ga0268264_10171755 Ga0268264_101717553 227
875 3300028573 Ga0265334_10008556 Ga0265334_100085562 227
876 3300028573 Ga0265334_10009569 Ga0265334_100095692 227
877 3300028786 Ga0307517_10208587 Ga0307517_102085872 227
878 3300031235 Ga0265330_10020175 Ga0265330_100201752 227
879 3300031238 Ga0265332_10071251 Ga0265332_100712512 227
880 3300031238 Ga0265332_10082669 Ga0265332_100826691 227
881 3300031247 Ga0265340_10083545 Ga0265340_100835452 227
882 3300031344 Ga0265316_10513737 Ga0265316_105137371 227
883 3300031616 Ga0307508_10501094 Ga0307508_105010941 227
884 3300031712 Ga0265342_10049653 Ga0265342_100496532 227
885 3300031731 Ga0307405_10418501 Ga0307405_104185011 227
886 3300031852 Ga0307410_10612720 Ga0307410_106127201 227
887 3300032002 Ga0307416_100523804 Ga0307416_1005238042 227
888 3300033180 Ga0307510_10006778 Ga0307510_1000677815 227
889 3300033180 Ga0307510_10162952 Ga0307510_101629522 227
890 3300035086 Ga0373934_0001348 Ga0373934_0001348_1796_2488 227
891 3300035111 Ga0373923_0019072 Ga0373923_0019072_1689_2384 227
892 3300035112 Ga0373932_0039456 Ga0373932_0039456_360_1052 227
893 3300035113 Ga0373936_0032337 Ga0373936_0032337_1135_1830 227
894 3300035117 Ga0373953_0000092 Ga0373953_0000092_2902_3594 227
895 3300035118 Ga0373954_0000223 Ga0373954_0000223_19431_20123 227
896 3300035119 Ga0373956_0002691 Ga0373956_0002691_6475_7167 227
897 3300035120 Ga0373957_0002000 Ga0373957_0002000_2319_3011 227
898 3300035172 Ga0373955_0001089 Ga0373955_0001089_4464_5156 227
899 3300035410 Ga0373924_0001415 Ga0373924_0001415_4728_5420 227
900 3300035691 Ga0373931_0423484 Ga0373931_0423484_119_823 227
901 3300035695 Ga0373927_0021697 Ga0373927_0021697_1859_2554 227
902 3300035724 Ga0373933_0000758 Ga0373933_0000758_3166_3858 227
903 3300036401 Ga0373937_0011287 Ga0373937_0011287_161_853 227
904 3300036401 Ga0373937_0610044 Ga0373937_0610044_201_902 227
905 3300037068 Ga0373925_0330287 Ga0373925_0330287_403_1098 227
906 3300037418 Ga0395900_0001310 Ga0395900_0001310_15125_15823 227
907 3300037466 Ga0395898_0008958 Ga0395898_0008958_955_1653 227
908 3300037471 Ga0395905_0103015 Ga0395905_0103015_18_716 227
909 3300037471 Ga0395905_0565963 Ga0395905_0565963_131_835 227
910 3300038443 Ga0395901_0376709 Ga0395901_0376709_552_1250 227
911 3300044765 Ga0466970_0060878 Ga0466970_0060878_337_1032 227
912 3300046452 Ga0495617_046188 Ga0495617_046188_516_1220 227
913 3300046454 Ga0495592_0000714 Ga0495592_0000714_19448_20140 227
914 3300046455 Ga0495603_0050885 Ga0495603_0050885_1623_2327 227
915 3300046455 Ga0495603_0058358 Ga0495603_0058358_1451_2143 227
916 3300046459 Ga0495629_0000533 Ga0495629_0000533_25231_25923 227
917 3300046462 Ga0495651_0003125 Ga0495651_0003125_12046_12738 227
918 3300046463 Ga0495653_0000404 Ga0495653_0000404_19254_19946 227
919 3300046471 Ga0495650_0027735 Ga0495650_0027735_1644_2348 227
920 3300046472 Ga0495580_0148068 Ga0495580_0148068_391_1086 227
921 3300046474 Ga0495605_0059460 Ga0495605_0059460_882_1586 227
922 3300046475 Ga0495639_0082956 Ga0495639_0082956_346_1038 227
923 3300046477 Ga0495664_0057062 Ga0495664_0057062_1596_2288 227
924 3300046492 Ga0495585_0078928 Ga0495585_0078928_34_738 227
925 3300046499 Ga0495594_0112587 Ga0495594_0112587_764_1468 227
926 3300046499 Ga0495594_0196800 Ga0495594_0196800_225_920 227
927 3300046511 Ga0495608_0000932 Ga0495608_0000932_2175_2867 227
928 3300046514 Ga0495618_0012136 Ga0495618_0012136_114_806 227
929 3300046515 Ga0495620_0076224 Ga0495620_0076224_626_1330 227
930 3300046516 Ga0495628_0031051 Ga0495628_0031051_3012_3704 227
931 3300046524 Ga0495648_0204606 Ga0495648_0204606_173_877 227
932 3300046526 Ga0495666_0170416 Ga0495666_0170416_170_871 227
933 3300046528 Ga0495642_0050354 Ga0495642_0050354_877_1581 227
934 3300046529 Ga0495652_0013257 Ga0495652_0013257_1310_2002 227
935 3300046533 Ga0495640_0007521 Ga0495640_0007521_2196_2888 227
936 3300046536 Ga0495587_0003370 Ga0495587_0003370_6764_7456 227
937 3300046538 Ga0495609_0143707 Ga0495609_0143707_253_948 227
938 3300046542 Ga0495597_0102447 Ga0495597_0102447_221_925 227
939 3300046558 Ga0495633_0086169 Ga0495633_0086169_722_1426 227
940 3300046558 Ga0495633_0093318 Ga0495633_0093318_579_1283 227
941 3300046559 Ga0495667_0002368 Ga0495667_0002368_5424_6116 227
942 3300046615 Ga0495656_0044210 Ga0495656_0044210_307_1011 227
943 3300046615 Ga0495656_0128563 Ga0495656_0128563_126_830 227
944 3300046615 Ga0495656_0270940 Ga0495656_0270940_42_734 227
945 3300046616 Ga0495668_0034791 Ga0495668_0034791_1376_2071 227
946 3300046616 Ga0495668_0158266 Ga0495668_0158266_128_820 227
947 3300046642 Ga0495634_0023484 Ga0495634_0023484_1801_2493 227
948 3300046648 Ga0495611_0040112 Ga0495611_0040112_747_1451 227
949 3300046660 Ga0495625_0059939 Ga0495625_0059939_1408_2112 227
950 3300046663 Ga0495635_0000536 Ga0495635_0000536_2705_3397 227
951 3300046664 Ga0495659_0054850 Ga0495659_0054850_505_1209 227
952 3300046664 Ga0495659_0149900 Ga0495659_0149900_72_776 227
953 3300046674 Ga0495588_0022249 Ga0495588_0022249_1797_2501 227
954 3300046675 Ga0495657_0002815 Ga0495657_0002815_6983_7675 227
955 3300046678 Ga0495599_0001740 Ga0495599_0001740_9702_10394 227
956 3300046679 Ga0495623_0004997 Ga0495623_0004997_6225_6917 227
957 3300046680 Ga0495646_0005634 Ga0495646_0005634_4533_5225 227
958 3300046681 Ga0495647_0240453 Ga0495647_0240453_81_776 227
959 3300046684 Ga0495669_0038689 Ga0495669_0038689_627_1331 227
960 3300046684 Ga0495669_0046434 Ga0495669_0046434_881_1585 227
961 3300046684 Ga0495669_0140829 Ga0495669_0140829_377_1069 227
962 3300046684 Ga0495669_0229813 Ga0495669_0229813_69_773 227
963 3300046689 Ga0495613_0032424 Ga0495613_0032424_2040_2732 227
964 3300046690 Ga0495624_0141767 Ga0495624_0141767_425_1117 227
965 3300046794 Ga0495589_0016006 Ga0495589_0016006_831_1535 227
966 3300046794 Ga0495589_0153835 Ga0495589_0153835_214_918 227
967 3300046809 Ga0495600_0001712 Ga0495600_0001712_4584_5276 227
968 3300047315 Ga0495581_0178954 Ga0495581_0178954_191_895 227
969 3300047315 Ga0495581_0382688 Ga0495581_0382688_47_742 227
970 3300047317 Ga0495604_0003351 Ga0495604_0003351_33_725 227
971 3300047319 Ga0495674_0117011 Ga0495674_0117011_605_1297 227
972 3300047322 Ga0495680_0007831 Ga0495680_0007831_3072_3764 227
973 3300047323 Ga0495683_0046253 Ga0495683_0046253_783_1487 227
974 3300047444 Ga0495675_0004477 Ga0495675_0004477_5989_6681 227
975 3300047469 Ga0495673_0065337 Ga0495673_0065337_783_1478 227
976 3300047470 Ga0495681_0129795 Ga0495681_0129795_119_823 227
977 3300047471 Ga0495684_0000470 Ga0495684_0000470_18971_19663 227
978 3300047673 Ga0495593_0001464 Ga0495593_0001464_10492_11184 227
979 3300047673 Ga0495593_0148975 Ga0495593_0148975_315_1010 227
980 3300048088 Ga0495602_0008321 Ga0495602_0008321_3167_3859 227
981 3300048091 Ga0495626_0024099 Ga0495626_0024099_320_1024 227
982 3300048904 Ga0496101_0082846 Ga0496101_0082846_1522_2226 227
983 3300048904 Ga0496101_0175162 Ga0496101_0175162_329_1033 227
984 3300048905 Ga0496102_0299426 Ga0496102_0299426_734_1438 227
985 3300048905 Ga0496102_0596132 Ga0496102_0596132_121_819 227
986 3300048907 Ga0496104_0520484 Ga0496104_0520484_385_1089 227
987 3300048907 Ga0496104_0568872 Ga0496104_0568872_166_870 227
988 3300048908 Ga0496105_0214171 Ga0496105_0214171_822_1526 227
989 3300048909 Ga0496106_0262191 Ga0496106_0262191_193_897 227
990 3300048909 Ga0496106_0326857 Ga0496106_0326857_365_1069 227
991 3300048910 Ga0496107_0443689 Ga0496107_0443689_80_784 227
992 3300048911 Ga0496108_0452091 Ga0496108_0452091_147_845 227
993 3300048913 Ga0496110_0256100 Ga0496110_0256100_260_958 227
994 3300048914 Ga0496111_0091927 Ga0496111_0091927_1044_1742 227
995 3300048915 Ga0496112_0025259 Ga0496112_0025259_3065_3763 227
996 3300048916 Ga0496113_0171986 Ga0496113_0171986_17_721 227
997 3300048916 Ga0496113_0369158 Ga0496113_0369158_50_754 227
998 3300048917 Ga0496114_0390494 Ga0496114_0390494_112_816 227
999 3300048918 Ga0496115_0074639 Ga0496115_0074639_68_772 227
1000 3300048918 Ga0496115_0343562 Ga0496115_0343562_270_974 227
1001 3300048918 Ga0496115_0393285 Ga0496115_0393285_216_920 227
1002 3300048924 Ga0496121_0162930 Ga0496121_0162930_905_1609 227
1003 3300048925 Ga0496122_0053961 Ga0496122_0053961_606_1310 227
1004 3300048927 Ga0496124_0130386 Ga0496124_0130386_1265_1969 227
1005 3300048928 Ga0496125_0000048 Ga0496125_0000048_14471_15175 227
1006 3300048928 Ga0496125_0006588 Ga0496125_0006588_4468_5172 227
1007 3300048929 Ga0496126_0018558 Ga0496126_0018558_4978_5682 227
1008 3300048929 Ga0496126_0355864 Ga0496126_0355864_258_962 227
1009 3300048929 Ga0496126_0455158 Ga0496126_0455158_110_814 227
1010 3300049568 Ga0501031_0227518 Ga0501031_0227518_172_876 227
1011 3300049573 Ga0501037_0282654 Ga0501037_0282654_35_739 227
1012 3300049576 Ga0501040_0150548 Ga0501040_0150548_405_1109 227
1013 3300049582 Ga0501048_0444954 Ga0501048_0444954_212_916 227
1014 3300049587 Ga0501071_0058731 Ga0501071_0058731_375_1079 227
1015 3300049592 Ga0501076_0384800 Ga0501076_0384800_64_768 227
1016 3300049744 Ga0501083_0106614 Ga0501083_0106614_590_1282 227
1017 3300050489 nmdc:mga03683_204267_c1 nmdc:mga03683_204267_c1_127_831 227
1018 3300050490 nmdc:mga03n38_251279_c1 nmdc:mga03n38_251279_c1_34_738 227
1019 3300050490 nmdc:mga03n38_42142_c1 nmdc:mga03n38_42142_c1_67_771 227
1020 3300050491 nmdc:mga00v17_40924_c1 nmdc:mga00v17_40924_c1_912_1616 227
1021 3300050492 nmdc:mga0yw44_225522_c1 nmdc:mga0yw44_225522_c1_460_1170 227
1022 3300050492 nmdc:mga0yw44_25743_c1 nmdc:mga0yw44_25743_c1_954_1658 227
1023 3300050496 nmdc:mga07m45_156899_c1 nmdc:mga07m45_156899_c1_536_1240 227
1024 3300050496 nmdc:mga07m45_31562_c1 nmdc:mga07m45_31562_c1_625_1329 227
1025 3300050496 nmdc:mga07m45_43758_c1 nmdc:mga07m45_43758_c1_1099_1803 227
1026 3300050507 nmdc:mga05p37_49010_c1 nmdc:mga05p37_49010_c1_1613_2317 227
1027 3300050511 nmdc:mga08y16_107272_c1 nmdc:mga08y16_107272_c1_493_1197 227
1028 3300050511 nmdc:mga08y16_611197_c1 nmdc:mga08y16_611197_c1_377_1081 227
1029 3300050513 nmdc:mga0rr50_123844_c1 nmdc:mga0rr50_123844_c1_597_1289 227
1030 3300053084 Ga0495595_0000452 Ga0495595_0000452_14373_15065 227
1031 3300053085 Ga0495619_0000590 Ga0495619_0000590_21614_22306 227
1032 3300053085 Ga0495619_0111363 Ga0495619_0111363_944_1651 227
1033 3300053092 Ga0500583_0056105 Ga0500583_0056105_611_1315 227
1034 3300053094 Ga0500566_0000174 Ga0500566_0000174_17216_17923 227
1035 3300053099 Ga0500654_085783 Ga0500654_085783_70_774 227
1036 3300053109 Ga0500569_019888 Ga0500569_019888_88_792 227
1037 3300053114 Ga0500582_118168 Ga0500582_118168_12_716 227
1038 3300053119 Ga0500595_001346 Ga0500595_001346_7184_7888 227
1039 3300053119 Ga0500595_017155 Ga0500595_017155_210_902 227
1040 3300053119 Ga0500595_051785 Ga0500595_051785_102_794 227
1041 3300053142 Ga0500577_0136134 Ga0500577_0136134_264_968 227
1042 3300053150 Ga0500603_018233 Ga0500603_018233_740_1441 227
1043 3300053162 Ga0500638_098187 Ga0500638_098187_547_1251 227
1044 3300053178 Ga0500637_0130859 Ga0500637_0130859_328_1032 227
1045 3300053178 Ga0500637_0209086 Ga0500637_0209086_164_871 227
1046 iso_pu_bacteria 2791355196 2793061058 227
1047 iso_pu_bacteria 2874628541 2874630145 227
1048 3300021361 Ga0213872_10141816 Ga0213872_101418162 228
1049 3300037418 Ga0395900_0055509 Ga0395900_0055509_3139_3837 228
1050 3300037471 Ga0395905_0008401 Ga0395905_0008401_2016_2708 228
1051 3300038443 Ga0395901_0013467 Ga0395901_0013467_4830_5528 228
1052 3300038443 Ga0395901_0025727 Ga0395901_0025727_2897_3589 228
1053 3300039447 Ga0436361_0573481 Ga0436361_0573481_1567_2292 228
1054 3300039447 Ga0436361_1064158 Ga0436361_1064158_2196_2900 228
1055 3300039453 Ga0436362_0031186 Ga0436362_0031186_4525_5250 228
1056 3300044656 Ga0466969_0194011 Ga0466969_0194011_132_830 228
1057 3300044684 Ga0466966_0093402 Ga0466966_0093402_147_845 228
1058 3300046524 Ga0495648_0003484 Ga0495648_0003484_5924_6619 228
1059 3300049568 Ga0501031_0091786 Ga0501031_0091786_752_1450 228
1060 3300049570 Ga0501033_0027180 Ga0501033_0027180_1976_2674 228
1061 3300049571 Ga0501034_0087971 Ga0501034_0087971_1660_2358 228
1062 3300049572 Ga0501036_0086884 Ga0501036_0086884_1557_2255 228
1063 3300049575 Ga0501039_0272180 Ga0501039_0272180_515_1213 228
1064 3300049579 Ga0501043_0052885 Ga0501043_0052885_2480_3178 228
1065 3300049581 Ga0501047_0069896 Ga0501047_0069896_1441_2139 228
1066 3300049581 Ga0501047_0686796 Ga0501047_0686796_126_821 228
1067 3300049582 Ga0501048_0166996 Ga0501048_0166996_237_935 228
1068 3300049585 Ga0501069_0441190 Ga0501069_0441190_43_741 228
1069 3300049822 Ga0501035_0015948 Ga0501035_0015948_3855_4553 228
1070 3300049823 Ga0501044_0017591 Ga0501044_0017591_4509_5207 228
1071 iso_pu_bacteria 2507262055 2507506133 228
1072 iso_pu_bacteria 2508501009 2508541597 228
1073 iso_pu_bacteria 2508501042 2508692861 228
1074 iso_pu_bacteria 2511231028 2511398107 228
1075 iso_pu_bacteria 2513237092 2513623846 228
1076 iso_pu_bacteria 2513237094 2513636876 228
1077 iso_pu_bacteria 2513237095 2513651178 228
1078 iso_pu_bacteria 2513237102 2513702692 228
1079 iso_pu_bacteria 2513237139 2513878333 228
1080 iso_pu_bacteria 2513237161 2514011739 228
1081 iso_pu_bacteria 2515154112 2515626254 228
1082 iso_pu_bacteria 2517093001 2517108211 228
1083 iso_pu_bacteria 2524023205 2524436101 228
1084 iso_pu_bacteria 2528768022 2528852842 228
1085 iso_pu_bacteria 2528768022 2528856737 228
1086 iso_pu_bacteria 2528768022 2528858578 228
1087 iso_pu_bacteria 2617270735 2617352741 228
1088 iso_pu_bacteria 2617270741 2617372917 228
1089 iso_pu_bacteria 2744054633 2745080943 228
1090 iso_pu_bacteria 2802429603 2805920556 228
1091 iso_pu_bacteria 2816332527 2818236744 228
1092 iso_pu_bacteria 2824600985 2824602972 228
1093 iso_pu_bacteria 2824609381 2824611805 228
1094 iso_pu_bacteria 2824617872 2824621561 228
1095 iso_pu_bacteria 2824626560 2824630673 228
1096 iso_pu_bacteria 2824635225 2824641109 228
1097 iso_pu_bacteria 2824644064 2824650673 228
1098 iso_pu_bacteria 2824653114 2824655041 228
1099 iso_pu_bacteria 2824661429 2824664425 228
1100 iso_pu_bacteria 2824671348 2824672299 228
1101 iso_pu_bacteria 2824679649 2824682293 228
1102 iso_pu_bacteria 2824687955 2824688818 228
1103 iso_pu_bacteria 2824696289 2824697659 228
1104 iso_pu_bacteria 2824704595 2824707876 228
1105 iso_pu_bacteria 2824714736 2824720305 228
1106 iso_pu_bacteria 2824723954 2824730784 228
1107 iso_pu_bacteria 2824732956 2824739286 228
1108 iso_pu_bacteria 2824746037 2824748435 228
1109 iso_pu_bacteria 2824753945 2824757935 228
1110 iso_pu_bacteria 2824763712 2824766530 228
1111 iso_pu_bacteria 2824773399 2824776653 228
1112 iso_pu_bacteria 2838122688 2838129410 228
1113 iso_pu_bacteria 2841941048 2841946418 228
1114 iso_pu_bacteria 2841949485 2841953667 228
1115 iso_pu_bacteria 2841957949 2841962727 228
1116 iso_pu_bacteria 2841966195 2841972928 228
1117 iso_pu_bacteria 2841974524 2841978400 228
1118 iso_pu_bacteria 2841983080 2841990615 228
1119 iso_pu_bacteria 2842038055 2842040833 228
1120 iso_pu_bacteria 2842045827 2842046222 228
1121 iso_pu_bacteria 2844315083 2844320195 228
1122 iso_pu_bacteria 2847930680 2847937514 228
1123 iso_pu_bacteria 2847939898 2847947937 228
1124 iso_pu_bacteria 2849076700 2849078216 228
1125 iso_pu_bacteria 2857509624 2857511371 228
1126 iso_pu_bacteria 2874590934 2874598596 228
1127 iso_pu_bacteria 2874612657 2874619251 228
1128 iso_pu_bacteria 2874620515 2874628261 228
1129 iso_pu_bacteria 2874645413 2874652050 228
1130 iso_pu_bacteria 2876761206 2876768273 228
1131 iso_pu_bacteria 2876771140 2876778635 228
1132 iso_pu_bacteria 2876818435 2876823439 228
1133 iso_pu_bacteria 2879074833 2879082428 228
1134 iso_pu_bacteria 2879083081 2879084927 228
1135 iso_pu_bacteria 2879099564 2879101923 228
1136 iso_pu_bacteria 2879127579 2879131791 228
1137 iso_pu_bacteria 2879142872 2879150127 228
1138 iso_pu_bacteria 2881364244 2881370091 228
1139 iso_pu_bacteria 2885366525 2885370151 228
1140 iso_pu_bacteria 2885409591 2885414342 228
1141 iso_pu_bacteria 2888378607 2888385666 228
1142 iso_pu_bacteria 2888388044 2888392602 228
1143 iso_pu_bacteria 2888419890 2888425786 228
1144 iso_pu_bacteria 2903727486 2903731215 228
1145 iso_pu_bacteria 2904666416 2904674120 228
1146 iso_pu_bacteria 2904711408 2904711772 228
1147 iso_pu_bacteria 2906602504 2906610018 228
1148 iso_pu_bacteria 2906626472 2906629353 228
1149 iso_pu_bacteria 2906626472 2906634975 228
1150 iso_pu_bacteria 2906643746 2906645531 228
1151 iso_pu_bacteria 2908775508 2908781366 228
1152 iso_pu_bacteria 2922368715 2922375902 228
1153 iso_pu_bacteria 2922393267 2922396885 228
1154 iso_pu_bacteria 2929615660 2929621226 228
1155 iso_pu_bacteria 2929624759 2929625943 228
1156 iso_pu_bacteria 2932784394 2932785167 228
1157 iso_pu_bacteria 2932784394 2932789340 228
1158 iso_pu_bacteria 2932794094 2932801339 228
1159 iso_pu_bacteria 2932801729 2932806282 228
1160 iso_pu_bacteria 2932828146 2932829003 228
1161 iso_pu_bacteria 2933577622 2933582905 228
1162 iso_pu_bacteria 2935608549 2935610013 228
1163 iso_pu_bacteria 2935616580 2935619577 228
1164 iso_pu_bacteria 2935638405 2935638557 228
1165 iso_pu_bacteria 2935648319 2935651959 228
1166 iso_pu_bacteria 2935656913 2935660068 228
1167 iso_pu_bacteria 2935665750 2935666591 228
1168 iso_pu_bacteria 2935675223 2935676364 228
1169 iso_pu_bacteria 2935684952 2935691119 228
1170 iso_pu_bacteria 2935694250 2935694450 228
1171 iso_pu_bacteria 2935694250 2935702739 228
1172 iso_pu_bacteria 2935703347 2935703563 228
1173 iso_pu_bacteria 2935713505 2935718500 228
1174 iso_pu_bacteria 2935722832 2935727520 228
1175 iso_pu_bacteria 2935732158 2935736223 228
1176 iso_pu_bacteria 2935741537 2935745603 228
1177 iso_pu_bacteria 2935750917 2935755984 228
1178 iso_pu_bacteria 2935769743 2935776214 228
1179 iso_pu_bacteria 2935777560 2935784923 228
1180 iso_pu_bacteria 2935785616 2935792092 228
1181 iso_pu_bacteria 2935793552 2935798067 228
1182 iso_pu_bacteria 2935801545 2935801700 228
1183 iso_pu_bacteria 2935819856 2935823173 228
1184 iso_pu_bacteria 2935819856 2935826977 228
1185 iso_pu_bacteria 2935827899 2935828051 228
1186 iso_pu_bacteria 2935837841 2935842257 228
1187 iso_pu_bacteria 2935847175 2935848755 228
1188 iso_pu_bacteria 2935847175 2935854155 228
1189 iso_pu_bacteria 2935855204 2935858107 228
1190 iso_pu_bacteria 2935864058 2935868012 228
1191 iso_pu_bacteria 2935873716 2935873965 228
1192 iso_pu_bacteria 2935883170 2935889952 228
1193 iso_pu_bacteria 2935908558 2935909440 228
1194 iso_pu_bacteria 2935916978 2935917164 228
1195 iso_pu_bacteria 2935926038 2935926921 228
1196 iso_pu_bacteria 2935934488 2935937235 228
1197 iso_pu_bacteria 2935942939 2935944462 228
1198 iso_pu_bacteria 2935951376 2935952899 228
1199 iso_pu_bacteria 2935959822 2935965212 228
1200 iso_pu_bacteria 2935967501 2935969739 228
1201 iso_pu_bacteria 2935975950 2935976349 228
1202 iso_pu_bacteria 2935975950 2935982862 228
1203 iso_pu_bacteria 2935984226 2935987213 228
1204 iso_pu_bacteria 2935992306 2935993111 228
1205 iso_pu_bacteria 2936002035 2936003023 228
1206 iso_pu_bacteria 2936011229 2936014484 228
1207 iso_pu_bacteria 2936019824 2936023676 228
1208 iso_pu_bacteria 2936028420 2936031319 228
1209 iso_pu_bacteria 2936046547 2936049590 228
1210 iso_pu_bacteria 2936055302 2936061194 228
1211 iso_pu_bacteria 2936055302 2936062658 228
1212 iso_pu_bacteria 2940556831 2940562041 228
1213 iso_pu_bacteria 2941531003 2941537143 228
1214 iso_pu_bacteria 2941538514 2941542305 228
1215 iso_pu_bacteria 2941538514 2941546548 228
1216 iso_pu_bacteria 3005483717 3005485584 228
1217 iso_pu_bacteria 3005506211 3005508249 228
1218 iso_pu_bacteria 3005587118 3005588247 228
1219 iso_pu_bacteria 3005594810 3005600508 228
1220 iso_pu_bacteria 3005710791 3005715981 228
1221 iso_pu_bacteria 3005718088 3005723336 228
1222 iso_pu_bacteria 8016511872 8016520458 228
1223 iso_pu_bacteria 8016522445 8016527647 228
1224 iso_pu_bacteria 8016530956 8016532744 228
1225 iso_pu_bacteria 8016539877 8016545974 228
1226 iso_pu_bacteria 8016548790 8016556138 228
1227 iso_pu_bacteria 8016557553 8016564503 228
1228 iso_pu_bacteria 8016566248 8016571052 228
1229 iso_pu_bacteria 8016575299 8016583554 228
1230 iso_pu_bacteria 8016583857 8016594568 228
1231 iso_pu_bacteria 8016595262 8016602164 228
1232 iso_pu_bacteria 8016603502 8016605149 228
1233 iso_pu_bacteria 8016613128 8016616944 228
1234 iso_pu_bacteria 8016622563 8016630734 228
1235 iso_pu_bacteria 8016630954 8016638973 228
1236 iso_pu_bacteria 8017057580 8017065117 228
1237 iso_pu_bacteria 8019538911 8019542222 228
1238 iso_pu_bacteria 8019547302 8019547402 228
1239 iso_pu_bacteria 8019576017 8019584505 228
1240 iso_pu_bacteria 8019586578 8019592277 228
1241 iso_pu_bacteria 8019597564 8019599010 228
1242 iso_pu_bacteria 8019608314 8019609363 228
1243 iso_pu_bacteria 8019629233 8019632249 228
1244 iso_pu_bacteria 8019629233 8019633102 228
1245 iso_pu_bacteria 8019638758 8019646797 228
1246 iso_pu_bacteria 8019648815 8019649566 228
1247 iso_pu_bacteria 8019648815 8019654375 228
1248 iso_pu_bacteria 8019659431 8019660168 228
1249 iso_pu_bacteria 8019659431 8019660986 228
1250 iso_pu_bacteria 8019668869 8019669600 228
1251 iso_pu_bacteria 8019668869 8019670545 228
1252 iso_pu_bacteria 8019678201 8019685690 228
1253 iso_pu_bacteria 8019687851 8019691266 228
1254 iso_pu_bacteria 8055742211 8055744912 228
1255 iso_pu_bacteria 8056967851 8056974886 228
1256 3300005367 Ga0070667_100464305 Ga0070667_1004643051 229
1257 3300005455 Ga0070663_100033723 Ga0070663_1000337233 229
1258 3300005547 Ga0070693_100304043 Ga0070693_1003040431 229
1259 3300005577 Ga0068857_100169751 Ga0068857_1001697512 229
1260 3300005614 Ga0068856_100188519 Ga0068856_1001885193 229
1261 3300005617 Ga0068859_100695716 Ga0068859_1006957161 229
1262 3300005618 Ga0068864_100365528 Ga0068864_1003655282 229
1263 3300005842 Ga0068858_100824898 Ga0068858_1008248981 229
1264 3300006931 Ga0097620_100695825 Ga0097620_1006958252 229
1265 3300009101 Ga0105247_10099588 Ga0105247_100995882 229
1266 3300009545 Ga0105237_10139841 Ga0105237_101398414 229
1267 3300009553 Ga0105249_10350444 Ga0105249_103504442 229
1268 3300010375 Ga0105239_10688587 Ga0105239_106885872 229
1269 3300013308 Ga0157375_10329718 Ga0157375_103297183 229
1270 3300013308 Ga0157375_10511498 Ga0157375_105114982 229
1271 3300014325 Ga0163163_10372665 Ga0163163_103726652 229
1272 3300025927 Ga0207687_10690745 Ga0207687_106907452 229
1273 3300026035 Ga0207703_10798815 Ga0207703_107988151 229
1274 3300026041 Ga0207639_10492971 Ga0207639_104929712 229
1275 3300026078 Ga0207702_10143887 Ga0207702_101438872 229
1276 3300026095 Ga0207676_10220663 Ga0207676_102206632 229
1277 3300026095 Ga0207676_10477062 Ga0207676_104770622 229
1278 3300035172 Ga0373955_0059739 Ga0373955_0059739_257_961 229
1279 3300035692 Ga0373935_0079641 Ga0373935_0079641_229_933 229
1280 3300035724 Ga0373933_0027558 Ga0373933_0027558_2322_3026 229
1281 3300036401 Ga0373937_0174880 Ga0373937_0174880_620_1318 229
1282 3300036401 Ga0373937_0279464 Ga0373937_0279464_236_940 229
1283 3300046454 Ga0495592_0009461 Ga0495592_0009461_5212_5916 229
1284 3300046462 Ga0495651_0119678 Ga0495651_0119678_101_805 229
1285 3300046477 Ga0495664_0207672 Ga0495664_0207672_333_1037 229
1286 3300046516 Ga0495628_0221072 Ga0495628_0221072_72_776 229
1287 3300046517 Ga0495630_0059141 Ga0495630_0059141_1029_1733 229
1288 3300046536 Ga0495587_0029262 Ga0495587_0029262_2213_2917 229
1289 3300046543 Ga0495645_0014090 Ga0495645_0014090_1695_2399 229
1290 3300046557 Ga0495622_0007020 Ga0495622_0007020_3416_4114 229
1291 3300046663 Ga0495635_0035502 Ga0495635_0035502_1164_1868 229
1292 3300046680 Ga0495646_0044385 Ga0495646_0044385_50_754 229
1293 3300047317 Ga0495604_0062119 Ga0495604_0062119_51_755 229
1294 3300047321 Ga0495676_0195381 Ga0495676_0195381_484_1182 229
1295 3300047322 Ga0495680_0010833 Ga0495680_0010833_4043_4747 229
1296 3300047444 Ga0495675_0103343 Ga0495675_0103343_95_799 229
1297 3300047471 Ga0495684_0062879 Ga0495684_0062879_1266_1970 229
1298 3300048903 Ga0496100_0151213 Ga0496100_0151213_866_1564 229
1299 3300048907 Ga0496104_0007733 Ga0496104_0007733_8313_9011 229
1300 3300048908 Ga0496105_0049374 Ga0496105_0049374_90_788 229
1301 3300048908 Ga0496105_0097279 Ga0496105_0097279_1150_1848 229
1302 3300048912 Ga0496109_0033050 Ga0496109_0033050_3372_4070 229
1303 3300048913 Ga0496110_0035920 Ga0496110_0035920_73_771 229
1304 3300048915 Ga0496112_0004505 Ga0496112_0004505_4231_4929 229
1305 3300048916 Ga0496113_0056420 Ga0496113_0056420_570_1268 229
1306 3300048918 Ga0496115_0225732 Ga0496115_0225732_495_1193 229
1307 3300048919 Ga0496116_0037444 Ga0496116_0037444_221_919 229
1308 3300048921 Ga0496118_0017368 Ga0496118_0017368_1450_2148 229
1309 3300048924 Ga0496121_0009113 Ga0496121_0009113_5663_6361 229
1310 3300048923 Ga0496120_0165777 Ga0496120_0165777_39_746 231
1311 iso_pu_bacteria 8016583857 8016587442 231
1312 3300003215 JGI25153J46596_10004382 JGI25153J46596_100043822 232
1313 3300003215 JGI25153J46596_10023126 JGI25153J46596_100231262 232
1314 3300003354 JGI25160J50197_1001088 JGI25160J50197_10010887 232
1315 3300003354 JGI25160J50197_1012990 JGI25160J50197_10129904 232
1316 3300003762 Ga0055542_1003299 Ga0055542_10032994 232
1317 3300005262 Ga0065165_1001485 Ga0065165_100148517 232
1318 3300005262 Ga0065165_1003538 Ga0065165_10035386 232
1319 3300005327 Ga0070658_10232430 Ga0070658_102324301 232
1320 3300005331 Ga0070670_100079423 Ga0070670_1000794232 232
1321 3300005338 Ga0068868_100116950 Ga0068868_1001169502 232
1322 3300005345 Ga0070692_10057416 Ga0070692_100574162 232
1323 3300005347 Ga0070668_100131339 Ga0070668_1001313393 232
1324 3300005354 Ga0070675_100845270 Ga0070675_1008452701 232
1325 3300005355 Ga0070671_100011809 Ga0070671_1000118094 232
1326 3300005367 Ga0070667_100032529 Ga0070667_1000325294 232
1327 3300005455 Ga0070663_100013684 Ga0070663_1000136844 232
1328 3300005455 Ga0070663_100438289 Ga0070663_1004382892 232
1329 3300005539 Ga0068853_100251795 Ga0068853_1002517952 232
1330 3300005548 Ga0070665_100061786 Ga0070665_1000617864 232
1331 3300005563 Ga0068855_100361321 Ga0068855_1003613212 232
1332 3300005563 Ga0068855_100571113 Ga0068855_1005711132 232
1333 3300005564 Ga0070664_100337338 Ga0070664_1003373381 232
1334 3300005578 Ga0068854_100171225 Ga0068854_1001712251 232
1335 3300005614 Ga0068856_100233436 Ga0068856_1002334362 232
1336 3300005616 Ga0068852_100060941 Ga0068852_1000609414 232
1337 3300005842 Ga0068858_100592630 Ga0068858_1005926302 232
1338 3300005937 Ga0081455_10157595 Ga0081455_101575952 232
1339 3300005983 Ga0081540_1058435 Ga0081540_10584352 232
1340 3300006038 Ga0075365_10118909 Ga0075365_101189092 232
1341 3300006177 Ga0075362_10010036 Ga0075362_100100364 232
1342 3300006353 Ga0075370_10043907 Ga0075370_100439072 232
1343 3300006944 Ga0099823_1056087 Ga0099823_10560872 232
1344 3300009093 Ga0105240_10015188 Ga0105240_100151887 232
1345 3300009098 Ga0105245_10175532 Ga0105245_101755321 232
1346 3300009148 Ga0105243_10417760 Ga0105243_104177602 232
1347 3300009174 Ga0105241_10013936 Ga0105241_100139362 232
1348 3300009174 Ga0105241_10038188 Ga0105241_100381882 232
1349 3300009177 Ga0105248_10158216 Ga0105248_101582164 232
1350 3300009545 Ga0105237_10004211 Ga0105237_100042117 232
1351 3300009545 Ga0105237_10264365 Ga0105237_102643653 232
1352 3300010375 Ga0105239_10007324 Ga0105239_100073241 232
1353 3300010375 Ga0105239_10186840 Ga0105239_101868403 232
1354 3300011119 Ga0105246_10074364 Ga0105246_100743643 232
1355 3300013104 Ga0157370_10561219 Ga0157370_105612191 232
1356 3300013105 Ga0157369_10355444 Ga0157369_103554442 232
1357 3300013297 Ga0157378_10548319 Ga0157378_105483191 232
1358 3300013306 Ga0163162_10124380 Ga0163162_101243802 232
1359 3300014325 Ga0163163_10073241 Ga0163163_100732414 232
1360 3300014969 Ga0157376_10346421 Ga0157376_103464212 232
1361 3300015261 Ga0182006_1120839 Ga0182006_11208391 232
1362 3300021321 Ga0214542_1031903 Ga0214542_10319032 232
1363 3300021324 Ga0214545_1024560 Ga0214545_10245604 232
1364 3300021327 Ga0214543_1026447 Ga0214543_10264474 232
1365 3300025230 Ga0209563_101250 Ga0209563_1012505 232
1366 3300025253 Ga0209677_104007 Ga0209677_1040072 232
1367 3300025254 Ga0209148_1000479 Ga0209148_100047914 232
1368 3300025261 Ga0209233_1010455 Ga0209233_10104553 232
1369 3300025261 Ga0209233_1016085 Ga0209233_10160853 232
1370 3300025272 Ga0209455_1001925 Ga0209455_10019252 232
1371 3300025295 Ga0209564_1007279 Ga0209564_10072792 232
1372 3300025297 Ga0209758_1000120 Ga0209758_10001207 232
1373 3300025297 Ga0209758_1002106 Ga0209758_10021067 232
1374 3300025297 Ga0209758_1002858 Ga0209758_10028588 232
1375 3300025297 Ga0209758_1037364 Ga0209758_10373642 232
1376 3300025297 Ga0209758_1039361 Ga0209758_10393612 232
1377 3300025302 Ga0207426_1000458 Ga0207426_100045845 232
1378 3300025302 Ga0207426_1001218 Ga0207426_100121815 232
1379 3300025304 Ga0209257_1016464 Ga0209257_10164643 232
1380 3300025304 Ga0209257_1017778 Ga0209257_10177782 232
1381 3300025904 Ga0207647_10001853 Ga0207647_1000185310 232
1382 3300025911 Ga0207654_10156360 Ga0207654_101563601 232
1383 3300025913 Ga0207695_10000008 Ga0207695_10000008974 232
1384 3300025914 Ga0207671_10011583 Ga0207671_100115834 232
1385 3300025920 Ga0207649_10060907 Ga0207649_100609074 232
1386 3300025923 Ga0207681_10047012 Ga0207681_100470122 232
1387 3300025924 Ga0207694_10243554 Ga0207694_102435541 232
1388 3300025927 Ga0207687_10046631 Ga0207687_100466313 232
1389 3300025949 Ga0207667_10255377 Ga0207667_102553772 232
1390 3300025981 Ga0207640_10028073 Ga0207640_100280733 232
1391 3300025981 Ga0207640_10326608 Ga0207640_103266082 232
1392 3300025986 Ga0207658_10825971 Ga0207658_108259711 232
1393 3300026023 Ga0207677_10164390 Ga0207677_101643902 232
1394 3300026035 Ga0207703_10051105 Ga0207703_100511051 232
1395 3300026041 Ga0207639_10166335 Ga0207639_101663353 232
1396 3300026041 Ga0207639_10612664 Ga0207639_106126641 232
1397 3300026067 Ga0207678_10012486 Ga0207678_100124863 232
1398 3300026067 Ga0207678_10018553 Ga0207678_100185534 232
1399 3300026067 Ga0207678_10044384 Ga0207678_100443842 232
1400 3300026078 Ga0207702_10123822 Ga0207702_101238222 232
1401 3300026089 Ga0207648_10235485 Ga0207648_102354852 232
1402 3300026142 Ga0207698_10025711 Ga0207698_100257113 232
1403 3300027296 Ga0209389_1000077 Ga0209389_100007761 232
1404 3300027361 Ga0209489_100251 Ga0209489_10025161 232
1405 3300027363 Ga0209700_100271 Ga0209700_10027160 232
1406 3300027866 Ga0209813_10024797 Ga0209813_100247972 232
1407 3300033180 Ga0307510_10014911 Ga0307510_1001491110 232
1408 3300033180 Ga0307510_10044432 Ga0307510_100444322 232
1409 3300033180 Ga0307510_10400293 Ga0307510_104002931 232
1410 3300037418 Ga0395900_0280357 Ga0395900_0280357_138_845 232
1411 3300037471 Ga0395905_0093170 Ga0395905_0093170_1296_2003 232
1412 3300041492 Ga0451835_0015839 Ga0451835_0015839_23_733 232
1413 3300044656 Ga0466969_0129516 Ga0466969_0129516_18_725 232
1414 3300044658 Ga0466972_0001031 Ga0466972_0001031_6035_6742 232
1415 3300044684 Ga0466966_0000191 Ga0466966_0000191_2339_3046 232
1416 3300044693 Ga0466961_0000005 Ga0466961_0000005_42365_43072 232
1417 3300044765 Ga0466970_0278525 Ga0466970_0278525_97_804 232
1418 3300045049 Ga0466959_0000654 Ga0466959_0000654_1043_1750 232
1419 3300046460 Ga0495638_0002117 Ga0495638_0002117_1562_2269 232
1420 3300046463 Ga0495653_0042601 Ga0495653_0042601_2310_3020 232
1421 3300046507 Ga0495606_0186378 Ga0495606_0186378_118_825 232
1422 3300046511 Ga0495608_0017146 Ga0495608_0017146_3036_3746 232
1423 3300046515 Ga0495620_0071298 Ga0495620_0071298_618_1325 232
1424 3300046516 Ga0495628_0453242 Ga0495628_0453242_175_885 232
1425 3300046524 Ga0495648_0043575 Ga0495648_0043575_53_760 232
1426 3300046524 Ga0495648_0052682 Ga0495648_0052682_1577_2284 232
1427 3300046529 Ga0495652_0006289 Ga0495652_0006289_1747_2457 232
1428 3300046533 Ga0495640_0019283 Ga0495640_0019283_1303_2013 232
1429 3300046536 Ga0495587_0092400 Ga0495587_0092400_398_1108 232
1430 3300046538 Ga0495609_0029919 Ga0495609_0029919_1719_2426 232
1431 3300046660 Ga0495625_0068302 Ga0495625_0068302_1405_2112 232
1432 3300046660 Ga0495625_0169454 Ga0495625_0169454_621_1328 232
1433 3300046675 Ga0495657_0015183 Ga0495657_0015183_4264_4974 232
1434 3300046678 Ga0495599_0047987 Ga0495599_0047987_1130_1840 232
1435 3300046679 Ga0495623_0027880 Ga0495623_0027880_1542_2252 232
1436 3300046809 Ga0495600_0008483 Ga0495600_0008483_4174_4884 232
1437 3300047322 Ga0495680_0000920 Ga0495680_0000920_10045_10755 232
1438 3300047444 Ga0495675_0003454 Ga0495675_0003454_604_1314 232
1439 3300047469 Ga0495673_0179962 Ga0495673_0179962_46_753 232
1440 3300047472 Ga0495686_0231918 Ga0495686_0231918_247_954 232
1441 3300048088 Ga0495602_0003657 Ga0495602_0003657_5396_6106 232
1442 3300048903 Ga0496100_0035627 Ga0496100_0035627_1425_2132 232
1443 3300048905 Ga0496102_0061830 Ga0496102_0061830_1391_2101 232
1444 3300048905 Ga0496102_0127399 Ga0496102_0127399_1068_1775 232
1445 3300048907 Ga0496104_0045912 Ga0496104_0045912_1245_1952 232
1446 3300048908 Ga0496105_0047972 Ga0496105_0047972_401_1111 232
1447 3300048911 Ga0496108_0219976 Ga0496108_0219976_852_1562 232
1448 3300048912 Ga0496109_0120180 Ga0496109_0120180_95_805 232
1449 3300048913 Ga0496110_0146604 Ga0496110_0146604_1015_1725 232
1450 3300048913 Ga0496110_0828990 Ga0496110_0828990_89_796 232
1451 3300048916 Ga0496113_0003004 Ga0496113_0003004_1851_2561 232
1452 3300048916 Ga0496113_0335056 Ga0496113_0335056_142_849 232
1453 3300048917 Ga0496114_0532233 Ga0496114_0532233_65_772 232
1454 3300048918 Ga0496115_0220835 Ga0496115_0220835_716_1426 232
1455 3300048921 Ga0496118_0085444 Ga0496118_0085444_734_1441 232
1456 3300048922 Ga0496119_0012861 Ga0496119_0012861_4688_5398 232
1457 3300048924 Ga0496121_0171798 Ga0496121_0171798_721_1428 232
1458 3300048925 Ga0496122_0107848 Ga0496122_0107848_1001_1711 232
1459 3300048927 Ga0496124_0116507 Ga0496124_0116507_262_972 232
1460 3300048928 Ga0496125_0112310 Ga0496125_0112310_826_1533 232
1461 3300048929 Ga0496126_0197957 Ga0496126_0197957_736_1443 232
1462 3300049460 Ga0495682_0035131 Ga0495682_0035131_38_745 232
1463 3300050491 nmdc:mga00v17_16990_c1 nmdc:mga00v17_16990_c1_1722_2429 232
1464 3300050492 nmdc:mga0yw44_38628_c1 nmdc:mga0yw44_38628_c1_319_1026 232
1465 3300050492 nmdc:mga0yw44_68816_c1 nmdc:mga0yw44_68816_c1_815_1522 232
1466 3300050496 nmdc:mga07m45_165349_c1 nmdc:mga07m45_165349_c1_324_1031 232
1467 3300050516 nmdc:mga0sz30_112720_c1 nmdc:mga0sz30_112720_c1_353_1060 232
1468 3300053080 Ga0500635_0007819 Ga0500635_0007819_1043_1750 232
1469 3300053083 Ga0495655_0058865 Ga0495655_0058865_154_864 232
1470 3300053086 Ga0500578_0175876 Ga0500578_0175876_451_1158 232
1471 3300053104 Ga0500556_0003645 Ga0500556_0003645_2101_2808 232
1472 3300053108 Ga0500562_005901 Ga0500562_005901_601_1308 232
1473 3300053111 Ga0500572_031118 Ga0500572_031118_297_1004 232
1474 3300053130 Ga0500642_0000138 Ga0500642_0000138_11565_12272 232
1475 3300053136 Ga0500559_0005624 Ga0500559_0005624_2786_3493 232
1476 3300053153 Ga0500616_0010044 Ga0500616_0010044_1651_2358 232
1477 3300053156 Ga0500622_0001764 Ga0500622_0001764_8482_9189 232
1478 3300053160 Ga0500633_0038059 Ga0500633_0038059_538_1245 232
1479 3300053162 Ga0500638_109654 Ga0500638_109654_82_789 232
1480 3300053177 Ga0500636_0000608 Ga0500636_0000608_13289_13996 232
1481 3300053177 Ga0500636_0042215 Ga0500636_0042215_249_959 232
1482 3300053730 Ga0500645_047689 Ga0500645_047689_313_1020 232
1483 3300053731 Ga0500609_010779 Ga0500609_010779_23_730 232
1484 3300053737 Ga0500601_000276 Ga0500601_000276_888_1598 232

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00325

Crp

Bacterial regulatory proteins, crp family

197

228

0.97

PF13545

HTH_Crp_2

Crp-like helix-turn-helix domain

176

247

0.9

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

59

142

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i2o-assembly1.cif.gz_B the structure of fixk2 from bradyrhizobium japonicum 0.9305 38 232
5e44-assembly1.cif.gz_A-2 crystal structure of holo-fnr of a. fischeri 0.9174 44 231
4i2o-assembly1.cif.gz_B the structure of fixk2 from bradyrhizobium japonicum 0.9126 38 232
5j3u-assembly1.cif.gz_A co-crystal structure of the regulatory domain of toxoplasma gondii pka with camp 0.9075 40 122
5cvr-assembly1.cif.gz_A-2 crystal structure of fnr of a. fischeri in a partially degraded form 0.9045 42 230
ID Description Score Start End Superfamily
4i2oB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9519 38 155 2.60.120.10
5e44A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9446 44 155 2.60.120.10
4i2oB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9442 38 155 2.60.120.10
5cvrA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9326 42 155 2.60.120.10
4jqfA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9239 192 222 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4V6JIQ5-F1-model_v4 Fumarate and nitrate reduction regulatory protein 0.9634 44 171 GO:0003700
GO:0005829
GO:0051539
AF-A0A454D2S9-F1-model_v4 Fumarate and nitrate reduction regulatory protein 0.9548 44 176 GO:0003677
GO:0003700
GO:0005829
AF-A0A376KUT7-F1-model_v4 Fumarate and nitrate reduction regulatory protein 0.9447 39 192 GO:0003677
GO:0003700
GO:0005829
GO:0051539
AF-A0A3D5Q3P1-F1-model_v4 Crp/Fnr family transcriptional regulator 0.943 42 122 GO:0003700
GO:0005829
AF-A0A840RBY8-F1-model_v4 CRP/FNR family transcriptional regulator 0.9383 38 231 GO:0003677
GO:0003700

Feature Viewer

pLDDT pTM Quality
84.22 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map