F494185

General Info

Members Datasets Scaffolds Average Seq Length
1469 381 1469 91

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10044899|Ga0070710_100448991
Length 107
Sequence VSLCVLCGKCFFERIALRLSRDKVNKLAHVVTDALAETSEADFVEDRNTIRLQVRKILEDLLMQEARIDQSARQKIESQKRTILEGSQEWDILYRKYYNEEVKKLGI

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
10 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
101 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
102 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
103 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
120 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
121 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
122 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
139 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
140 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
146 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
147 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
148 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
149 3300024123 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 Metagenome Unclassified
150 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
151 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
152 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
153 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
223 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
224 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
225 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
229 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
230 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
234 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
235 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
236 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
237 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
238 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
239 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
240 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
241 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
242 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
243 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
244 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
245 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
246 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
247 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
248 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
249 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
250 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
251 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
252 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
253 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
254 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
255 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
256 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
257 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
258 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
259 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
260 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
261 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
262 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
263 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
264 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
265 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
266 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
267 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
268 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
269 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
270 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
271 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
272 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
273 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
274 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
275 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
276 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
277 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
278 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
279 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
280 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
281 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
282 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
283 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
284 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
285 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
286 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
287 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
288 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
289 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
290 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
291 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
292 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
293 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
294 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
295 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
296 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
297 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
298 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
299 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
300 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
301 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
302 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
303 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
304 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
305 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
306 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
307 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
308 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
309 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
310 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
311 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
312 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
313 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
314 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
315 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
316 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
317 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
318 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
319 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
320 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
321 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
322 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
323 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
324 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
325 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
326 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
327 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
328 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
329 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
330 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
331 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
332 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
333 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
334 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
335 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
336 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
337 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
338 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
339 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
340 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
341 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
342 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
343 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
344 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
345 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
346 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
347 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
348 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
349 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
350 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
351 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
352 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
353 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
354 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
355 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
356 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
357 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
358 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
359 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
360 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
361 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
362 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
363 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
364 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
365 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
366 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
367 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
368 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
369 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
370 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
371 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
372 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
373 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
374 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
375 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
376 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
377 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
378 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
379 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
380 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 1.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 5.45
Rhizosphere 93.33
Stem 0
Stem Tuber 0
Unclassified 1.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000036 3300000546 Bacteria 17917
2 JGI24752J21851_1007148 3300001976 Bacteria 1456
3 JGI24737J22298_10015197 3300001990 Unclassified 2493
4 JGI24743J22301_10054495 3300001991 Unclassified 818
5 JGI24748J21848_1022754 3300002074 Bacteria 759
6 JGI24034J26672_10001447 3300002239 Unclassified 3152
7 JGI24034J26672_10001666 3300002239 Unclassified 2982
8 JGI24751J29686_10001674 3300002459 Bacteria 4561
9 Ga0058861_10907943 3300004800 Unclassified 593
10 Ga0065717_1012939 3300005276 Bacteria 541
11 Ga0065716_1010305 3300005277 Bacteria 628
12 Ga0065712_10167439 3300005290 Bacteria 1264
13 Ga0065712_10172437 3300005290 Bacteria 1208
14 Ga0065712_10187511 3300005290 Bacteria 1163
15 Ga0065712_10773954 3300005290 Bacteria 521
16 Ga0065715_10014803 3300005293 Bacteria 2877
17 Ga0065715_10094290 3300005293 Unclassified 4384
18 Ga0065715_11005403 3300005293 Unclassified 544
19 Ga0070658_10010352 3300005327 Bacteria 7480
20 Ga0070658_10213155 3300005327 Bacteria 1632
21 Ga0070658_11168686 3300005327 Unclassified 669
22 Ga0070658_11186799 3300005327 Bacteria 664
23 Ga0070676_10001573 3300005328 Bacteria 11599
24 Ga0070676_10631973 3300005328 Bacteria 775
25 Ga0070683_100028458 3300005329 Bacteria 5051
26 Ga0070683_100038574 3300005329 Unclassified 4380
27 Ga0070683_100121121 3300005329 Bacteria 2472
28 Ga0070683_100321154 3300005329 Unclassified 1473
29 Ga0070683_102103257 3300005329 Bacteria 542
30 Ga0070690_100002570 3300005330 Bacteria 9767
31 Ga0070690_100314741 3300005330 Bacteria 1126
32 Ga0070670_100000753 3300005331 Bacteria 25120
33 Ga0070670_100041136 3300005331 Unclassified 3972
34 Ga0070670_100155057 3300005331 Bacteria 1983
35 Ga0070670_100160122 3300005331 Bacteria 1951
36 Ga0070670_100363641 3300005331 Bacteria 1273
37 Ga0070677_10022503 3300005333 Unclassified 2323
38 Ga0068869_100001656 3300005334 Bacteria 13302
39 Ga0068869_100023395 3300005334 Unclassified 4266
40 Ga0068869_100059236 3300005334 Bacteria 2803
41 Ga0070666_10001676 3300005335 Bacteria 13513
42 Ga0070666_10022188 3300005335 Bacteria 4120
43 Ga0070666_10294937 3300005335 Bacteria 1154
44 Ga0070680_100013215 3300005336 Bacteria 6426
45 Ga0070680_100032609 3300005336 Bacteria 4194
46 Ga0070680_100136729 3300005336 Unclassified 2053
47 Ga0070680_100175621 3300005336 Bacteria 1803
48 Ga0070680_100355689 3300005336 Bacteria 1245
49 Ga0070680_100358017 3300005336 Bacteria 1241
50 Ga0070680_100446469 3300005336 Bacteria 1104
51 Ga0070680_100505260 3300005336 Bacteria 1034
52 Ga0070680_100839337 3300005336 Bacteria 792
53 Ga0070680_100966927 3300005336 Bacteria 735
54 Ga0070680_101283846 3300005336 Unclassified 633
55 Ga0070682_100007667 3300005337 Bacteria 6081
56 Ga0070682_100040210 3300005337 Bacteria 2876
57 Ga0070682_100178498 3300005337 Bacteria 1481
58 Ga0070682_100439015 3300005337 Bacteria 997
59 Ga0068868_100002821 3300005338 Bacteria 12036
60 Ga0068868_100003863 3300005338 Bacteria 10455
61 Ga0068868_100019101 3300005338 Bacteria 5133
62 Ga0068868_100025367 3300005338 Unclassified 4509
63 Ga0068868_100039594 3300005338 Bacteria 3663
64 Ga0068868_100077887 3300005338 Unclassified 2653
65 Ga0068868_100273016 3300005338 Bacteria 1429
66 Ga0070660_100004187 3300005339 Bacteria 9960
67 Ga0070660_100004706 3300005339 Bacteria 9447
68 Ga0070660_100171539 3300005339 Bacteria 1752
69 Ga0070689_100000561 3300005340 Bacteria 22273
70 Ga0070689_100178614 3300005340 Bacteria 1723
71 Ga0070689_100432149 3300005340 Bacteria 1118
72 Ga0070691_10012237 3300005341 Bacteria 3927
73 Ga0070687_100000875 3300005343 Bacteria 10121
74 Ga0070687_100012958 3300005343 Bacteria 3700
75 Ga0070661_100003497 3300005344 Bacteria 10814
76 Ga0070661_100004646 3300005344 Bacteria 9458
77 Ga0070661_100012866 3300005344 Bacteria 5861
78 Ga0070661_100079448 3300005344 Bacteria 2420
79 Ga0070661_100775053 3300005344 Unclassified 785
80 Ga0070692_10184039 3300005345 Bacteria 1213
81 Ga0070692_10357521 3300005345 Unclassified 909
82 Ga0070668_100003183 3300005347 Bacteria 12094
83 Ga0070668_100009374 3300005347 Bacteria 7262
84 Ga0070668_100200725 3300005347 Bacteria 1637
85 Ga0070669_100000603 3300005353 Bacteria 26696
86 Ga0070669_100338753 3300005353 Bacteria 1218
87 Ga0070675_100004780 3300005354 Bacteria 10330
88 Ga0070675_100834027 3300005354 Bacteria 843
89 Ga0070671_100036446 3300005355 Bacteria 4079
90 Ga0070671_100040002 3300005355 Bacteria 3893
91 Ga0070671_100045883 3300005355 Bacteria 3633
92 Ga0070671_100377531 3300005355 Bacteria 1211
93 Ga0070671_100821451 3300005355 Unclassified 810
94 Ga0070674_100010541 3300005356 Bacteria 5594
95 Ga0070674_101829522 3300005356 Bacteria 551
96 Ga0070673_100010977 3300005364 Bacteria 6165
97 Ga0070673_100527069 3300005364 Unclassified 1071
98 Ga0070673_100691104 3300005364 Bacteria 936
99 Ga0070673_101461751 3300005364 Bacteria 644
100 Ga0070688_100003656 3300005365 Bacteria 7940
101 Ga0070688_100126054 3300005365 Bacteria 1721
102 Ga0070659_100003831 3300005366 Bacteria 10728
103 Ga0070659_100068855 3300005366 Bacteria 2808
104 Ga0070659_100077727 3300005366 Bacteria 2647
105 Ga0070659_100103438 3300005366 Bacteria 2294
106 Ga0070667_100020507 3300005367 Bacteria 5487
107 Ga0070667_100109111 3300005367 Bacteria 2398
108 Ga0070667_100140821 3300005367 Bacteria 2112
109 Ga0070667_101592768 3300005367 Bacteria 614
110 Ga0070709_10002168 3300005434 Bacteria 10639
111 Ga0070709_10056200 3300005434 Bacteria 2488
112 Ga0070709_10057313 3300005434 Bacteria 2467
113 Ga0070709_10089707 3300005434 Bacteria 2025
114 Ga0070709_10096139 3300005434 Bacteria 1964
115 Ga0070709_10125879 3300005434 Bacteria 1743
116 Ga0070709_10496101 3300005434 Bacteria 927
117 Ga0070709_10814621 3300005434 Bacteria 734
118 Ga0070709_11323534 3300005434 Bacteria 581
119 Ga0070714_100004032 3300005435 Bacteria 11040
120 Ga0070714_100039856 3300005435 Bacteria 3957
121 Ga0070714_100057676 3300005435 Bacteria 3325
122 Ga0070714_100058349 3300005435 Bacteria 3306
123 Ga0070714_100064938 3300005435 Bacteria 3143
124 Ga0070714_100159525 3300005435 Bacteria 2039
125 Ga0070714_100389250 3300005435 Bacteria 1316
126 Ga0070714_100481554 3300005435 Bacteria 1182
127 Ga0070714_101114057 3300005435 Bacteria 769
128 Ga0070714_101122127 3300005435 Unclassified 767
129 Ga0070714_101311596 3300005435 Bacteria 707
130 Ga0070714_101461329 3300005435 Bacteria 668
131 Ga0070714_101469283 3300005435 Bacteria 666
132 Ga0070713_100002203 3300005436 Bacteria 12625
133 Ga0070713_100017814 3300005436 Bacteria 5387
134 Ga0070713_100049015 3300005436 Bacteria 3482
135 Ga0070713_100070480 3300005436 Bacteria 2951
136 Ga0070713_100076373 3300005436 Bacteria 2845
137 Ga0070713_100076696 3300005436 Bacteria 2840
138 Ga0070713_100095167 3300005436 Bacteria 2568
139 Ga0070713_100135339 3300005436 Bacteria 2177
140 Ga0070713_100136809 3300005436 Bacteria 2166
141 Ga0070713_100178941 3300005436 Bacteria 1904
142 Ga0070713_100256439 3300005436 Bacteria 1597
143 Ga0070713_100285477 3300005436 Bacteria 1515
144 Ga0070713_100337334 3300005436 Bacteria 1396
145 Ga0070713_100530988 3300005436 Bacteria 1113
146 Ga0070713_101066122 3300005436 Bacteria 781
147 Ga0070713_101076650 3300005436 Bacteria 777
148 Ga0070713_101374802 3300005436 Bacteria 684
149 Ga0070713_101468437 3300005436 Bacteria 661
150 Ga0070713_101538408 3300005436 Bacteria 646
151 Ga0070713_101924419 3300005436 Bacteria 574
152 Ga0070713_101925833 3300005436 Bacteria 573
153 Ga0070710_10002827 3300005437 Bacteria 8277
154 Ga0070710_10044899 3300005437 Bacteria 2454
155 Ga0070710_10103590 3300005437 Bacteria 1699
156 Ga0070710_10190408 3300005437 Bacteria 1290
157 Ga0070710_10394818 3300005437 Bacteria 926
158 Ga0070710_10656947 3300005437 Bacteria 736
159 Ga0070710_10764752 3300005437 Bacteria 687
160 Ga0070710_10983980 3300005437 Bacteria 614
161 Ga0070701_10813381 3300005438 Unclassified 638
162 Ga0070711_100001744 3300005439 Bacteria 12078
163 Ga0070711_100002313 3300005439 Bacteria 10819
164 Ga0070711_100039697 3300005439 Bacteria 3171
165 Ga0070711_100042318 3300005439 Bacteria 3079
166 Ga0070711_100204168 3300005439 Bacteria 1527
167 Ga0070711_100242000 3300005439 Bacteria 1411
168 Ga0070711_100356588 3300005439 Bacteria 1177
169 Ga0070711_100490973 3300005439 Bacteria 1011
170 Ga0070711_100512876 3300005439 Bacteria 990
171 Ga0070711_101119248 3300005439 Bacteria 679
172 Ga0070711_101521046 3300005439 Bacteria 584
173 Ga0070705_100094915 3300005440 Bacteria 1869
174 Ga0070705_100845064 3300005440 Bacteria 732
175 Ga0070700_100028361 3300005441 Bacteria 3329
176 Ga0070700_100466445 3300005441 Bacteria 964
177 Ga0070694_100805243 3300005444 Bacteria 771
178 Ga0070708_100001021 3300005445 Bacteria 21313
179 Ga0070708_100004178 3300005445 Bacteria 11342
180 Ga0070708_100005868 3300005445 Bacteria 9749
181 Ga0070708_100009780 3300005445 Bacteria 7742
182 Ga0070708_100025531 3300005445 Bacteria 5051
183 Ga0070708_100064523 3300005445 Bacteria 3281
184 Ga0070708_100153659 3300005445 Bacteria 2141
185 Ga0070708_100154205 3300005445 Bacteria 2137
186 Ga0070708_100261212 3300005445 Bacteria 1628
187 Ga0070708_100933109 3300005445 Bacteria 814
188 Ga0070708_101197764 3300005445 Bacteria 710
189 Ga0070708_101234123 3300005445 Bacteria 699
190 Ga0070708_101742891 3300005445 Bacteria 579
191 Ga0070708_102019282 3300005445 Bacteria 534
192 Ga0070663_100038804 3300005455 Bacteria 3324
193 Ga0070663_100086332 3300005455 Bacteria 2317
194 Ga0070663_100338135 3300005455 Bacteria 1215
195 Ga0070663_101995251 3300005455 Unclassified 522
196 Ga0070678_100104871 3300005456 Bacteria 2199
197 Ga0070678_100269069 3300005456 Bacteria 1436
198 Ga0070678_100616479 3300005456 Unclassified 970
199 Ga0070678_100695862 3300005456 Bacteria 915
200 Ga0070678_101565272 3300005456 Bacteria 618
201 Ga0070662_100003296 3300005457 Bacteria 10056
202 Ga0070662_100213022 3300005457 Bacteria 1538
203 Ga0070662_101130172 3300005457 Bacteria 672
204 Ga0070681_10002831 3300005458 Bacteria 16031
205 Ga0070681_10014065 3300005458 Bacteria 7964
206 Ga0070681_10022642 3300005458 Bacteria 6310
207 Ga0070681_10093913 3300005458 Bacteria 2948
208 Ga0070681_10102463 3300005458 Bacteria 2807
209 Ga0070681_10299022 3300005458 Bacteria 1519
210 Ga0070681_10543460 3300005458 Bacteria 1075
211 Ga0070681_10662457 3300005458 Bacteria 959
212 Ga0068867_100004051 3300005459 Bacteria 10311
213 Ga0068867_100023454 3300005459 Bacteria 4417
214 Ga0068867_100124841 3300005459 Bacteria 1993
215 Ga0068867_100132066 3300005459 Bacteria 1942
216 Ga0070685_10024882 3300005466 Bacteria 3292
217 Ga0070685_10290172 3300005466 Bacteria 1098
218 Ga0070685_10304929 3300005466 Bacteria 1074
219 Ga0070706_100000278 3300005467 Bacteria 62365
220 Ga0070706_100000595 3300005467 Bacteria 41856
221 Ga0070706_100045927 3300005467 Bacteria 4032
222 Ga0070706_100497845 3300005467 Bacteria 1134
223 Ga0070706_101252364 3300005467 Bacteria 681
224 Ga0070707_100004455 3300005468 Bacteria 13112
225 Ga0070707_100145423 3300005468 Bacteria 2307
226 Ga0070707_100186138 3300005468 Unclassified 2025
227 Ga0070707_100196422 3300005468 Bacteria 1967
228 Ga0070707_100223122 3300005468 Bacteria 1835
229 Ga0070707_100250496 3300005468 Bacteria 1724
230 Ga0070707_100341025 3300005468 Bacteria 1456
231 Ga0070707_100345787 3300005468 Bacteria 1445
232 Ga0070707_102113389 3300005468 Bacteria 531
233 Ga0070707_102161417 3300005468 Bacteria 524
234 Ga0070698_100000133 3300005471 Bacteria 65381
235 Ga0070698_100078539 3300005471 Bacteria 3299
236 Ga0070698_102147803 3300005471 Bacteria 512
237 Ga0070699_100006520 3300005518 Bacteria 10162
238 Ga0070699_100106108 3300005518 Unclassified 2464
239 Ga0070699_100241825 3300005518 Bacteria 1611
240 Ga0070699_100681669 3300005518 Unclassified 938
241 Ga0070699_100881210 3300005518 Bacteria 820
242 Ga0070699_101130295 3300005518 Bacteria 719
243 Ga0070699_101717809 3300005518 Unclassified 575
244 Ga0070679_100177580 3300005530 Bacteria 2102
245 Ga0070679_100211260 3300005530 Bacteria 1904
246 Ga0070679_100230449 3300005530 Bacteria 1812
247 Ga0070679_100297156 3300005530 Bacteria 1566
248 Ga0070679_100300595 3300005530 Bacteria 1555
249 Ga0070679_100325599 3300005530 Bacteria 1486
250 Ga0070679_100664265 3300005530 Unclassified 985
251 Ga0070679_100781077 3300005530 Unclassified 898
252 Ga0070684_100001190 3300005535 Bacteria 18684
253 Ga0070684_100011291 3300005535 Bacteria 7110
254 Ga0070684_100074592 3300005535 Bacteria 2990
255 Ga0070684_100237320 3300005535 Bacteria 1665
256 Ga0070684_100269800 3300005535 Bacteria 1557
257 Ga0070697_100000049 3300005536 Bacteria 90362
258 Ga0070697_100000255 3300005536 Bacteria 43116
259 Ga0070697_100038208 3300005536 Unclassified 3878
260 Ga0070697_100143724 3300005536 Bacteria 2007
261 Ga0070697_100161770 3300005536 Bacteria 1891
262 Ga0070697_100576933 3300005536 Bacteria 987
263 Ga0070697_100580303 3300005536 Bacteria 984
264 Ga0070697_100631506 3300005536 Unclassified 942
265 Ga0068853_100002282 3300005539 Bacteria 14324
266 Ga0068853_100005173 3300005539 Bacteria 10199
267 Ga0068853_100062832 3300005539 Bacteria 3215
268 Ga0068853_100090596 3300005539 Unclassified 2688
269 Ga0068853_100631000 3300005539 Bacteria 1019
270 Ga0068853_101304336 3300005539 Bacteria 702
271 Ga0070672_100039356 3300005543 Unclassified 3621
272 Ga0070672_100188377 3300005543 Bacteria 1722
273 Ga0070672_100191392 3300005543 Bacteria 1708
274 Ga0070686_100003613 3300005544 Bacteria 8488
275 Ga0070686_100314088 3300005544 Unclassified 1166
276 Ga0070686_101232541 3300005544 Unclassified 622
277 Ga0070695_100061824 3300005545 Bacteria 2430
278 Ga0070695_100772022 3300005545 Bacteria 768
279 Ga0070696_100213201 3300005546 Bacteria 1446
280 Ga0070693_100029975 3300005547 Unclassified 2971
281 Ga0070693_100030630 3300005547 Bacteria 2943
282 Ga0070693_100139014 3300005547 Unclassified 1527
283 Ga0070693_100193703 3300005547 Bacteria 1316
284 Ga0070693_100360263 3300005547 Bacteria 998
285 Ga0070693_100680857 3300005547 Unclassified 751
286 Ga0070665_100022636 3300005548 Bacteria 6327
287 Ga0070665_100025132 3300005548 Bacteria 6001
288 Ga0070665_100623326 3300005548 Bacteria 1092
289 Ga0070704_101127413 3300005549 Unclassified 713
290 Ga0068855_100005674 3300005563 Bacteria 15246
291 Ga0068855_100006875 3300005563 Bacteria 13801
292 Ga0068855_100030538 3300005563 Bacteria 6444
293 Ga0068855_100147787 3300005563 Bacteria 2674
294 Ga0068855_100222617 3300005563 Bacteria 2115
295 Ga0068855_100391830 3300005563 Bacteria 1523
296 Ga0068855_100868288 3300005563 Bacteria 955
297 Ga0068855_102247423 3300005563 Bacteria 547
298 Ga0070664_100000307 3300005564 Bacteria 35638
299 Ga0070664_100184194 3300005564 Bacteria 1857
300 Ga0070664_100247992 3300005564 Bacteria 1600
301 Ga0070664_100347328 3300005564 Bacteria 1349
302 Ga0070664_100867620 3300005564 Bacteria 845
303 Ga0068857_100000052 3300005577 Bacteria 64590
304 Ga0068857_100000280 3300005577 Bacteria 34978
305 Ga0068857_100151484 3300005577 Unclassified 2101
306 Ga0068854_100002487 3300005578 Bacteria 11410
307 Ga0068854_100010775 3300005578 Bacteria 5933
308 Ga0068854_100088407 3300005578 Bacteria 2301
309 Ga0068854_100145669 3300005578 Bacteria 1822
310 Ga0068854_100221396 3300005578 Bacteria 1497
311 Ga0068856_100001757 3300005614 Bacteria 22667
312 Ga0068856_100002725 3300005614 Bacteria 18085
313 Ga0068856_100004534 3300005614 Bacteria 13808
314 Ga0068856_100004998 3300005614 Bacteria 13125
315 Ga0068856_100006513 3300005614 Bacteria 11452
316 Ga0068856_100011290 3300005614 Bacteria 8669
317 Ga0068856_100027037 3300005614 Bacteria 5597
318 Ga0068856_100045286 3300005614 Bacteria 4331
319 Ga0068856_100383503 3300005614 Bacteria 1425
320 Ga0068856_100634344 3300005614 Bacteria 1089
321 Ga0068856_101220961 3300005614 Bacteria 768
322 Ga0070702_100000721 3300005615 Bacteria 12525
323 Ga0070702_100221959 3300005615 Bacteria 1264
324 Ga0070702_100368888 3300005615 Bacteria 1017
325 Ga0070702_100507290 3300005615 Unclassified 887
326 Ga0070702_100584913 3300005615 Bacteria 834
327 Ga0068852_100004021 3300005616 Bacteria 10341
328 Ga0068852_100020726 3300005616 Bacteria 5231
329 Ga0068852_100100162 3300005616 Bacteria 2613
330 Ga0068852_100117037 3300005616 Unclassified 2433
331 Ga0068852_100290960 3300005616 Bacteria 1578
332 Ga0068852_100564179 3300005616 Bacteria 1140
333 Ga0068852_102685491 3300005616 Bacteria 517
334 Ga0068859_100003076 3300005617 Bacteria 16921
335 Ga0068859_100012521 3300005617 Bacteria 8532
336 Ga0068859_100025553 3300005617 Bacteria 5923
337 Ga0068859_100221358 3300005617 Bacteria 1980
338 Ga0068859_100416267 3300005617 Bacteria 1440
339 Ga0068864_100002285 3300005618 Bacteria 15846
340 Ga0068864_100065036 3300005618 Bacteria 3164
341 Ga0068864_100070751 3300005618 Bacteria 3036
342 Ga0068864_100275487 3300005618 Bacteria 1569
343 Ga0068864_100748190 3300005618 Bacteria 958
344 Ga0068866_10015153 3300005718 Unclassified 3421
345 Ga0068866_10057630 3300005718 Bacteria 2003
346 Ga0068866_10156913 3300005718 Bacteria 1323
347 Ga0068866_10488898 3300005718 Unclassified 812
348 Ga0068866_10758944 3300005718 Bacteria 671
349 Ga0068866_11461038 3300005718 Unclassified 501
350 Ga0068866_11473144 3300005718 Bacteria 500
351 Ga0068861_100013255 3300005719 Bacteria 5768
352 Ga0068861_100048205 3300005719 Bacteria 3219
353 Ga0068861_100057257 3300005719 Bacteria 2976
354 Ga0068861_100643871 3300005719 Bacteria 978
355 Ga0068851_10007893 3300005834 Unclassified 4902
356 Ga0068851_10179022 3300005834 Bacteria 1173
357 Ga0068851_10698684 3300005834 Unclassified 624
358 Ga0068851_10895653 3300005834 Bacteria 555
359 Ga0068870_10001049 3300005840 Bacteria 10932
360 Ga0068870_10356504 3300005840 Bacteria 940
361 Ga0068863_100006560 3300005841 Bacteria 11424
362 Ga0068863_100014255 3300005841 Bacteria 7658
363 Ga0068863_100033837 3300005841 Bacteria 4869
364 Ga0068863_100045475 3300005841 Unclassified 4166
365 Ga0068863_100058053 3300005841 Bacteria 3662
366 Ga0068863_100711822 3300005841 Unclassified 998
367 Ga0068863_100779727 3300005841 Bacteria 953
368 Ga0068858_100000802 3300005842 Bacteria 32930
369 Ga0068858_100015444 3300005842 Bacteria 7181
370 Ga0068858_100021307 3300005842 Bacteria 6054
371 Ga0068858_100046324 3300005842 Bacteria 4031
372 Ga0068858_100143828 3300005842 Bacteria 2239
373 Ga0068858_100243486 3300005842 Bacteria 1707
374 Ga0068858_100555543 3300005842 Unclassified 1111
375 Ga0068858_102335605 3300005842 Bacteria 528
376 Ga0068860_100033543 3300005843 Bacteria 4926
377 Ga0068860_100115830 3300005843 Bacteria 2563
378 Ga0068860_100140567 3300005843 Bacteria 2320
379 Ga0068860_100226953 3300005843 Bacteria 1814
380 Ga0068860_100248127 3300005843 Bacteria 1733
381 Ga0068860_101852911 3300005843 Unclassified 625
382 Ga0068860_102529411 3300005843 Bacteria 533
383 Ga0068862_100005831 3300005844 Bacteria 10268
384 Ga0068862_100066662 3300005844 Bacteria 3102
385 Ga0068862_100200934 3300005844 Bacteria 1797
386 Ga0068862_100290504 3300005844 Bacteria 1501
387 Ga0068862_100296503 3300005844 Bacteria 1486
388 Ga0068862_101258793 3300005844 Unclassified 740
389 Ga0081540_1064642 3300005983 Bacteria 1725
390 Ga0070717_10000478 3300006028 Bacteria 25528
391 Ga0070717_10027645 3300006028 Bacteria 4534
392 Ga0070717_10038603 3300006028 Bacteria 3882
393 Ga0070717_10051432 3300006028 Bacteria 3391
394 Ga0070717_10067234 3300006028 Bacteria 2981
395 Ga0070717_10106646 3300006028 Bacteria 2386
396 Ga0070717_10111034 3300006028 Bacteria 2339
397 Ga0070717_10169658 3300006028 Bacteria 1897
398 Ga0070717_10190428 3300006028 Bacteria 1792
399 Ga0070717_10265074 3300006028 Bacteria 1521
400 Ga0070717_10294431 3300006028 Unclassified 1442
401 Ga0070717_10311660 3300006028 Bacteria 1401
402 Ga0070717_10383900 3300006028 Bacteria 1260
403 Ga0070717_10449026 3300006028 Bacteria 1162
404 Ga0070717_11192592 3300006028 Bacteria 693
405 Ga0070717_11840043 3300006028 Bacteria 547
406 Ga0070715_10025533 3300006163 Unclassified 2342
407 Ga0070715_10046839 3300006163 Bacteria 1840
408 Ga0070715_10104417 3300006163 Bacteria 1327
409 Ga0070715_10228213 3300006163 Bacteria 961
410 Ga0070715_11020183 3300006163 Bacteria 517
411 Ga0070716_100000122 3300006173 Bacteria 30821
412 Ga0070716_100002719 3300006173 Bacteria 8197
413 Ga0070716_100017247 3300006173 Bacteria 3740
414 Ga0070716_100022175 3300006173 Bacteria 3353
415 Ga0070716_100023219 3300006173 Bacteria 3286
416 Ga0070716_100059433 3300006173 Bacteria 2204
417 Ga0070716_100127100 3300006173 Bacteria 1605
418 Ga0070716_100139877 3300006173 Bacteria 1542
419 Ga0070716_100147438 3300006173 Bacteria 1509
420 Ga0070716_100163169 3300006173 Bacteria 1446
421 Ga0070716_100324058 3300006173 Unclassified 1081
422 Ga0070716_100666016 3300006173 Bacteria 791
423 Ga0070716_101201202 3300006173 Bacteria 609
424 Ga0070712_100000604 3300006175 Bacteria 21049
425 Ga0070712_100002921 3300006175 Bacteria 10592
426 Ga0070712_100051522 3300006175 Bacteria 2867
427 Ga0070712_100139686 3300006175 Bacteria 1847
428 Ga0070712_100334611 3300006175 Bacteria 1235
429 Ga0070712_100628563 3300006175 Bacteria 911
430 Ga0070712_100993435 3300006175 Bacteria 726
431 Ga0070712_101621487 3300006175 Bacteria 566
432 Ga0097621_100000181 3300006237 Bacteria 40008
433 Ga0097621_100001506 3300006237 Bacteria 15948
434 Ga0097621_100002842 3300006237 Bacteria 11877
435 Ga0097621_100054324 3300006237 Bacteria 3266
436 Ga0097621_100065577 3300006237 Bacteria 2989
437 Ga0097621_100268527 3300006237 Bacteria 1498
438 Ga0097621_100292476 3300006237 Bacteria 1436
439 Ga0097621_100507075 3300006237 Bacteria 1093
440 Ga0097621_100638191 3300006237 Bacteria 976
441 Ga0068871_100000998 3300006358 Bacteria 18956
442 Ga0068871_100000999 3300006358 Bacteria 18956
443 Ga0068871_100002941 3300006358 Bacteria 11686
444 Ga0068871_100005659 3300006358 Bacteria 8767
445 Ga0068871_100010732 3300006358 Bacteria 6699
446 Ga0068871_100029585 3300006358 Bacteria 4303
447 Ga0068871_100041494 3300006358 Bacteria 3690
448 Ga0068871_100136354 3300006358 Bacteria 2084
449 Ga0068871_100340858 3300006358 Unclassified 1324
450 Ga0068871_100513946 3300006358 Bacteria 1081
451 Ga0075433_10000396 3300006852 Bacteria 27734
452 Ga0075433_10038134 3300006852 Bacteria 4149
453 Ga0075433_10445848 3300006852 Bacteria 1141
454 Ga0075434_100000839 3300006871 Bacteria 24421
455 Ga0075434_100000845 3300006871 Bacteria 24386
456 Ga0075434_100165682 3300006871 Bacteria 2230
457 Ga0075434_100560705 3300006871 Bacteria 1162
458 Ga0075434_101110809 3300006871 Bacteria 804
459 Ga0068865_100016388 3300006881 Bacteria 4742
460 Ga0068865_100074386 3300006881 Bacteria 2419
461 Ga0068865_100092582 3300006881 Bacteria 2196
462 Ga0068865_100492527 3300006881 Bacteria 1020
463 Ga0075436_100000632 3300006914 Bacteria 23148
464 Ga0075436_100018376 3300006914 Unclassified 4787
465 Ga0075436_100063787 3300006914 Bacteria 2546
466 Ga0075436_100076528 3300006914 Bacteria 2317
467 Ga0075436_100196118 3300006914 Bacteria 1429
468 Ga0075436_100379663 3300006914 Bacteria 1022
469 Ga0075436_100528632 3300006914 Bacteria 864
470 Ga0075436_100605053 3300006914 Unclassified 808
471 Ga0097620_100003076 3300006931 Bacteria 16921
472 Ga0097620_100012522 3300006931 Bacteria 8532
473 Ga0097620_100025553 3300006931 Bacteria 5923
474 Ga0097620_100221375 3300006931 Bacteria 1980
475 Ga0097620_100416303 3300006931 Bacteria 1440
476 Ga0075435_100000861 3300007076 Bacteria 18993
477 Ga0075435_100015875 3300007076 Bacteria 5667
478 Ga0075435_100087008 3300007076 Bacteria 2574
479 Ga0075435_100138280 3300007076 Bacteria 2042
480 Ga0075435_100244132 3300007076 Bacteria 1528
481 Ga0075435_100398215 3300007076 Unclassified 1184
482 Ga0075435_100516984 3300007076 Unclassified 1033
483 Ga0075435_100564805 3300007076 Bacteria 986
484 Ga0099794_10036946 3300007265 Bacteria 2311
485 Ga0099794_10045843 3300007265 Bacteria 2093
486 Ga0099794_10751266 3300007265 Unclassified 521
487 Ga0099795_10042447 3300007788 Bacteria 1624
488 Ga0099795_10216511 3300007788 Unclassified 814
489 Ga0099795_10552584 3300007788 Unclassified 543
490 Ga0105244_10441842 3300009036 Unclassified 598
491 Ga0105250_10051808 3300009092 Bacteria 1646
492 Ga0105250_10162974 3300009092 Bacteria 931
493 Ga0105250_10327658 3300009092 Bacteria 667
494 Ga0105250_10599143 3300009092 Bacteria 510
495 Ga0105240_10017493 3300009093 Bacteria 9660
496 Ga0105240_10052191 3300009093 Bacteria 5141
497 Ga0105240_10064311 3300009093 Unclassified 4559
498 Ga0105240_10100466 3300009093 Bacteria 3520
499 Ga0105240_10176589 3300009093 Bacteria 2525
500 Ga0105240_10200215 3300009093 Bacteria 2341
501 Ga0105240_10203733 3300009093 Bacteria 2317
502 Ga0105240_10613575 3300009093 Bacteria 1196
503 Ga0105240_10814277 3300009093 Bacteria 1011
504 Ga0105240_10976218 3300009093 Bacteria 907
505 Ga0105240_11351558 3300009093 Bacteria 750
506 Ga0111539_10267448 3300009094 Unclassified 1990
507 Ga0105245_10000979 3300009098 Bacteria 26081
508 Ga0105245_10004165 3300009098 Bacteria 12844
509 Ga0105245_10024319 3300009098 Bacteria 5318
510 Ga0105245_10086466 3300009098 Bacteria 2876
511 Ga0105245_10221678 3300009098 Bacteria 1825
512 Ga0105245_10553994 3300009098 Bacteria 1172
513 Ga0105245_10859936 3300009098 Bacteria 947
514 Ga0105245_10950032 3300009098 Bacteria 902
515 Ga0105245_11758589 3300009098 Bacteria 672
516 Ga0105247_10004042 3300009101 Bacteria 9434
517 Ga0105247_10126066 3300009101 Bacteria 1664
518 Ga0105247_10323048 3300009101 Bacteria 1077
519 Ga0114129_10180336 3300009147 Unclassified 2874
520 Ga0105243_11507440 3300009148 Bacteria 696
521 Ga0105241_10001985 3300009174 Bacteria 15492
522 Ga0105241_10005353 3300009174 Bacteria 9483
523 Ga0105241_10008557 3300009174 Bacteria 7525
524 Ga0105241_10010339 3300009174 Bacteria 6850
525 Ga0105241_10041900 3300009174 Bacteria 3461
526 Ga0105241_10047699 3300009174 Unclassified 3258
527 Ga0105241_10095263 3300009174 Bacteria 2356
528 Ga0105241_10136686 3300009174 Bacteria 1991
529 Ga0105241_10240042 3300009174 Bacteria 1531
530 Ga0105241_10264645 3300009174 Bacteria 1462
531 Ga0105241_10654729 3300009174 Bacteria 954
532 Ga0105241_11059784 3300009174 Unclassified 761
533 Ga0105242_10010997 3300009176 Bacteria 6952
534 Ga0105242_10017186 3300009176 Bacteria 5632
535 Ga0105242_10262687 3300009176 Bacteria 1560
536 Ga0105248_10009690 3300009177 Bacteria 10611
537 Ga0105248_10024516 3300009177 Bacteria 6706
538 Ga0105248_10107224 3300009177 Bacteria 3150
539 Ga0105248_10167670 3300009177 Bacteria 2475
540 Ga0105248_10480620 3300009177 Bacteria 1400
541 Ga0105248_10488817 3300009177 Bacteria 1387
542 Ga0105248_10560102 3300009177 Bacteria 1289
543 Ga0105248_10955152 3300009177 Bacteria 968
544 Ga0105237_10005157 3300009545 Bacteria 14785
545 Ga0105237_10016421 3300009545 Bacteria 7692
546 Ga0105237_10026217 3300009545 Bacteria 5958
547 Ga0105237_10053067 3300009545 Bacteria 4067
548 Ga0105237_10167340 3300009545 Bacteria 2198
549 Ga0105237_10180541 3300009545 Unclassified 2111
550 Ga0105237_10428991 3300009545 Unclassified 1327
551 Ga0105237_10460958 3300009545 Bacteria 1277
552 Ga0105237_10605787 3300009545 Unclassified 1102
553 Ga0105237_11583882 3300009545 Bacteria 662
554 Ga0105238_10000259 3300009551 Bacteria 59189
555 Ga0105238_10034947 3300009551 Bacteria 5113
556 Ga0105238_10035829 3300009551 Bacteria 5044
557 Ga0105238_10123885 3300009551 Bacteria 2564
558 Ga0105238_10389290 3300009551 Bacteria 1386
559 Ga0105238_10891548 3300009551 Bacteria 908
560 Ga0105238_10948417 3300009551 Bacteria 880
561 Ga0105238_11069682 3300009551 Bacteria 829
562 Ga0105238_11200045 3300009551 Unclassified 783
563 Ga0105238_12874889 3300009551 Unclassified 518
564 Ga0105249_10000536 3300009553 Bacteria 35037
565 Ga0105249_10012325 3300009553 Bacteria 7533
566 Ga0105249_10073394 3300009553 Bacteria 3165
567 Ga0105249_10251258 3300009553 Bacteria 1753
568 Ga0105249_10312847 3300009553 Bacteria 1579
569 Ga0105249_10481204 3300009553 Unclassified 1284
570 Ga0105249_11222732 3300009553 Unclassified 822
571 Ga0099796_10068845 3300010159 Bacteria 1273
572 Ga0105239_10019879 3300010375 Bacteria 7412
573 Ga0105239_10022575 3300010375 Bacteria 6939
574 Ga0105239_10023128 3300010375 Bacteria 6849
575 Ga0105239_10084013 3300010375 Bacteria 3506
576 Ga0105239_10100986 3300010375 Bacteria 3191
577 Ga0105239_10119848 3300010375 Bacteria 2921
578 Ga0105239_10314742 3300010375 Bacteria 1764
579 Ga0105239_10657495 3300010375 Bacteria 1197
580 Ga0105239_10824994 3300010375 Bacteria 1063
581 Ga0105239_11308317 3300010375 Bacteria 836
582 Ga0105239_12129718 3300010375 Bacteria 652
583 Ga0105239_12407892 3300010375 Bacteria 613
584 Ga0105246_10000747 3300011119 Bacteria 18502
585 Ga0105246_10026754 3300011119 Bacteria 3773
586 Ga0105246_10330292 3300011119 Bacteria 1242
587 Ga0105246_11664088 3300011119 Unclassified 605
588 Ga0157337_1001645 3300012483 Bacteria 1178
589 Ga0157337_1029714 3300012483 Bacteria 553
590 Ga0157339_1035240 3300012505 Bacteria 605
591 Ga0157316_1021853 3300012510 Bacteria 707
592 Ga0157326_1093107 3300012513 Bacteria 510
593 Ga0157373_10001041 3300013100 Bacteria 21375
594 Ga0157373_10001696 3300013100 Bacteria 16794
595 Ga0157373_10032936 3300013100 Bacteria 3730
596 Ga0157373_10086362 3300013100 Bacteria 2211
597 Ga0157373_10097402 3300013100 Bacteria 2071
598 Ga0157373_10254176 3300013100 Bacteria 1243
599 Ga0157373_10675133 3300013100 Unclassified 756
600 Ga0157373_10720048 3300013100 Bacteria 732
601 Ga0157373_11299280 3300013100 Bacteria 551
602 Ga0157371_10022718 3300013102 Bacteria 4590
603 Ga0157371_10047987 3300013102 Unclassified 3036
604 Ga0157371_10052195 3300013102 Unclassified 2904
605 Ga0157371_10115125 3300013102 Bacteria 1910
606 Ga0157371_10268693 3300013102 Bacteria 1230
607 Ga0157371_10421609 3300013102 Bacteria 978
608 Ga0157370_10036871 3300013104 Bacteria 4743
609 Ga0157370_10072702 3300013104 Bacteria 3244
610 Ga0157370_10308361 3300013104 Bacteria 1461
611 Ga0157370_10557035 3300013104 Unclassified 1051
612 Ga0157370_10639894 3300013104 Bacteria 972
613 Ga0157370_11155664 3300013104 Bacteria 699
614 Ga0157369_10005494 3300013105 Bacteria 14729
615 Ga0157369_10007593 3300013105 Bacteria 12476
616 Ga0157369_10024299 3300013105 Bacteria 6744
617 Ga0157369_10029962 3300013105 Bacteria 6007
618 Ga0157369_10044918 3300013105 Bacteria 4807
619 Ga0157369_10049521 3300013105 Bacteria 4554
620 Ga0157369_10074650 3300013105 Bacteria 3636
621 Ga0157369_10075926 3300013105 Bacteria 3602
622 Ga0157369_10097433 3300013105 Bacteria 3137
623 Ga0157369_10238024 3300013105 Bacteria 1902
624 Ga0157369_10254082 3300013105 Bacteria 1834
625 Ga0157369_10842640 3300013105 Bacteria 941
626 Ga0157369_10983075 3300013105 Bacteria 864
627 Ga0157374_10002163 3300013296 Bacteria 16565
628 Ga0157374_10008155 3300013296 Bacteria 8952
629 Ga0157374_10013453 3300013296 Bacteria 7141
630 Ga0157374_10025874 3300013296 Bacteria 5275
631 Ga0157374_10026893 3300013296 Bacteria 5181
632 Ga0157374_10033516 3300013296 Bacteria 4685
633 Ga0157374_10081108 3300013296 Unclassified 3078
634 Ga0157374_10229805 3300013296 Bacteria 1822
635 Ga0157374_10635086 3300013296 Bacteria 1079
636 Ga0157374_10674121 3300013296 Bacteria 1046
637 Ga0157374_10860523 3300013296 Unclassified 924
638 Ga0157374_11061443 3300013296 Bacteria 830
639 Ga0157374_11160190 3300013296 Bacteria 793
640 Ga0157374_11697597 3300013296 Unclassified 656
641 Ga0157378_10000029 3300013297 Bacteria 125377
642 Ga0157378_10000162 3300013297 Bacteria 63795
643 Ga0157378_10001916 3300013297 Bacteria 18684
644 Ga0157378_10037026 3300013297 Bacteria 4320
645 Ga0157378_10074747 3300013297 Bacteria 3050
646 Ga0157378_10265921 3300013297 Bacteria 1647
647 Ga0157378_11953741 3300013297 Bacteria 636
648 Ga0163162_10000471 3300013306 Bacteria 37412
649 Ga0163162_10011174 3300013306 Bacteria 8748
650 Ga0163162_10044127 3300013306 Unclassified 4465
651 Ga0163162_10079642 3300013306 Bacteria 3342
652 Ga0163162_10111146 3300013306 Bacteria 2838
653 Ga0163162_10111618 3300013306 Bacteria 2832
654 Ga0163162_10146893 3300013306 Bacteria 2474
655 Ga0163162_10437948 3300013306 Bacteria 1439
656 Ga0157372_10000416 3300013307 Bacteria 46749
657 Ga0157372_10001019 3300013307 Bacteria 30659
658 Ga0157372_10003722 3300013307 Bacteria 16384
659 Ga0157372_10005772 3300013307 Bacteria 13190
660 Ga0157372_10011557 3300013307 Bacteria 9392
661 Ga0157372_10016052 3300013307 Bacteria 8033
662 Ga0157372_10017575 3300013307 Bacteria 7674
663 Ga0157372_10109235 3300013307 Bacteria 3167
664 Ga0157372_10130438 3300013307 Bacteria 2892
665 Ga0157372_10196323 3300013307 Bacteria 2338
666 Ga0157372_10290914 3300013307 Bacteria 1900
667 Ga0157372_10430384 3300013307 Bacteria 1538
668 Ga0157375_10028596 3300013308 Bacteria 5228
669 Ga0157375_10055742 3300013308 Bacteria 3898
670 Ga0157375_10880173 3300013308 Bacteria 1041
671 Ga0157375_11667158 3300013308 Bacteria 754
672 Ga0157375_13281576 3300013308 Unclassified 539
673 Ga0163163_10003473 3300014325 Bacteria 13387
674 Ga0163163_10029534 3300014325 Bacteria 5275
675 Ga0163163_10057120 3300014325 Bacteria 3858
676 Ga0163163_10149594 3300014325 Bacteria 2379
677 Ga0163163_10160234 3300014325 Unclassified 2295
678 Ga0163163_10193941 3300014325 Bacteria 2079
679 Ga0163163_10219156 3300014325 Bacteria 1951
680 Ga0163163_10305621 3300014325 Bacteria 1643
681 Ga0163163_10899969 3300014325 Unclassified 948
682 Ga0163163_10992189 3300014325 Unclassified 903
683 Ga0163163_11018389 3300014325 Bacteria 891
684 Ga0163163_11192598 3300014325 Bacteria 824
685 Ga0163163_12351860 3300014325 Bacteria 591
686 Ga0157380_10217861 3300014326 Unclassified 1706
687 Ga0182008_10029411 3300014497 Bacteria 2776
688 Ga0182008_10042499 3300014497 Bacteria 2264
689 Ga0182008_10355155 3300014497 Bacteria 778
690 Ga0157377_10000277 3300014745 Bacteria 24525
691 Ga0157377_10095794 3300014745 Bacteria 1760
692 Ga0157377_10212598 3300014745 Bacteria 1234
693 Ga0157379_10016594 3300014968 Bacteria 6476
694 Ga0157379_10035343 3300014968 Bacteria 4456
695 Ga0157379_10188603 3300014968 Bacteria 1864
696 Ga0157379_10332722 3300014968 Bacteria 1388
697 Ga0157379_10648126 3300014968 Bacteria 989
698 Ga0157379_10698099 3300014968 Bacteria 952
699 Ga0157379_12669902 3300014968 Bacteria 501
700 Ga0157376_10016114 3300014969 Bacteria 5666
701 Ga0157376_10033356 3300014969 Bacteria 4145
702 Ga0157376_10083098 3300014969 Unclassified 2754
703 Ga0157376_10092267 3300014969 Bacteria 2625
704 Ga0157376_10248996 3300014969 Bacteria 1659
705 Ga0157376_10801279 3300014969 Bacteria 955
706 Ga0157376_11911733 3300014969 Bacteria 630
707 Ga0157376_12129865 3300014969 Bacteria 599
708 Ga0182006_1212500 3300015261 Bacteria 639
709 Ga0182007_10005375 3300015262 Bacteria 5631
710 Ga0182007_10012503 3300015262 Bacteria 3263
711 Ga0182007_10207527 3300015262 Bacteria 687
712 Ga0182005_1074833 3300015265 Unclassified 932
713 Ga0163161_10093260 3300017792 Bacteria 2231
714 Ga0206356_10599515 3300020070 Bacteria 1029
715 Ga0206352_10633791 3300020078 Bacteria 660
716 Ga0154015_1401803 3300020610 Bacteria 812
717 Ga0154015_1486212 3300020610 Bacteria 1070
718 Ga0213873_10001167 3300021358 Bacteria 4303
719 Ga0213874_10019506 3300021377 Bacteria 1846
720 Ga0213874_10143075 3300021377 Bacteria 829
721 Ga0213876_10132786 3300021384 Archaea 1324
722 Ga0224569_108131 3300022732 Bacteria 753
723 Ga0228600_1011841 3300024123 Bacteria 683
724 Ga0224572_1003306 3300024225 Bacteria 2711
725 Ga0224572_1008819 3300024225 Bacteria 1871
726 Ga0224572_1051692 3300024225 Bacteria 765
727 Ga0209437_102879 3300025233 Bacteria 3227
728 Ga0209233_1001463 3300025261 Bacteria 9318
729 Ga0207697_10006880 3300025315 Bacteria 5101
730 Ga0207656_10207589 3300025321 Bacteria 948
731 Ga0207656_10544732 3300025321 Unclassified 591
732 Ga0207696_1177061 3300025711 Bacteria 564
733 Ga0207682_10048244 3300025893 Bacteria 1755
734 Ga0207692_10010709 3300025898 Bacteria 3877
735 Ga0207692_10112707 3300025898 Bacteria 1511
736 Ga0207692_10458559 3300025898 Bacteria 803
737 Ga0207692_10511566 3300025898 Bacteria 763
738 Ga0207692_10694067 3300025898 Bacteria 660
739 Ga0207692_11210565 3300025898 Bacteria 502
740 Ga0207642_10032390 3300025899 Bacteria 2200
741 Ga0207642_10142054 3300025899 Bacteria 1267
742 Ga0207642_10650847 3300025899 Bacteria 660
743 Ga0207642_10993676 3300025899 Bacteria 540
744 Ga0207710_10013566 3300025900 Unclassified 3428
745 Ga0207688_10000388 3300025901 Bacteria 20579
746 Ga0207680_10132654 3300025903 Bacteria 1643
747 Ga0207680_10147676 3300025903 Unclassified 1565
748 Ga0207680_10464096 3300025903 Bacteria 899
749 Ga0207680_10621135 3300025903 Bacteria 773
750 Ga0207647_10000779 3300025904 Bacteria 24804
751 Ga0207647_10004209 3300025904 Bacteria 10673
752 Ga0207647_10008996 3300025904 Bacteria 7116
753 Ga0207647_10044898 3300025904 Bacteria 2759
754 Ga0207647_10170150 3300025904 Bacteria 1269
755 Ga0207685_10068268 3300025905 Bacteria 1432
756 Ga0207685_10109011 3300025905 Bacteria 1197
757 Ga0207685_10294209 3300025905 Bacteria 801
758 Ga0207699_10025078 3300025906 Bacteria 3270
759 Ga0207699_10042954 3300025906 Bacteria 2623
760 Ga0207699_10048808 3300025906 Bacteria 2488
761 Ga0207699_10098607 3300025906 Bacteria 1849
762 Ga0207699_10110411 3300025906 Bacteria 1761
763 Ga0207699_10280283 3300025906 Bacteria 1158
764 Ga0207699_10383897 3300025906 Bacteria 997
765 Ga0207699_10408795 3300025906 Bacteria 968
766 Ga0207699_10412030 3300025906 Bacteria 964
767 Ga0207699_10582425 3300025906 Bacteria 814
768 Ga0207699_10644850 3300025906 Bacteria 773
769 Ga0207699_10730114 3300025906 Bacteria 726
770 Ga0207699_10849670 3300025906 Bacteria 672
771 Ga0207699_10862537 3300025906 Bacteria 667
772 Ga0207645_10000028 3300025907 Bacteria 95418
773 Ga0207643_10000419 3300025908 Bacteria 28056
774 Ga0207643_10225594 3300025908 Bacteria 1148
775 Ga0207705_10055547 3300025909 Bacteria 2855
776 Ga0207705_10161576 3300025909 Bacteria 1683
777 Ga0207705_10258078 3300025909 Bacteria 1330
778 Ga0207684_10000283 3300025910 Bacteria 73904
779 Ga0207684_10032584 3300025910 Bacteria 4430
780 Ga0207684_10330577 3300025910 Bacteria 1313
781 Ga0207684_11076890 3300025910 Bacteria 670
782 Ga0207684_11231962 3300025910 Bacteria 618
783 Ga0207684_11258450 3300025910 Unclassified 611
784 Ga0207654_10008624 3300025911 Bacteria 5165
785 Ga0207654_10062808 3300025911 Unclassified 2177
786 Ga0207654_10113086 3300025911 Bacteria 1692
787 Ga0207654_10245212 3300025911 Bacteria 1199
788 Ga0207654_10245751 3300025911 Unclassified 1197
789 Ga0207654_10364573 3300025911 Bacteria 998
790 Ga0207654_10505132 3300025911 Bacteria 854
791 Ga0207654_10587732 3300025911 Bacteria 794
792 Ga0207654_10617758 3300025911 Bacteria 774
793 Ga0207654_11273988 3300025911 Bacteria 536
794 Ga0207707_10017412 3300025912 Bacteria 6265
795 Ga0207707_10049647 3300025912 Bacteria 3655
796 Ga0207707_10073636 3300025912 Bacteria 2978
797 Ga0207707_10149835 3300025912 Bacteria 2040
798 Ga0207707_10154367 3300025912 Bacteria 2007
799 Ga0207707_10225869 3300025912 Bacteria 1629
800 Ga0207707_10345980 3300025912 Bacteria 1281
801 Ga0207707_10398054 3300025912 Bacteria 1183
802 Ga0207695_10007994 3300025913 Bacteria 13327
803 Ga0207695_10022590 3300025913 Bacteria 7135
804 Ga0207695_10050323 3300025913 Bacteria 4384
805 Ga0207695_10101873 3300025913 Bacteria 2865
806 Ga0207695_10228140 3300025913 Bacteria 1768
807 Ga0207695_10582456 3300025913 Bacteria 1000
808 Ga0207695_10595434 3300025913 Bacteria 987
809 Ga0207695_10733919 3300025913 Bacteria 868
810 Ga0207671_10069938 3300025914 Bacteria 2616
811 Ga0207671_10244797 3300025914 Bacteria 1409
812 Ga0207671_10273344 3300025914 Bacteria 1331
813 Ga0207671_10390312 3300025914 Unclassified 1106
814 Ga0207671_10470581 3300025914 Unclassified 1001
815 Ga0207671_10612037 3300025914 Unclassified 868
816 Ga0207671_10845475 3300025914 Unclassified 725
817 Ga0207671_10932963 3300025914 Unclassified 685
818 Ga0207693_10000402 3300025915 Bacteria 39488
819 Ga0207693_10002534 3300025915 Bacteria 15879
820 Ga0207693_10011908 3300025915 Bacteria 7031
821 Ga0207693_10013610 3300025915 Bacteria 6556
822 Ga0207693_10015724 3300025915 Bacteria 6064
823 Ga0207693_10024315 3300025915 Unclassified 4808
824 Ga0207693_10096252 3300025915 Bacteria 2321
825 Ga0207693_10161385 3300025915 Bacteria 1764
826 Ga0207693_10367862 3300025915 Bacteria 1125
827 Ga0207693_10483841 3300025915 Unclassified 966
828 Ga0207693_11093755 3300025915 Unclassified 606
829 Ga0207663_10007982 3300025916 Bacteria 5519
830 Ga0207663_10021553 3300025916 Bacteria 3670
831 Ga0207663_10043016 3300025916 Bacteria 2763
832 Ga0207663_10064972 3300025916 Bacteria 2330
833 Ga0207663_10245685 3300025916 Bacteria 1315
834 Ga0207663_10300360 3300025916 Bacteria 1199
835 Ga0207663_10421729 3300025916 Bacteria 1024
836 Ga0207663_10519576 3300025916 Bacteria 927
837 Ga0207663_10818239 3300025916 Bacteria 742
838 Ga0207663_11368750 3300025916 Bacteria 570
839 Ga0207660_10120453 3300025917 Unclassified 1987
840 Ga0207660_10192261 3300025917 Bacteria 1590
841 Ga0207660_10220714 3300025917 Bacteria 1487
842 Ga0207660_10356371 3300025917 Bacteria 1173
843 Ga0207660_10524703 3300025917 Bacteria 962
844 Ga0207660_10946202 3300025917 Bacteria 703
845 Ga0207662_10003100 3300025918 Bacteria 8483
846 Ga0207662_10012909 3300025918 Bacteria 4662
847 Ga0207662_10294092 3300025918 Bacteria 1078
848 Ga0207657_10002130 3300025919 Bacteria 21445
849 Ga0207657_10003702 3300025919 Bacteria 16252
850 Ga0207657_10077184 3300025919 Bacteria 2808
851 Ga0207657_10173269 3300025919 Bacteria 1747
852 Ga0207649_10000466 3300025920 Bacteria 28974
853 Ga0207649_10151103 3300025920 Bacteria 1599
854 Ga0207649_10809404 3300025920 Bacteria 732
855 Ga0207649_10829842 3300025920 Unclassified 722
856 Ga0207649_10844389 3300025920 Bacteria 716
857 Ga0207649_11376848 3300025920 Unclassified 558
858 Ga0207652_10007037 3300025921 Bacteria 9065
859 Ga0207652_10139822 3300025921 Bacteria 2165
860 Ga0207652_10170544 3300025921 Bacteria 1952
861 Ga0207652_10259266 3300025921 Bacteria 1568
862 Ga0207652_10452131 3300025921 Bacteria 1158
863 Ga0207652_10794448 3300025921 Bacteria 841
864 Ga0207652_10799879 3300025921 Bacteria 837
865 Ga0207652_11656193 3300025921 Bacteria 544
866 Ga0207646_10003114 3300025922 Bacteria 19045
867 Ga0207646_10062706 3300025922 Bacteria 3319
868 Ga0207646_10066911 3300025922 Unclassified 3207
869 Ga0207646_10083033 3300025922 Unclassified 2865
870 Ga0207646_10204262 3300025922 Bacteria 1785
871 Ga0207646_10264033 3300025922 Bacteria 1556
872 Ga0207646_10340535 3300025922 Unclassified 1355
873 Ga0207646_10344018 3300025922 Bacteria 1347
874 Ga0207646_11590196 3300025922 Unclassified 564
875 Ga0207646_11649286 3300025922 Unclassified 552
876 Ga0207681_10109254 3300025923 Bacteria 2009
877 Ga0207681_10197584 3300025923 Bacteria 1542
878 Ga0207681_10412346 3300025923 Bacteria 1093
879 Ga0207681_11833190 3300025923 Unclassified 506
880 Ga0207694_10000652 3300025924 Bacteria 31375
881 Ga0207694_10135716 3300025924 Bacteria 1976
882 Ga0207694_10251486 3300025924 Unclassified 1446
883 Ga0207694_10367269 3300025924 Unclassified 1193
884 Ga0207694_10373180 3300025924 Bacteria 1183
885 Ga0207694_10591790 3300025924 Unclassified 933
886 Ga0207694_10640602 3300025924 Bacteria 895
887 Ga0207694_11438404 3300025924 Bacteria 582
888 Ga0207694_11455641 3300025924 Bacteria 578
889 Ga0207650_10000052 3300025925 Bacteria 165010
890 Ga0207650_10007804 3300025925 Bacteria 7294
891 Ga0207650_11543047 3300025925 Unclassified 564
892 Ga0207659_11520784 3300025926 Bacteria 572
893 Ga0207687_10002656 3300025927 Bacteria 12096
894 Ga0207687_10002692 3300025927 Bacteria 12021
895 Ga0207687_10043715 3300025927 Unclassified 3088
896 Ga0207687_10192746 3300025927 Bacteria 1587
897 Ga0207687_10959009 3300025927 Bacteria 733
898 Ga0207687_11314469 3300025927 Unclassified 621
899 Ga0207687_11877368 3300025927 Bacteria 512
900 Ga0207700_10010309 3300025928 Bacteria 5888
901 Ga0207700_10016603 3300025928 Bacteria 4896
902 Ga0207700_10041103 3300025928 Bacteria 3380
903 Ga0207700_10106643 3300025928 Bacteria 2246
904 Ga0207700_10190056 3300025928 Bacteria 1725
905 Ga0207700_10215277 3300025928 Bacteria 1626
906 Ga0207700_10253641 3300025928 Unclassified 1504
907 Ga0207700_10291109 3300025928 Bacteria 1407
908 Ga0207700_10322688 3300025928 Bacteria 1339
909 Ga0207700_10333574 3300025928 Bacteria 1317
910 Ga0207700_10337383 3300025928 Unclassified 1310
911 Ga0207700_10414798 3300025928 Bacteria 1182
912 Ga0207700_10476464 3300025928 Bacteria 1102
913 Ga0207700_10590474 3300025928 Bacteria 988
914 Ga0207700_10954346 3300025928 Bacteria 767
915 Ga0207664_10050192 3300025929 Bacteria 3289
916 Ga0207664_10115141 3300025929 Bacteria 2241
917 Ga0207664_10145632 3300025929 Unclassified 2008
918 Ga0207664_10148405 3300025929 Bacteria 1990
919 Ga0207664_10248189 3300025929 Bacteria 1552
920 Ga0207664_10311232 3300025929 Bacteria 1387
921 Ga0207664_10450596 3300025929 Bacteria 1148
922 Ga0207664_10492153 3300025929 Bacteria 1098
923 Ga0207664_10521175 3300025929 Bacteria 1065
924 Ga0207664_10859463 3300025929 Bacteria 815
925 Ga0207664_10930551 3300025929 Unclassified 780
926 Ga0207664_10945851 3300025929 Bacteria 773
927 Ga0207664_10952646 3300025929 Archaea 770
928 Ga0207664_11171897 3300025929 Bacteria 686
929 Ga0207644_10042968 3300025931 Unclassified 3205
930 Ga0207644_10128838 3300025931 Bacteria 1935
931 Ga0207644_10147128 3300025931 Bacteria 1820
932 Ga0207644_10570021 3300025931 Bacteria 938
933 Ga0207644_10845996 3300025931 Bacteria 766
934 Ga0207644_11176738 3300025931 Unclassified 644
935 Ga0207644_11493682 3300025931 Bacteria 567
936 Ga0207690_10003933 3300025932 Bacteria 8787
937 Ga0207690_10270201 3300025932 Bacteria 1320
938 Ga0207690_10278441 3300025932 Bacteria 1302
939 Ga0207690_10467374 3300025932 Bacteria 1016
940 Ga0207706_10000941 3300025933 Bacteria 29750
941 Ga0207706_10001265 3300025933 Bacteria 25483
942 Ga0207706_10008966 3300025933 Bacteria 9205
943 Ga0207706_10344789 3300025933 Bacteria 1295
944 Ga0207686_10004976 3300025934 Bacteria 7155
945 Ga0207686_10041868 3300025934 Bacteria 2796
946 Ga0207709_10651035 3300025935 Bacteria 839
947 Ga0207670_10389978 3300025936 Bacteria 1111
948 Ga0207670_10393429 3300025936 Bacteria 1106
949 Ga0207670_11530152 3300025936 Bacteria 567
950 Ga0207669_10656049 3300025937 Bacteria 858
951 Ga0207704_10022078 3300025938 Bacteria 3403
952 Ga0207704_10053233 3300025938 Bacteria 2459
953 Ga0207704_10810746 3300025938 Bacteria 782
954 Ga0207665_10002642 3300025939 Bacteria 12045
955 Ga0207665_10017742 3300025939 Bacteria 4677
956 Ga0207665_10018483 3300025939 Bacteria 4580
957 Ga0207665_10021171 3300025939 Bacteria 4274
958 Ga0207665_10025890 3300025939 Bacteria 3870
959 Ga0207665_10071214 3300025939 Bacteria 2373
960 Ga0207665_10083757 3300025939 Bacteria 2200
961 Ga0207665_10086101 3300025939 Bacteria 2170
962 Ga0207665_10114371 3300025939 Bacteria 1899
963 Ga0207665_10251341 3300025939 Bacteria 1306
964 Ga0207665_10479906 3300025939 Bacteria 958
965 Ga0207665_10484134 3300025939 Bacteria 954
966 Ga0207665_10488322 3300025939 Unclassified 950
967 Ga0207665_10679522 3300025939 Bacteria 808
968 Ga0207665_10910450 3300025939 Bacteria 698
969 Ga0207691_10001380 3300025940 Bacteria 24269
970 Ga0207711_10003898 3300025941 Bacteria 12836
971 Ga0207711_10114375 3300025941 Bacteria 2403
972 Ga0207711_10138237 3300025941 Bacteria 2190
973 Ga0207711_10419647 3300025941 Bacteria 1244
974 Ga0207711_10636263 3300025941 Unclassified 995
975 Ga0207711_10668577 3300025941 Bacteria 969
976 Ga0207711_10974258 3300025941 Bacteria 787
977 Ga0207711_11115753 3300025941 Bacteria 730
978 Ga0207711_11353172 3300025941 Unclassified 654
979 Ga0207689_10000394 3300025942 Bacteria 41129
980 Ga0207689_10000624 3300025942 Bacteria 33787
981 Ga0207689_10021271 3300025942 Bacteria 5453
982 Ga0207689_10119852 3300025942 Bacteria 2165
983 Ga0207689_10214793 3300025942 Bacteria 1589
984 Ga0207661_10000207 3300025944 Bacteria 38026
985 Ga0207661_10028276 3300025944 Bacteria 4292
986 Ga0207661_10047953 3300025944 Bacteria 3393
987 Ga0207661_10623723 3300025944 Unclassified 990
988 Ga0207661_11100971 3300025944 Bacteria 731
989 Ga0207661_11820572 3300025944 Bacteria 554
990 Ga0207679_10000068 3300025945 Bacteria 94173
991 Ga0207679_10011031 3300025945 Bacteria 5834
992 Ga0207679_10035727 3300025945 Bacteria 3518
993 Ga0207679_10297768 3300025945 Bacteria 1389
994 Ga0207679_10299160 3300025945 Bacteria 1386
995 Ga0207679_10388597 3300025945 Bacteria 1225
996 Ga0207679_10563628 3300025945 Bacteria 1023
997 Ga0207679_11770052 3300025945 Unclassified 565
998 Ga0207667_10000182 3300025949 Bacteria 91423
999 Ga0207667_10003330 3300025949 Bacteria 19833
1000 Ga0207667_10003515 3300025949 Bacteria 19377
1001 Ga0207667_10017624 3300025949 Bacteria 8034
1002 Ga0207667_10374787 3300025949 Bacteria 1450
1003 Ga0207667_10549560 3300025949 Bacteria 1168
1004 Ga0207667_10773499 3300025949 Bacteria 958
1005 Ga0207667_10797522 3300025949 Bacteria 941
1006 Ga0207667_10865071 3300025949 Bacteria 898
1007 Ga0207651_10031563 3300025960 Bacteria 3389
1008 Ga0207651_10300614 3300025960 Bacteria 1334
1009 Ga0207651_10543373 3300025960 Bacteria 1009
1010 Ga0207651_10557205 3300025960 Unclassified 997
1011 Ga0207651_10810081 3300025960 Unclassified 830
1012 Ga0207712_10009521 3300025961 Bacteria 6147
1013 Ga0207712_10055823 3300025961 Bacteria 2780
1014 Ga0207712_10525676 3300025961 Bacteria 1014
1015 Ga0207712_10557990 3300025961 Bacteria 986
1016 Ga0207668_11096560 3300025972 Bacteria 713
1017 Ga0207640_10010237 3300025981 Bacteria 5275
1018 Ga0207640_10073340 3300025981 Bacteria 2313
1019 Ga0207640_11437208 3300025981 Bacteria 618
1020 Ga0207658_10049080 3300025986 Unclassified 3099
1021 Ga0207658_10550632 3300025986 Unclassified 1032
1022 Ga0207677_10003533 3300026023 Bacteria 8282
1023 Ga0207677_10011145 3300026023 Bacteria 5112
1024 Ga0207677_10014423 3300026023 Unclassified 4615
1025 Ga0207677_10124190 3300026023 Bacteria 1947
1026 Ga0207677_10207554 3300026023 Bacteria 1562
1027 Ga0207677_10241867 3300026023 Bacteria 1461
1028 Ga0207677_10264664 3300026023 Bacteria 1403
1029 Ga0207677_12130119 3300026023 Unclassified 522
1030 Ga0207703_10002222 3300026035 Bacteria 17030
1031 Ga0207703_10002763 3300026035 Bacteria 15032
1032 Ga0207703_10016188 3300026035 Bacteria 5812
1033 Ga0207703_10104870 3300026035 Bacteria 2402
1034 Ga0207703_10265448 3300026035 Bacteria 1553
1035 Ga0207703_10356605 3300026035 Bacteria 1348
1036 Ga0207703_10517252 3300026035 Unclassified 1122
1037 Ga0207703_11087350 3300026035 Bacteria 768
1038 Ga0207703_11637061 3300026035 Bacteria 619
1039 Ga0207639_10018898 3300026041 Unclassified 4906
1040 Ga0207639_10168570 3300026041 Bacteria 1852
1041 Ga0207639_10230235 3300026041 Bacteria 1606
1042 Ga0207639_10460073 3300026041 Bacteria 1156
1043 Ga0207639_10603624 3300026041 Bacteria 1012
1044 Ga0207639_11193173 3300026041 Bacteria 714
1045 Ga0207678_10000833 3300026067 Bacteria 28257
1046 Ga0207678_10008752 3300026067 Bacteria 8909
1047 Ga0207708_10070591 3300026075 Bacteria 2674
1048 Ga0207708_10267701 3300026075 Bacteria 1381
1049 Ga0207702_10000794 3300026078 Bacteria 33513
1050 Ga0207702_10001724 3300026078 Bacteria 21538
1051 Ga0207702_10010990 3300026078 Bacteria 7551
1052 Ga0207702_10018260 3300026078 Bacteria 5802
1053 Ga0207702_10048597 3300026078 Unclassified 3578
1054 Ga0207702_10067710 3300026078 Bacteria 3065
1055 Ga0207702_10317888 3300026078 Bacteria 1482
1056 Ga0207702_10831221 3300026078 Bacteria 914
1057 Ga0207702_11145977 3300026078 Bacteria 772
1058 Ga0207702_11163172 3300026078 Bacteria 766
1059 Ga0207702_11308082 3300026078 Bacteria 719
1060 Ga0207702_11321293 3300026078 Bacteria 715
1061 Ga0207641_10000032 3300026088 Bacteria 221068
1062 Ga0207641_10017766 3300026088 Bacteria 5828
1063 Ga0207641_10141825 3300026088 Bacteria 2169
1064 Ga0207641_10170020 3300026088 Bacteria 1989
1065 Ga0207641_10203368 3300026088 Bacteria 1827
1066 Ga0207641_10235534 3300026088 Bacteria 1703
1067 Ga0207648_10000151 3300026089 Bacteria 69912
1068 Ga0207648_10015885 3300026089 Bacteria 6901
1069 Ga0207648_10035135 3300026089 Bacteria 4417
1070 Ga0207648_10097454 3300026089 Bacteria 2574
1071 Ga0207648_10390641 3300026089 Unclassified 1259
1072 Ga0207648_10634314 3300026089 Unclassified 987
1073 Ga0207648_10686585 3300026089 Bacteria 948
1074 Ga0207648_10844041 3300026089 Bacteria 854
1075 Ga0207676_10000333 3300026095 Bacteria 40650
1076 Ga0207676_10009692 3300026095 Bacteria 6848
1077 Ga0207676_10068471 3300026095 Bacteria 2839
1078 Ga0207676_10143769 3300026095 Bacteria 2045
1079 Ga0207676_10435406 3300026095 Bacteria 1233
1080 Ga0207676_12400827 3300026095 Unclassified 524
1081 Ga0207674_10000078 3300026116 Bacteria 104218
1082 Ga0207674_10000447 3300026116 Bacteria 53711
1083 Ga0207674_10050944 3300026116 Unclassified 4226
1084 Ga0207674_10372800 3300026116 Bacteria 1380
1085 Ga0207674_10647112 3300026116 Bacteria 1021
1086 Ga0207674_11509482 3300026116 Bacteria 641
1087 Ga0207675_100007755 3300026118 Bacteria 10130
1088 Ga0207675_100018663 3300026118 Bacteria 6474
1089 Ga0207675_100354204 3300026118 Bacteria 1439
1090 Ga0207683_10000042 3300026121 Bacteria 92530
1091 Ga0207683_10175191 3300026121 Bacteria 1944
1092 Ga0207683_10279497 3300026121 Bacteria 1525
1093 Ga0207683_10475241 3300026121 Bacteria 1153
1094 Ga0207683_11524264 3300026121 Unclassified 617
1095 Ga0207698_10054686 3300026142 Unclassified 3073
1096 Ga0207698_10128519 3300026142 Bacteria 2161
1097 Ga0207698_10233315 3300026142 Unclassified 1672
1098 Ga0207698_11470067 3300026142 Bacteria 697
1099 Ga0209588_1102948 3300027671 Bacteria 918
1100 Ga0265354_1001582 3300028016 Bacteria 3189
1101 Ga0265354_1004095 3300028016 Bacteria 1560
1102 Ga0265356_1010985 3300028017 Bacteria 1006
1103 Ga0265357_1015711 3300028023 Archaea 802
1104 Ga0268266_10008803 3300028379 Bacteria 8939
1105 Ga0268266_10768012 3300028379 Bacteria 930
1106 Ga0268265_10041404 3300028380 Bacteria 3409
1107 Ga0268265_10065312 3300028380 Unclassified 2807
1108 Ga0268265_10171260 3300028380 Bacteria 1856
1109 Ga0268265_10266398 3300028380 Bacteria 1526
1110 Ga0268264_10025516 3300028381 Unclassified 4829
1111 Ga0268264_10026658 3300028381 Bacteria 4723
1112 Ga0268264_10055381 3300028381 Bacteria 3314
1113 Ga0268264_10147249 3300028381 Bacteria 2107
1114 Ga0268264_10153901 3300028381 Bacteria 2064
1115 Ga0268264_11227514 3300028381 Unclassified 759
1116 Ga0265319_1070411 3300028563 Bacteria 1122
1117 Ga0265338_10001088 3300028800 Bacteria 45144
1118 Ga0265338_10073979 3300028800 Unclassified 2901
1119 Ga0265338_10112743 3300028800 Bacteria 2186
1120 Ga0265762_1000104 3300030760 Bacteria 12180
1121 Ga0265762_1014329 3300030760 Unclassified 1430
1122 Ga0265762_1059286 3300030760 Bacteria 784
1123 Ga0265765_1031027 3300030879 Bacteria 682
1124 Ga0265760_10000424 3300031090 Bacteria 11855
1125 Ga0265760_10001026 3300031090 Bacteria 8120
1126 Ga0265760_10001222 3300031090 Bacteria 7522
1127 Ga0265760_10003379 3300031090 Bacteria 4650
1128 Ga0265760_10115329 3300031090 Bacteria 859
1129 Ga0265760_10131730 3300031090 Bacteria 809
1130 Ga0265760_10163810 3300031090 Bacteria 735
1131 Ga0265760_10271619 3300031090 Bacteria 593
1132 Ga0265328_10152085 3300031239 Bacteria 871
1133 Ga0265325_10047696 3300031241 Unclassified 2216
1134 Ga0265325_10081997 3300031241 Bacteria 1602
1135 Ga0265329_10069491 3300031242 Bacteria 1114
1136 Ga0265340_10022332 3300031247 Unclassified 3236
1137 Ga0265340_10257486 3300031247 Bacteria 777
1138 Ga0265339_10010828 3300031249 Bacteria 5643
1139 Ga0265339_10185853 3300031249 Bacteria 1033
1140 Ga0265339_10377926 3300031249 Bacteria 664
1141 Ga0265331_10024473 3300031250 Unclassified 3054
1142 Ga0265327_10018371 3300031251 Bacteria 4339
1143 Ga0265316_10009449 3300031344 Bacteria 8981
1144 Ga0265316_10784716 3300031344 Bacteria 669
1145 Ga0307509_10903663 3300031507 Bacteria 548
1146 Ga0307408_100028359 3300031548 Bacteria 3868
1147 Ga0307408_100151157 3300031548 Bacteria 1833
1148 Ga0265313_10061785 3300031595 Unclassified 1752
1149 Ga0265313_10364089 3300031595 Bacteria 571
1150 Ga0265342_10191520 3300031712 Bacteria 1116
1151 Ga0307405_10036860 3300031731 Bacteria 2934
1152 Ga0307405_10235152 3300031731 Unclassified 1353
1153 Ga0307413_10821173 3300031824 Unclassified 783
1154 Ga0307410_10037879 3300031852 Bacteria 3154
1155 Ga0307410_11233183 3300031852 Bacteria 652
1156 Ga0307406_10077229 3300031901 Bacteria 2202
1157 Ga0307406_10193539 3300031901 Bacteria 1491
1158 Ga0307412_10587780 3300031911 Bacteria 941
1159 Ga0307409_100007574 3300031995 Bacteria 6507
1160 Ga0307409_100237662 3300031995 Bacteria 1656
1161 Ga0307416_100052747 3300032002 Bacteria 3258
1162 Ga0307416_100060319 3300032002 Bacteria 3089
1163 Ga0307416_100625143 3300032002 Bacteria 1159
1164 Ga0307416_103531987 3300032002 Bacteria 523
1165 Ga0307414_10219198 3300032004 Bacteria 1561
1166 Ga0307411_10005272 3300032005 Bacteria 6331
1167 Ga0307411_10055515 3300032005 Bacteria 2606
1168 Ga0307411_11947847 3300032005 Bacteria 548
1169 Ga0307415_100028639 3300032126 Bacteria 3547
1170 Ga0307415_100830272 3300032126 Unclassified 846
1171 Ga0316212_1024206 3300033547 Bacteria 851
1172 Ga0373930_0004763 3300034816 Bacteria 2225
1173 Ga0373930_0072414 3300034816 Bacteria 785
1174 Ga0373948_0036366 3300034817 Bacteria 1014
1175 Ga0373948_0154067 3300034817 Bacteria 576
1176 Ga0373938_0117920 3300034957 Bacteria 682
1177 Ga0373938_0233078 3300034957 Bacteria 521
1178 Ga0373928_0018190 3300035084 Bacteria 1454
1179 Ga0373940_0291297 3300035088 Bacteria 560
1180 Ga0373949_0150144 3300035090 Bacteria 673
1181 Ga0373951_0049847 3300035091 Bacteria 1028
1182 Ga0373923_0080670 3300035111 Bacteria 1411
1183 Ga0373923_0201563 3300035111 Bacteria 920
1184 Ga0373932_0039158 3300035112 Bacteria 1358
1185 Ga0373932_0344864 3300035112 Bacteria 565
1186 Ga0373936_0012871 3300035113 Bacteria 3189
1187 Ga0373936_0216097 3300035113 Unclassified 849
1188 Ga0373939_0054743 3300035114 Bacteria 1251
1189 Ga0373941_0065419 3300035115 Bacteria 1194
1190 Ga0373945_0258872 3300035116 Bacteria 737
1191 Ga0373945_0544479 3300035116 Unclassified 520
1192 Ga0373960_0016109 3300035121 Bacteria 1918
1193 Ga0373943_0100310 3300035170 Bacteria 1513
1194 Ga0373943_0232748 3300035170 Unclassified 1030
1195 Ga0373943_0780112 3300035170 Unclassified 568
1196 Ga0373955_0322178 3300035172 Bacteria 934
1197 Ga0373955_1027222 3300035172 Bacteria 508
1198 Ga0373942_0051057 3300035207 Bacteria 1160
1199 Ga0373942_0299060 3300035207 Bacteria 558
1200 Ga0373961_0417790 3300035241 Unclassified 518
1201 Ga0373962_0184372 3300035242 Bacteria 699
1202 Ga0373931_0003650 3300035691 Bacteria 6955
1203 Ga0373931_0050419 3300035691 Bacteria 2214
1204 Ga0373931_0604390 3300035691 Bacteria 717
1205 Ga0373935_0004737 3300035692 Bacteria 8002
1206 Ga0373935_0193273 3300035692 Unclassified 1403
1207 Ga0373935_0469788 3300035692 Unclassified 910
1208 Ga0373935_1276015 3300035692 Bacteria 548
1209 Ga0373927_0009241 3300035695 Bacteria 6612
1210 Ga0373927_0020158 3300035695 Bacteria 4372
1211 Ga0373927_0141683 3300035695 Bacteria 1573
1212 Ga0373927_0491173 3300035695 Bacteria 811
1213 Ga0373927_0650841 3300035695 Bacteria 696
1214 Ga0373927_0673286 3300035695 Bacteria 684
1215 Ga0373933_0307304 3300035724 Bacteria 1027
1216 Ga0373933_0472677 3300035724 Bacteria 821
1217 Ga0373933_0971303 3300035724 Unclassified 559
1218 Ga0373947_0030944 3300035725 Bacteria 3147
1219 Ga0373947_0196399 3300035725 Bacteria 1319
1220 Ga0373947_0638118 3300035725 Bacteria 726
1221 Ga0373947_0771710 3300035725 Bacteria 656
1222 Ga0373937_0125508 3300036401 Bacteria 2394
1223 Ga0373937_0462642 3300036401 Bacteria 1205
1224 Ga0373937_0519932 3300036401 Bacteria 1131
1225 Ga0373937_0844726 3300036401 Unclassified 864
1226 Ga0373925_0008856 3300037068 Bacteria 7330
1227 Ga0373925_0043294 3300037068 Bacteria 3341
1228 Ga0373925_0053355 3300037068 Unclassified 3022
1229 Ga0373925_0125552 3300037068 Bacteria 1996
1230 Ga0373925_0265821 3300037068 Bacteria 1379
1231 Ga0373925_0395939 3300037068 Bacteria 1126
1232 Ga0373925_1164065 3300037068 Bacteria 634
1233 Ga0395900_0811902 3300037418 Bacteria 863
1234 Ga0395898_0214047 3300037466 Bacteria 1838
1235 Ga0436364_0436695 3300037853 Unclassified 567
1236 Ga0242420_032002 3300038996 Bacteria 978
1237 Ga0436360_0060295 3300039438 Bacteria 742
1238 Ga0436360_0932365 3300039438 Bacteria 934
1239 Ga0436361_1086107 3300039447 Bacteria 1319
1240 Ga0436363_0248758 3300039450 Unclassified 1520
1241 Ga0436363_0536277 3300039450 Unclassified 983
1242 Ga0436363_0751323 3300039450 Bacteria 5032
1243 Ga0436363_1164548 3300039450 Bacteria 809
1244 Ga0436362_0739957 3300039453 Bacteria 11776
1245 Ga0451839_0626454 3300041496 Bacteria 607
1246 Ga0439444_0114669 3300042437 Bacteria 623
1247 Ga0451577_0000523 3300042876 Bacteria 63915
1248 Ga0453683_0053721 3300044673 Bacteria 2521
1249 Ga0466966_0263873 3300044684 Bacteria 1037
1250 Ga0466966_0779645 3300044684 Bacteria 576
1251 Ga0466961_0065080 3300044693 Bacteria 2317
1252 Ga0466961_0381538 3300044693 Unclassified 856
1253 Ga0466963_0149591 3300044694 Bacteria 1621
1254 Ga0466963_0446313 3300044694 Bacteria 913
1255 Ga0466963_0580123 3300044694 Bacteria 792
1256 Ga0466964_0091320 3300044706 Bacteria 1326
1257 Ga0453684_0000951 3300044712 Bacteria 95417
1258 Ga0466957_0191196 3300044842 Bacteria 1341
1259 Ga0466959_0352027 3300045049 Bacteria 1004
1260 Ga0451576_0003996 3300045051 Bacteria 19640
1261 Ga0451576_0050094 3300045051 Bacteria 4382
1262 Ga0451576_0440243 3300045051 Bacteria 1368
1263 Ga0451576_0687147 3300045051 Bacteria 1075
1264 Ga0451576_0942442 3300045051 Unclassified 905
1265 Ga0451576_1182981 3300045051 Unclassified 799
1266 Ga0466958_0086187 3300045836 Bacteria 1938
1267 Ga0466958_0356411 3300045836 Bacteria 942
1268 Ga0466967_0115740 3300045976 Bacteria 2469
1269 Ga0466967_0262803 3300045976 Bacteria 1652
1270 Ga0466967_0899730 3300045976 Bacteria 880
1271 Ga0466967_1021279 3300045976 Bacteria 823
1272 Ga0466967_1098126 3300045976 Bacteria 793
1273 Ga0466967_1518351 3300045976 Bacteria 667
1274 Ga0466967_1541482 3300045976 Bacteria 662
1275 Ga0495603_0133421 3300046455 Bacteria 1445
1276 Ga0495629_0358396 3300046459 Bacteria 994
1277 Ga0495651_0448451 3300046462 Bacteria 834
1278 Ga0495580_0001650 3300046472 Bacteria 19635
1279 Ga0495580_0002144 3300046472 Bacteria 17318
1280 Ga0495580_0004494 3300046472 Bacteria 11716
1281 Ga0495580_0004873 3300046472 Bacteria 11223
1282 Ga0495580_0005629 3300046472 Bacteria 10311
1283 Ga0495580_0038201 3300046472 Bacteria 3440
1284 Ga0495580_0081540 3300046472 Bacteria 2255
1285 Ga0495580_0190555 3300046472 Bacteria 1414
1286 Ga0495580_0677712 3300046472 Bacteria 676
1287 Ga0495580_0697340 3300046472 Bacteria 665
1288 Ga0495582_0001757 3300046473 Bacteria 12233
1289 Ga0495582_0080303 3300046473 Bacteria 1811
1290 Ga0495582_0137745 3300046473 Bacteria 1382
1291 Ga0495582_0614515 3300046473 Bacteria 629
1292 Ga0495639_0172445 3300046475 Bacteria 1050
1293 Ga0495594_0628899 3300046499 Bacteria 608
1294 Ga0495608_0584419 3300046511 Bacteria 671
1295 Ga0495628_0694579 3300046516 Bacteria 719
1296 Ga0495630_0639213 3300046517 Bacteria 815
1297 Ga0495666_0038004 3300046526 Bacteria 2342
1298 Ga0495642_0088724 3300046528 Unclassified 1308
1299 Ga0495665_0001542 3300046531 Bacteria 12287
1300 Ga0495665_0043792 3300046531 Bacteria 2380
1301 Ga0495665_0302484 3300046531 Bacteria 819
1302 Ga0495665_0520710 3300046531 Unclassified 598
1303 Ga0495586_0147439 3300046535 Bacteria 1323
1304 Ga0495587_0097146 3300046536 Unclassified 1699
1305 Ga0495587_0163603 3300046536 Bacteria 1266
1306 Ga0495587_0470093 3300046536 Bacteria 696
1307 Ga0495587_0829418 3300046536 Unclassified 504
1308 Ga0495645_0117702 3300046543 Bacteria 1874
1309 Ga0495645_0367218 3300046543 Bacteria 924
1310 Ga0495667_0095926 3300046559 Bacteria 1920
1311 Ga0495668_0169203 3300046616 Bacteria 1197
1312 Ga0495659_0029036 3300046664 Bacteria 1918
1313 Ga0495588_0178904 3300046674 Unclassified 1121
1314 Ga0495657_0677428 3300046675 Bacteria 594
1315 Ga0495623_0290338 3300046679 Bacteria 907
1316 Ga0495623_0484730 3300046679 Bacteria 654
1317 Ga0495646_0443496 3300046680 Bacteria 671
1318 Ga0495658_0113916 3300046683 Unclassified 1629
1319 Ga0495669_0006911 3300046684 Unclassified 4753
1320 Ga0495669_0230095 3300046684 Bacteria 889
1321 Ga0495669_0235917 3300046684 Bacteria 878
1322 Ga0495669_0266539 3300046684 Bacteria 823
1323 Ga0495600_0464071 3300046809 Bacteria 782
1324 Ga0495581_0198961 3300047315 Unclassified 1172
1325 Ga0495581_0292133 3300047315 Bacteria 953
1326 Ga0495604_0067772 3300047317 Unclassified 2711
1327 Ga0495636_0099653 3300047318 Unclassified 1269
1328 Ga0495674_0450793 3300047319 Bacteria 1034
1329 Ga0495674_0774659 3300047319 Unclassified 748
1330 Ga0495683_0273172 3300047323 Bacteria 734
1331 Ga0495675_0003156 3300047444 Bacteria 9890
1332 Ga0495675_0030018 3300047444 Unclassified 3469
1333 Ga0495675_0145504 3300047444 Bacteria 1467
1334 Ga0495677_0039698 3300047445 Bacteria 1721
1335 Ga0495684_0302291 3300047471 Bacteria 1149
1336 Ga0495686_0000035 3300047472 Bacteria 314930
1337 Ga0495686_0004908 3300047472 Bacteria 10782
1338 Ga0495686_0024909 3300047472 Bacteria 3926
1339 Ga0495593_0119934 3300047673 Bacteria 1339
1340 Ga0495602_0095505 3300048088 Bacteria 2454
1341 Ga0495602_0302883 3300048088 Bacteria 1169
1342 Ga0495602_0339611 3300048088 Bacteria 1087
1343 Ga0495602_0609863 3300048088 Bacteria 750
1344 Ga0495602_0730921 3300048088 Bacteria 669
1345 Ga0495602_0875100 3300048088 Bacteria 599
1346 Ga0496100_0003519 3300048903 Bacteria 8179
1347 Ga0496100_0025580 3300048903 Bacteria 3612
1348 Ga0496100_1184204 3300048903 Unclassified 603
1349 Ga0496101_0053213 3300048904 Unclassified 2920
1350 Ga0496101_0252917 3300048904 Bacteria 1373
1351 Ga0496101_0625295 3300048904 Unclassified 851
1352 Ga0496101_1142756 3300048904 Bacteria 611
1353 Ga0496102_0000786 3300048905 Bacteria 30824
1354 Ga0496102_0020216 3300048905 Bacteria 5881
1355 Ga0496102_0065308 3300048905 Bacteria 3335
1356 Ga0496102_0091110 3300048905 Bacteria 2822
1357 Ga0496102_0123337 3300048905 Unclassified 2421
1358 Ga0496102_0427224 3300048905 Bacteria 1244
1359 Ga0496102_0682247 3300048905 Bacteria 950
1360 Ga0496102_0928215 3300048905 Bacteria 792
1361 Ga0496102_1181674 3300048905 Bacteria 684
1362 Ga0496103_0009999 3300048906 Bacteria 5611
1363 Ga0496103_0437003 3300048906 Bacteria 840
1364 Ga0496103_0886084 3300048906 Bacteria 560
1365 Ga0496104_0000137 3300048907 Bacteria 67856
1366 Ga0496104_0056868 3300048907 Unclassified 3701
1367 Ga0496104_0087555 3300048907 Bacteria 2974
1368 Ga0496104_0162236 3300048907 Bacteria 2144
1369 Ga0496104_0470396 3300048907 Unclassified 1168
1370 Ga0496104_0608075 3300048907 Bacteria 1003
1371 Ga0496104_0716459 3300048907 Bacteria 908
1372 Ga0496104_1203399 3300048907 Bacteria 661
1373 Ga0496104_1731052 3300048907 Bacteria 527
1374 Ga0496104_1733582 3300048907 Bacteria 527
1375 Ga0496105_0198899 3300048908 Unclassified 1636
1376 Ga0496105_0248749 3300048908 Bacteria 1441
1377 Ga0496105_0346423 3300048908 Bacteria 1187
1378 Ga0496105_0701089 3300048908 Bacteria 777
1379 Ga0496105_0784200 3300048908 Unclassified 726
1380 Ga0496106_0013419 3300048909 Bacteria 6047
1381 Ga0496106_0031231 3300048909 Bacteria 3969
1382 Ga0496106_0050410 3300048909 Bacteria 3138
1383 Ga0496106_0058042 3300048909 Bacteria 2929
1384 Ga0496107_0042251 3300048910 Bacteria 3274
1385 Ga0496107_0200812 3300048910 Bacteria 1482
1386 Ga0496107_0273310 3300048910 Bacteria 1258
1387 Ga0496108_0002931 3300048911 Bacteria 13718
1388 Ga0496108_0099305 3300048911 Bacteria 2481
1389 Ga0496108_0657044 3300048911 Bacteria 911
1390 Ga0496108_1014237 3300048911 Unclassified 708
1391 Ga0496109_0001470 3300048912 Bacteria 19557
1392 Ga0496109_0173416 3300048912 Bacteria 2024
1393 Ga0496109_0517329 3300048912 Bacteria 1126
1394 Ga0496109_0708460 3300048912 Bacteria 944
1395 Ga0496109_1557296 3300048912 Bacteria 595
1396 Ga0496110_0003486 3300048913 Bacteria 12065
1397 Ga0496110_0048147 3300048913 Bacteria 3736
1398 Ga0496110_0178729 3300048913 Bacteria 1927
1399 Ga0496110_0806458 3300048913 Bacteria 843
1400 Ga0496110_1642391 3300048913 Bacteria 553
1401 Ga0496111_0041948 3300048914 Unclassified 3285
1402 Ga0496111_0235931 3300048914 Bacteria 1358
1403 Ga0496112_0000041 3300048915 Bacteria 88964
1404 Ga0496112_0009496 3300048915 Bacteria 8770
1405 Ga0496112_0038944 3300048915 Bacteria 4644
1406 Ga0496112_0045937 3300048915 Bacteria 4281
1407 Ga0496112_0066714 3300048915 Unclassified 3551
1408 Ga0496112_0101800 3300048915 Bacteria 2842
1409 Ga0496112_0106461 3300048915 Unclassified 2774
1410 Ga0496112_0121418 3300048915 Bacteria 2583
1411 Ga0496112_0234826 3300048915 Bacteria 1787
1412 Ga0496112_0289235 3300048915 Bacteria 1585
1413 Ga0496112_0414783 3300048915 Bacteria 1286
1414 Ga0496112_0486909 3300048915 Unclassified 1170
1415 Ga0496112_1536921 3300048915 Bacteria 579
1416 Ga0496112_1582220 3300048915 Bacteria 569
1417 Ga0496113_0000170 3300048916 Bacteria 28782
1418 Ga0496113_0037841 3300048916 Unclassified 3544
1419 Ga0496113_0141357 3300048916 Bacteria 1894
1420 Ga0496113_0363344 3300048916 Bacteria 1161
1421 Ga0496113_1118802 3300048916 Bacteria 617
1422 Ga0496114_0694438 3300048917 Bacteria 893
1423 Ga0496115_0066508 3300048918 Bacteria 2913
1424 Ga0496115_0455158 3300048918 Unclassified 1033
1425 Ga0496115_1067687 3300048918 Unclassified 614
1426 Ga0496120_0369124 3300048923 Bacteria 641
1427 Ga0496126_0000110 3300048929 Bacteria 196225
1428 Ga0496126_0006282 3300048929 Bacteria 13265
1429 Ga0501297_017415 3300049520 Bacteria 875
1430 Ga0501298_019834 3300049521 Bacteria 1248
1431 Ga0501069_0675344 3300049585 Bacteria 622
1432 Ga0501073_0091703 3300049589 Bacteria 2112
1433 Ga0501077_0081286 3300049593 Bacteria 2053
1434 Ga0501202_116273 3300049652 Bacteria 667
1435 Ga0501207_027749 3300049654 Bacteria 939
1436 Ga0501221_136968 3300049704 Bacteria 638
1437 Ga0501266_021858 3300049763 Bacteria 877
1438 Ga0501212_051207 3300049851 Bacteria 700
1439 nmdc:mga05p37_1626454_c1 3300050507 Unclassified 635
1440 nmdc:mga0n895_2065505_c1 3300050512 Archaea 527
1441 nmdc:mga0n895_279496_c1 3300050512 Bacteria 1693
1442 nmdc:mga0n895_29934_c1 3300050512 Bacteria 5198
1443 nmdc:mga0n895_3843_c1 3300050512 Bacteria 12190
1444 nmdc:mga0n895_480938_c1 3300050512 Bacteria 1252
1445 nmdc:mga0rr50_10973_c1 3300050513 Bacteria 5778
1446 nmdc:mga0rr50_182218_c1 3300050513 Unclassified 1717
1447 nmdc:mga0rr50_20989_c1 3300050513 Bacteria 4450
1448 nmdc:mga0rr50_302043_c1 3300050513 Bacteria 1339
1449 nmdc:mga0rr50_823996_c1 3300050513 Unclassified 792
1450 nmdc:mga0rr50_958_c1 3300050513 Bacteria 15640
1451 nmdc:mga08x19_13768_c1 3300050514 Bacteria 4897
1452 nmdc:mga08x19_2580_c1 3300050514 Unclassified 4846
1453 nmdc:mga08x19_267816_c1 3300050514 Bacteria 1182
1454 nmdc:mga08x19_283831_c1 3300050514 Bacteria 1148
1455 nmdc:mga08x19_432562_c1 3300050514 Bacteria 925
1456 nmdc:mga08x19_4525_c1 3300050514 Bacteria 8240
1457 nmdc:mga08x19_87014_c1 3300050514 Bacteria 2058
1458 nmdc:mga0a205_15885_c2 3300050515 Bacteria 4178
1459 nmdc:mga0a205_7106_c1 3300050515 Bacteria 10116
1460 Ga0495601_0019321 3300053077 Bacteria 4155
1461 Ga0495612_0439980 3300053078 Bacteria 595
1462 Ga0495612_0452251 3300053078 Bacteria 587
1463 Ga0495595_0636677 3300053084 Bacteria 546
1464 Ga0495619_0041163 3300053085 Bacteria 3022
1465 Ga0495619_0538093 3300053085 Bacteria 802
1466 Ga0500559_0079932 3300053136 Bacteria 1485
1467 Ga0501084_0485607 3300054114 Bacteria 1044
1468 Ga0587067_057455 3300059640 Unclassified 806
1469 Ga0466962_0534659 3300061719 Bacteria 595

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044694 Ga0466963_0149591 Ga0466963_0149591_840_1148 78
2 3300005293 Ga0065715_11005403 Ga0065715_110054031 89
3 3300005618 Ga0068864_100748190 Ga0068864_1007481902 89
4 3300005844 Ga0068862_101258793 Ga0068862_1012587932 89
5 3300007265 Ga0099794_10045843 Ga0099794_100458432 89
6 3300009553 Ga0105249_10312847 Ga0105249_103128472 89
7 3300013296 Ga0157374_11697597 Ga0157374_116975971 89
8 3300013306 Ga0163162_10437948 Ga0163162_104379482 89
9 3300013308 Ga0157375_13281576 Ga0157375_132815762 89
10 3300014325 Ga0163163_10219156 Ga0163163_102191562 89
11 3300014325 Ga0163163_10899969 Ga0163163_108999692 89
12 3300014969 Ga0157376_10016114 Ga0157376_100161145 89
13 3300014969 Ga0157376_10248996 Ga0157376_102489962 89
14 3300024123 Ga0228600_1011841 Ga0228600_10118411 89
15 3300024225 Ga0224572_1008819 Ga0224572_10088192 89
16 3300026095 Ga0207676_10435406 Ga0207676_104354062 89
17 3300026116 Ga0207674_11509482 Ga0207674_115094822 89
18 3300048903 Ga0496100_1184204 Ga0496100_1184204_118_387 89
19 3300050512 nmdc:mga0n895_279496_c1 nmdc:mga0n895_279496_c1_1366_1635 89
20 3300007788 Ga0099795_10042447 Ga0099795_100424472 90
21 3300007788 Ga0099795_10552584 Ga0099795_105525841 90
22 3300025920 Ga0207649_10809404 Ga0207649_108094041 90
23 3300000546 LJNas_1000036 LJNas_100003611 91
24 3300001976 JGI24752J21851_1007148 JGI24752J21851_10071482 91
25 3300001990 JGI24737J22298_10015197 JGI24737J22298_100151974 91
26 3300001991 JGI24743J22301_10054495 JGI24743J22301_100544951 91
27 3300002074 JGI24748J21848_1022754 JGI24748J21848_10227542 91
28 3300002239 JGI24034J26672_10001447 JGI24034J26672_100014474 91
29 3300002239 JGI24034J26672_10001666 JGI24034J26672_100016663 91
30 3300002459 JGI24751J29686_10001674 JGI24751J29686_100016744 91
31 3300004800 Ga0058861_10907943 Ga0058861_109079431 91
32 3300005276 Ga0065717_1012939 Ga0065717_10129391 91
33 3300005277 Ga0065716_1010305 Ga0065716_10103052 91
34 3300005290 Ga0065712_10167439 Ga0065712_101674391 91
35 3300005290 Ga0065712_10172437 Ga0065712_101724373 91
36 3300005290 Ga0065712_10187511 Ga0065712_101875112 91
37 3300005290 Ga0065712_10773954 Ga0065712_107739541 91
38 3300005293 Ga0065715_10014803 Ga0065715_100148033 91
39 3300005293 Ga0065715_10094290 Ga0065715_100942902 91
40 3300005327 Ga0070658_10010352 Ga0070658_100103521 91
41 3300005327 Ga0070658_10213155 Ga0070658_102131554 91
42 3300005327 Ga0070658_11168686 Ga0070658_111686862 91
43 3300005327 Ga0070658_11186799 Ga0070658_111867992 91
44 3300005328 Ga0070676_10001573 Ga0070676_100015732 91
45 3300005328 Ga0070676_10631973 Ga0070676_106319732 91
46 3300005329 Ga0070683_100028458 Ga0070683_1000284584 91
47 3300005329 Ga0070683_100038574 Ga0070683_1000385744 91
48 3300005329 Ga0070683_100121121 Ga0070683_1001211213 91
49 3300005329 Ga0070683_100321154 Ga0070683_1003211544 91
50 3300005329 Ga0070683_102103257 Ga0070683_1021032572 91
51 3300005330 Ga0070690_100002570 Ga0070690_1000025702 91
52 3300005330 Ga0070690_100314741 Ga0070690_1003147412 91
53 3300005331 Ga0070670_100000753 Ga0070670_10000075315 91
54 3300005331 Ga0070670_100041136 Ga0070670_1000411362 91
55 3300005331 Ga0070670_100155057 Ga0070670_1001550572 91
56 3300005331 Ga0070670_100160122 Ga0070670_1001601224 91
57 3300005331 Ga0070670_100363641 Ga0070670_1003636412 91
58 3300005333 Ga0070677_10022503 Ga0070677_100225032 91
59 3300005334 Ga0068869_100001656 Ga0068869_1000016566 91
60 3300005334 Ga0068869_100023395 Ga0068869_1000233954 91
61 3300005334 Ga0068869_100059236 Ga0068869_1000592363 91
62 3300005335 Ga0070666_10001676 Ga0070666_100016766 91
63 3300005335 Ga0070666_10022188 Ga0070666_100221883 91
64 3300005335 Ga0070666_10294937 Ga0070666_102949372 91
65 3300005336 Ga0070680_100013215 Ga0070680_1000132153 91
66 3300005336 Ga0070680_100032609 Ga0070680_1000326095 91
67 3300005336 Ga0070680_100136729 Ga0070680_1001367292 91
68 3300005336 Ga0070680_100175621 Ga0070680_1001756211 91
69 3300005336 Ga0070680_100355689 Ga0070680_1003556893 91
70 3300005336 Ga0070680_100358017 Ga0070680_1003580172 91
71 3300005336 Ga0070680_100446469 Ga0070680_1004464692 91
72 3300005336 Ga0070680_100505260 Ga0070680_1005052602 91
73 3300005336 Ga0070680_100839337 Ga0070680_1008393372 91
74 3300005336 Ga0070680_100966927 Ga0070680_1009669271 91
75 3300005336 Ga0070680_101283846 Ga0070680_1012838462 91
76 3300005337 Ga0070682_100007667 Ga0070682_1000076672 91
77 3300005337 Ga0070682_100040210 Ga0070682_1000402104 91
78 3300005337 Ga0070682_100178498 Ga0070682_1001784981 91
79 3300005337 Ga0070682_100439015 Ga0070682_1004390152 91
80 3300005338 Ga0068868_100002821 Ga0068868_1000028216 91
81 3300005338 Ga0068868_100003863 Ga0068868_1000038637 91
82 3300005338 Ga0068868_100019101 Ga0068868_1000191015 91
83 3300005338 Ga0068868_100025367 Ga0068868_1000253673 91
84 3300005338 Ga0068868_100039594 Ga0068868_1000395942 91
85 3300005338 Ga0068868_100077887 Ga0068868_1000778872 91
86 3300005338 Ga0068868_100273016 Ga0068868_1002730163 91
87 3300005339 Ga0070660_100004187 Ga0070660_1000041875 91
88 3300005339 Ga0070660_100004706 Ga0070660_1000047065 91
89 3300005339 Ga0070660_100171539 Ga0070660_1001715393 91
90 3300005340 Ga0070689_100000561 Ga0070689_1000005614 91
91 3300005340 Ga0070689_100178614 Ga0070689_1001786142 91
92 3300005340 Ga0070689_100432149 Ga0070689_1004321492 91
93 3300005341 Ga0070691_10012237 Ga0070691_100122374 91
94 3300005343 Ga0070687_100000875 Ga0070687_1000008759 91
95 3300005343 Ga0070687_100012958 Ga0070687_1000129582 91
96 3300005344 Ga0070661_100003497 Ga0070661_1000034975 91
97 3300005344 Ga0070661_100004646 Ga0070661_1000046468 91
98 3300005344 Ga0070661_100012866 Ga0070661_1000128665 91
99 3300005344 Ga0070661_100079448 Ga0070661_1000794484 91
100 3300005344 Ga0070661_100775053 Ga0070661_1007750531 91
101 3300005345 Ga0070692_10184039 Ga0070692_101840392 91
102 3300005345 Ga0070692_10357521 Ga0070692_103575212 91
103 3300005347 Ga0070668_100003183 Ga0070668_1000031839 91
104 3300005347 Ga0070668_100009374 Ga0070668_1000093745 91
105 3300005347 Ga0070668_100200725 Ga0070668_1002007253 91
106 3300005353 Ga0070669_100000603 Ga0070669_1000006038 91
107 3300005353 Ga0070669_100338753 Ga0070669_1003387532 91
108 3300005354 Ga0070675_100004780 Ga0070675_1000047809 91
109 3300005354 Ga0070675_100834027 Ga0070675_1008340273 91
110 3300005355 Ga0070671_100036446 Ga0070671_1000364463 91
111 3300005355 Ga0070671_100040002 Ga0070671_1000400023 91
112 3300005355 Ga0070671_100045883 Ga0070671_1000458833 91
113 3300005355 Ga0070671_100377531 Ga0070671_1003775313 91
114 3300005355 Ga0070671_100821451 Ga0070671_1008214512 91
115 3300005356 Ga0070674_100010541 Ga0070674_1000105414 91
116 3300005356 Ga0070674_101829522 Ga0070674_1018295222 91
117 3300005364 Ga0070673_100010977 Ga0070673_1000109775 91
118 3300005364 Ga0070673_100527069 Ga0070673_1005270692 91
119 3300005364 Ga0070673_100691104 Ga0070673_1006911042 91
120 3300005364 Ga0070673_101461751 Ga0070673_1014617511 91
121 3300005365 Ga0070688_100003656 Ga0070688_1000036564 91
122 3300005365 Ga0070688_100126054 Ga0070688_1001260541 91
123 3300005366 Ga0070659_100003831 Ga0070659_1000038314 91
124 3300005366 Ga0070659_100068855 Ga0070659_1000688554 91
125 3300005366 Ga0070659_100077727 Ga0070659_1000777273 91
126 3300005366 Ga0070659_100103438 Ga0070659_1001034382 91
127 3300005367 Ga0070667_100020507 Ga0070667_1000205075 91
128 3300005367 Ga0070667_100109111 Ga0070667_1001091112 91
129 3300005367 Ga0070667_100140821 Ga0070667_1001408212 91
130 3300005367 Ga0070667_101592768 Ga0070667_1015927681 91
131 3300005434 Ga0070709_10002168 Ga0070709_100021686 91
132 3300005434 Ga0070709_10056200 Ga0070709_100562002 91
133 3300005434 Ga0070709_10057313 Ga0070709_100573132 91
134 3300005434 Ga0070709_10089707 Ga0070709_100897072 91
135 3300005434 Ga0070709_10096139 Ga0070709_100961391 91
136 3300005434 Ga0070709_10125879 Ga0070709_101258793 91
137 3300005434 Ga0070709_10496101 Ga0070709_104961012 91
138 3300005434 Ga0070709_10814621 Ga0070709_108146211 91
139 3300005434 Ga0070709_11323534 Ga0070709_113235341 91
140 3300005435 Ga0070714_100004032 Ga0070714_1000040329 91
141 3300005435 Ga0070714_100039856 Ga0070714_1000398566 91
142 3300005435 Ga0070714_100057676 Ga0070714_1000576764 91
143 3300005435 Ga0070714_100058349 Ga0070714_1000583491 91
144 3300005435 Ga0070714_100064938 Ga0070714_1000649381 91
145 3300005435 Ga0070714_100159525 Ga0070714_1001595254 91
146 3300005435 Ga0070714_100389250 Ga0070714_1003892502 91
147 3300005435 Ga0070714_100481554 Ga0070714_1004815542 91
148 3300005435 Ga0070714_101114057 Ga0070714_1011140571 91
149 3300005435 Ga0070714_101122127 Ga0070714_1011221271 91
150 3300005435 Ga0070714_101311596 Ga0070714_1013115961 91
151 3300005435 Ga0070714_101461329 Ga0070714_1014613292 91
152 3300005435 Ga0070714_101469283 Ga0070714_1014692832 91
153 3300005436 Ga0070713_100002203 Ga0070713_1000022038 91
154 3300005436 Ga0070713_100017814 Ga0070713_1000178142 91
155 3300005436 Ga0070713_100049015 Ga0070713_1000490155 91
156 3300005436 Ga0070713_100070480 Ga0070713_1000704802 91
157 3300005436 Ga0070713_100076373 Ga0070713_1000763735 91
158 3300005436 Ga0070713_100076696 Ga0070713_1000766962 91
159 3300005436 Ga0070713_100095167 Ga0070713_1000951674 91
160 3300005436 Ga0070713_100135339 Ga0070713_1001353392 91
161 3300005436 Ga0070713_100136809 Ga0070713_1001368094 91
162 3300005436 Ga0070713_100178941 Ga0070713_1001789414 91
163 3300005436 Ga0070713_100256439 Ga0070713_1002564392 91
164 3300005436 Ga0070713_100285477 Ga0070713_1002854772 91
165 3300005436 Ga0070713_100337334 Ga0070713_1003373342 91
166 3300005436 Ga0070713_100530988 Ga0070713_1005309882 91
167 3300005436 Ga0070713_101066122 Ga0070713_1010661222 91
168 3300005436 Ga0070713_101076650 Ga0070713_1010766502 91
169 3300005436 Ga0070713_101374802 Ga0070713_1013748022 91
170 3300005436 Ga0070713_101468437 Ga0070713_1014684371 91
171 3300005436 Ga0070713_101538408 Ga0070713_1015384081 91
172 3300005436 Ga0070713_101924419 Ga0070713_1019244191 91
173 3300005436 Ga0070713_101925833 Ga0070713_1019258331 91
174 3300005437 Ga0070710_10002827 Ga0070710_100028278 91
175 3300005437 Ga0070710_10044899 Ga0070710_100448991 91
176 3300005437 Ga0070710_10103590 Ga0070710_101035902 91
177 3300005437 Ga0070710_10190408 Ga0070710_101904082 91
178 3300005437 Ga0070710_10394818 Ga0070710_103948182 91
179 3300005437 Ga0070710_10656947 Ga0070710_106569471 91
180 3300005437 Ga0070710_10764752 Ga0070710_107647522 91
181 3300005437 Ga0070710_10983980 Ga0070710_109839801 91
182 3300005438 Ga0070701_10813381 Ga0070701_108133811 91
183 3300005439 Ga0070711_100001744 Ga0070711_1000017445 91
184 3300005439 Ga0070711_100002313 Ga0070711_10000231310 91
185 3300005439 Ga0070711_100039697 Ga0070711_1000396972 91
186 3300005439 Ga0070711_100042318 Ga0070711_1000423184 91
187 3300005439 Ga0070711_100204168 Ga0070711_1002041683 91
188 3300005439 Ga0070711_100242000 Ga0070711_1002420003 91
189 3300005439 Ga0070711_100356588 Ga0070711_1003565883 91
190 3300005439 Ga0070711_100490973 Ga0070711_1004909733 91
191 3300005439 Ga0070711_100512876 Ga0070711_1005128762 91
192 3300005439 Ga0070711_101119248 Ga0070711_1011192481 91
193 3300005439 Ga0070711_101521046 Ga0070711_1015210461 91
194 3300005440 Ga0070705_100094915 Ga0070705_1000949153 91
195 3300005440 Ga0070705_100845064 Ga0070705_1008450641 91
196 3300005441 Ga0070700_100028361 Ga0070700_1000283614 91
197 3300005441 Ga0070700_100466445 Ga0070700_1004664452 91
198 3300005444 Ga0070694_100805243 Ga0070694_1008052431 91
199 3300005445 Ga0070708_100001021 Ga0070708_10000102111 91
200 3300005445 Ga0070708_100004178 Ga0070708_1000041784 91
201 3300005445 Ga0070708_100005868 Ga0070708_1000058686 91
202 3300005445 Ga0070708_100009780 Ga0070708_1000097807 91
203 3300005445 Ga0070708_100025531 Ga0070708_1000255316 91
204 3300005445 Ga0070708_100064523 Ga0070708_1000645233 91
205 3300005445 Ga0070708_100153659 Ga0070708_1001536594 91
206 3300005445 Ga0070708_100154205 Ga0070708_1001542052 91
207 3300005445 Ga0070708_100261212 Ga0070708_1002612123 91
208 3300005445 Ga0070708_100933109 Ga0070708_1009331092 91
209 3300005445 Ga0070708_101197764 Ga0070708_1011977641 91
210 3300005445 Ga0070708_101234123 Ga0070708_1012341231 91
211 3300005445 Ga0070708_101742891 Ga0070708_1017428911 91
212 3300005445 Ga0070708_102019282 Ga0070708_1020192822 91
213 3300005455 Ga0070663_100038804 Ga0070663_1000388043 91
214 3300005455 Ga0070663_100086332 Ga0070663_1000863323 91
215 3300005455 Ga0070663_100338135 Ga0070663_1003381352 91
216 3300005455 Ga0070663_101995251 Ga0070663_1019952511 91
217 3300005456 Ga0070678_100104871 Ga0070678_1001048712 91
218 3300005456 Ga0070678_100269069 Ga0070678_1002690692 91
219 3300005456 Ga0070678_100616479 Ga0070678_1006164792 91
220 3300005456 Ga0070678_100695862 Ga0070678_1006958621 91
221 3300005456 Ga0070678_101565272 Ga0070678_1015652721 91
222 3300005457 Ga0070662_100003296 Ga0070662_1000032968 91
223 3300005457 Ga0070662_100213022 Ga0070662_1002130222 91
224 3300005457 Ga0070662_101130172 Ga0070662_1011301721 91
225 3300005458 Ga0070681_10002831 Ga0070681_1000283115 91
226 3300005458 Ga0070681_10014065 Ga0070681_100140658 91
227 3300005458 Ga0070681_10022642 Ga0070681_100226428 91
228 3300005458 Ga0070681_10093913 Ga0070681_100939134 91
229 3300005458 Ga0070681_10102463 Ga0070681_101024632 91
230 3300005458 Ga0070681_10299022 Ga0070681_102990222 91
231 3300005458 Ga0070681_10543460 Ga0070681_105434601 91
232 3300005458 Ga0070681_10662457 Ga0070681_106624573 91
233 3300005459 Ga0068867_100004051 Ga0068867_1000040515 91
234 3300005459 Ga0068867_100023454 Ga0068867_1000234542 91
235 3300005459 Ga0068867_100124841 Ga0068867_1001248414 91
236 3300005459 Ga0068867_100132066 Ga0068867_1001320663 91
237 3300005466 Ga0070685_10024882 Ga0070685_100248823 91
238 3300005466 Ga0070685_10290172 Ga0070685_102901722 91
239 3300005466 Ga0070685_10304929 Ga0070685_103049291 91
240 3300005467 Ga0070706_100000278 Ga0070706_10000027858 91
241 3300005467 Ga0070706_100000595 Ga0070706_10000059530 91
242 3300005467 Ga0070706_100045927 Ga0070706_1000459274 91
243 3300005467 Ga0070706_100497845 Ga0070706_1004978451 91
244 3300005467 Ga0070706_101252364 Ga0070706_1012523642 91
245 3300005468 Ga0070707_100004455 Ga0070707_1000044557 91
246 3300005468 Ga0070707_100145423 Ga0070707_1001454233 91
247 3300005468 Ga0070707_100186138 Ga0070707_1001861382 91
248 3300005468 Ga0070707_100196422 Ga0070707_1001964224 91
249 3300005468 Ga0070707_100223122 Ga0070707_1002231222 91
250 3300005468 Ga0070707_100250496 Ga0070707_1002504962 91
251 3300005468 Ga0070707_100341025 Ga0070707_1003410251 91
252 3300005468 Ga0070707_100345787 Ga0070707_1003457873 91
253 3300005468 Ga0070707_102113389 Ga0070707_1021133892 91
254 3300005468 Ga0070707_102161417 Ga0070707_1021614171 91
255 3300005471 Ga0070698_100000133 Ga0070698_10000013331 91
256 3300005471 Ga0070698_100078539 Ga0070698_1000785392 91
257 3300005471 Ga0070698_102147803 Ga0070698_1021478032 91
258 3300005518 Ga0070699_100006520 Ga0070699_1000065204 91
259 3300005518 Ga0070699_100106108 Ga0070699_1001061083 91
260 3300005518 Ga0070699_100241825 Ga0070699_1002418253 91
261 3300005518 Ga0070699_100681669 Ga0070699_1006816692 91
262 3300005518 Ga0070699_100881210 Ga0070699_1008812102 91
263 3300005518 Ga0070699_101130295 Ga0070699_1011302952 91
264 3300005518 Ga0070699_101717809 Ga0070699_1017178092 91
265 3300005530 Ga0070679_100177580 Ga0070679_1001775804 91
266 3300005530 Ga0070679_100211260 Ga0070679_1002112604 91
267 3300005530 Ga0070679_100230449 Ga0070679_1002304493 91
268 3300005530 Ga0070679_100297156 Ga0070679_1002971562 91
269 3300005530 Ga0070679_100300595 Ga0070679_1003005953 91
270 3300005530 Ga0070679_100325599 Ga0070679_1003255993 91
271 3300005530 Ga0070679_100664265 Ga0070679_1006642652 91
272 3300005530 Ga0070679_100781077 Ga0070679_1007810772 91
273 3300005535 Ga0070684_100001190 Ga0070684_1000011907 91
274 3300005535 Ga0070684_100011291 Ga0070684_1000112914 91
275 3300005535 Ga0070684_100074592 Ga0070684_1000745923 91
276 3300005535 Ga0070684_100237320 Ga0070684_1002373202 91
277 3300005535 Ga0070684_100269800 Ga0070684_1002698002 91
278 3300005536 Ga0070697_100000049 Ga0070697_10000004919 91
279 3300005536 Ga0070697_100000255 Ga0070697_10000025522 91
280 3300005536 Ga0070697_100038208 Ga0070697_1000382082 91
281 3300005536 Ga0070697_100143724 Ga0070697_1001437243 91
282 3300005536 Ga0070697_100161770 Ga0070697_1001617702 91
283 3300005536 Ga0070697_100576933 Ga0070697_1005769332 91
284 3300005536 Ga0070697_100580303 Ga0070697_1005803032 91
285 3300005536 Ga0070697_100631506 Ga0070697_1006315061 91
286 3300005539 Ga0068853_100002282 Ga0068853_1000022829 91
287 3300005539 Ga0068853_100005173 Ga0068853_1000051737 91
288 3300005539 Ga0068853_100062832 Ga0068853_1000628322 91
289 3300005539 Ga0068853_100090596 Ga0068853_1000905963 91
290 3300005539 Ga0068853_100631000 Ga0068853_1006310002 91
291 3300005539 Ga0068853_101304336 Ga0068853_1013043361 91
292 3300005543 Ga0070672_100039356 Ga0070672_1000393563 91
293 3300005543 Ga0070672_100188377 Ga0070672_1001883772 91
294 3300005543 Ga0070672_100191392 Ga0070672_1001913922 91
295 3300005544 Ga0070686_100003613 Ga0070686_1000036138 91
296 3300005544 Ga0070686_100314088 Ga0070686_1003140881 91
297 3300005544 Ga0070686_101232541 Ga0070686_1012325411 91
298 3300005545 Ga0070695_100061824 Ga0070695_1000618244 91
299 3300005545 Ga0070695_100772022 Ga0070695_1007720222 91
300 3300005546 Ga0070696_100213201 Ga0070696_1002132012 91
301 3300005547 Ga0070693_100029975 Ga0070693_1000299754 91
302 3300005547 Ga0070693_100030630 Ga0070693_1000306301 91
303 3300005547 Ga0070693_100139014 Ga0070693_1001390142 91
304 3300005547 Ga0070693_100193703 Ga0070693_1001937033 91
305 3300005547 Ga0070693_100360263 Ga0070693_1003602632 91
306 3300005547 Ga0070693_100680857 Ga0070693_1006808572 91
307 3300005548 Ga0070665_100022636 Ga0070665_1000226366 91
308 3300005548 Ga0070665_100025132 Ga0070665_1000251324 91
309 3300005548 Ga0070665_100623326 Ga0070665_1006233262 91
310 3300005549 Ga0070704_101127413 Ga0070704_1011274132 91
311 3300005563 Ga0068855_100005674 Ga0068855_1000056744 91
312 3300005563 Ga0068855_100006875 Ga0068855_10000687512 91
313 3300005563 Ga0068855_100030538 Ga0068855_1000305383 91
314 3300005563 Ga0068855_100147787 Ga0068855_1001477872 91
315 3300005563 Ga0068855_100222617 Ga0068855_1002226172 91
316 3300005563 Ga0068855_100391830 Ga0068855_1003918303 91
317 3300005563 Ga0068855_100868288 Ga0068855_1008682882 91
318 3300005563 Ga0068855_102247423 Ga0068855_1022474231 91
319 3300005564 Ga0070664_100000307 Ga0070664_10000030719 91
320 3300005564 Ga0070664_100184194 Ga0070664_1001841943 91
321 3300005564 Ga0070664_100247992 Ga0070664_1002479921 91
322 3300005564 Ga0070664_100347328 Ga0070664_1003473282 91
323 3300005564 Ga0070664_100867620 Ga0070664_1008676201 91
324 3300005577 Ga0068857_100000052 Ga0068857_10000005232 91
325 3300005577 Ga0068857_100000280 Ga0068857_10000028021 91
326 3300005577 Ga0068857_100151484 Ga0068857_1001514842 91
327 3300005578 Ga0068854_100002487 Ga0068854_1000024876 91
328 3300005578 Ga0068854_100010775 Ga0068854_1000107755 91
329 3300005578 Ga0068854_100088407 Ga0068854_1000884073 91
330 3300005578 Ga0068854_100145669 Ga0068854_1001456694 91
331 3300005578 Ga0068854_100221396 Ga0068854_1002213962 91
332 3300005614 Ga0068856_100001757 Ga0068856_1000017577 91
333 3300005614 Ga0068856_100002725 Ga0068856_10000272511 91
334 3300005614 Ga0068856_100004534 Ga0068856_10000453412 91
335 3300005614 Ga0068856_100004998 Ga0068856_1000049989 91
336 3300005614 Ga0068856_100006513 Ga0068856_1000065138 91
337 3300005614 Ga0068856_100011290 Ga0068856_1000112906 91
338 3300005614 Ga0068856_100027037 Ga0068856_1000270372 91
339 3300005614 Ga0068856_100045286 Ga0068856_1000452865 91
340 3300005614 Ga0068856_100383503 Ga0068856_1003835033 91
341 3300005614 Ga0068856_100634344 Ga0068856_1006343442 91
342 3300005614 Ga0068856_101220961 Ga0068856_1012209612 91
343 3300005615 Ga0070702_100000721 Ga0070702_1000007212 91
344 3300005615 Ga0070702_100221959 Ga0070702_1002219591 91
345 3300005615 Ga0070702_100368888 Ga0070702_1003688881 91
346 3300005615 Ga0070702_100507290 Ga0070702_1005072902 91
347 3300005615 Ga0070702_100584913 Ga0070702_1005849131 91
348 3300005616 Ga0068852_100004021 Ga0068852_1000040215 91
349 3300005616 Ga0068852_100020726 Ga0068852_1000207267 91
350 3300005616 Ga0068852_100100162 Ga0068852_1001001622 91
351 3300005616 Ga0068852_100117037 Ga0068852_1001170372 91
352 3300005616 Ga0068852_100290960 Ga0068852_1002909603 91
353 3300005616 Ga0068852_100564179 Ga0068852_1005641793 91
354 3300005616 Ga0068852_102685491 Ga0068852_1026854911 91
355 3300005617 Ga0068859_100003076 Ga0068859_1000030767 91
356 3300005617 Ga0068859_100012521 Ga0068859_1000125214 91
357 3300005617 Ga0068859_100025553 Ga0068859_1000255534 91
358 3300005617 Ga0068859_100221358 Ga0068859_1002213582 91
359 3300005617 Ga0068859_100416267 Ga0068859_1004162672 91
360 3300005618 Ga0068864_100002285 Ga0068864_10000228512 91
361 3300005618 Ga0068864_100065036 Ga0068864_1000650364 91
362 3300005618 Ga0068864_100070751 Ga0068864_1000707511 91
363 3300005618 Ga0068864_100275487 Ga0068864_1002754872 91
364 3300005718 Ga0068866_10015153 Ga0068866_100151534 91
365 3300005718 Ga0068866_10057630 Ga0068866_100576302 91
366 3300005718 Ga0068866_10156913 Ga0068866_101569132 91
367 3300005718 Ga0068866_10488898 Ga0068866_104888982 91
368 3300005718 Ga0068866_10758944 Ga0068866_107589442 91
369 3300005718 Ga0068866_11461038 Ga0068866_114610381 91
370 3300005718 Ga0068866_11473144 Ga0068866_114731441 91
371 3300005719 Ga0068861_100013255 Ga0068861_1000132552 91
372 3300005719 Ga0068861_100048205 Ga0068861_1000482054 91
373 3300005719 Ga0068861_100057257 Ga0068861_1000572572 91
374 3300005719 Ga0068861_100643871 Ga0068861_1006438712 91
375 3300005834 Ga0068851_10007893 Ga0068851_100078936 91
376 3300005834 Ga0068851_10179022 Ga0068851_101790222 91
377 3300005834 Ga0068851_10698684 Ga0068851_106986842 91
378 3300005834 Ga0068851_10895653 Ga0068851_108956532 91
379 3300005840 Ga0068870_10001049 Ga0068870_100010499 91
380 3300005840 Ga0068870_10356504 Ga0068870_103565042 91
381 3300005841 Ga0068863_100006560 Ga0068863_1000065604 91
382 3300005841 Ga0068863_100014255 Ga0068863_1000142553 91
383 3300005841 Ga0068863_100033837 Ga0068863_1000338376 91
384 3300005841 Ga0068863_100045475 Ga0068863_1000454755 91
385 3300005841 Ga0068863_100058053 Ga0068863_1000580535 91
386 3300005841 Ga0068863_100711822 Ga0068863_1007118222 91
387 3300005841 Ga0068863_100779727 Ga0068863_1007797272 91
388 3300005842 Ga0068858_100000802 Ga0068858_10000080212 91
389 3300005842 Ga0068858_100015444 Ga0068858_1000154444 91
390 3300005842 Ga0068858_100021307 Ga0068858_1000213075 91
391 3300005842 Ga0068858_100046324 Ga0068858_1000463244 91
392 3300005842 Ga0068858_100143828 Ga0068858_1001438282 91
393 3300005842 Ga0068858_100243486 Ga0068858_1002434861 91
394 3300005842 Ga0068858_100555543 Ga0068858_1005555432 91
395 3300005842 Ga0068858_102335605 Ga0068858_1023356052 91
396 3300005843 Ga0068860_100033543 Ga0068860_1000335434 91
397 3300005843 Ga0068860_100115830 Ga0068860_1001158302 91
398 3300005843 Ga0068860_100140567 Ga0068860_1001405672 91
399 3300005843 Ga0068860_100226953 Ga0068860_1002269531 91
400 3300005843 Ga0068860_100248127 Ga0068860_1002481272 91
401 3300005843 Ga0068860_101852911 Ga0068860_1018529112 91
402 3300005843 Ga0068860_102529411 Ga0068860_1025294112 91
403 3300005844 Ga0068862_100005831 Ga0068862_1000058315 91
404 3300005844 Ga0068862_100066662 Ga0068862_1000666624 91
405 3300005844 Ga0068862_100200934 Ga0068862_1002009343 91
406 3300005844 Ga0068862_100290504 Ga0068862_1002905042 91
407 3300005844 Ga0068862_100296503 Ga0068862_1002965033 91
408 3300005983 Ga0081540_1064642 Ga0081540_10646421 91
409 3300006028 Ga0070717_10000478 Ga0070717_1000047821 91
410 3300006028 Ga0070717_10027645 Ga0070717_100276454 91
411 3300006028 Ga0070717_10038603 Ga0070717_100386032 91
412 3300006028 Ga0070717_10051432 Ga0070717_100514322 91
413 3300006028 Ga0070717_10067234 Ga0070717_100672343 91
414 3300006028 Ga0070717_10106646 Ga0070717_101066464 91
415 3300006028 Ga0070717_10111034 Ga0070717_101110344 91
416 3300006028 Ga0070717_10169658 Ga0070717_101696582 91
417 3300006028 Ga0070717_10190428 Ga0070717_101904284 91
418 3300006028 Ga0070717_10265074 Ga0070717_102650741 91
419 3300006028 Ga0070717_10294431 Ga0070717_102944312 91
420 3300006028 Ga0070717_10311660 Ga0070717_103116602 91
421 3300006028 Ga0070717_10383900 Ga0070717_103839002 91
422 3300006028 Ga0070717_10449026 Ga0070717_104490262 91
423 3300006028 Ga0070717_11192592 Ga0070717_111925922 91
424 3300006028 Ga0070717_11840043 Ga0070717_118400431 91
425 3300006163 Ga0070715_10025533 Ga0070715_100255335 91
426 3300006163 Ga0070715_10046839 Ga0070715_100468392 91
427 3300006163 Ga0070715_10104417 Ga0070715_101044172 91
428 3300006163 Ga0070715_10228213 Ga0070715_102282132 91
429 3300006163 Ga0070715_11020183 Ga0070715_110201831 91
430 3300006173 Ga0070716_100000122 Ga0070716_1000001222 91
431 3300006173 Ga0070716_100002719 Ga0070716_1000027195 91
432 3300006173 Ga0070716_100017247 Ga0070716_1000172474 91
433 3300006173 Ga0070716_100022175 Ga0070716_1000221752 91
434 3300006173 Ga0070716_100023219 Ga0070716_1000232192 91
435 3300006173 Ga0070716_100059433 Ga0070716_1000594332 91
436 3300006173 Ga0070716_100127100 Ga0070716_1001271005 91
437 3300006173 Ga0070716_100139877 Ga0070716_1001398771 91
438 3300006173 Ga0070716_100147438 Ga0070716_1001474383 91
439 3300006173 Ga0070716_100163169 Ga0070716_1001631693 91
440 3300006173 Ga0070716_100324058 Ga0070716_1003240581 91
441 3300006173 Ga0070716_100666016 Ga0070716_1006660162 91
442 3300006173 Ga0070716_101201202 Ga0070716_1012012021 91
443 3300006175 Ga0070712_100000604 Ga0070712_10000060410 91
444 3300006175 Ga0070712_100002921 Ga0070712_1000029215 91
445 3300006175 Ga0070712_100051522 Ga0070712_1000515224 91
446 3300006175 Ga0070712_100139686 Ga0070712_1001396865 91
447 3300006175 Ga0070712_100334611 Ga0070712_1003346112 91
448 3300006175 Ga0070712_100628563 Ga0070712_1006285631 91
449 3300006175 Ga0070712_100993435 Ga0070712_1009934352 91
450 3300006175 Ga0070712_101621487 Ga0070712_1016214872 91
451 3300006237 Ga0097621_100000181 Ga0097621_10000018115 91
452 3300006237 Ga0097621_100001506 Ga0097621_1000015062 91
453 3300006237 Ga0097621_100002842 Ga0097621_1000028429 91
454 3300006237 Ga0097621_100054324 Ga0097621_1000543242 91
455 3300006237 Ga0097621_100065577 Ga0097621_1000655773 91
456 3300006237 Ga0097621_100268527 Ga0097621_1002685272 91
457 3300006237 Ga0097621_100292476 Ga0097621_1002924762 91
458 3300006237 Ga0097621_100507075 Ga0097621_1005070752 91
459 3300006237 Ga0097621_100638191 Ga0097621_1006381912 91
460 3300006358 Ga0068871_100000998 Ga0068871_10000099820 91
461 3300006358 Ga0068871_100000999 Ga0068871_10000099918 91
462 3300006358 Ga0068871_100002941 Ga0068871_1000029415 91
463 3300006358 Ga0068871_100005659 Ga0068871_10000565910 91
464 3300006358 Ga0068871_100010732 Ga0068871_1000107327 91
465 3300006358 Ga0068871_100029585 Ga0068871_1000295853 91
466 3300006358 Ga0068871_100041494 Ga0068871_1000414944 91
467 3300006358 Ga0068871_100136354 Ga0068871_1001363542 91
468 3300006358 Ga0068871_100340858 Ga0068871_1003408581 91
469 3300006358 Ga0068871_100513946 Ga0068871_1005139462 91
470 3300006852 Ga0075433_10000396 Ga0075433_1000039610 91
471 3300006852 Ga0075433_10038134 Ga0075433_100381345 91
472 3300006852 Ga0075433_10445848 Ga0075433_104458483 91
473 3300006871 Ga0075434_100000839 Ga0075434_10000083910 91
474 3300006871 Ga0075434_100000845 Ga0075434_10000084523 91
475 3300006871 Ga0075434_100165682 Ga0075434_1001656824 91
476 3300006871 Ga0075434_100560705 Ga0075434_1005607052 91
477 3300006871 Ga0075434_101110809 Ga0075434_1011108091 91
478 3300006881 Ga0068865_100016388 Ga0068865_1000163884 91
479 3300006881 Ga0068865_100074386 Ga0068865_1000743863 91
480 3300006881 Ga0068865_100092582 Ga0068865_1000925823 91
481 3300006881 Ga0068865_100492527 Ga0068865_1004925272 91
482 3300006914 Ga0075436_100000632 Ga0075436_10000063216 91
483 3300006914 Ga0075436_100018376 Ga0075436_1000183762 91
484 3300006914 Ga0075436_100063787 Ga0075436_1000637875 91
485 3300006914 Ga0075436_100076528 Ga0075436_1000765282 91
486 3300006914 Ga0075436_100196118 Ga0075436_1001961182 91
487 3300006914 Ga0075436_100379663 Ga0075436_1003796632 91
488 3300006914 Ga0075436_100528632 Ga0075436_1005286322 91
489 3300006914 Ga0075436_100605053 Ga0075436_1006050532 91
490 3300006931 Ga0097620_100003076 Ga0097620_1000030767 91
491 3300006931 Ga0097620_100012522 Ga0097620_1000125224 91
492 3300006931 Ga0097620_100025553 Ga0097620_1000255535 91
493 3300006931 Ga0097620_100221375 Ga0097620_1002213752 91
494 3300006931 Ga0097620_100416303 Ga0097620_1004163032 91
495 3300007076 Ga0075435_100000861 Ga0075435_10000086110 91
496 3300007076 Ga0075435_100015875 Ga0075435_1000158754 91
497 3300007076 Ga0075435_100087008 Ga0075435_1000870084 91
498 3300007076 Ga0075435_100138280 Ga0075435_1001382803 91
499 3300007076 Ga0075435_100244132 Ga0075435_1002441323 91
500 3300007076 Ga0075435_100398215 Ga0075435_1003982152 91
501 3300007076 Ga0075435_100516984 Ga0075435_1005169842 91
502 3300007076 Ga0075435_100564805 Ga0075435_1005648054 91
503 3300007265 Ga0099794_10036946 Ga0099794_100369462 91
504 3300007265 Ga0099794_10751266 Ga0099794_107512662 91
505 3300007788 Ga0099795_10216511 Ga0099795_102165112 91
506 3300009036 Ga0105244_10441842 Ga0105244_104418421 91
507 3300009092 Ga0105250_10051808 Ga0105250_100518082 91
508 3300009092 Ga0105250_10162974 Ga0105250_101629742 91
509 3300009092 Ga0105250_10327658 Ga0105250_103276582 91
510 3300009092 Ga0105250_10599143 Ga0105250_105991432 91
511 3300009093 Ga0105240_10017493 Ga0105240_100174938 91
512 3300009093 Ga0105240_10052191 Ga0105240_100521915 91
513 3300009093 Ga0105240_10064311 Ga0105240_100643116 91
514 3300009093 Ga0105240_10100466 Ga0105240_101004666 91
515 3300009093 Ga0105240_10176589 Ga0105240_101765893 91
516 3300009093 Ga0105240_10200215 Ga0105240_102002151 91
517 3300009093 Ga0105240_10203733 Ga0105240_102037334 91
518 3300009093 Ga0105240_10613575 Ga0105240_106135752 91
519 3300009093 Ga0105240_10814277 Ga0105240_108142772 91
520 3300009093 Ga0105240_10976218 Ga0105240_109762182 91
521 3300009093 Ga0105240_11351558 Ga0105240_113515582 91
522 3300009094 Ga0111539_10267448 Ga0111539_102674482 91
523 3300009098 Ga0105245_10000979 Ga0105245_100009794 91
524 3300009098 Ga0105245_10004165 Ga0105245_100041655 91
525 3300009098 Ga0105245_10024319 Ga0105245_100243194 91
526 3300009098 Ga0105245_10086466 Ga0105245_100864663 91
527 3300009098 Ga0105245_10221678 Ga0105245_102216782 91
528 3300009098 Ga0105245_10553994 Ga0105245_105539942 91
529 3300009098 Ga0105245_10859936 Ga0105245_108599363 91
530 3300009098 Ga0105245_10950032 Ga0105245_109500322 91
531 3300009098 Ga0105245_11758589 Ga0105245_117585892 91
532 3300009101 Ga0105247_10004042 Ga0105247_100040422 91
533 3300009101 Ga0105247_10126066 Ga0105247_101260663 91
534 3300009101 Ga0105247_10323048 Ga0105247_103230482 91
535 3300009147 Ga0114129_10180336 Ga0114129_101803364 91
536 3300009148 Ga0105243_11507440 Ga0105243_115074402 91
537 3300009174 Ga0105241_10001985 Ga0105241_100019858 91
538 3300009174 Ga0105241_10005353 Ga0105241_100053539 91
539 3300009174 Ga0105241_10008557 Ga0105241_100085572 91
540 3300009174 Ga0105241_10010339 Ga0105241_100103396 91
541 3300009174 Ga0105241_10041900 Ga0105241_100419003 91
542 3300009174 Ga0105241_10047699 Ga0105241_100476994 91
543 3300009174 Ga0105241_10095263 Ga0105241_100952633 91
544 3300009174 Ga0105241_10136686 Ga0105241_101366862 91
545 3300009174 Ga0105241_10240042 Ga0105241_102400422 91
546 3300009174 Ga0105241_10264645 Ga0105241_102646452 91
547 3300009174 Ga0105241_10654729 Ga0105241_106547291 91
548 3300009174 Ga0105241_11059784 Ga0105241_110597841 91
549 3300009176 Ga0105242_10010997 Ga0105242_100109975 91
550 3300009176 Ga0105242_10017186 Ga0105242_100171862 91
551 3300009176 Ga0105242_10262687 Ga0105242_102626872 91
552 3300009177 Ga0105248_10009690 Ga0105248_100096904 91
553 3300009177 Ga0105248_10024516 Ga0105248_100245164 91
554 3300009177 Ga0105248_10107224 Ga0105248_101072243 91
555 3300009177 Ga0105248_10167670 Ga0105248_101676703 91
556 3300009177 Ga0105248_10480620 Ga0105248_104806202 91
557 3300009177 Ga0105248_10488817 Ga0105248_104888173 91
558 3300009177 Ga0105248_10560102 Ga0105248_105601021 91
559 3300009177 Ga0105248_10955152 Ga0105248_109551522 91
560 3300009545 Ga0105237_10005157 Ga0105237_100051575 91
561 3300009545 Ga0105237_10016421 Ga0105237_100164217 91
562 3300009545 Ga0105237_10026217 Ga0105237_100262173 91
563 3300009545 Ga0105237_10053067 Ga0105237_100530672 91
564 3300009545 Ga0105237_10167340 Ga0105237_101673404 91
565 3300009545 Ga0105237_10180541 Ga0105237_101805414 91
566 3300009545 Ga0105237_10428991 Ga0105237_104289913 91
567 3300009545 Ga0105237_10460958 Ga0105237_104609582 91
568 3300009545 Ga0105237_10605787 Ga0105237_106057872 91
569 3300009545 Ga0105237_11583882 Ga0105237_115838822 91
570 3300009551 Ga0105238_10000259 Ga0105238_1000025942 91
571 3300009551 Ga0105238_10034947 Ga0105238_100349475 91
572 3300009551 Ga0105238_10035829 Ga0105238_100358295 91
573 3300009551 Ga0105238_10123885 Ga0105238_101238852 91
574 3300009551 Ga0105238_10389290 Ga0105238_103892902 91
575 3300009551 Ga0105238_10891548 Ga0105238_108915481 91
576 3300009551 Ga0105238_10948417 Ga0105238_109484172 91
577 3300009551 Ga0105238_11069682 Ga0105238_110696822 91
578 3300009551 Ga0105238_11200045 Ga0105238_112000452 91
579 3300009551 Ga0105238_12874889 Ga0105238_128748892 91
580 3300009553 Ga0105249_10000536 Ga0105249_100005369 91
581 3300009553 Ga0105249_10012325 Ga0105249_100123257 91
582 3300009553 Ga0105249_10073394 Ga0105249_100733942 91
583 3300009553 Ga0105249_10251258 Ga0105249_102512584 91
584 3300009553 Ga0105249_10481204 Ga0105249_104812043 91
585 3300009553 Ga0105249_11222732 Ga0105249_112227321 91
586 3300010159 Ga0099796_10068845 Ga0099796_100688453 91
587 3300010375 Ga0105239_10019879 Ga0105239_100198795 91
588 3300010375 Ga0105239_10022575 Ga0105239_100225757 91
589 3300010375 Ga0105239_10023128 Ga0105239_100231287 91
590 3300010375 Ga0105239_10084013 Ga0105239_100840133 91
591 3300010375 Ga0105239_10100986 Ga0105239_101009863 91
592 3300010375 Ga0105239_10119848 Ga0105239_101198484 91
593 3300010375 Ga0105239_10314742 Ga0105239_103147422 91
594 3300010375 Ga0105239_10657495 Ga0105239_106574952 91
595 3300010375 Ga0105239_10824994 Ga0105239_108249943 91
596 3300010375 Ga0105239_11308317 Ga0105239_113083172 91
597 3300010375 Ga0105239_12129718 Ga0105239_121297181 91
598 3300010375 Ga0105239_12407892 Ga0105239_124078921 91
599 3300011119 Ga0105246_10000747 Ga0105246_100007477 91
600 3300011119 Ga0105246_10026754 Ga0105246_100267544 91
601 3300011119 Ga0105246_10330292 Ga0105246_103302922 91
602 3300011119 Ga0105246_11664088 Ga0105246_116640882 91
603 3300012483 Ga0157337_1001645 Ga0157337_10016451 91
604 3300012483 Ga0157337_1029714 Ga0157337_10297141 91
605 3300012505 Ga0157339_1035240 Ga0157339_10352401 91
606 3300012510 Ga0157316_1021853 Ga0157316_10218532 91
607 3300012513 Ga0157326_1093107 Ga0157326_10931071 91
608 3300013100 Ga0157373_10001041 Ga0157373_100010418 91
609 3300013100 Ga0157373_10001696 Ga0157373_1000169612 91
610 3300013100 Ga0157373_10032936 Ga0157373_100329367 91
611 3300013100 Ga0157373_10086362 Ga0157373_100863623 91
612 3300013100 Ga0157373_10097402 Ga0157373_100974023 91
613 3300013100 Ga0157373_10254176 Ga0157373_102541762 91
614 3300013100 Ga0157373_10675133 Ga0157373_106751332 91
615 3300013100 Ga0157373_10720048 Ga0157373_107200481 91
616 3300013100 Ga0157373_11299280 Ga0157373_112992802 91
617 3300013102 Ga0157371_10022718 Ga0157371_100227185 91
618 3300013102 Ga0157371_10047987 Ga0157371_100479873 91
619 3300013102 Ga0157371_10052195 Ga0157371_100521952 91
620 3300013102 Ga0157371_10115125 Ga0157371_101151254 91
621 3300013102 Ga0157371_10268693 Ga0157371_102686932 91
622 3300013102 Ga0157371_10421609 Ga0157371_104216092 91
623 3300013104 Ga0157370_10036871 Ga0157370_100368713 91
624 3300013104 Ga0157370_10072702 Ga0157370_100727023 91
625 3300013104 Ga0157370_10308361 Ga0157370_103083612 91
626 3300013104 Ga0157370_10557035 Ga0157370_105570353 91
627 3300013104 Ga0157370_10639894 Ga0157370_106398942 91
628 3300013104 Ga0157370_11155664 Ga0157370_111556642 91
629 3300013105 Ga0157369_10005494 Ga0157369_1000549410 91
630 3300013105 Ga0157369_10007593 Ga0157369_1000759310 91
631 3300013105 Ga0157369_10024299 Ga0157369_100242996 91
632 3300013105 Ga0157369_10029962 Ga0157369_100299621 91
633 3300013105 Ga0157369_10044918 Ga0157369_100449187 91
634 3300013105 Ga0157369_10049521 Ga0157369_100495215 91
635 3300013105 Ga0157369_10074650 Ga0157369_100746502 91
636 3300013105 Ga0157369_10075926 Ga0157369_100759264 91
637 3300013105 Ga0157369_10097433 Ga0157369_100974334 91
638 3300013105 Ga0157369_10238024 Ga0157369_102380243 91
639 3300013105 Ga0157369_10254082 Ga0157369_102540822 91
640 3300013105 Ga0157369_10842640 Ga0157369_108426402 91
641 3300013105 Ga0157369_10983075 Ga0157369_109830751 91
642 3300013296 Ga0157374_10002163 Ga0157374_1000216315 91
643 3300013296 Ga0157374_10008155 Ga0157374_100081558 91
644 3300013296 Ga0157374_10013453 Ga0157374_100134537 91
645 3300013296 Ga0157374_10025874 Ga0157374_100258746 91
646 3300013296 Ga0157374_10026893 Ga0157374_100268934 91
647 3300013296 Ga0157374_10033516 Ga0157374_100335162 91
648 3300013296 Ga0157374_10081108 Ga0157374_100811084 91
649 3300013296 Ga0157374_10229805 Ga0157374_102298052 91
650 3300013296 Ga0157374_10635086 Ga0157374_106350863 91
651 3300013296 Ga0157374_10674121 Ga0157374_106741212 91
652 3300013296 Ga0157374_10860523 Ga0157374_108605233 91
653 3300013296 Ga0157374_11061443 Ga0157374_110614432 91
654 3300013296 Ga0157374_11160190 Ga0157374_111601901 91
655 3300013297 Ga0157378_10000029 Ga0157378_1000002975 91
656 3300013297 Ga0157378_10000162 Ga0157378_1000016238 91
657 3300013297 Ga0157378_10001916 Ga0157378_1000191616 91
658 3300013297 Ga0157378_10037026 Ga0157378_100370265 91
659 3300013297 Ga0157378_10074747 Ga0157378_100747472 91
660 3300013297 Ga0157378_10265921 Ga0157378_102659212 91
661 3300013297 Ga0157378_11953741 Ga0157378_119537412 91
662 3300013306 Ga0163162_10000471 Ga0163162_100004719 91
663 3300013306 Ga0163162_10011174 Ga0163162_100111744 91
664 3300013306 Ga0163162_10044127 Ga0163162_100441274 91
665 3300013306 Ga0163162_10079642 Ga0163162_100796425 91
666 3300013306 Ga0163162_10111146 Ga0163162_101111462 91
667 3300013306 Ga0163162_10111618 Ga0163162_101116182 91
668 3300013306 Ga0163162_10146893 Ga0163162_101468935 91
669 3300013307 Ga0157372_10000416 Ga0157372_100004167 91
670 3300013307 Ga0157372_10001019 Ga0157372_100010196 91
671 3300013307 Ga0157372_10003722 Ga0157372_1000372215 91
672 3300013307 Ga0157372_10005772 Ga0157372_100057729 91
673 3300013307 Ga0157372_10011557 Ga0157372_100115578 91
674 3300013307 Ga0157372_10016052 Ga0157372_100160525 91
675 3300013307 Ga0157372_10017575 Ga0157372_100175755 91
676 3300013307 Ga0157372_10109235 Ga0157372_101092354 91
677 3300013307 Ga0157372_10130438 Ga0157372_101304382 91
678 3300013307 Ga0157372_10196323 Ga0157372_101963232 91
679 3300013307 Ga0157372_10290914 Ga0157372_102909143 91
680 3300013307 Ga0157372_10430384 Ga0157372_104303842 91
681 3300013308 Ga0157375_10028596 Ga0157375_100285963 91
682 3300013308 Ga0157375_10055742 Ga0157375_100557423 91
683 3300013308 Ga0157375_10880173 Ga0157375_108801731 91
684 3300013308 Ga0157375_11667158 Ga0157375_116671582 91
685 3300014325 Ga0163163_10003473 Ga0163163_100034736 91
686 3300014325 Ga0163163_10029534 Ga0163163_100295343 91
687 3300014325 Ga0163163_10057120 Ga0163163_100571204 91
688 3300014325 Ga0163163_10149594 Ga0163163_101495945 91
689 3300014325 Ga0163163_10160234 Ga0163163_101602344 91
690 3300014325 Ga0163163_10193941 Ga0163163_101939413 91
691 3300014325 Ga0163163_10305621 Ga0163163_103056212 91
692 3300014325 Ga0163163_10992189 Ga0163163_109921892 91
693 3300014325 Ga0163163_11018389 Ga0163163_110183892 91
694 3300014325 Ga0163163_11192598 Ga0163163_111925983 91
695 3300014325 Ga0163163_12351860 Ga0163163_123518602 91
696 3300014326 Ga0157380_10217861 Ga0157380_102178614 91
697 3300014497 Ga0182008_10029411 Ga0182008_100294114 91
698 3300014497 Ga0182008_10042499 Ga0182008_100424991 91
699 3300014497 Ga0182008_10355155 Ga0182008_103551552 91
700 3300014745 Ga0157377_10000277 Ga0157377_1000027710 91
701 3300014745 Ga0157377_10095794 Ga0157377_100957941 91
702 3300014745 Ga0157377_10212598 Ga0157377_102125983 91
703 3300014968 Ga0157379_10016594 Ga0157379_100165944 91
704 3300014968 Ga0157379_10035343 Ga0157379_100353433 91
705 3300014968 Ga0157379_10188603 Ga0157379_101886033 91
706 3300014968 Ga0157379_10332722 Ga0157379_103327222 91
707 3300014968 Ga0157379_10648126 Ga0157379_106481262 91
708 3300014968 Ga0157379_10698099 Ga0157379_106980992 91
709 3300014968 Ga0157379_12669902 Ga0157379_126699021 91
710 3300014969 Ga0157376_10033356 Ga0157376_100333564 91
711 3300014969 Ga0157376_10083098 Ga0157376_100830983 91
712 3300014969 Ga0157376_10092267 Ga0157376_100922675 91
713 3300014969 Ga0157376_10801279 Ga0157376_108012792 91
714 3300014969 Ga0157376_11911733 Ga0157376_119117331 91
715 3300014969 Ga0157376_12129865 Ga0157376_121298651 91
716 3300015261 Ga0182006_1212500 Ga0182006_12125002 91
717 3300015262 Ga0182007_10005375 Ga0182007_100053754 91
718 3300015262 Ga0182007_10012503 Ga0182007_100125034 91
719 3300015262 Ga0182007_10207527 Ga0182007_102075272 91
720 3300015265 Ga0182005_1074833 Ga0182005_10748331 91
721 3300017792 Ga0163161_10093260 Ga0163161_100932602 91
722 3300020070 Ga0206356_10599515 Ga0206356_105995151 91
723 3300020078 Ga0206352_10633791 Ga0206352_106337912 91
724 3300020610 Ga0154015_1401803 Ga0154015_14018032 91
725 3300020610 Ga0154015_1486212 Ga0154015_14862122 91
726 3300021358 Ga0213873_10001167 Ga0213873_100011675 91
727 3300021377 Ga0213874_10019506 Ga0213874_100195063 91
728 3300021377 Ga0213874_10143075 Ga0213874_101430752 91
729 3300021384 Ga0213876_10132786 Ga0213876_101327862 91
730 3300022732 Ga0224569_108131 Ga0224569_1081311 91
731 3300024225 Ga0224572_1003306 Ga0224572_10033063 91
732 3300024225 Ga0224572_1051692 Ga0224572_10516923 91
733 3300025233 Ga0209437_102879 Ga0209437_1028795 91
734 3300025261 Ga0209233_1001463 Ga0209233_10014635 91
735 3300025315 Ga0207697_10006880 Ga0207697_100068802 91
736 3300025321 Ga0207656_10207589 Ga0207656_102075892 91
737 3300025321 Ga0207656_10544732 Ga0207656_105447321 91
738 3300025711 Ga0207696_1177061 Ga0207696_11770611 91
739 3300025893 Ga0207682_10048244 Ga0207682_100482442 91
740 3300025898 Ga0207692_10010709 Ga0207692_100107093 91
741 3300025898 Ga0207692_10112707 Ga0207692_101127072 91
742 3300025898 Ga0207692_10458559 Ga0207692_104585591 91
743 3300025898 Ga0207692_10511566 Ga0207692_105115662 91
744 3300025898 Ga0207692_10694067 Ga0207692_106940672 91
745 3300025898 Ga0207692_11210565 Ga0207692_112105651 91
746 3300025899 Ga0207642_10032390 Ga0207642_100323902 91
747 3300025899 Ga0207642_10142054 Ga0207642_101420542 91
748 3300025899 Ga0207642_10650847 Ga0207642_106508472 91
749 3300025899 Ga0207642_10993676 Ga0207642_109936762 91
750 3300025900 Ga0207710_10013566 Ga0207710_100135662 91
751 3300025901 Ga0207688_10000388 Ga0207688_100003886 91
752 3300025903 Ga0207680_10132654 Ga0207680_101326541 91
753 3300025903 Ga0207680_10147676 Ga0207680_101476762 91
754 3300025903 Ga0207680_10464096 Ga0207680_104640962 91
755 3300025903 Ga0207680_10621135 Ga0207680_106211352 91
756 3300025904 Ga0207647_10000779 Ga0207647_100007794 91
757 3300025904 Ga0207647_10004209 Ga0207647_100042094 91
758 3300025904 Ga0207647_10008996 Ga0207647_100089965 91
759 3300025904 Ga0207647_10044898 Ga0207647_100448984 91
760 3300025904 Ga0207647_10170150 Ga0207647_101701502 91
761 3300025905 Ga0207685_10068268 Ga0207685_100682682 91
762 3300025905 Ga0207685_10109011 Ga0207685_101090112 91
763 3300025905 Ga0207685_10294209 Ga0207685_102942092 91
764 3300025906 Ga0207699_10025078 Ga0207699_100250784 91
765 3300025906 Ga0207699_10042954 Ga0207699_100429541 91
766 3300025906 Ga0207699_10048808 Ga0207699_100488082 91
767 3300025906 Ga0207699_10098607 Ga0207699_100986073 91
768 3300025906 Ga0207699_10110411 Ga0207699_101104113 91
769 3300025906 Ga0207699_10280283 Ga0207699_102802832 91
770 3300025906 Ga0207699_10383897 Ga0207699_103838972 91
771 3300025906 Ga0207699_10408795 Ga0207699_104087952 91
772 3300025906 Ga0207699_10412030 Ga0207699_104120301 91
773 3300025906 Ga0207699_10582425 Ga0207699_105824252 91
774 3300025906 Ga0207699_10644850 Ga0207699_106448502 91
775 3300025906 Ga0207699_10730114 Ga0207699_107301142 91
776 3300025906 Ga0207699_10849670 Ga0207699_108496701 91
777 3300025906 Ga0207699_10862537 Ga0207699_108625371 91
778 3300025907 Ga0207645_10000028 Ga0207645_1000002817 91
779 3300025908 Ga0207643_10000419 Ga0207643_1000041913 91
780 3300025908 Ga0207643_10225594 Ga0207643_102255942 91
781 3300025909 Ga0207705_10055547 Ga0207705_100555472 91
782 3300025909 Ga0207705_10161576 Ga0207705_101615764 91
783 3300025909 Ga0207705_10258078 Ga0207705_102580781 91
784 3300025910 Ga0207684_10000283 Ga0207684_100002838 91
785 3300025910 Ga0207684_10032584 Ga0207684_100325842 91
786 3300025910 Ga0207684_10330577 Ga0207684_103305772 91
787 3300025910 Ga0207684_11076890 Ga0207684_110768901 91
788 3300025910 Ga0207684_11231962 Ga0207684_112319621 91
789 3300025910 Ga0207684_11258450 Ga0207684_112584501 91
790 3300025911 Ga0207654_10008624 Ga0207654_100086243 91
791 3300025911 Ga0207654_10062808 Ga0207654_100628084 91
792 3300025911 Ga0207654_10113086 Ga0207654_101130863 91
793 3300025911 Ga0207654_10245212 Ga0207654_102452122 91
794 3300025911 Ga0207654_10245751 Ga0207654_102457512 91
795 3300025911 Ga0207654_10364573 Ga0207654_103645732 91
796 3300025911 Ga0207654_10505132 Ga0207654_105051322 91
797 3300025911 Ga0207654_10587732 Ga0207654_105877322 91
798 3300025911 Ga0207654_10617758 Ga0207654_106177582 91
799 3300025911 Ga0207654_11273988 Ga0207654_112739882 91
800 3300025912 Ga0207707_10017412 Ga0207707_100174126 91
801 3300025912 Ga0207707_10049647 Ga0207707_100496473 91
802 3300025912 Ga0207707_10073636 Ga0207707_100736364 91
803 3300025912 Ga0207707_10149835 Ga0207707_101498353 91
804 3300025912 Ga0207707_10154367 Ga0207707_101543672 91
805 3300025912 Ga0207707_10225869 Ga0207707_102258693 91
806 3300025912 Ga0207707_10345980 Ga0207707_103459802 91
807 3300025912 Ga0207707_10398054 Ga0207707_103980543 91
808 3300025913 Ga0207695_10007994 Ga0207695_100079942 91
809 3300025913 Ga0207695_10022590 Ga0207695_100225904 91
810 3300025913 Ga0207695_10050323 Ga0207695_100503234 91
811 3300025913 Ga0207695_10101873 Ga0207695_101018732 91
812 3300025913 Ga0207695_10228140 Ga0207695_102281402 91
813 3300025913 Ga0207695_10582456 Ga0207695_105824563 91
814 3300025913 Ga0207695_10595434 Ga0207695_105954341 91
815 3300025913 Ga0207695_10733919 Ga0207695_107339191 91
816 3300025914 Ga0207671_10069938 Ga0207671_100699384 91
817 3300025914 Ga0207671_10244797 Ga0207671_102447972 91
818 3300025914 Ga0207671_10273344 Ga0207671_102733442 91
819 3300025914 Ga0207671_10390312 Ga0207671_103903122 91
820 3300025914 Ga0207671_10470581 Ga0207671_104705812 91
821 3300025914 Ga0207671_10612037 Ga0207671_106120372 91
822 3300025914 Ga0207671_10845475 Ga0207671_108454752 91
823 3300025914 Ga0207671_10932963 Ga0207671_109329631 91
824 3300025915 Ga0207693_10000402 Ga0207693_1000040217 91
825 3300025915 Ga0207693_10002534 Ga0207693_100025348 91
826 3300025915 Ga0207693_10011908 Ga0207693_100119087 91
827 3300025915 Ga0207693_10013610 Ga0207693_100136108 91
828 3300025915 Ga0207693_10015724 Ga0207693_100157244 91
829 3300025915 Ga0207693_10024315 Ga0207693_100243153 91
830 3300025915 Ga0207693_10096252 Ga0207693_100962521 91
831 3300025915 Ga0207693_10161385 Ga0207693_101613853 91
832 3300025915 Ga0207693_10367862 Ga0207693_103678623 91
833 3300025915 Ga0207693_10483841 Ga0207693_104838411 91
834 3300025915 Ga0207693_11093755 Ga0207693_110937551 91
835 3300025916 Ga0207663_10007982 Ga0207663_100079823 91
836 3300025916 Ga0207663_10021553 Ga0207663_100215533 91
837 3300025916 Ga0207663_10043016 Ga0207663_100430164 91
838 3300025916 Ga0207663_10064972 Ga0207663_100649723 91
839 3300025916 Ga0207663_10245685 Ga0207663_102456852 91
840 3300025916 Ga0207663_10300360 Ga0207663_103003602 91
841 3300025916 Ga0207663_10421729 Ga0207663_104217292 91
842 3300025916 Ga0207663_10519576 Ga0207663_105195762 91
843 3300025916 Ga0207663_10818239 Ga0207663_108182392 91
844 3300025916 Ga0207663_11368750 Ga0207663_113687501 91
845 3300025917 Ga0207660_10120453 Ga0207660_101204534 91
846 3300025917 Ga0207660_10192261 Ga0207660_101922614 91
847 3300025917 Ga0207660_10220714 Ga0207660_102207143 91
848 3300025917 Ga0207660_10356371 Ga0207660_103563712 91
849 3300025917 Ga0207660_10524703 Ga0207660_105247032 91
850 3300025917 Ga0207660_10946202 Ga0207660_109462022 91
851 3300025918 Ga0207662_10003100 Ga0207662_100031007 91
852 3300025918 Ga0207662_10012909 Ga0207662_100129095 91
853 3300025918 Ga0207662_10294092 Ga0207662_102940922 91
854 3300025919 Ga0207657_10002130 Ga0207657_1000213015 91
855 3300025919 Ga0207657_10003702 Ga0207657_100037025 91
856 3300025919 Ga0207657_10077184 Ga0207657_100771844 91
857 3300025919 Ga0207657_10173269 Ga0207657_101732694 91
858 3300025920 Ga0207649_10000466 Ga0207649_1000046615 91
859 3300025920 Ga0207649_10151103 Ga0207649_101511033 91
860 3300025920 Ga0207649_10829842 Ga0207649_108298421 91
861 3300025920 Ga0207649_10844389 Ga0207649_108443891 91
862 3300025920 Ga0207649_11376848 Ga0207649_113768481 91
863 3300025921 Ga0207652_10007037 Ga0207652_100070377 91
864 3300025921 Ga0207652_10139822 Ga0207652_101398222 91
865 3300025921 Ga0207652_10170544 Ga0207652_101705442 91
866 3300025921 Ga0207652_10259266 Ga0207652_102592662 91
867 3300025921 Ga0207652_10452131 Ga0207652_104521311 91
868 3300025921 Ga0207652_10794448 Ga0207652_107944482 91
869 3300025921 Ga0207652_10799879 Ga0207652_107998791 91
870 3300025921 Ga0207652_11656193 Ga0207652_116561932 91
871 3300025922 Ga0207646_10003114 Ga0207646_100031146 91
872 3300025922 Ga0207646_10062706 Ga0207646_100627061 91
873 3300025922 Ga0207646_10066911 Ga0207646_100669112 91
874 3300025922 Ga0207646_10083033 Ga0207646_100830332 91
875 3300025922 Ga0207646_10204262 Ga0207646_102042623 91
876 3300025922 Ga0207646_10264033 Ga0207646_102640332 91
877 3300025922 Ga0207646_10340535 Ga0207646_103405353 91
878 3300025922 Ga0207646_10344018 Ga0207646_103440183 91
879 3300025922 Ga0207646_11590196 Ga0207646_115901962 91
880 3300025922 Ga0207646_11649286 Ga0207646_116492862 91
881 3300025923 Ga0207681_10109254 Ga0207681_101092544 91
882 3300025923 Ga0207681_10197584 Ga0207681_101975842 91
883 3300025923 Ga0207681_10412346 Ga0207681_104123461 91
884 3300025923 Ga0207681_11833190 Ga0207681_118331902 91
885 3300025924 Ga0207694_10000652 Ga0207694_1000065215 91
886 3300025924 Ga0207694_10135716 Ga0207694_101357163 91
887 3300025924 Ga0207694_10251486 Ga0207694_102514862 91
888 3300025924 Ga0207694_10367269 Ga0207694_103672692 91
889 3300025924 Ga0207694_10373180 Ga0207694_103731801 91
890 3300025924 Ga0207694_10591790 Ga0207694_105917902 91
891 3300025924 Ga0207694_10640602 Ga0207694_106406022 91
892 3300025924 Ga0207694_11438404 Ga0207694_114384042 91
893 3300025924 Ga0207694_11455641 Ga0207694_114556411 91
894 3300025925 Ga0207650_10000052 Ga0207650_1000005217 91
895 3300025925 Ga0207650_10007804 Ga0207650_100078044 91
896 3300025925 Ga0207650_11543047 Ga0207650_115430471 91
897 3300025926 Ga0207659_11520784 Ga0207659_115207842 91
898 3300025927 Ga0207687_10002656 Ga0207687_100026564 91
899 3300025927 Ga0207687_10002692 Ga0207687_100026924 91
900 3300025927 Ga0207687_10043715 Ga0207687_100437153 91
901 3300025927 Ga0207687_10192746 Ga0207687_101927462 91
902 3300025927 Ga0207687_10959009 Ga0207687_109590092 91
903 3300025927 Ga0207687_11314469 Ga0207687_113144692 91
904 3300025927 Ga0207687_11877368 Ga0207687_118773682 91
905 3300025928 Ga0207700_10010309 Ga0207700_100103095 91
906 3300025928 Ga0207700_10016603 Ga0207700_100166033 91
907 3300025928 Ga0207700_10041103 Ga0207700_100411032 91
908 3300025928 Ga0207700_10106643 Ga0207700_101066432 91
909 3300025928 Ga0207700_10190056 Ga0207700_101900563 91
910 3300025928 Ga0207700_10215277 Ga0207700_102152772 91
911 3300025928 Ga0207700_10253641 Ga0207700_102536413 91
912 3300025928 Ga0207700_10291109 Ga0207700_102911092 91
913 3300025928 Ga0207700_10322688 Ga0207700_103226883 91
914 3300025928 Ga0207700_10333574 Ga0207700_103335742 91
915 3300025928 Ga0207700_10337383 Ga0207700_103373832 91
916 3300025928 Ga0207700_10414798 Ga0207700_104147982 91
917 3300025928 Ga0207700_10476464 Ga0207700_104764642 91
918 3300025928 Ga0207700_10590474 Ga0207700_105904741 91
919 3300025928 Ga0207700_10954346 Ga0207700_109543461 91
920 3300025929 Ga0207664_10050192 Ga0207664_100501924 91
921 3300025929 Ga0207664_10115141 Ga0207664_101151413 91
922 3300025929 Ga0207664_10145632 Ga0207664_101456321 91
923 3300025929 Ga0207664_10148405 Ga0207664_101484054 91
924 3300025929 Ga0207664_10248189 Ga0207664_102481892 91
925 3300025929 Ga0207664_10311232 Ga0207664_103112323 91
926 3300025929 Ga0207664_10450596 Ga0207664_104505962 91
927 3300025929 Ga0207664_10492153 Ga0207664_104921533 91
928 3300025929 Ga0207664_10521175 Ga0207664_105211753 91
929 3300025929 Ga0207664_10859463 Ga0207664_108594632 91
930 3300025929 Ga0207664_10930551 Ga0207664_109305512 91
931 3300025929 Ga0207664_10945851 Ga0207664_109458512 91
932 3300025929 Ga0207664_10952646 Ga0207664_109526462 91
933 3300025929 Ga0207664_11171897 Ga0207664_111718971 91
934 3300025931 Ga0207644_10042968 Ga0207644_100429684 91
935 3300025931 Ga0207644_10128838 Ga0207644_101288383 91
936 3300025931 Ga0207644_10147128 Ga0207644_101471283 91
937 3300025931 Ga0207644_10570021 Ga0207644_105700212 91
938 3300025931 Ga0207644_10845996 Ga0207644_108459962 91
939 3300025931 Ga0207644_11176738 Ga0207644_111767382 91
940 3300025931 Ga0207644_11493682 Ga0207644_114936822 91
941 3300025932 Ga0207690_10003933 Ga0207690_100039332 91
942 3300025932 Ga0207690_10270201 Ga0207690_102702011 91
943 3300025932 Ga0207690_10278441 Ga0207690_102784412 91
944 3300025932 Ga0207690_10467374 Ga0207690_104673742 91
945 3300025933 Ga0207706_10000941 Ga0207706_1000094113 91
946 3300025933 Ga0207706_10001265 Ga0207706_1000126510 91
947 3300025933 Ga0207706_10008966 Ga0207706_100089666 91
948 3300025933 Ga0207706_10344789 Ga0207706_103447892 91
949 3300025934 Ga0207686_10004976 Ga0207686_100049764 91
950 3300025934 Ga0207686_10041868 Ga0207686_100418684 91
951 3300025935 Ga0207709_10651035 Ga0207709_106510352 91
952 3300025936 Ga0207670_10389978 Ga0207670_103899782 91
953 3300025936 Ga0207670_10393429 Ga0207670_103934292 91
954 3300025936 Ga0207670_11530152 Ga0207670_115301521 91
955 3300025937 Ga0207669_10656049 Ga0207669_106560492 91
956 3300025938 Ga0207704_10022078 Ga0207704_100220783 91
957 3300025938 Ga0207704_10053233 Ga0207704_100532333 91
958 3300025938 Ga0207704_10810746 Ga0207704_108107462 91
959 3300025939 Ga0207665_10002642 Ga0207665_1000264211 91
960 3300025939 Ga0207665_10017742 Ga0207665_100177424 91
961 3300025939 Ga0207665_10018483 Ga0207665_100184834 91
962 3300025939 Ga0207665_10021171 Ga0207665_100211712 91
963 3300025939 Ga0207665_10025890 Ga0207665_100258905 91
964 3300025939 Ga0207665_10071214 Ga0207665_100712142 91
965 3300025939 Ga0207665_10083757 Ga0207665_100837572 91
966 3300025939 Ga0207665_10086101 Ga0207665_100861015 91
967 3300025939 Ga0207665_10114371 Ga0207665_101143712 91
968 3300025939 Ga0207665_10251341 Ga0207665_102513411 91
969 3300025939 Ga0207665_10479906 Ga0207665_104799061 91
970 3300025939 Ga0207665_10484134 Ga0207665_104841342 91
971 3300025939 Ga0207665_10488322 Ga0207665_104883222 91
972 3300025939 Ga0207665_10679522 Ga0207665_106795221 91
973 3300025939 Ga0207665_10910450 Ga0207665_109104502 91
974 3300025940 Ga0207691_10001380 Ga0207691_1000138017 91
975 3300025941 Ga0207711_10003898 Ga0207711_100038981 91
976 3300025941 Ga0207711_10114375 Ga0207711_101143753 91
977 3300025941 Ga0207711_10138237 Ga0207711_101382373 91
978 3300025941 Ga0207711_10419647 Ga0207711_104196471 91
979 3300025941 Ga0207711_10636263 Ga0207711_106362632 91
980 3300025941 Ga0207711_10668577 Ga0207711_106685771 91
981 3300025941 Ga0207711_10974258 Ga0207711_109742582 91
982 3300025941 Ga0207711_11115753 Ga0207711_111157532 91
983 3300025941 Ga0207711_11353172 Ga0207711_113531722 91
984 3300025942 Ga0207689_10000394 Ga0207689_1000039420 91
985 3300025942 Ga0207689_10000624 Ga0207689_1000062417 91
986 3300025942 Ga0207689_10021271 Ga0207689_100212714 91
987 3300025942 Ga0207689_10119852 Ga0207689_101198522 91
988 3300025942 Ga0207689_10214793 Ga0207689_102147934 91
989 3300025944 Ga0207661_10000207 Ga0207661_1000020711 91
990 3300025944 Ga0207661_10028276 Ga0207661_100282761 91
991 3300025944 Ga0207661_10047953 Ga0207661_100479532 91
992 3300025944 Ga0207661_10623723 Ga0207661_106237232 91
993 3300025944 Ga0207661_11100971 Ga0207661_111009712 91
994 3300025944 Ga0207661_11820572 Ga0207661_118205722 91
995 3300025945 Ga0207679_10000068 Ga0207679_1000006846 91
996 3300025945 Ga0207679_10011031 Ga0207679_100110315 91
997 3300025945 Ga0207679_10035727 Ga0207679_100357274 91
998 3300025945 Ga0207679_10297768 Ga0207679_102977682 91
999 3300025945 Ga0207679_10299160 Ga0207679_102991603 91
1000 3300025945 Ga0207679_10388597 Ga0207679_103885972 91
1001 3300025945 Ga0207679_10563628 Ga0207679_105636282 91
1002 3300025945 Ga0207679_11770052 Ga0207679_117700521 91
1003 3300025949 Ga0207667_10000182 Ga0207667_1000018254 91
1004 3300025949 Ga0207667_10003330 Ga0207667_1000333013 91
1005 3300025949 Ga0207667_10003515 Ga0207667_100035154 91
1006 3300025949 Ga0207667_10017624 Ga0207667_100176247 91
1007 3300025949 Ga0207667_10374787 Ga0207667_103747871 91
1008 3300025949 Ga0207667_10549560 Ga0207667_105495602 91
1009 3300025949 Ga0207667_10773499 Ga0207667_107734992 91
1010 3300025949 Ga0207667_10797522 Ga0207667_107975222 91
1011 3300025949 Ga0207667_10865071 Ga0207667_108650713 91
1012 3300025960 Ga0207651_10031563 Ga0207651_100315632 91
1013 3300025960 Ga0207651_10300614 Ga0207651_103006142 91
1014 3300025960 Ga0207651_10543373 Ga0207651_105433732 91
1015 3300025960 Ga0207651_10557205 Ga0207651_105572052 91
1016 3300025960 Ga0207651_10810081 Ga0207651_108100812 91
1017 3300025961 Ga0207712_10009521 Ga0207712_100095212 91
1018 3300025961 Ga0207712_10055823 Ga0207712_100558231 91
1019 3300025961 Ga0207712_10525676 Ga0207712_105256762 91
1020 3300025961 Ga0207712_10557990 Ga0207712_105579902 91
1021 3300025972 Ga0207668_11096560 Ga0207668_110965602 91
1022 3300025981 Ga0207640_10010237 Ga0207640_100102374 91
1023 3300025981 Ga0207640_10073340 Ga0207640_100733403 91
1024 3300025981 Ga0207640_11437208 Ga0207640_114372081 91
1025 3300025986 Ga0207658_10049080 Ga0207658_100490801 91
1026 3300025986 Ga0207658_10550632 Ga0207658_105506323 91
1027 3300026023 Ga0207677_10003533 Ga0207677_100035335 91
1028 3300026023 Ga0207677_10011145 Ga0207677_100111454 91
1029 3300026023 Ga0207677_10014423 Ga0207677_100144233 91
1030 3300026023 Ga0207677_10124190 Ga0207677_101241903 91
1031 3300026023 Ga0207677_10207554 Ga0207677_102075542 91
1032 3300026023 Ga0207677_10241867 Ga0207677_102418672 91
1033 3300026023 Ga0207677_10264664 Ga0207677_102646641 91
1034 3300026023 Ga0207677_12130119 Ga0207677_121301191 91
1035 3300026035 Ga0207703_10002222 Ga0207703_1000222216 91
1036 3300026035 Ga0207703_10002763 Ga0207703_100027637 91
1037 3300026035 Ga0207703_10016188 Ga0207703_100161884 91
1038 3300026035 Ga0207703_10104870 Ga0207703_101048703 91
1039 3300026035 Ga0207703_10265448 Ga0207703_102654481 91
1040 3300026035 Ga0207703_10356605 Ga0207703_103566052 91
1041 3300026035 Ga0207703_10517252 Ga0207703_105172522 91
1042 3300026035 Ga0207703_11087350 Ga0207703_110873501 91
1043 3300026035 Ga0207703_11637061 Ga0207703_116370612 91
1044 3300026041 Ga0207639_10018898 Ga0207639_100188981 91
1045 3300026041 Ga0207639_10168570 Ga0207639_101685702 91
1046 3300026041 Ga0207639_10230235 Ga0207639_102302352 91
1047 3300026041 Ga0207639_10460073 Ga0207639_104600733 91
1048 3300026041 Ga0207639_10603624 Ga0207639_106036242 91
1049 3300026041 Ga0207639_11193173 Ga0207639_111931731 91
1050 3300026067 Ga0207678_10000833 Ga0207678_100008335 91
1051 3300026067 Ga0207678_10008752 Ga0207678_100087526 91
1052 3300026075 Ga0207708_10070591 Ga0207708_100705912 91
1053 3300026075 Ga0207708_10267701 Ga0207708_102677013 91
1054 3300026078 Ga0207702_10000794 Ga0207702_100007948 91
1055 3300026078 Ga0207702_10001724 Ga0207702_1000172417 91
1056 3300026078 Ga0207702_10010990 Ga0207702_100109907 91
1057 3300026078 Ga0207702_10018260 Ga0207702_100182602 91
1058 3300026078 Ga0207702_10048597 Ga0207702_100485972 91
1059 3300026078 Ga0207702_10067710 Ga0207702_100677102 91
1060 3300026078 Ga0207702_10317888 Ga0207702_103178883 91
1061 3300026078 Ga0207702_10831221 Ga0207702_108312211 91
1062 3300026078 Ga0207702_11145977 Ga0207702_111459772 91
1063 3300026078 Ga0207702_11163172 Ga0207702_111631722 91
1064 3300026078 Ga0207702_11308082 Ga0207702_113080821 91
1065 3300026078 Ga0207702_11321293 Ga0207702_113212932 91
1066 3300026088 Ga0207641_10000032 Ga0207641_1000003265 91
1067 3300026088 Ga0207641_10017766 Ga0207641_100177663 91
1068 3300026088 Ga0207641_10141825 Ga0207641_101418252 91
1069 3300026088 Ga0207641_10170020 Ga0207641_101700203 91
1070 3300026088 Ga0207641_10203368 Ga0207641_102033683 91
1071 3300026088 Ga0207641_10235534 Ga0207641_102355343 91
1072 3300026089 Ga0207648_10000151 Ga0207648_1000015145 91
1073 3300026089 Ga0207648_10015885 Ga0207648_100158858 91
1074 3300026089 Ga0207648_10035135 Ga0207648_100351352 91
1075 3300026089 Ga0207648_10097454 Ga0207648_100974542 91
1076 3300026089 Ga0207648_10390641 Ga0207648_103906412 91
1077 3300026089 Ga0207648_10634314 Ga0207648_106343142 91
1078 3300026089 Ga0207648_10686585 Ga0207648_106865851 91
1079 3300026089 Ga0207648_10844041 Ga0207648_108440413 91
1080 3300026095 Ga0207676_10000333 Ga0207676_1000033332 91
1081 3300026095 Ga0207676_10009692 Ga0207676_100096926 91
1082 3300026095 Ga0207676_10068471 Ga0207676_100684713 91
1083 3300026095 Ga0207676_10143769 Ga0207676_101437693 91
1084 3300026095 Ga0207676_12400827 Ga0207676_124008271 91
1085 3300026116 Ga0207674_10000078 Ga0207674_1000007817 91
1086 3300026116 Ga0207674_10000447 Ga0207674_1000044732 91
1087 3300026116 Ga0207674_10050944 Ga0207674_100509444 91
1088 3300026116 Ga0207674_10372800 Ga0207674_103728001 91
1089 3300026116 Ga0207674_10647112 Ga0207674_106471122 91
1090 3300026118 Ga0207675_100007755 Ga0207675_1000077555 91
1091 3300026118 Ga0207675_100018663 Ga0207675_1000186634 91
1092 3300026118 Ga0207675_100354204 Ga0207675_1003542042 91
1093 3300026121 Ga0207683_10000042 Ga0207683_1000004217 91
1094 3300026121 Ga0207683_10175191 Ga0207683_101751913 91
1095 3300026121 Ga0207683_10279497 Ga0207683_102794973 91
1096 3300026121 Ga0207683_10475241 Ga0207683_104752412 91
1097 3300026121 Ga0207683_11524264 Ga0207683_115242641 91
1098 3300026142 Ga0207698_10054686 Ga0207698_100546864 91
1099 3300026142 Ga0207698_10128519 Ga0207698_101285194 91
1100 3300026142 Ga0207698_10233315 Ga0207698_102333152 91
1101 3300026142 Ga0207698_11470067 Ga0207698_114700672 91
1102 3300027671 Ga0209588_1102948 Ga0209588_11029482 91
1103 3300028016 Ga0265354_1001582 Ga0265354_10015823 91
1104 3300028016 Ga0265354_1004095 Ga0265354_10040954 91
1105 3300028017 Ga0265356_1010985 Ga0265356_10109853 91
1106 3300028023 Ga0265357_1015711 Ga0265357_10157111 91
1107 3300028379 Ga0268266_10008803 Ga0268266_100088032 91
1108 3300028379 Ga0268266_10768012 Ga0268266_107680122 91
1109 3300028380 Ga0268265_10041404 Ga0268265_100414044 91
1110 3300028380 Ga0268265_10065312 Ga0268265_100653124 91
1111 3300028380 Ga0268265_10171260 Ga0268265_101712602 91
1112 3300028380 Ga0268265_10266398 Ga0268265_102663983 91
1113 3300028381 Ga0268264_10025516 Ga0268264_100255161 91
1114 3300028381 Ga0268264_10026658 Ga0268264_100266582 91
1115 3300028381 Ga0268264_10055381 Ga0268264_100553814 91
1116 3300028381 Ga0268264_10147249 Ga0268264_101472494 91
1117 3300028381 Ga0268264_10153901 Ga0268264_101539012 91
1118 3300028381 Ga0268264_11227514 Ga0268264_112275142 91
1119 3300028563 Ga0265319_1070411 Ga0265319_10704113 91
1120 3300028800 Ga0265338_10001088 Ga0265338_1000108840 91
1121 3300028800 Ga0265338_10073979 Ga0265338_100739793 91
1122 3300028800 Ga0265338_10112743 Ga0265338_101127432 91
1123 3300030760 Ga0265762_1000104 Ga0265762_10001049 91
1124 3300030760 Ga0265762_1014329 Ga0265762_10143293 91
1125 3300030760 Ga0265762_1059286 Ga0265762_10592861 91
1126 3300030879 Ga0265765_1031027 Ga0265765_10310272 91
1127 3300031090 Ga0265760_10000424 Ga0265760_100004244 91
1128 3300031090 Ga0265760_10001026 Ga0265760_100010264 91
1129 3300031090 Ga0265760_10001222 Ga0265760_100012223 91
1130 3300031090 Ga0265760_10003379 Ga0265760_100033797 91
1131 3300031090 Ga0265760_10115329 Ga0265760_101153292 91
1132 3300031090 Ga0265760_10131730 Ga0265760_101317302 91
1133 3300031090 Ga0265760_10163810 Ga0265760_101638102 91
1134 3300031090 Ga0265760_10271619 Ga0265760_102716192 91
1135 3300031239 Ga0265328_10152085 Ga0265328_101520852 91
1136 3300031241 Ga0265325_10047696 Ga0265325_100476961 91
1137 3300031241 Ga0265325_10081997 Ga0265325_100819972 91
1138 3300031242 Ga0265329_10069491 Ga0265329_100694911 91
1139 3300031247 Ga0265340_10022332 Ga0265340_100223324 91
1140 3300031247 Ga0265340_10257486 Ga0265340_102574861 91
1141 3300031249 Ga0265339_10010828 Ga0265339_100108285 91
1142 3300031249 Ga0265339_10185853 Ga0265339_101858531 91
1143 3300031249 Ga0265339_10377926 Ga0265339_103779262 91
1144 3300031250 Ga0265331_10024473 Ga0265331_100244732 91
1145 3300031251 Ga0265327_10018371 Ga0265327_100183712 91
1146 3300031344 Ga0265316_10009449 Ga0265316_100094499 91
1147 3300031344 Ga0265316_10784716 Ga0265316_107847162 91
1148 3300031507 Ga0307509_10903663 Ga0307509_109036632 91
1149 3300031548 Ga0307408_100028359 Ga0307408_1000283595 91
1150 3300031548 Ga0307408_100151157 Ga0307408_1001511573 91
1151 3300031595 Ga0265313_10061785 Ga0265313_100617851 91
1152 3300031595 Ga0265313_10364089 Ga0265313_103640891 91
1153 3300031712 Ga0265342_10191520 Ga0265342_101915202 91
1154 3300031731 Ga0307405_10036860 Ga0307405_100368601 91
1155 3300031731 Ga0307405_10235152 Ga0307405_102351524 91
1156 3300031824 Ga0307413_10821173 Ga0307413_108211732 91
1157 3300031852 Ga0307410_10037879 Ga0307410_100378792 91
1158 3300031852 Ga0307410_11233183 Ga0307410_112331832 91
1159 3300031901 Ga0307406_10077229 Ga0307406_100772293 91
1160 3300031901 Ga0307406_10193539 Ga0307406_101935393 91
1161 3300031911 Ga0307412_10587780 Ga0307412_105877801 91
1162 3300031995 Ga0307409_100007574 Ga0307409_1000075746 91
1163 3300031995 Ga0307409_100237662 Ga0307409_1002376623 91
1164 3300032002 Ga0307416_100052747 Ga0307416_1000527472 91
1165 3300032002 Ga0307416_100060319 Ga0307416_1000603194 91
1166 3300032002 Ga0307416_100625143 Ga0307416_1006251431 91
1167 3300032002 Ga0307416_103531987 Ga0307416_1035319871 91
1168 3300032004 Ga0307414_10219198 Ga0307414_102191982 91
1169 3300032005 Ga0307411_10005272 Ga0307411_100052728 91
1170 3300032005 Ga0307411_10055515 Ga0307411_100555154 91
1171 3300032005 Ga0307411_11947847 Ga0307411_119478472 91
1172 3300032126 Ga0307415_100028639 Ga0307415_1000286393 91
1173 3300032126 Ga0307415_100830272 Ga0307415_1008302722 91
1174 3300033547 Ga0316212_1024206 Ga0316212_10242062 91
1175 3300034816 Ga0373930_0004763 Ga0373930_0004763_458_733 91
1176 3300034816 Ga0373930_0072414 Ga0373930_0072414_157_432 91
1177 3300034817 Ga0373948_0036366 Ga0373948_0036366_312_587 91
1178 3300034817 Ga0373948_0154067 Ga0373948_0154067_88_363 91
1179 3300034957 Ga0373938_0117920 Ga0373938_0117920_305_580 91
1180 3300034957 Ga0373938_0233078 Ga0373938_0233078_77_352 91
1181 3300035084 Ga0373928_0018190 Ga0373928_0018190_271_546 91
1182 3300035088 Ga0373940_0291297 Ga0373940_0291297_95_370 91
1183 3300035090 Ga0373949_0150144 Ga0373949_0150144_374_649 91
1184 3300035091 Ga0373951_0049847 Ga0373951_0049847_264_539 91
1185 3300035111 Ga0373923_0080670 Ga0373923_0080670_465_740 91
1186 3300035111 Ga0373923_0201563 Ga0373923_0201563_122_397 91
1187 3300035112 Ga0373932_0039158 Ga0373932_0039158_886_1161 91
1188 3300035112 Ga0373932_0344864 Ga0373932_0344864_15_290 91
1189 3300035113 Ga0373936_0012871 Ga0373936_0012871_2472_2747 91
1190 3300035113 Ga0373936_0216097 Ga0373936_0216097_381_656 91
1191 3300035114 Ga0373939_0054743 Ga0373939_0054743_172_447 91
1192 3300035115 Ga0373941_0065419 Ga0373941_0065419_224_499 91
1193 3300035116 Ga0373945_0258872 Ga0373945_0258872_42_317 91
1194 3300035116 Ga0373945_0544479 Ga0373945_0544479_123_398 91
1195 3300035121 Ga0373960_0016109 Ga0373960_0016109_1294_1569 91
1196 3300035170 Ga0373943_0100310 Ga0373943_0100310_278_553 91
1197 3300035170 Ga0373943_0232748 Ga0373943_0232748_458_733 91
1198 3300035170 Ga0373943_0780112 Ga0373943_0780112_212_487 91
1199 3300035172 Ga0373955_0322178 Ga0373955_0322178_108_383 91
1200 3300035172 Ga0373955_1027222 Ga0373955_1027222_67_342 91
1201 3300035207 Ga0373942_0051057 Ga0373942_0051057_798_1073 91
1202 3300035207 Ga0373942_0299060 Ga0373942_0299060_192_467 91
1203 3300035241 Ga0373961_0417790 Ga0373961_0417790_101_376 91
1204 3300035242 Ga0373962_0184372 Ga0373962_0184372_406_681 91
1205 3300035691 Ga0373931_0003650 Ga0373931_0003650_1991_2266 91
1206 3300035691 Ga0373931_0050419 Ga0373931_0050419_826_1101 91
1207 3300035691 Ga0373931_0604390 Ga0373931_0604390_186_461 91
1208 3300035692 Ga0373935_0004737 Ga0373935_0004737_6896_7171 91
1209 3300035692 Ga0373935_0193273 Ga0373935_0193273_721_996 91
1210 3300035692 Ga0373935_0469788 Ga0373935_0469788_409_684 91
1211 3300035692 Ga0373935_1276015 Ga0373935_1276015_208_483 91
1212 3300035695 Ga0373927_0009241 Ga0373927_0009241_5460_5735 91
1213 3300035695 Ga0373927_0020158 Ga0373927_0020158_298_573 91
1214 3300035695 Ga0373927_0141683 Ga0373927_0141683_893_1168 91
1215 3300035695 Ga0373927_0491173 Ga0373927_0491173_474_749 91
1216 3300035695 Ga0373927_0650841 Ga0373927_0650841_62_337 91
1217 3300035695 Ga0373927_0673286 Ga0373927_0673286_335_610 91
1218 3300035724 Ga0373933_0307304 Ga0373933_0307304_378_653 91
1219 3300035724 Ga0373933_0472677 Ga0373933_0472677_73_348 91
1220 3300035724 Ga0373933_0971303 Ga0373933_0971303_140_415 91
1221 3300035725 Ga0373947_0030944 Ga0373947_0030944_1535_1810 91
1222 3300035725 Ga0373947_0196399 Ga0373947_0196399_827_1102 91
1223 3300035725 Ga0373947_0638118 Ga0373947_0638118_51_326 91
1224 3300035725 Ga0373947_0771710 Ga0373947_0771710_46_321 91
1225 3300036401 Ga0373937_0125508 Ga0373937_0125508_458_733 91
1226 3300036401 Ga0373937_0462642 Ga0373937_0462642_272_547 91
1227 3300036401 Ga0373937_0519932 Ga0373937_0519932_117_392 91
1228 3300036401 Ga0373937_0844726 Ga0373937_0844726_130_405 91
1229 3300037068 Ga0373925_0008856 Ga0373925_0008856_1217_1492 91
1230 3300037068 Ga0373925_0043294 Ga0373925_0043294_1434_1709 91
1231 3300037068 Ga0373925_0053355 Ga0373925_0053355_1013_1288 91
1232 3300037068 Ga0373925_0125552 Ga0373925_0125552_1202_1477 91
1233 3300037068 Ga0373925_0265821 Ga0373925_0265821_1070_1345 91
1234 3300037068 Ga0373925_0395939 Ga0373925_0395939_492_767 91
1235 3300037068 Ga0373925_1164065 Ga0373925_1164065_217_492 91
1236 3300037418 Ga0395900_0811902 Ga0395900_0811902_93_368 91
1237 3300037466 Ga0395898_0214047 Ga0395898_0214047_593_868 91
1238 3300037853 Ga0436364_0436695 Ga0436364_0436695_35_310 91
1239 3300038996 Ga0242420_032002 Ga0242420_032002_216_491 91
1240 3300039438 Ga0436360_0060295 Ga0436360_0060295_276_551 91
1241 3300039438 Ga0436360_0932365 Ga0436360_0932365_521_796 91
1242 3300039447 Ga0436361_1086107 Ga0436361_1086107_350_649 91
1243 3300039450 Ga0436363_0248758 Ga0436363_0248758_260_535 91
1244 3300039450 Ga0436363_0536277 Ga0436363_0536277_384_659 91
1245 3300039450 Ga0436363_0751323 Ga0436363_0751323_1368_1643 91
1246 3300039450 Ga0436363_1164548 Ga0436363_1164548_268_543 91
1247 3300039453 Ga0436362_0739957 Ga0436362_0739957_5247_5522 91
1248 3300041496 Ga0451839_0626454 Ga0451839_0626454_122_397 91
1249 3300042437 Ga0439444_0114669 Ga0439444_0114669_54_329 91
1250 3300042876 Ga0451577_0000523 Ga0451577_0000523_45672_45947 91
1251 3300044673 Ga0453683_0053721 Ga0453683_0053721_417_692 91
1252 3300044684 Ga0466966_0263873 Ga0466966_0263873_523_798 91
1253 3300044684 Ga0466966_0779645 Ga0466966_0779645_243_518 91
1254 3300044693 Ga0466961_0065080 Ga0466961_0065080_530_805 91
1255 3300044693 Ga0466961_0381538 Ga0466961_0381538_57_332 91
1256 3300044694 Ga0466963_0446313 Ga0466963_0446313_33_308 91
1257 3300044694 Ga0466963_0580123 Ga0466963_0580123_141_416 91
1258 3300044706 Ga0466964_0091320 Ga0466964_0091320_878_1153 91
1259 3300044712 Ga0453684_0000951 Ga0453684_0000951_40707_40982 91
1260 3300044842 Ga0466957_0191196 Ga0466957_0191196_356_670 91
1261 3300045049 Ga0466959_0352027 Ga0466959_0352027_492_767 91
1262 3300045051 Ga0451576_0003996 Ga0451576_0003996_5735_6010 91
1263 3300045051 Ga0451576_0050094 Ga0451576_0050094_2864_3139 91
1264 3300045051 Ga0451576_0440243 Ga0451576_0440243_363_638 91
1265 3300045051 Ga0451576_0687147 Ga0451576_0687147_236_511 91
1266 3300045051 Ga0451576_0942442 Ga0451576_0942442_170_445 91
1267 3300045051 Ga0451576_1182981 Ga0451576_1182981_481_756 91
1268 3300045836 Ga0466958_0086187 Ga0466958_0086187_189_464 91
1269 3300045836 Ga0466958_0356411 Ga0466958_0356411_537_812 91
1270 3300045976 Ga0466967_0115740 Ga0466967_0115740_981_1256 91
1271 3300045976 Ga0466967_0262803 Ga0466967_0262803_1034_1309 91
1272 3300045976 Ga0466967_0899730 Ga0466967_0899730_505_780 91
1273 3300045976 Ga0466967_1021279 Ga0466967_1021279_437_712 91
1274 3300045976 Ga0466967_1098126 Ga0466967_1098126_143_418 91
1275 3300045976 Ga0466967_1518351 Ga0466967_1518351_109_384 91
1276 3300045976 Ga0466967_1541482 Ga0466967_1541482_283_558 91
1277 3300046455 Ga0495603_0133421 Ga0495603_0133421_39_314 91
1278 3300046459 Ga0495629_0358396 Ga0495629_0358396_394_669 91
1279 3300046462 Ga0495651_0448451 Ga0495651_0448451_471_746 91
1280 3300046472 Ga0495580_0001650 Ga0495580_0001650_6287_6562 91
1281 3300046472 Ga0495580_0002144 Ga0495580_0002144_10149_10424 91
1282 3300046472 Ga0495580_0004494 Ga0495580_0004494_8329_8604 91
1283 3300046472 Ga0495580_0004873 Ga0495580_0004873_25_300 91
1284 3300046472 Ga0495580_0005629 Ga0495580_0005629_9128_9403 91
1285 3300046472 Ga0495580_0038201 Ga0495580_0038201_1522_1797 91
1286 3300046472 Ga0495580_0081540 Ga0495580_0081540_361_636 91
1287 3300046472 Ga0495580_0190555 Ga0495580_0190555_874_1149 91
1288 3300046472 Ga0495580_0677712 Ga0495580_0677712_335_610 91
1289 3300046472 Ga0495580_0697340 Ga0495580_0697340_370_645 91
1290 3300046473 Ga0495582_0001757 Ga0495582_0001757_513_788 91
1291 3300046473 Ga0495582_0080303 Ga0495582_0080303_822_1097 91
1292 3300046473 Ga0495582_0137745 Ga0495582_0137745_392_667 91
1293 3300046473 Ga0495582_0614515 Ga0495582_0614515_26_301 91
1294 3300046475 Ga0495639_0172445 Ga0495639_0172445_89_364 91
1295 3300046499 Ga0495594_0628899 Ga0495594_0628899_300_575 91
1296 3300046511 Ga0495608_0584419 Ga0495608_0584419_279_554 91
1297 3300046516 Ga0495628_0694579 Ga0495628_0694579_339_614 91
1298 3300046517 Ga0495630_0639213 Ga0495630_0639213_102_377 91
1299 3300046526 Ga0495666_0038004 Ga0495666_0038004_2019_2294 91
1300 3300046528 Ga0495642_0088724 Ga0495642_0088724_744_1031 91
1301 3300046531 Ga0495665_0001542 Ga0495665_0001542_4265_4540 91
1302 3300046531 Ga0495665_0043792 Ga0495665_0043792_1200_1475 91
1303 3300046531 Ga0495665_0302484 Ga0495665_0302484_83_370 91
1304 3300046531 Ga0495665_0520710 Ga0495665_0520710_160_435 91
1305 3300046535 Ga0495586_0147439 Ga0495586_0147439_1017_1304 91
1306 3300046536 Ga0495587_0097146 Ga0495587_0097146_97_384 91
1307 3300046536 Ga0495587_0163603 Ga0495587_0163603_773_1060 91
1308 3300046536 Ga0495587_0470093 Ga0495587_0470093_13_288 91
1309 3300046536 Ga0495587_0829418 Ga0495587_0829418_28_303 91
1310 3300046543 Ga0495645_0117702 Ga0495645_0117702_447_734 91
1311 3300046543 Ga0495645_0367218 Ga0495645_0367218_103_378 91
1312 3300046559 Ga0495667_0095926 Ga0495667_0095926_1149_1436 91
1313 3300046616 Ga0495668_0169203 Ga0495668_0169203_43_330 91
1314 3300046664 Ga0495659_0029036 Ga0495659_0029036_936_1250 91
1315 3300046674 Ga0495588_0178904 Ga0495588_0178904_466_753 91
1316 3300046675 Ga0495657_0677428 Ga0495657_0677428_137_412 91
1317 3300046679 Ga0495623_0290338 Ga0495623_0290338_186_461 91
1318 3300046679 Ga0495623_0484730 Ga0495623_0484730_136_423 91
1319 3300046680 Ga0495646_0443496 Ga0495646_0443496_110_385 91
1320 3300046683 Ga0495658_0113916 Ga0495658_0113916_1260_1535 91
1321 3300046684 Ga0495669_0006911 Ga0495669_0006911_2775_3062 91
1322 3300046684 Ga0495669_0230095 Ga0495669_0230095_389_664 91
1323 3300046684 Ga0495669_0235917 Ga0495669_0235917_397_684 91
1324 3300046684 Ga0495669_0266539 Ga0495669_0266539_26_301 91
1325 3300046809 Ga0495600_0464071 Ga0495600_0464071_36_311 91
1326 3300047315 Ga0495581_0198961 Ga0495581_0198961_23_310 91
1327 3300047315 Ga0495581_0292133 Ga0495581_0292133_580_855 91
1328 3300047317 Ga0495604_0067772 Ga0495604_0067772_121_408 91
1329 3300047318 Ga0495636_0099653 Ga0495636_0099653_130_417 91
1330 3300047319 Ga0495674_0450793 Ga0495674_0450793_214_489 91
1331 3300047319 Ga0495674_0774659 Ga0495674_0774659_46_333 91
1332 3300047323 Ga0495683_0273172 Ga0495683_0273172_74_361 91
1333 3300047444 Ga0495675_0003156 Ga0495675_0003156_3811_4098 91
1334 3300047444 Ga0495675_0030018 Ga0495675_0030018_1301_1588 91
1335 3300047444 Ga0495675_0145504 Ga0495675_0145504_121_396 91
1336 3300047445 Ga0495677_0039698 Ga0495677_0039698_523_810 91
1337 3300047471 Ga0495684_0302291 Ga0495684_0302291_220_495 91
1338 3300047472 Ga0495686_0000035 Ga0495686_0000035_99836_100111 91
1339 3300047472 Ga0495686_0004908 Ga0495686_0004908_7696_7971 91
1340 3300047472 Ga0495686_0024909 Ga0495686_0024909_1076_1351 91
1341 3300047673 Ga0495593_0119934 Ga0495593_0119934_337_612 91
1342 3300048088 Ga0495602_0095505 Ga0495602_0095505_356_631 91
1343 3300048088 Ga0495602_0302883 Ga0495602_0302883_791_1066 91
1344 3300048088 Ga0495602_0339611 Ga0495602_0339611_628_903 91
1345 3300048088 Ga0495602_0609863 Ga0495602_0609863_265_552 91
1346 3300048088 Ga0495602_0730921 Ga0495602_0730921_340_615 91
1347 3300048088 Ga0495602_0875100 Ga0495602_0875100_249_524 91
1348 3300048903 Ga0496100_0003519 Ga0496100_0003519_7724_7999 91
1349 3300048903 Ga0496100_0025580 Ga0496100_0025580_401_676 91
1350 3300048904 Ga0496101_0053213 Ga0496101_0053213_1822_2097 91
1351 3300048904 Ga0496101_0252917 Ga0496101_0252917_445_720 91
1352 3300048904 Ga0496101_0625295 Ga0496101_0625295_303_578 91
1353 3300048904 Ga0496101_1142756 Ga0496101_1142756_318_593 91
1354 3300048905 Ga0496102_0000786 Ga0496102_0000786_3365_3640 91
1355 3300048905 Ga0496102_0020216 Ga0496102_0020216_214_489 91
1356 3300048905 Ga0496102_0065308 Ga0496102_0065308_2413_2688 91
1357 3300048905 Ga0496102_0091110 Ga0496102_0091110_362_637 91
1358 3300048905 Ga0496102_0123337 Ga0496102_0123337_614_889 91
1359 3300048905 Ga0496102_0427224 Ga0496102_0427224_477_752 91
1360 3300048905 Ga0496102_0682247 Ga0496102_0682247_243_518 91
1361 3300048905 Ga0496102_0928215 Ga0496102_0928215_156_431 91
1362 3300048905 Ga0496102_1181674 Ga0496102_1181674_385_660 91
1363 3300048906 Ga0496103_0009999 Ga0496103_0009999_346_621 91
1364 3300048906 Ga0496103_0437003 Ga0496103_0437003_154_429 91
1365 3300048906 Ga0496103_0886084 Ga0496103_0886084_212_487 91
1366 3300048907 Ga0496104_0000137 Ga0496104_0000137_51396_51671 91
1367 3300048907 Ga0496104_0056868 Ga0496104_0056868_3414_3689 91
1368 3300048907 Ga0496104_0087555 Ga0496104_0087555_1598_1873 91
1369 3300048907 Ga0496104_0162236 Ga0496104_0162236_173_448 91
1370 3300048907 Ga0496104_0470396 Ga0496104_0470396_485_760 91
1371 3300048907 Ga0496104_0608075 Ga0496104_0608075_121_396 91
1372 3300048907 Ga0496104_0716459 Ga0496104_0716459_561_836 91
1373 3300048907 Ga0496104_1203399 Ga0496104_1203399_273_548 91
1374 3300048907 Ga0496104_1731052 Ga0496104_1731052_50_325 91
1375 3300048907 Ga0496104_1733582 Ga0496104_1733582_190_465 91
1376 3300048908 Ga0496105_0198899 Ga0496105_0198899_1038_1313 91
1377 3300048908 Ga0496105_0248749 Ga0496105_0248749_266_541 91
1378 3300048908 Ga0496105_0346423 Ga0496105_0346423_900_1175 91
1379 3300048908 Ga0496105_0701089 Ga0496105_0701089_47_322 91
1380 3300048908 Ga0496105_0784200 Ga0496105_0784200_117_392 91
1381 3300048909 Ga0496106_0013419 Ga0496106_0013419_1933_2208 91
1382 3300048909 Ga0496106_0031231 Ga0496106_0031231_2045_2320 91
1383 3300048909 Ga0496106_0050410 Ga0496106_0050410_394_669 91
1384 3300048909 Ga0496106_0058042 Ga0496106_0058042_2106_2381 91
1385 3300048910 Ga0496107_0042251 Ga0496107_0042251_1207_1482 91
1386 3300048910 Ga0496107_0200812 Ga0496107_0200812_412_687 91
1387 3300048910 Ga0496107_0273310 Ga0496107_0273310_435_710 91
1388 3300048911 Ga0496108_0002931 Ga0496108_0002931_4812_5087 91
1389 3300048911 Ga0496108_0099305 Ga0496108_0099305_774_1049 91
1390 3300048911 Ga0496108_0657044 Ga0496108_0657044_173_448 91
1391 3300048911 Ga0496108_1014237 Ga0496108_1014237_57_332 91
1392 3300048912 Ga0496109_0001470 Ga0496109_0001470_9762_10037 91
1393 3300048912 Ga0496109_0173416 Ga0496109_0173416_1076_1351 91
1394 3300048912 Ga0496109_0517329 Ga0496109_0517329_32_307 91
1395 3300048912 Ga0496109_0708460 Ga0496109_0708460_35_310 91
1396 3300048912 Ga0496109_1557296 Ga0496109_1557296_251_526 91
1397 3300048913 Ga0496110_0003486 Ga0496110_0003486_1032_1307 91
1398 3300048913 Ga0496110_0048147 Ga0496110_0048147_1741_2016 91
1399 3300048913 Ga0496110_0178729 Ga0496110_0178729_1521_1796 91
1400 3300048913 Ga0496110_0806458 Ga0496110_0806458_309_584 91
1401 3300048913 Ga0496110_1642391 Ga0496110_1642391_89_364 91
1402 3300048914 Ga0496111_0041948 Ga0496111_0041948_1638_1913 91
1403 3300048914 Ga0496111_0235931 Ga0496111_0235931_61_336 91
1404 3300048915 Ga0496112_0000041 Ga0496112_0000041_23701_23976 91
1405 3300048915 Ga0496112_0009496 Ga0496112_0009496_4211_4486 91
1406 3300048915 Ga0496112_0038944 Ga0496112_0038944_3965_4240 91
1407 3300048915 Ga0496112_0045937 Ga0496112_0045937_3169_3444 91
1408 3300048915 Ga0496112_0066714 Ga0496112_0066714_80_355 91
1409 3300048915 Ga0496112_0101800 Ga0496112_0101800_239_514 91
1410 3300048915 Ga0496112_0106461 Ga0496112_0106461_929_1204 91
1411 3300048915 Ga0496112_0121418 Ga0496112_0121418_335_610 91
1412 3300048915 Ga0496112_0234826 Ga0496112_0234826_426_701 91
1413 3300048915 Ga0496112_0289235 Ga0496112_0289235_754_1029 91
1414 3300048915 Ga0496112_0414783 Ga0496112_0414783_625_942 91
1415 3300048915 Ga0496112_0486909 Ga0496112_0486909_244_531 91
1416 3300048915 Ga0496112_1536921 Ga0496112_1536921_290_565 91
1417 3300048915 Ga0496112_1582220 Ga0496112_1582220_153_440 91
1418 3300048916 Ga0496113_0000170 Ga0496113_0000170_9756_10031 91
1419 3300048916 Ga0496113_0037841 Ga0496113_0037841_2824_3099 91
1420 3300048916 Ga0496113_0141357 Ga0496113_0141357_87_362 91
1421 3300048916 Ga0496113_0363344 Ga0496113_0363344_554_829 91
1422 3300048916 Ga0496113_1118802 Ga0496113_1118802_323_598 91
1423 3300048917 Ga0496114_0694438 Ga0496114_0694438_363_638 91
1424 3300048918 Ga0496115_0066508 Ga0496115_0066508_291_566 91
1425 3300048918 Ga0496115_0455158 Ga0496115_0455158_470_757 91
1426 3300048918 Ga0496115_1067687 Ga0496115_1067687_152_427 91
1427 3300048923 Ga0496120_0369124 Ga0496120_0369124_311_586 91
1428 3300048929 Ga0496126_0000110 Ga0496126_0000110_97547_97822 91
1429 3300048929 Ga0496126_0006282 Ga0496126_0006282_5689_5964 91
1430 3300049520 Ga0501297_017415 Ga0501297_017415_492_767 91
1431 3300049521 Ga0501298_019834 Ga0501298_019834_822_1097 91
1432 3300049585 Ga0501069_0675344 Ga0501069_0675344_105_380 91
1433 3300049589 Ga0501073_0091703 Ga0501073_0091703_1317_1604 91
1434 3300049593 Ga0501077_0081286 Ga0501077_0081286_780_1067 91
1435 3300049652 Ga0501202_116273 Ga0501202_116273_210_485 91
1436 3300049654 Ga0501207_027749 Ga0501207_027749_583_858 91
1437 3300049704 Ga0501221_136968 Ga0501221_136968_88_363 91
1438 3300049763 Ga0501266_021858 Ga0501266_021858_398_673 91
1439 3300049851 Ga0501212_051207 Ga0501212_051207_67_342 91
1440 3300050507 nmdc:mga05p37_1626454_c1 nmdc:mga05p37_1626454_c1_248_523 91
1441 3300050512 nmdc:mga0n895_2065505_c1 nmdc:mga0n895_2065505_c1_39_314 91
1442 3300050512 nmdc:mga0n895_29934_c1 nmdc:mga0n895_29934_c1_1466_1741 91
1443 3300050512 nmdc:mga0n895_3843_c1 nmdc:mga0n895_3843_c1_6339_6614 91
1444 3300050512 nmdc:mga0n895_480938_c1 nmdc:mga0n895_480938_c1_148_423 91
1445 3300050513 nmdc:mga0rr50_10973_c1 nmdc:mga0rr50_10973_c1_2704_2979 91
1446 3300050513 nmdc:mga0rr50_182218_c1 nmdc:mga0rr50_182218_c1_85_360 91
1447 3300050513 nmdc:mga0rr50_20989_c1 nmdc:mga0rr50_20989_c1_2889_3164 91
1448 3300050513 nmdc:mga0rr50_302043_c1 nmdc:mga0rr50_302043_c1_28_303 91
1449 3300050513 nmdc:mga0rr50_823996_c1 nmdc:mga0rr50_823996_c1_471_746 91
1450 3300050513 nmdc:mga0rr50_958_c1 nmdc:mga0rr50_958_c1_6923_7198 91
1451 3300050514 nmdc:mga08x19_13768_c1 nmdc:mga08x19_13768_c1_3057_3332 91
1452 3300050514 nmdc:mga08x19_2580_c1 nmdc:mga08x19_2580_c1_4172_4447 91
1453 3300050514 nmdc:mga08x19_267816_c1 nmdc:mga08x19_267816_c1_596_871 91
1454 3300050514 nmdc:mga08x19_283831_c1 nmdc:mga08x19_283831_c1_122_397 91
1455 3300050514 nmdc:mga08x19_432562_c1 nmdc:mga08x19_432562_c1_178_453 91
1456 3300050514 nmdc:mga08x19_4525_c1 nmdc:mga08x19_4525_c1_3472_3747 91
1457 3300050514 nmdc:mga08x19_87014_c1 nmdc:mga08x19_87014_c1_1116_1391 91
1458 3300050515 nmdc:mga0a205_15885_c2 nmdc:mga0a205_15885_c2_2821_3096 91
1459 3300050515 nmdc:mga0a205_7106_c1 nmdc:mga0a205_7106_c1_1404_1679 91
1460 3300053077 Ga0495601_0019321 Ga0495601_0019321_270_545 91
1461 3300053078 Ga0495612_0439980 Ga0495612_0439980_273_548 91
1462 3300053078 Ga0495612_0452251 Ga0495612_0452251_154_429 91
1463 3300053084 Ga0495595_0636677 Ga0495595_0636677_212_487 91
1464 3300053085 Ga0495619_0041163 Ga0495619_0041163_1629_1904 91
1465 3300053085 Ga0495619_0538093 Ga0495619_0538093_481_756 91
1466 3300053136 Ga0500559_0079932 Ga0500559_0079932_174_449 91
1467 3300054114 Ga0501084_0485607 Ga0501084_0485607_13_300 91
1468 3300059640 Ga0587067_057455 Ga0587067_057455_243_518 91
1469 3300061719 Ga0466962_0534659 Ga0466962_0534659_106_381 91

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04368

DUF507

Protein of unknown function (DUF507)

9

107

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8t8l-assembly1.cif.gz_A structure of domain of unknown function 507 (duf507) in space group p3(2)21 0.9085 5 90
8t8l-assembly1.cif.gz_A structure of domain of unknown function 507 (duf507) in space group p3(2)21 0.8535 5 90
3k10-assembly1.cif.gz_A crystal structure of telomere capping protein stn1 from saccharomyces cerevisiae 0.702 7 49
3qaz-assembly11.cif.gz_e il-2 mutant d10 ternary complex 0.5095 6 47
3c1c-assembly1.cif.gz_A the effect of h3 k79 dimethylation and h4 k20 trimethylation on nucleosome and chromatin structure 0.4408 10 84
ID Description Score Start End Superfamily
3k10A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Stn1, N-terminal wHTH domain 0.699 7 46 1.10.10.1080
af_A0A0B4K7C5_135_220_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.6793 3 50 1.10.238.10
4gfkB00 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.5949 5 53 1.10.357.10
af_Q19153_286_501_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.5448 5 88 1.20.1640.10
af_Q19153_286_501_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.5133 5 88 1.20.1640.10
ID Description Score Start End GO Terms
AF-A0A522T815-F1-model_v4 DUF507 family protein 0.9572 2 91
AF-A0A1F3WWH8-F1-model_v4 DUF507 domain-containing protein 0.9515 1 88
AF-A0A532DI91-F1-model_v4 DUF507 family protein 0.9509 2 90
AF-A0A2V9G150-F1-model_v4 DUF507 domain-containing protein 0.9476 2 90
AF-A0A2V9CGU6-F1-model_v4 DUF507 domain-containing protein 0.9471 1 90

Feature Viewer

pLDDT pTM Quality
88.01 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map