F494133

General Info

Members Datasets Scaffolds Average Seq Length
1461 645 1288 247

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0247653|Ga0466967_0247653_635_1519
Length 294
Sequence LLRLYFYFACKPVYPFPRTVAGYYIGGVHGAIGPESIRVRGSKQMDLELKSKAAVVTGASIGIGRAIAKGLALEGVRVVAVARRKDLLTALDEETRVAGGAPIIPVVQDIVQGDAATKLAATAVAELGHVDILVNNAGGSRPLPVDAPDRDWDEAIALNFTSYRKVAHALLPHMIERRWGRIINITGKSEPEGLNAAFAAKAAVHAWAKGLSREIGKYGITVNCIPPGRIMSEQIRRNYPEDYRKRFAEEEIPVGYWGEPEDLAALAVFLASPRARYVTGTVIPVDGGLRRYQF

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
8 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
9 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
10 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
11 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
12 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
13 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
14 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
15 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
16 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
17 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
18 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
19 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
20 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
21 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
22 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
23 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
24 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
25 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
26 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
27 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
28 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
29 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
30 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
31 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
32 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
33 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
34 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
35 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
36 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
37 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
38 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
39 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
40 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
41 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
42 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
43 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
44 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
45 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
46 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
47 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
48 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
49 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
50 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
51 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
52 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
53 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
54 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
55 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
56 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
57 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
58 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
59 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
60 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
61 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
62 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
63 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
64 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
65 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
66 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
67 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
68 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
69 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
70 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
71 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
72 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
73 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
74 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
75 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
76 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
77 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
78 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
79 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
80 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
81 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
82 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
83 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
84 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
85 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
86 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
87 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
88 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
89 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
90 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
91 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
92 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
93 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
94 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
95 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
96 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
97 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
98 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
99 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
100 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
101 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
102 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
103 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
104 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
105 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
106 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
107 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
108 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
109 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
110 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
111 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
112 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
113 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
114 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
115 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
116 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
117 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
118 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
119 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
120 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
121 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
122 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
123 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
124 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
125 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
126 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
127 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
128 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
129 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
130 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
131 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
132 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
133 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
134 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
135 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
136 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
137 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
138 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
139 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
140 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
141 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
142 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
143 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
144 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
145 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
146 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
147 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
148 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
149 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
150 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
151 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
152 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
153 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
154 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
155 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
156 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
157 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
158 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
159 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
160 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
161 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
162 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
163 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
164 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
165 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
166 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
167 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
168 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
169 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
170 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
171 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
172 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
173 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
174 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
175 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
176 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
177 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
178 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
179 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
180 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
181 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
182 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
183 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
184 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
185 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
186 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
187 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
188 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
189 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
190 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
191 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
192 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
193 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
194 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
195 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
196 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
197 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
198 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
199 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
200 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
201 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
202 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
203 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
204 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
205 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
206 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
207 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
208 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
209 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
210 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
211 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
212 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
213 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
214 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
215 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
216 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
217 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
218 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
219 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
220 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
221 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
222 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
223 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
224 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
225 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
226 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
227 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
228 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
229 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
230 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
231 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
232 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
233 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
234 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
235 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
236 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
237 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
238 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
239 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
240 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
241 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
242 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
243 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
244 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
245 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
246 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
247 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
248 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
249 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
250 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
251 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
252 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
253 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
254 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
255 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
256 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
257 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
258 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
259 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
260 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
261 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
262 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
263 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
264 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
265 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
266 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
267 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
268 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
269 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
270 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
271 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
272 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
274 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
275 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
277 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
278 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
279 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
280 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
281 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
282 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
283 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
284 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
350 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
351 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
352 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
353 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
354 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
355 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
356 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
357 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
358 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
359 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
360 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
361 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
365 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
366 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
367 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
368 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
369 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
370 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
371 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
372 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
373 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
374 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
375 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
376 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
377 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
378 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
379 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
380 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
381 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
382 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
383 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
384 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
385 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
386 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
387 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
388 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
389 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
390 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
391 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
392 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
393 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
394 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
395 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
396 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
397 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
398 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
399 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
400 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
401 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
402 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
403 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
404 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
405 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
406 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
407 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
408 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
409 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
410 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
411 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
412 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
413 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
414 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
415 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
416 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
417 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
418 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
419 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
420 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
421 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
422 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
423 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
424 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
425 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
426 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
427 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
428 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
429 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
430 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
431 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
432 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
433 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
434 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
435 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
436 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
437 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
438 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
439 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
440 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
441 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
442 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
443 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
444 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
445 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
446 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
447 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
448 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
449 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
450 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
451 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
452 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
453 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
454 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
455 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
456 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
457 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
458 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
459 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
460 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
461 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
462 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
463 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
464 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
465 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
466 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
467 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
468 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
469 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
470 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
471 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
472 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
473 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
474 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
475 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
476 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
477 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
478 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
479 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
480 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
481 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
482 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
483 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
484 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
485 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
486 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
487 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
488 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
489 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
490 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
491 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
492 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
493 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
494 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
495 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
496 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
497 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
498 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
499 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
500 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
501 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
502 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
503 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
504 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
505 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
506 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
507 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
508 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
509 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
510 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
511 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
512 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
513 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
514 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
515 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
516 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
517 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
518 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
519 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
520 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
521 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
522 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
523 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
524 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
525 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
526 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
527 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
528 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
529 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
530 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
531 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
532 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
533 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
534 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
535 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
536 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
537 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
538 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
539 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
540 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
541 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
542 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
543 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
544 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
545 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
546 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
547 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
548 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
549 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
550 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
551 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
552 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
553 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
554 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
555 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
556 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
557 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
558 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
559 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
560 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
561 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
562 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
563 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
564 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
565 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
566 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
567 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
568 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
569 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
570 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
571 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
572 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
573 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
574 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
575 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
576 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
577 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
578 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
579 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
580 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
581 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
582 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
583 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
584 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
585 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
586 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
587 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
588 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
589 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
590 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
591 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
592 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
593 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
594 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
595 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
596 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
597 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
598 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
599 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
600 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
601 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
602 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
603 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
604 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
605 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
606 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
607 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
608 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
609 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
610 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
611 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
612 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
613 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
614 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
615 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
616 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
617 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
618 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
619 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
620 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
621 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
622 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
623 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
624 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
625 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
626 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
627 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
628 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
629 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
630 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
631 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
632 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
633 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
634 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
635 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
636 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
637 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
638 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
639 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
640 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
641 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
642 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
643 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
644 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
645 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.09
Metatranscriptomes 0.07
Isolates 11.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.98
Nodule 9.17
Rhizoplane 4.11
Rhizosphere 73.65
Stem 0
Stem Tuber 0
Unclassified 6.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000317 3300003215 Bacteria 35509
2 JGI25153J46596_10001194 3300003215 Bacteria 15699
3 JGI25153J46596_10001553 3300003215 Bacteria 13646
4 JGI25153J46596_10006579 3300003215 Bacteria 5858
5 JGI25160J50197_1001548 3300003354 Bacteria 11381
6 JGI25160J50197_1006813 3300003354 Bacteria 4574
7 JGI25160J50197_1009493 3300003354 Bacteria 3603
8 Ga0055540_1006236 3300003792 Bacteria 4784
9 Ga0055531_10001449 3300003794 Bacteria 17511
10 Ga0055543_1030343 3300004625 Bacteria 946
11 Ga0065165_1000747 3300005262 Bacteria 44635
12 Ga0065165_1001867 3300005262 Bacteria 20445
13 Ga0065165_1005506 3300005262 Bacteria 7079
14 Ga0065165_1022460 3300005262 Bacteria 2161
15 Ga0070676_10021860 3300005328 Bacteria 3583
16 Ga0070676_10081208 3300005328 Bacteria 1967
17 Ga0070683_100012136 3300005329 Bacteria 7477
18 Ga0070683_100012606 3300005329 Bacteria 7350
19 Ga0070683_100043532 3300005329 Bacteria 4138
20 Ga0070683_100143303 3300005329 Bacteria 2264
21 Ga0070690_100053642 3300005330 Bacteria 2579
22 Ga0070690_100154103 3300005330 Bacteria 1570
23 Ga0070690_100571774 3300005330 Bacteria 854
24 Ga0070670_100001648 3300005331 Bacteria 18088
25 Ga0070670_100031103 3300005331 Bacteria 4597
26 Ga0070670_100353565 3300005331 Bacteria 1291
27 Ga0070677_10110921 3300005333 Unclassified 1224
28 Ga0070666_10109371 3300005335 Bacteria 1910
29 Ga0070680_100010478 3300005336 Bacteria 7148
30 Ga0070680_100097733 3300005336 Bacteria 2435
31 Ga0070680_100126238 3300005336 Bacteria 2138
32 Ga0070680_100171076 3300005336 Bacteria 1828
33 Ga0070680_100584232 3300005336 Bacteria 958
34 Ga0070680_100603539 3300005336 Bacteria 942
35 Ga0068868_100000130 3300005338 Bacteria 48331
36 Ga0068868_100090667 3300005338 Bacteria 2462
37 Ga0068868_100095768 3300005338 Bacteria 2396
38 Ga0070660_100045797 3300005339 Bacteria 3350
39 Ga0070660_100136044 3300005339 Unclassified 1969
40 Ga0070689_100007535 3300005340 Bacteria 7619
41 Ga0070689_100277453 3300005340 Bacteria 1389
42 Ga0070691_10023957 3300005341 Bacteria 2835
43 Ga0070691_10055300 3300005341 Bacteria 1901
44 Ga0070691_10101246 3300005341 Bacteria 1431
45 Ga0070691_10106762 3300005341 Unclassified 1396
46 Ga0070691_10144072 3300005341 Bacteria 1217
47 Ga0070691_10186388 3300005341 Bacteria 1083
48 Ga0070661_100086188 3300005344 Bacteria 2322
49 Ga0070692_10264143 3300005345 Bacteria 1036
50 Ga0070668_100002013 3300005347 Bacteria 14865
51 Ga0070675_100006171 3300005354 Bacteria 9188
52 Ga0070671_100000330 3300005355 Bacteria 32427
53 Ga0070671_100013367 3300005355 Bacteria 6617
54 Ga0070671_100023957 3300005355 Bacteria 4994
55 Ga0070674_100034983 3300005356 Bacteria 3360
56 Ga0070674_100061051 3300005356 Bacteria 2629
57 Ga0070673_100000435 3300005364 Bacteria 22065
58 Ga0070673_100043909 3300005364 Bacteria 3458
59 Ga0070673_100185130 3300005364 Bacteria 1785
60 Ga0070673_100652908 3300005364 Bacteria 963
61 Ga0070673_100836141 3300005364 Bacteria 851
62 Ga0070673_100945760 3300005364 Bacteria 800
63 Ga0070688_100151679 3300005365 Bacteria 1585
64 Ga0070688_100522181 3300005365 Bacteria 899
65 Ga0070659_100091369 3300005366 Unclassified 2440
66 Ga0070659_100107110 3300005366 Bacteria 2254
67 Ga0070667_100020332 3300005367 Bacteria 5511
68 Ga0070667_100038796 3300005367 Bacteria 3993
69 Ga0070667_100266954 3300005367 Bacteria 1533
70 Ga0070667_100335592 3300005367 Bacteria 1366
71 Ga0070703_10001535 3300005406 Bacteria 6889
72 Ga0070703_10042987 3300005406 Bacteria 1415
73 Ga0070709_10083482 3300005434 Bacteria 2090
74 Ga0070709_10446400 3300005434 Bacteria 974
75 Ga0070714_100165838 3300005435 Bacteria 2002
76 Ga0070714_100257950 3300005435 Bacteria 1614
77 Ga0070701_10013024 3300005438 Bacteria 3773
78 Ga0070705_100000415 3300005440 Bacteria 24569
79 Ga0070705_100003253 3300005440 Bacteria 7985
80 Ga0070705_100040925 3300005440 Bacteria 2639
81 Ga0070700_100002043 3300005441 Bacteria 10255
82 Ga0070700_100074201 3300005441 Bacteria 2179
83 Ga0070700_100273059 3300005441 Bacteria 1222
84 Ga0070700_100554647 3300005441 Bacteria 893
85 Ga0070700_100656663 3300005441 Bacteria 829
86 Ga0070694_100004365 3300005444 Bacteria 8504
87 Ga0070708_100288576 3300005445 Bacteria 1545
88 Ga0070708_100492230 3300005445 Bacteria 1157
89 Ga0070708_100943617 3300005445 Bacteria 809
90 Ga0070663_100125193 3300005455 Unclassified 1946
91 Ga0070663_100130104 3300005455 Bacteria 1911
92 Ga0070663_100353265 3300005455 Bacteria 1191
93 Ga0070678_100000210 3300005456 Bacteria 26068
94 Ga0070678_100622561 3300005456 Bacteria 966
95 Ga0070678_100926828 3300005456 Bacteria 797
96 Ga0070662_100048811 3300005457 Bacteria 3051
97 Ga0070662_100217259 3300005457 Bacteria 1524
98 Ga0070681_10000916 3300005458 Bacteria 24937
99 Ga0070681_10009637 3300005458 Bacteria 9499
100 Ga0070681_10016908 3300005458 Bacteria 7287
101 Ga0070681_10029114 3300005458 Bacteria 5545
102 Ga0070681_10110336 3300005458 Bacteria 2691
103 Ga0070681_10334996 3300005458 Bacteria 1423
104 Ga0068867_100001160 3300005459 Bacteria 18024
105 Ga0068867_100004550 3300005459 Bacteria 9752
106 Ga0068867_100009475 3300005459 Bacteria 6867
107 Ga0068867_100125954 3300005459 Bacteria 1985
108 Ga0068867_100145606 3300005459 Bacteria 1856
109 Ga0070685_10081051 3300005466 Bacteria 1945
110 Ga0070706_100009522 3300005467 Bacteria 9033
111 Ga0070706_100360060 3300005467 Bacteria 1356
112 Ga0070707_100272154 3300005468 Bacteria 1646
113 Ga0070707_100452880 3300005468 Bacteria 1244
114 Ga0070698_100685423 3300005471 Bacteria 967
115 Ga0070699_100000540 3300005518 Bacteria 35757
116 Ga0070699_100076883 3300005518 Bacteria 2906
117 Ga0070699_100256617 3300005518 Bacteria 1563
118 Ga0070699_100446089 3300005518 Bacteria 1173
119 Ga0070679_100003976 3300005530 Bacteria 13614
120 Ga0070679_100014503 3300005530 Bacteria 7570
121 Ga0070679_100020326 3300005530 Bacteria 6471
122 Ga0070679_100045886 3300005530 Bacteria 4354
123 Ga0070679_100091564 3300005530 Bacteria 3029
124 Ga0070679_100130755 3300005530 Bacteria 2492
125 Ga0070679_100246724 3300005530 Bacteria 1742
126 Ga0070684_100007833 3300005535 Bacteria 8332
127 Ga0070684_100031860 3300005535 Bacteria 4491
128 Ga0070684_100054337 3300005535 Bacteria 3490
129 Ga0070684_100067650 3300005535 Bacteria 3139
130 Ga0070697_100035192 3300005536 Bacteria 4039
131 Ga0070697_100043526 3300005536 Bacteria 3636
132 Ga0070697_100069550 3300005536 Bacteria 2884
133 Ga0070697_100103170 3300005536 Bacteria 2370
134 Ga0068853_100003330 3300005539 Bacteria 12297
135 Ga0068853_100032207 3300005539 Bacteria 4440
136 Ga0068853_100089144 3300005539 Bacteria 2709
137 Ga0068853_100323594 3300005539 Bacteria 1430
138 Ga0068853_100573906 3300005539 Bacteria 1070
139 Ga0070672_100003927 3300005543 Bacteria 9689
140 Ga0070672_100112495 3300005543 Bacteria 2221
141 Ga0070686_100017229 3300005544 Bacteria 4218
142 Ga0070695_100000710 3300005545 Bacteria 17788
143 Ga0070695_100004325 3300005545 Bacteria 8317
144 Ga0070695_100015228 3300005545 Bacteria 4641
145 Ga0070695_100019895 3300005545 Bacteria 4094
146 Ga0070695_100153996 3300005545 Bacteria 1607
147 Ga0070696_100007039 3300005546 Bacteria 7509
148 Ga0070696_100022290 3300005546 Bacteria 4301
149 Ga0070696_100105155 3300005546 Bacteria 2027
150 Ga0070696_100199053 3300005546 Bacteria 1495
151 Ga0070696_100257062 3300005546 Bacteria 1323
152 Ga0070693_100086881 3300005547 Bacteria 1877
153 Ga0070665_100071086 3300005548 Bacteria 3486
154 Ga0070665_100128570 3300005548 Bacteria 2536
155 Ga0070665_100187732 3300005548 Bacteria 2068
156 Ga0070704_100000882 3300005549 Bacteria 15016
157 Ga0070704_100356747 3300005549 Bacteria 1236
158 Ga0070704_100438904 3300005549 Bacteria 1122
159 Ga0068855_100007560 3300005563 Bacteria 13147
160 Ga0068855_100178130 3300005563 Bacteria 2404
161 Ga0068855_100196793 3300005563 Bacteria 2270
162 Ga0068855_100216276 3300005563 Bacteria 2151
163 Ga0068855_100467097 3300005563 Bacteria 1375
164 Ga0068855_100876680 3300005563 Bacteria 949
165 Ga0070664_100026818 3300005564 Bacteria 4784
166 Ga0068857_100002616 3300005577 Bacteria 14779
167 Ga0068857_100010399 3300005577 Bacteria 8086
168 Ga0068857_100022493 3300005577 Bacteria 5547
169 Ga0068857_100091731 3300005577 Bacteria 2719
170 Ga0068857_100395140 3300005577 Bacteria 1286
171 Ga0068854_100007298 3300005578 Bacteria 7061
172 Ga0068854_100126259 3300005578 Bacteria 1949
173 Ga0068856_100011621 3300005614 Bacteria 8539
174 Ga0068856_100018079 3300005614 Bacteria 6834
175 Ga0068856_100242713 3300005614 Bacteria 1817
176 Ga0068856_100334605 3300005614 Bacteria 1532
177 Ga0070702_100068615 3300005615 Bacteria 2087
178 Ga0068852_100000400 3300005616 Bacteria 29058
179 Ga0068852_100047090 3300005616 Bacteria 3676
180 Ga0068852_100156552 3300005616 Bacteria 2123
181 Ga0068852_100220473 3300005616 Bacteria 1804
182 Ga0068852_100360105 3300005616 Bacteria 1423
183 Ga0068852_100713371 3300005616 Bacteria 1013
184 Ga0068859_100001347 3300005617 Bacteria 25058
185 Ga0068859_100004592 3300005617 Bacteria 14085
186 Ga0068859_100066061 3300005617 Bacteria 3652
187 Ga0068859_100157942 3300005617 Bacteria 2346
188 Ga0068859_100274500 3300005617 Bacteria 1778
189 Ga0068859_100290213 3300005617 Bacteria 1729
190 Ga0068859_101082384 3300005617 Bacteria 881
191 Ga0068864_100001786 3300005618 Bacteria 17662
192 Ga0068864_100023054 3300005618 Bacteria 5226
193 Ga0068864_100309664 3300005618 Bacteria 1480
194 Ga0068864_101007163 3300005618 Bacteria 826
195 Ga0068861_100002626 3300005719 Bacteria 11748
196 Ga0068861_100019221 3300005719 Bacteria 4881
197 Ga0068861_100230289 3300005719 Bacteria 1571
198 Ga0068861_100340735 3300005719 Bacteria 1312
199 Ga0068861_100644440 3300005719 Bacteria 978
200 Ga0068870_10035490 3300005840 Bacteria 2559
201 Ga0068870_10135581 3300005840 Bacteria 1435
202 Ga0068863_100025164 3300005841 Bacteria 5676
203 Ga0068863_100039160 3300005841 Bacteria 4510
204 Ga0068863_100177172 3300005841 Bacteria 2046
205 Ga0068863_100759500 3300005841 Bacteria 966
206 Ga0068863_101054922 3300005841 Bacteria 816
207 Ga0068858_100005298 3300005842 Bacteria 12648
208 Ga0068858_100421503 3300005842 Bacteria 1283
209 Ga0068860_100006411 3300005843 Bacteria 11811
210 Ga0068860_100043129 3300005843 Bacteria 4305
211 Ga0068860_100142367 3300005843 Bacteria 2305
212 Ga0068860_100386754 3300005843 Bacteria 1382
213 Ga0068862_100032090 3300005844 Bacteria 4437
214 Ga0068862_100108368 3300005844 Bacteria 2436
215 Ga0068862_100171477 3300005844 Bacteria 1943
216 Ga0081540_1000455 3300005983 Bacteria 40662
217 Ga0081540_1019188 3300005983 Bacteria 4166
218 Ga0081539_10002630 3300005985 Bacteria 24552
219 Ga0070717_10001973 3300006028 Bacteria 14345
220 Ga0075368_10000176 3300006042 Bacteria 17416
221 Ga0075368_10008020 3300006042 Bacteria 3745
222 Ga0075363_100006512 3300006048 Bacteria 5312
223 Ga0075363_100008153 3300006048 Bacteria 4863
224 Ga0075363_100011597 3300006048 Bacteria 4225
225 Ga0075363_100202052 3300006048 Bacteria 1136
226 Ga0075364_10000375 3300006051 Bacteria 22017
227 Ga0070715_10099188 3300006163 Bacteria 1355
228 Ga0070716_100204847 3300006173 Bacteria 1314
229 Ga0070712_100160328 3300006175 Bacteria 1736
230 Ga0075362_10120141 3300006177 Bacteria 1243
231 Ga0075367_10000439 3300006178 Bacteria 15444
232 Ga0075367_10012388 3300006178 Bacteria 4544
233 Ga0075366_10008178 3300006195 Bacteria 5803
234 Ga0075366_10016147 3300006195 Bacteria 4288
235 Ga0075366_10044599 3300006195 Bacteria 2628
236 Ga0075366_10307762 3300006195 Bacteria 970
237 Ga0097621_100001929 3300006237 Bacteria 14157
238 Ga0097621_100009529 3300006237 Bacteria 7052
239 Ga0097621_100174203 3300006237 Bacteria 1856
240 Ga0068871_100419030 3300006358 Bacteria 1195
241 Ga0068871_100742920 3300006358 Bacteria 901
242 Ga0068871_100757569 3300006358 Bacteria 893
243 Ga0075428_100003812 3300006844 Bacteria 16545
244 Ga0075428_100105066 3300006844 Bacteria 3080
245 Ga0075428_100236451 3300006844 Bacteria 1971
246 Ga0075428_100276416 3300006844 Bacteria 1807
247 Ga0075430_100010264 3300006846 Bacteria 7930
248 Ga0075430_100077969 3300006846 Bacteria 2778
249 Ga0075430_100226041 3300006846 Bacteria 1552
250 Ga0075431_100006349 3300006847 Bacteria 11742
251 Ga0075431_100094748 3300006847 Bacteria 3081
252 Ga0075431_100291433 3300006847 Bacteria 1651
253 Ga0075431_100325936 3300006847 Bacteria 1548
254 Ga0075431_100592979 3300006847 Bacteria 1093
255 Ga0075433_10006970 3300006852 Bacteria 8959
256 Ga0075433_10173759 3300006852 Bacteria 1917
257 Ga0075434_100001148 3300006871 Bacteria 21880
258 Ga0075434_100344115 3300006871 Bacteria 1512
259 Ga0075434_100404736 3300006871 Bacteria 1386
260 Ga0075429_100023937 3300006880 Bacteria 5298
261 Ga0075429_100040854 3300006880 Bacteria 4038
262 Ga0075429_100086654 3300006880 Bacteria 2729
263 Ga0075429_100243255 3300006880 Bacteria 1576
264 Ga0068865_100116100 3300006881 Bacteria 1982
265 Ga0068865_100293563 3300006881 Bacteria 1298
266 Ga0075436_100000431 3300006914 Bacteria 26895
267 Ga0075436_100001883 3300006914 Bacteria 14419
268 Ga0075436_100002000 3300006914 Bacteria 14080
269 Ga0075436_100039926 3300006914 Bacteria 3238
270 Ga0075436_100050676 3300006914 Bacteria 2865
271 Ga0075436_100055807 3300006914 Bacteria 2728
272 Ga0097620_100001347 3300006931 Bacteria 25058
273 Ga0097620_100004592 3300006931 Bacteria 14085
274 Ga0097620_100066063 3300006931 Bacteria 3652
275 Ga0097620_100157952 3300006931 Bacteria 2346
276 Ga0097620_100274485 3300006931 Bacteria 1778
277 Ga0097620_100290207 3300006931 Bacteria 1729
278 Ga0097620_101082357 3300006931 Bacteria 881
279 Ga0099824_1014958 3300006942 Bacteria 7524
280 Ga0075435_100001283 3300007076 Bacteria 16141
281 Ga0075435_100014770 3300007076 Bacteria 5852
282 Ga0075435_100015371 3300007076 Bacteria 5753
283 Ga0075435_100107534 3300007076 Bacteria 2317
284 Ga0099794_10011812 3300007265 Bacteria 3751
285 Ga0099794_10051542 3300007265 Bacteria 1981
286 Ga0105240_10045969 3300009093 Bacteria 5535
287 Ga0105240_10061780 3300009093 Bacteria 4667
288 Ga0105240_10119203 3300009093 Bacteria 3179
289 Ga0105240_10128638 3300009093 Bacteria 3040
290 Ga0105240_10185517 3300009093 Bacteria 2450
291 Ga0105240_10354189 3300009093 Bacteria 1664
292 Ga0111539_10001755 3300009094 Bacteria 28803
293 Ga0111539_10023402 3300009094 Bacteria 7589
294 Ga0111539_10046787 3300009094 Bacteria 5174
295 Ga0111539_10117520 3300009094 Bacteria 3117
296 Ga0111539_10156457 3300009094 Bacteria 2667
297 Ga0111539_10300993 3300009094 Bacteria 1866
298 Ga0111539_10613135 3300009094 Bacteria 1267
299 Ga0111539_10983089 3300009094 Bacteria 981
300 Ga0111539_10989820 3300009094 Bacteria 978
301 Ga0111539_11059332 3300009094 Bacteria 942
302 Ga0111539_11081060 3300009094 Bacteria 932
303 Ga0111539_11318560 3300009094 Bacteria 838
304 Ga0105245_10000086 3300009098 Bacteria 93019
305 Ga0105245_10290624 3300009098 Bacteria 1601
306 Ga0105245_10938520 3300009098 Bacteria 908
307 Ga0114129_10151243 3300009147 Bacteria 3176
308 Ga0114129_10339853 3300009147 Bacteria 1991
309 Ga0114129_10762280 3300009147 Bacteria 1238
310 Ga0105243_10000360 3300009148 Bacteria 48717
311 Ga0105243_10008145 3300009148 Bacteria 8047
312 Ga0105243_10311275 3300009148 Bacteria 1431
313 Ga0105241_10003630 3300009174 Bacteria 11467
314 Ga0105241_10012445 3300009174 Bacteria 6236
315 Ga0105241_10020398 3300009174 Bacteria 4897
316 Ga0105241_10115152 3300009174 Bacteria 2158
317 Ga0105241_10749501 3300009174 Bacteria 895
318 Ga0105242_10003774 3300009176 Bacteria 11777
319 Ga0105242_10012096 3300009176 Bacteria 6640
320 Ga0105242_10241689 3300009176 Bacteria 1623
321 Ga0105242_10292686 3300009176 Unclassified 1483
322 Ga0105248_10044422 3300009177 Bacteria 4982
323 Ga0105248_10160072 3300009177 Bacteria 2540
324 Ga0105248_10541737 3300009177 Bacteria 1313
325 Ga0105248_11315078 3300009177 Bacteria 818
326 Ga0105237_10016707 3300009545 Bacteria 7619
327 Ga0105237_10019921 3300009545 Bacteria 6926
328 Ga0105237_10047919 3300009545 Bacteria 4297
329 Ga0105237_10175693 3300009545 Bacteria 2142
330 Ga0105237_10177319 3300009545 Bacteria 2131
331 Ga0105237_10179144 3300009545 Bacteria 2120
332 Ga0105238_10013345 3300009551 Bacteria 8287
333 Ga0105238_10051160 3300009551 Bacteria 4155
334 Ga0105238_10116350 3300009551 Bacteria 2653
335 Ga0105238_10352274 3300009551 Bacteria 1461
336 Ga0105238_10882833 3300009551 Bacteria 912
337 Ga0105249_10000690 3300009553 Bacteria 30677
338 Ga0105249_10002066 3300009553 Bacteria 17401
339 Ga0105249_10011943 3300009553 Bacteria 7639
340 Ga0105249_10673243 3300009553 Bacteria 1093
341 Ga0099796_10143275 3300010159 Bacteria 935
342 Ga0105239_10025561 3300010375 Bacteria 6500
343 Ga0105239_10114449 3300010375 Bacteria 2992
344 Ga0105239_10270013 3300010375 Bacteria 1913
345 Ga0105239_10626865 3300010375 Bacteria 1227
346 Ga0105239_10728912 3300010375 Bacteria 1134
347 Ga0157370_10037070 3300013104 Bacteria 4728
348 Ga0157370_10059717 3300013104 Bacteria 3623
349 Ga0157370_10112112 3300013104 Bacteria 2549
350 Ga0157370_10865256 3300013104 Bacteria 821
351 Ga0157369_10022801 3300013105 Bacteria 6981
352 Ga0157369_10082359 3300013105 Bacteria 3442
353 Ga0157369_10120684 3300013105 Bacteria 2782
354 Ga0157374_10002510 3300013296 Bacteria 15487
355 Ga0157374_10009522 3300013296 Bacteria 8341
356 Ga0157374_10102381 3300013296 Bacteria 2746
357 Ga0157378_10001516 3300013297 Bacteria 21037
358 Ga0157378_10004019 3300013297 Bacteria 12985
359 Ga0157378_10009382 3300013297 Bacteria 8525
360 Ga0163162_10039487 3300013306 Bacteria 4717
361 Ga0163162_10150206 3300013306 Bacteria 2447
362 Ga0163162_10254169 3300013306 Bacteria 1889
363 Ga0163162_10311474 3300013306 Bacteria 1707
364 Ga0163162_10333361 3300013306 Bacteria 1650
365 Ga0163162_10374774 3300013306 Bacteria 1556
366 Ga0163162_10502740 3300013306 Bacteria 1342
367 Ga0157372_10061585 3300013307 Bacteria 4202
368 Ga0157375_10026695 3300013308 Bacteria 5387
369 Ga0157375_10040858 3300013308 Bacteria 4474
370 Ga0157375_10091204 3300013308 Bacteria 3108
371 Ga0157375_10139603 3300013308 Bacteria 2549
372 Ga0157375_11065180 3300013308 Bacteria 945
373 Ga0157375_11114810 3300013308 Bacteria 924
374 Ga0163163_10051526 3300014325 Bacteria 4059
375 Ga0163163_10860553 3300014325 Bacteria 970
376 Ga0157380_10015244 3300014326 Bacteria 5645
377 Ga0157380_10039123 3300014326 Bacteria 3686
378 Ga0157380_10050244 3300014326 Bacteria 3293
379 Ga0157380_10079215 3300014326 Bacteria 2683
380 Ga0157380_10195562 3300014326 Bacteria 1789
381 Ga0157380_10329298 3300014326 Bacteria 1420
382 Ga0157377_10037174 3300014745 Bacteria 2682
383 Ga0157377_10048220 3300014745 Bacteria 2389
384 Ga0157376_10002221 3300014969 Bacteria 13093
385 Ga0157376_10008104 3300014969 Bacteria 7551
386 Ga0157376_10020365 3300014969 Bacteria 5129
387 Ga0157376_10061439 3300014969 Bacteria 3158
388 Ga0157376_11159622 3300014969 Bacteria 800
389 Ga0163161_10094745 3300017792 Bacteria 2214
390 Ga0197907_10076814 3300020069 Bacteria 1344
391 Ga0213872_10050831 3300021361 Bacteria 1881
392 Ga0213876_10002898 3300021384 Bacteria 9954
393 Ga0213876_10003579 3300021384 Bacteria 8838
394 Ga0213876_10027678 3300021384 Bacteria 2990
395 Ga0213875_10012736 3300021388 Bacteria 4141
396 Ga0209563_104872 3300025230 Bacteria 2509
397 Ga0207425_1010355 3300025245 Bacteria 2273
398 Ga0209677_104551 3300025253 Bacteria 3951
399 Ga0209148_1000479 3300025254 Bacteria 42062
400 Ga0209233_1005481 3300025261 Bacteria 4204
401 Ga0209233_1022311 3300025261 Bacteria 1623
402 Ga0209455_1000521 3300025272 Bacteria 27243
403 Ga0209673_1019247 3300025273 Bacteria 2457
404 Ga0209564_1007463 3300025295 Bacteria 5643
405 Ga0209564_1048876 3300025295 Bacteria 1052
406 Ga0209758_1000011 3300025297 Bacteria 1049685
407 Ga0209758_1000120 3300025297 Bacteria 192212
408 Ga0209758_1003647 3300025297 Bacteria 13738
409 Ga0209758_1005738 3300025297 Bacteria 9349
410 Ga0209256_1001013 3300025299 Bacteria 33164
411 Ga0209256_1020612 3300025299 Bacteria 2052
412 Ga0207426_1000458 3300025302 Bacteria 64019
413 Ga0207426_1001355 3300025302 Bacteria 20765
414 Ga0207426_1003487 3300025302 Bacteria 8493
415 Ga0207426_1033497 3300025302 Bacteria 1656
416 Ga0209051_1000369 3300025303 Bacteria 64656
417 Ga0209257_1000317 3300025304 Bacteria 101723
418 Ga0209257_1001101 3300025304 Bacteria 35153
419 Ga0207656_10114613 3300025321 Bacteria 1249
420 Ga0207653_10006836 3300025885 Bacteria 3562
421 Ga0207682_10050609 3300025893 Bacteria 1718
422 Ga0207682_10104079 3300025893 Unclassified 1244
423 Ga0207642_10038003 3300025899 Bacteria 2079
424 Ga0207642_10072559 3300025899 Bacteria 1643
425 Ga0207710_10249368 3300025900 Bacteria 887
426 Ga0207688_10005840 3300025901 Bacteria 6698
427 Ga0207688_10064140 3300025901 Bacteria 2073
428 Ga0207688_10115519 3300025901 Unclassified 1562
429 Ga0207647_10080520 3300025904 Bacteria 1953
430 Ga0207685_10078916 3300025905 Bacteria 1356
431 Ga0207699_10018431 3300025906 Bacteria 3699
432 Ga0207699_10247025 3300025906 Bacteria 1228
433 Ga0207645_10019696 3300025907 Bacteria 4422
434 Ga0207645_10042608 3300025907 Bacteria 2904
435 Ga0207645_10070534 3300025907 Bacteria 2235
436 Ga0207643_10038546 3300025908 Bacteria 2684
437 Ga0207643_10040021 3300025908 Bacteria 2638
438 Ga0207643_10047192 3300025908 Bacteria 2436
439 Ga0207705_10050894 3300025909 Bacteria 2982
440 Ga0207705_10100427 3300025909 Bacteria 2128
441 Ga0207705_10375523 3300025909 Bacteria 1098
442 Ga0207684_10101583 3300025910 Bacteria 2459
443 Ga0207684_10213044 3300025910 Bacteria 1666
444 Ga0207654_10022029 3300025911 Bacteria 3395
445 Ga0207707_10000886 3300025912 Bacteria 29266
446 Ga0207707_10001576 3300025912 Bacteria 21009
447 Ga0207707_10001907 3300025912 Bacteria 18977
448 Ga0207707_10031180 3300025912 Bacteria 4664
449 Ga0207707_10036585 3300025912 Bacteria 4291
450 Ga0207707_10105975 3300025912 Bacteria 2457
451 Ga0207707_10223411 3300025912 Bacteria 1639
452 Ga0207707_10224565 3300025912 Bacteria 1635
453 Ga0207707_10272849 3300025912 Bacteria 1466
454 Ga0207707_10306170 3300025912 Bacteria 1373
455 Ga0207695_10000008 3300025913 Bacteria 1058268
456 Ga0207695_10074780 3300025913 Bacteria 3448
457 Ga0207695_10088068 3300025913 Bacteria 3126
458 Ga0207695_10100999 3300025913 Bacteria 2880
459 Ga0207695_10351826 3300025913 Bacteria 1360
460 Ga0207671_10037498 3300025914 Bacteria 3595
461 Ga0207671_10075242 3300025914 Bacteria 2525
462 Ga0207693_10040763 3300025915 Bacteria 3657
463 Ga0207693_10145318 3300025915 Bacteria 1865
464 Ga0207663_10572132 3300025916 Bacteria 885
465 Ga0207660_10008004 3300025917 Bacteria 6833
466 Ga0207660_10016752 3300025917 Bacteria 4859
467 Ga0207660_10018336 3300025917 Bacteria 4662
468 Ga0207660_10061026 3300025917 Bacteria 2713
469 Ga0207660_10231000 3300025917 Bacteria 1454
470 Ga0207660_10238924 3300025917 Bacteria 1431
471 Ga0207662_10190082 3300025918 Bacteria 1325
472 Ga0207657_10017806 3300025919 Bacteria 6801
473 Ga0207657_10047173 3300025919 Bacteria 3769
474 Ga0207649_10013276 3300025920 Bacteria 4594
475 Ga0207649_10192440 3300025920 Bacteria 1436
476 Ga0207649_10201153 3300025920 Bacteria 1407
477 Ga0207652_10028071 3300025921 Bacteria 4693
478 Ga0207652_10028625 3300025921 Bacteria 4651
479 Ga0207652_10145041 3300025921 Bacteria 2124
480 Ga0207652_10165535 3300025921 Bacteria 1983
481 Ga0207652_10239627 3300025921 Bacteria 1635
482 Ga0207652_10384907 3300025921 Bacteria 1266
483 Ga0207646_10073903 3300025922 Bacteria 3045
484 Ga0207646_10365285 3300025922 Bacteria 1304
485 Ga0207646_10641091 3300025922 Bacteria 952
486 Ga0207681_10001932 3300025923 Bacteria 13279
487 Ga0207694_10017635 3300025924 Bacteria 5397
488 Ga0207694_10276676 3300025924 Bacteria 1378
489 Ga0207650_10062660 3300025925 Bacteria 2779
490 Ga0207650_10101071 3300025925 Bacteria 2219
491 Ga0207650_10324423 3300025925 Bacteria 1262
492 Ga0207659_10008337 3300025926 Bacteria 6427
493 Ga0207659_10024473 3300025926 Bacteria 4046
494 Ga0207687_10173227 3300025927 Bacteria 1666
495 Ga0207700_10049267 3300025928 Bacteria 3133
496 Ga0207664_10108586 3300025929 Bacteria 2304
497 Ga0207664_10148323 3300025929 Bacteria 1991
498 Ga0207644_10000662 3300025931 Bacteria 21756
499 Ga0207644_10028414 3300025931 Bacteria 3871
500 Ga0207644_10101300 3300025931 Bacteria 2164
501 Ga0207706_10039524 3300025933 Bacteria 4183
502 Ga0207706_10075564 3300025933 Bacteria 2963
503 Ga0207686_10281531 3300025934 Unclassified 1228
504 Ga0207709_10116889 3300025935 Bacteria 1794
505 Ga0207709_10204687 3300025935 Bacteria 1412
506 Ga0207670_10014902 3300025936 Bacteria 4630
507 Ga0207670_10035833 3300025936 Bacteria 3221
508 Ga0207669_10022596 3300025937 Bacteria 3344
509 Ga0207669_10023774 3300025937 Bacteria 3280
510 Ga0207704_10135121 3300025938 Bacteria 1715
511 Ga0207704_10291416 3300025938 Bacteria 1246
512 Ga0207665_10704104 3300025939 Bacteria 794
513 Ga0207691_10002630 3300025940 Bacteria 17536
514 Ga0207691_10088217 3300025940 Bacteria 2782
515 Ga0207691_10200017 3300025940 Bacteria 1739
516 Ga0207711_10202967 3300025941 Bacteria 1810
517 Ga0207689_10038394 3300025942 Bacteria 3967
518 Ga0207689_10090571 3300025942 Bacteria 2513
519 Ga0207689_10122781 3300025942 Bacteria 2136
520 Ga0207661_10028588 3300025944 Bacteria 4271
521 Ga0207661_10040759 3300025944 Bacteria 3652
522 Ga0207661_10042658 3300025944 Bacteria 3577
523 Ga0207661_10051634 3300025944 Bacteria 3281
524 Ga0207661_10080436 3300025944 Bacteria 2689
525 Ga0207679_10000999 3300025945 Bacteria 18145
526 Ga0207679_10287696 3300025945 Bacteria 1412
527 Ga0207667_10022102 3300025949 Bacteria 7037
528 Ga0207667_10033353 3300025949 Bacteria 5536
529 Ga0207667_10203396 3300025949 Bacteria 2031
530 Ga0207651_10000539 3300025960 Bacteria 15885
531 Ga0207651_10028595 3300025960 Bacteria 3519
532 Ga0207651_10029593 3300025960 Bacteria 3472
533 Ga0207651_10117247 3300025960 Bacteria 2011
534 Ga0207651_10128910 3300025960 Bacteria 1933
535 Ga0207651_10210603 3300025960 Bacteria 1564
536 Ga0207712_10008328 3300025961 Bacteria 6555
537 Ga0207712_10054104 3300025961 Bacteria 2818
538 Ga0207668_10020017 3300025972 Bacteria 4244
539 Ga0207640_10002923 3300025981 Bacteria 9178
540 Ga0207640_10098327 3300025981 Bacteria 2046
541 Ga0207640_10181520 3300025981 Bacteria 1578
542 Ga0207640_10385433 3300025981 Bacteria 1137
543 Ga0207658_10067312 3300025986 Bacteria 2697
544 Ga0207658_10067700 3300025986 Bacteria 2691
545 Ga0207658_10587423 3300025986 Bacteria 1000
546 Ga0207658_10813997 3300025986 Bacteria 848
547 Ga0207677_10006479 3300026023 Bacteria 6428
548 Ga0207677_10050315 3300026023 Bacteria 2818
549 Ga0207703_10001771 3300026035 Bacteria 19284
550 Ga0207703_10116025 3300026035 Bacteria 2291
551 Ga0207703_10212189 3300026035 Bacteria 1727
552 Ga0207703_10435245 3300026035 Bacteria 1223
553 Ga0207639_10053692 3300026041 Bacteria 3076
554 Ga0207639_10140624 3300026041 Bacteria 2010
555 Ga0207639_10337528 3300026041 Bacteria 1343
556 Ga0207678_10036030 3300026067 Bacteria 4307
557 Ga0207678_10178085 3300026067 Unclassified 1816
558 Ga0207708_10001813 3300026075 Bacteria 15767
559 Ga0207708_10093652 3300026075 Bacteria 2319
560 Ga0207708_10139312 3300026075 Bacteria 1902
561 Ga0207708_10156445 3300026075 Bacteria 1797
562 Ga0207708_10227188 3300026075 Bacteria 1497
563 Ga0207702_10000052 3300026078 Bacteria 137784
564 Ga0207702_10035413 3300026078 Bacteria 4174
565 Ga0207702_10614122 3300026078 Bacteria 1067
566 Ga0207641_10050841 3300026088 Bacteria 3508
567 Ga0207641_10170386 3300026088 Bacteria 1986
568 Ga0207641_10355003 3300026088 Unclassified 1398
569 Ga0207648_10001802 3300026089 Bacteria 23480
570 Ga0207648_10012847 3300026089 Bacteria 7820
571 Ga0207648_10092144 3300026089 Bacteria 2649
572 Ga0207648_10236908 3300026089 Bacteria 1624
573 Ga0207676_10004415 3300026095 Bacteria 9944
574 Ga0207676_10010216 3300026095 Bacteria 6678
575 Ga0207676_10014329 3300026095 Bacteria 5703
576 Ga0207676_10047826 3300026095 Bacteria 3317
577 Ga0207676_10523919 3300026095 Bacteria 1129
578 Ga0207676_10791364 3300026095 Bacteria 925
579 Ga0207676_11010937 3300026095 Bacteria 819
580 Ga0207674_10002489 3300026116 Bacteria 23224
581 Ga0207674_10002494 3300026116 Bacteria 23211
582 Ga0207674_10013097 3300026116 Bacteria 9231
583 Ga0207674_10113796 3300026116 Bacteria 2678
584 Ga0207674_10185786 3300026116 Bacteria 2029
585 Ga0207674_10275169 3300026116 Bacteria 1631
586 Ga0207674_10308643 3300026116 Bacteria 1531
587 Ga0207675_100001457 3300026118 Bacteria 23724
588 Ga0207675_100063974 3300026118 Bacteria 3437
589 Ga0207675_100261260 3300026118 Bacteria 1678
590 Ga0207675_100571763 3300026118 Bacteria 1131
591 Ga0207675_100635994 3300026118 Bacteria 1072
592 Ga0207675_100834745 3300026118 Bacteria 936
593 Ga0207683_10006114 3300026121 Bacteria 10311
594 Ga0207683_10030306 3300026121 Bacteria 4687
595 Ga0207683_10103223 3300026121 Bacteria 2546
596 Ga0207683_10160286 3300026121 Bacteria 2033
597 Ga0207683_10284239 3300026121 Bacteria 1512
598 Ga0207683_10953198 3300026121 Bacteria 797
599 Ga0207698_10124070 3300026142 Bacteria 2192
600 Ga0207698_10174151 3300026142 Bacteria 1898
601 Ga0207698_10450068 3300026142 Bacteria 1243
602 Ga0209389_1000043 3300027296 Bacteria 123224
603 Ga0209389_1000077 3300027296 Bacteria 91273
604 Ga0209589_1000047 3300027357 Bacteria 118659
605 Ga0209969_1001449 3300027360 Bacteria 3269
606 Ga0209969_1018048 3300027360 Bacteria 1041
607 Ga0209489_100075 3300027361 Bacteria 136991
608 Ga0209489_100251 3300027361 Bacteria 91273
609 Ga0209700_100271 3300027363 Bacteria 91215
610 Ga0209981_1002479 3300027378 Bacteria 2353
611 Ga0209996_1005842 3300027395 Bacteria 1580
612 Ga0209971_1009416 3300027682 Bacteria 2314
613 Ga0209966_1014624 3300027695 Bacteria 1467
614 Ga0209813_10000818 3300027866 Bacteria 7060
615 Ga0209813_10002644 3300027866 Bacteria 4118
616 Ga0209974_10004349 3300027876 Bacteria 5038
617 Ga0207428_10002848 3300027907 Bacteria 17167
618 Ga0207428_10013797 3300027907 Bacteria 7042
619 Ga0207428_10035406 3300027907 Bacteria 4081
620 Ga0207428_10130760 3300027907 Bacteria 1921
621 Ga0268266_10118526 3300028379 Bacteria 2353
622 Ga0268266_10957672 3300028379 Bacteria 828
623 Ga0268265_10002033 3300028380 Bacteria 15864
624 Ga0268265_10002314 3300028380 Bacteria 14497
625 Ga0268265_10177827 3300028380 Bacteria 1825
626 Ga0268265_10416984 3300028380 Bacteria 1245
627 Ga0268265_11031378 3300028380 Bacteria 814
628 Ga0268264_10000030 3300028381 Bacteria 418542
629 Ga0268264_10001973 3300028381 Bacteria 18439
630 Ga0268264_10003102 3300028381 Bacteria 14386
631 Ga0268264_10079591 3300028381 Bacteria 2796
632 Ga0268264_10142466 3300028381 Bacteria 2139
633 Ga0268264_10309156 3300028381 Bacteria 1491
634 Ga0268264_10409806 3300028381 Bacteria 1305
635 Ga0265319_1079999 3300028563 Bacteria 1039
636 Ga0265318_10010466 3300028577 Bacteria 4039
637 Ga0307511_10039065 3300030521 Bacteria 4061
638 Ga0265332_10002444 3300031238 Bacteria 9471
639 Ga0265328_10026267 3300031239 Bacteria 2189
640 Ga0265320_10029069 3300031240 Bacteria 2863
641 Ga0265329_10004978 3300031242 Bacteria 5437
642 Ga0265340_10120833 3300031247 Bacteria 1205
643 Ga0265339_10009845 3300031249 Bacteria 5970
644 Ga0265339_10152391 3300031249 Bacteria 1168
645 Ga0265331_10002990 3300031250 Bacteria 11119
646 Ga0265316_10015341 3300031344 Bacteria 6703
647 Ga0265316_10187146 3300031344 Bacteria 1540
648 Ga0307513_10000034 3300031456 Bacteria 185012
649 Ga0307513_10007609 3300031456 Bacteria 13999
650 Ga0307509_10084524 3300031507 Bacteria 3268
651 Ga0307509_10274920 3300031507 Bacteria 1449
652 Ga0307408_100157637 3300031548 Bacteria 1800
653 Ga0307408_100728188 3300031548 Bacteria 894
654 Ga0307508_10003532 3300031616 Bacteria 15752
655 Ga0307508_10161807 3300031616 Bacteria 1841
656 Ga0307508_10186206 3300031616 Bacteria 1678
657 Ga0265314_10000245 3300031711 Bacteria 79757
658 Ga0265314_10002700 3300031711 Bacteria 17767
659 Ga0265314_10046257 3300031711 Bacteria 3071
660 Ga0265314_10139617 3300031711 Bacteria 1500
661 Ga0265314_10236417 3300031711 Bacteria 1057
662 Ga0265342_10008315 3300031712 Bacteria 7461
663 Ga0307516_10018252 3300031730 Bacteria 7295
664 Ga0307405_10377919 3300031731 Bacteria 1102
665 Ga0307413_10061935 3300031824 Bacteria 2312
666 Ga0307413_10682957 3300031824 Bacteria 851
667 Ga0307518_10200924 3300031838 Bacteria 1324
668 Ga0307410_10709754 3300031852 Bacteria 848
669 Ga0307406_10318118 3300031901 Bacteria 1203
670 Ga0307407_10115600 3300031903 Bacteria 1692
671 Ga0307409_100106327 3300031995 Bacteria 2342
672 Ga0307416_100042761 3300032002 Bacteria 3541
673 Ga0307416_100076909 3300032002 Bacteria 2800
674 Ga0307411_10162153 3300032005 Bacteria 1676
675 Ga0307411_10235812 3300032005 Bacteria 1429
676 Ga0307507_10026861 3300033179 Bacteria 6192
677 Ga0307510_10017164 3300033180 Bacteria 8539
678 Ga0373950_0018298 3300034818 Bacteria 1215
679 Ga0373938_0004232 3300034957 Bacteria 2386
680 Ga0373926_0038226 3300035083 Bacteria 1709
681 Ga0373926_0088564 3300035083 Bacteria 1149
682 Ga0373929_0008806 3300035085 Bacteria 1865
683 Ga0373929_0011614 3300035085 Bacteria 1662
684 Ga0373929_0043119 3300035085 Bacteria 1009
685 Ga0373934_0009337 3300035086 Bacteria 3672
686 Ga0373944_0012480 3300035089 Bacteria 2342
687 Ga0373951_0005556 3300035091 Bacteria 2924
688 Ga0373952_0006139 3300035092 Bacteria 2215
689 Ga0373923_0004076 3300035111 Bacteria 4801
690 Ga0373923_0062235 3300035111 Bacteria 1587
691 Ga0373932_0004300 3300035112 Bacteria 3378
692 Ga0373932_0066187 3300035112 Bacteria 1110
693 Ga0373936_0045218 3300035113 Bacteria 1773
694 Ga0373936_0102151 3300035113 Bacteria 1210
695 Ga0373939_0015963 3300035114 Bacteria 1973
696 Ga0373945_0003594 3300035116 Bacteria 4885
697 Ga0373945_0004386 3300035116 Bacteria 4481
698 Ga0373953_0000715 3300035117 Bacteria 9186
699 Ga0373954_0000084 3300035118 Bacteria 33354
700 Ga0373956_0027703 3300035119 Bacteria 2462
701 Ga0373957_0004322 3300035120 Bacteria 4310
702 Ga0373960_0002619 3300035121 Bacteria 4069
703 Ga0373960_0029936 3300035121 Bacteria 1513
704 Ga0373943_0137670 3300035170 Bacteria 1312
705 Ga0373955_0000301 3300035172 Bacteria 20395
706 Ga0373955_0024108 3300035172 Bacteria 3107
707 Ga0373942_0011396 3300035207 Bacteria 2108
708 Ga0373924_0003265 3300035410 Bacteria 5550
709 Ga0373924_0004344 3300035410 Bacteria 4949
710 Ga0373931_0000116 3300035691 Bacteria 36224
711 Ga0373931_0006888 3300035691 Bacteria 5345
712 Ga0373931_0024087 3300035691 Bacteria 3079
713 Ga0373931_0026893 3300035691 Bacteria 2932
714 Ga0373931_0111062 3300035691 Bacteria 1555
715 Ga0373935_0026781 3300035692 Bacteria 3563
716 Ga0373935_0120149 3300035692 Bacteria 1754
717 Ga0373935_0173688 3300035692 Bacteria 1475
718 Ga0373927_0018106 3300035695 Bacteria 4632
719 Ga0373927_0038713 3300035695 Bacteria 3095
720 Ga0373927_0046867 3300035695 Bacteria 2796
721 Ga0373927_0085133 3300035695 Bacteria 2051
722 Ga0373927_0240362 3300035695 Bacteria 1190
723 Ga0373927_0266483 3300035695 Bacteria 1126
724 Ga0373933_0000951 3300035724 Bacteria 17668
725 Ga0373933_0032348 3300035724 Bacteria 3040
726 Ga0373947_0022472 3300035725 Bacteria 3659
727 Ga0373947_0026018 3300035725 Bacteria 3415
728 Ga0373947_0164254 3300035725 Bacteria 1437
729 Ga0373937_0008455 3300036401 Bacteria 8945
730 Ga0373937_0225314 3300036401 Bacteria 1765
731 Ga0373937_0390306 3300036401 Bacteria 1320
732 Ga0373925_0016726 3300037068 Bacteria 5312
733 Ga0373925_0024885 3300037068 Bacteria 4373
734 Ga0373925_0084632 3300037068 Bacteria 2417
735 Ga0373925_0178949 3300037068 Bacteria 1677
736 Ga0373925_0432399 3300037068 Bacteria 1076
737 Ga0395900_0001310 3300037418 Bacteria 30209
738 Ga0395900_0008575 3300037418 Bacteria 10508
739 Ga0395900_0334580 3300037418 Bacteria 1491
740 Ga0395900_0415545 3300037418 Bacteria 1307
741 Ga0395898_0011039 3300037466 Bacteria 9411
742 Ga0395898_0035192 3300037466 Bacteria 4984
743 Ga0395898_0086895 3300037466 Bacteria 3013
744 Ga0395898_0089354 3300037466 Bacteria 2965
745 Ga0395898_0245347 3300037466 Bacteria 1708
746 Ga0395905_0028793 3300037471 Bacteria 5234
747 Ga0436364_0586291 3300037853 Bacteria 97560
748 Ga0395901_0024836 3300038443 Bacteria 6151
749 Ga0395901_0127744 3300038443 Bacteria 2672
750 Ga0436365_0401821 3300039437 Bacteria 2515
751 Ga0436365_0812156 3300039437 Bacteria 1069
752 Ga0436365_0991677 3300039437 Bacteria 1200
753 Ga0436365_1236739 3300039437 Bacteria 30341
754 Ga0436365_1491363 3300039437 Bacteria 7723
755 Ga0436360_0222734 3300039438 Bacteria 1174
756 Ga0436360_1227094 3300039438 Bacteria 4421
757 Ga0436361_0075293 3300039447 Bacteria 1881
758 Ga0436361_0975863 3300039447 Bacteria 3276
759 Ga0436361_1096819 3300039447 Bacteria 2130
760 Ga0436363_0884224 3300039450 Bacteria 6818
761 Ga0436363_1119093 3300039450 Bacteria 1482
762 Ga0436362_0093970 3300039453 Bacteria 1166
763 Ga0436362_0548217 3300039453 Bacteria 3819
764 Ga0451793_0601538 3300041452 Bacteria 2473
765 Ga0451807_2436701 3300041486 Bacteria 1158
766 Ga0451835_1188482 3300041492 Bacteria 943
767 Ga0451851_0511660 3300041507 Bacteria 1156
768 Ga0439441_027153 3300042001 Bacteria 1091
769 Ga0439456_030969 3300042013 Bacteria 1145
770 Ga0439446_0007953 3300042156 Bacteria 2802
771 Ga0439435_0012673 3300042436 Bacteria 2048
772 Ga0439435_0119447 3300042436 Bacteria 825
773 Ga0451577_0025631 3300042876 Bacteria 5349
774 Ga0466969_0071333 3300044656 Bacteria 1670
775 Ga0466969_0128632 3300044656 Bacteria 1175
776 Ga0466972_0000079 3300044658 Bacteria 90348
777 Ga0466972_0004993 3300044658 Bacteria 6655
778 Ga0466972_0060127 3300044658 Bacteria 1823
779 Ga0453683_0201124 3300044673 Bacteria 1265
780 Ga0466966_0000191 3300044684 Bacteria 40906
781 Ga0466961_0000005 3300044693 Bacteria 173105
782 Ga0466961_0033127 3300044693 Bacteria 3321
783 Ga0466963_0134668 3300044694 Bacteria 1709
784 Ga0466963_0192617 3300044694 Bacteria 1424
785 Ga0466963_0329166 3300044694 Bacteria 1075
786 Ga0466964_0011528 3300044706 Bacteria 3341
787 Ga0466968_0286535 3300044735 Bacteria 789
788 Ga0466970_0159152 3300044765 Bacteria 1249
789 Ga0466957_0127298 3300044842 Bacteria 1628
790 Ga0466960_0022513 3300044901 Bacteria 2818
791 Ga0466959_0000654 3300045049 Bacteria 20198
792 Ga0466959_0047848 3300045049 Bacteria 3145
793 Ga0451576_0003058 3300045051 Bacteria 23525
794 Ga0451576_0024160 3300045051 Bacteria 6567
795 Ga0451576_0135192 3300045051 Bacteria 2571
796 Ga0451576_0194719 3300045051 Bacteria 2117
797 Ga0451576_0491751 3300045051 Bacteria 1289
798 Ga0451576_0532206 3300045051 Bacteria 1235
799 Ga0451576_0938594 3300045051 Bacteria 907
800 Ga0466967_0056368 3300045976 Bacteria 3464
801 Ga0466967_0167498 3300045976 Bacteria 2065
802 Ga0466967_0234169 3300045976 Bacteria 1749
803 Ga0466967_0247653 3300045976 Bacteria 1701
804 Ga0466967_0398772 3300045976 Bacteria 1338
805 Ga0466967_0523322 3300045976 Bacteria 1165
806 Ga0495592_0001709 3300046454 Bacteria 15422
807 Ga0495592_0016467 3300046454 Bacteria 5609
808 Ga0495592_0029039 3300046454 Bacteria 4187
809 Ga0495592_0059743 3300046454 Bacteria 2806
810 Ga0495603_0022391 3300046455 Bacteria 3826
811 Ga0495603_0023839 3300046455 Bacteria 3702
812 Ga0495603_0045351 3300046455 Bacteria 2622
813 Ga0495590_0067357 3300046457 Bacteria 1255
814 Ga0495629_0003566 3300046459 Bacteria 11757
815 Ga0495629_0065560 3300046459 Bacteria 2535
816 Ga0495641_0047349 3300046461 Bacteria 1974
817 Ga0495651_0001292 3300046462 Bacteria 19438
818 Ga0495653_0002541 3300046463 Bacteria 14539
819 Ga0495653_0044851 3300046463 Bacteria 3430
820 Ga0495580_0005831 3300046472 Bacteria 10102
821 Ga0495580_0018121 3300046472 Bacteria 5247
822 Ga0495582_0016731 3300046473 Bacteria 4016
823 Ga0495639_0006521 3300046475 Bacteria 5021
824 Ga0495639_0051667 3300046475 Bacteria 1869
825 Ga0495639_0198840 3300046475 Bacteria 981
826 Ga0495664_0012490 3300046477 Bacteria 4810
827 Ga0495664_0103801 3300046477 Bacteria 1713
828 Ga0495664_0365399 3300046477 Bacteria 868
829 Ga0495583_0053826 3300046506 Bacteria 1825
830 Ga0495608_0007174 3300046511 Bacteria 7881
831 Ga0495608_0030932 3300046511 Bacteria 3620
832 Ga0495608_0095790 3300046511 Bacteria 1917
833 Ga0495608_0139730 3300046511 Bacteria 1546
834 Ga0495618_0020969 3300046514 Bacteria 4025
835 Ga0495618_0043985 3300046514 Bacteria 2817
836 Ga0495628_0001353 3300046516 Bacteria 22476
837 Ga0495628_0010524 3300046516 Bacteria 7852
838 Ga0495628_0018938 3300046516 Bacteria 5696
839 Ga0495628_0364153 3300046516 Bacteria 1061
840 Ga0495630_0004252 3300046517 Bacteria 10039
841 Ga0495630_0023538 3300046517 Bacteria 4553
842 Ga0495630_0024806 3300046517 Bacteria 4433
843 Ga0495648_0028398 3300046524 Bacteria 3727
844 Ga0495663_0100065 3300046525 Bacteria 954
845 Ga0495666_0024399 3300046526 Bacteria 2987
846 Ga0495666_0064310 3300046526 Bacteria 1751
847 Ga0495652_0006590 3300046529 Bacteria 10786
848 Ga0495652_0230362 3300046529 Bacteria 1386
849 Ga0495652_0427058 3300046529 Bacteria 933
850 Ga0495665_0028674 3300046531 Bacteria 2983
851 Ga0495640_0001127 3300046533 Bacteria 20904
852 Ga0495640_0021531 3300046533 Bacteria 4730
853 Ga0495640_0030787 3300046533 Bacteria 3838
854 Ga0495640_0046916 3300046533 Bacteria 2991
855 Ga0495586_0002131 3300046535 Bacteria 10752
856 Ga0495586_0020997 3300046535 Bacteria 3480
857 Ga0495586_0046702 3300046535 Bacteria 2335
858 Ga0495587_0008387 3300046536 Bacteria 6650
859 Ga0495609_0121254 3300046538 Bacteria 1124
860 Ga0495621_0012895 3300046539 Bacteria 2615
861 Ga0495621_0054227 3300046539 Bacteria 1441
862 Ga0495597_0078838 3300046542 Bacteria 1411
863 Ga0495645_0002913 3300046543 Bacteria 11620
864 Ga0495645_0021817 3300046543 Bacteria 4629
865 Ga0495645_0043454 3300046543 Bacteria 3278
866 Ga0495622_0007219 3300046557 Bacteria 5160
867 Ga0495622_0009262 3300046557 Bacteria 4557
868 Ga0495622_0095691 3300046557 Bacteria 1363
869 Ga0495667_0007315 3300046559 Bacteria 7491
870 Ga0495667_0007620 3300046559 Bacteria 7343
871 Ga0495656_0028453 3300046615 Bacteria 2242
872 Ga0495668_0209470 3300046616 Bacteria 1067
873 Ga0495634_0012018 3300046642 Bacteria 6277
874 Ga0495634_0013010 3300046642 Bacteria 6019
875 Ga0495634_0178489 3300046642 Bacteria 1331
876 Ga0495611_0026243 3300046648 Bacteria 2541
877 Ga0495635_0002472 3300046663 Bacteria 12617
878 Ga0495635_0002810 3300046663 Bacteria 11943
879 Ga0495635_0049929 3300046663 Bacteria 2884
880 Ga0495635_0066981 3300046663 Bacteria 2463
881 Ga0495635_0090539 3300046663 Bacteria 2092
882 Ga0495659_0138713 3300046664 Bacteria 969
883 Ga0495588_0004811 3300046674 Bacteria 5976
884 Ga0495588_0050203 3300046674 Bacteria 2146
885 Ga0495588_0064104 3300046674 Bacteria 1906
886 Ga0495657_0001354 3300046675 Bacteria 21307
887 Ga0495657_0004748 3300046675 Bacteria 10827
888 Ga0495599_0001302 3300046678 Bacteria 14182
889 Ga0495599_0005290 3300046678 Bacteria 7698
890 Ga0495599_0030205 3300046678 Bacteria 3399
891 Ga0495599_0081921 3300046678 Bacteria 2016
892 Ga0495623_0017513 3300046679 Bacteria 4628
893 Ga0495623_0027704 3300046679 Bacteria 3648
894 Ga0495646_0003632 3300046680 Bacteria 9626
895 Ga0495647_0000583 3300046681 Bacteria 10814
896 Ga0495647_0009435 3300046681 Bacteria 3307
897 Ga0495647_0078863 3300046681 Bacteria 1332
898 Ga0495658_0002859 3300046683 Bacteria 8673
899 Ga0495658_0038669 3300046683 Bacteria 2643
900 Ga0495658_0097178 3300046683 Bacteria 1753
901 Ga0495669_0200987 3300046684 Bacteria 952
902 Ga0495613_0011558 3300046689 Bacteria 6563
903 Ga0495613_0020813 3300046689 Bacteria 4890
904 Ga0495613_0065191 3300046689 Bacteria 2662
905 Ga0495613_0118867 3300046689 Bacteria 1899
906 Ga0495613_0162640 3300046689 Bacteria 1587
907 Ga0495613_0277321 3300046689 Bacteria 1165
908 Ga0495624_0007439 3300046690 Bacteria 7686
909 Ga0495589_0075661 3300046794 Bacteria 1642
910 Ga0495600_0000887 3300046809 Bacteria 16014
911 Ga0495600_0002308 3300046809 Bacteria 10889
912 Ga0495600_0012950 3300046809 Bacteria 5228
913 Ga0495600_0116846 3300046809 Bacteria 1736
914 Ga0495581_0007913 3300047315 Bacteria 6156
915 Ga0495604_0008849 3300047317 Bacteria 7957
916 Ga0495636_0003358 3300047318 Bacteria 6202
917 Ga0495674_0018855 3300047319 Bacteria 6417
918 Ga0495674_0115472 3300047319 Bacteria 2272
919 Ga0495674_0570629 3300047319 Bacteria 899
920 Ga0495676_0025504 3300047321 Bacteria 5103
921 Ga0495676_0031801 3300047321 Bacteria 4459
922 Ga0495676_0250756 3300047321 Bacteria 1208
923 Ga0495680_0004106 3300047322 Bacteria 14003
924 Ga0495680_0008905 3300047322 Bacteria 9074
925 Ga0495680_0013546 3300047322 Bacteria 7107
926 Ga0495680_0210282 3300047322 Bacteria 1393
927 Ga0495675_0006334 3300047444 Bacteria 7245
928 Ga0495675_0014844 3300047444 Bacteria 4926
929 Ga0495675_0153474 3300047444 Bacteria 1422
930 Ga0495684_0000777 3300047471 Bacteria 25850
931 Ga0495684_0004968 3300047471 Bacteria 10383
932 Ga0495684_0368462 3300047471 Bacteria 1016
933 Ga0495684_0421971 3300047471 Bacteria 932
934 Ga0495686_0089415 3300047472 Bacteria 1871
935 Ga0495593_0005870 3300047673 Bacteria 7235
936 Ga0495593_0018091 3300047673 Bacteria 3963
937 Ga0495593_0044871 3300047673 Bacteria 2362
938 Ga0495593_0153959 3300047673 Bacteria 1162
939 Ga0495602_0048917 3300048088 Bacteria 3793
940 Ga0495602_0055388 3300048088 Bacteria 3492
941 Ga0495602_0083357 3300048088 Bacteria 2679
942 Ga0496100_0354358 3300048903 Bacteria 1109
943 Ga0496100_0386626 3300048903 Bacteria 1063
944 Ga0496101_0010462 3300048904 Bacteria 6126
945 Ga0496101_0195605 3300048904 Bacteria 1562
946 Ga0496102_0004180 3300048905 Bacteria 12212
947 Ga0496102_0037694 3300048905 Bacteria 4362
948 Ga0496102_0298173 3300048905 Bacteria 1519
949 Ga0496102_0611487 3300048905 Bacteria 1013
950 Ga0496103_0010570 3300048906 Bacteria 5464
951 Ga0496103_0020026 3300048906 Bacteria 4017
952 Ga0496103_0079575 3300048906 Bacteria 2060
953 Ga0496104_0000887 3300048907 Bacteria 25727
954 Ga0496104_0003143 3300048907 Bacteria 14231
955 Ga0496104_0004370 3300048907 Bacteria 12305
956 Ga0496104_0019617 3300048907 Bacteria 6189
957 Ga0496104_0037883 3300048907 Bacteria 4509
958 Ga0496104_0249331 3300048907 Bacteria 1688
959 Ga0496105_0015706 3300048908 Bacteria 6041
960 Ga0496105_0022134 3300048908 Bacteria 5149
961 Ga0496105_0025293 3300048908 Bacteria 4831
962 Ga0496106_0005519 3300048909 Bacteria 9359
963 Ga0496106_0006989 3300048909 Bacteria 8338
964 Ga0496106_0012569 3300048909 Bacteria 6251
965 Ga0496106_0032551 3300048909 Bacteria 3888
966 Ga0496106_0111916 3300048909 Bacteria 2127
967 Ga0496107_0053363 3300048910 Bacteria 2916
968 Ga0496107_0145016 3300048910 Bacteria 1755
969 Ga0496108_0001980 3300048911 Bacteria 16402
970 Ga0496108_0003753 3300048911 Bacteria 12174
971 Ga0496108_0009913 3300048911 Bacteria 7723
972 Ga0496108_0041408 3300048911 Bacteria 3846
973 Ga0496108_0561733 3300048911 Bacteria 995
974 Ga0496109_0014368 3300048912 Bacteria 6889
975 Ga0496109_0043521 3300048912 Bacteria 4070
976 Ga0496109_0072366 3300048912 Bacteria 3167
977 Ga0496109_0230160 3300048912 Bacteria 1744
978 Ga0496109_0368026 3300048912 Bacteria 1358
979 Ga0496110_0000895 3300048913 Bacteria 20991
980 Ga0496110_0005352 3300048913 Bacteria 10053
981 Ga0496110_0031997 3300048913 Bacteria 4540
982 Ga0496110_0143275 3300048913 Bacteria 2161
983 Ga0496110_0550857 3300048913 Bacteria 1048
984 Ga0496111_0011980 3300048914 Bacteria 5861
985 Ga0496111_0029520 3300048914 Bacteria 3895
986 Ga0496111_0064293 3300048914 Bacteria 2661
987 Ga0496111_0093348 3300048914 Bacteria 2206
988 Ga0496112_0004485 3300048915 Bacteria 11845
989 Ga0496112_0086125 3300048915 Bacteria 3109
990 Ga0496112_0112237 3300048915 Bacteria 2695
991 Ga0496112_0330066 3300048915 Bacteria 1469
992 Ga0496113_0157676 3300048916 Bacteria 1793
993 Ga0496113_0248641 3300048916 Bacteria 1419
994 Ga0496114_0014641 3300048917 Bacteria 6301
995 Ga0496114_0034538 3300048917 Bacteria 4173
996 Ga0496114_0200320 3300048917 Unclassified 1749
997 Ga0496114_0358657 3300048917 Bacteria 1290
998 Ga0496114_0657747 3300048917 Bacteria 921
999 Ga0496115_0096434 3300048918 Bacteria 2421
1000 Ga0496116_0022844 3300048919 Bacteria 4673
1001 Ga0496116_0083636 3300048919 Bacteria 1969
1002 Ga0496118_0006235 3300048921 Bacteria 13179
1003 Ga0496118_0046707 3300048921 Bacteria 3365
1004 Ga0496118_0262934 3300048921 Bacteria 972
1005 Ga0496119_0004854 3300048922 Bacteria 13172
1006 Ga0496119_0012751 3300048922 Bacteria 6787
1007 Ga0496120_0027812 3300048923 Bacteria 3473
1008 Ga0496121_0002635 3300048924 Bacteria 27038
1009 Ga0496121_0115874 3300048924 Bacteria 2033
1010 Ga0496121_0240280 3300048924 Bacteria 1262
1011 Ga0496122_0058473 3300048925 Bacteria 2854
1012 Ga0496124_0004890 3300048927 Bacteria 15418
1013 Ga0496125_0017937 3300048928 Bacteria 6728
1014 Ga0496125_0197232 3300048928 Bacteria 1322
1015 Ga0496126_0002122 3300048929 Bacteria 27701
1016 Ga0496126_0029792 3300048929 Bacteria 5181
1017 Ga0496126_0045231 3300048929 Bacteria 4047
1018 Ga0496126_0404681 3300048929 Bacteria 1106
1019 Ga0501031_0002180 3300049568 Bacteria 12363
1020 Ga0501031_0002433 3300049568 Bacteria 11846
1021 Ga0501031_0010261 3300049568 Bacteria 6100
1022 Ga0501031_0244256 3300049568 Bacteria 1167
1023 Ga0501032_0000136 3300049569 Bacteria 59896
1024 Ga0501032_0095248 3300049569 Bacteria 1974
1025 Ga0501033_0000202 3300049570 Bacteria 57109
1026 Ga0501034_0000113 3300049571 Bacteria 149824
1027 Ga0501034_0014166 3300049571 Bacteria 8219
1028 Ga0501034_0029250 3300049571 Bacteria 5601
1029 Ga0501034_0102984 3300049571 Bacteria 2848
1030 Ga0501034_0253230 3300049571 Bacteria 1705
1031 Ga0501034_0514815 3300049571 Bacteria 1109
1032 Ga0501034_0526711 3300049571 Bacteria 1093
1033 Ga0501036_0000059 3300049572 Bacteria 72347
1034 Ga0501036_0005674 3300049572 Bacteria 10126
1035 Ga0501036_0149482 3300049572 Bacteria 1970
1036 Ga0501036_0268433 3300049572 Bacteria 1429
1037 Ga0501036_0314199 3300049572 Bacteria 1310
1038 Ga0501036_0424980 3300049572 Bacteria 1108
1039 Ga0501037_0000214 3300049573 Bacteria 51638
1040 Ga0501037_0053793 3300049573 Bacteria 2945
1041 Ga0501038_0001436 3300049574 Bacteria 21855
1042 Ga0501038_0002810 3300049574 Bacteria 16214
1043 Ga0501038_0037147 3300049574 Bacteria 4273
1044 Ga0501038_0115598 3300049574 Bacteria 2218
1045 Ga0501038_0439717 3300049574 Bacteria 1004
1046 Ga0501039_0000694 3300049575 Bacteria 24174
1047 Ga0501039_0001981 3300049575 Bacteria 15182
1048 Ga0501039_0053131 3300049575 Bacteria 3135
1049 Ga0501039_0164874 3300049575 Bacteria 1742
1050 Ga0501040_0000067 3300049576 Bacteria 50568
1051 Ga0501040_0037972 3300049576 Bacteria 3274
1052 Ga0501040_0157012 3300049576 Bacteria 1607
1053 Ga0501041_0000874 3300049577 Bacteria 16264
1054 Ga0501041_0011051 3300049577 Bacteria 5332
1055 Ga0501041_0013257 3300049577 Bacteria 4883
1056 Ga0501041_0039663 3300049577 Bacteria 2858
1057 Ga0501041_0086153 3300049577 Bacteria 1938
1058 Ga0501042_0053316 3300049578 Bacteria 2885
1059 Ga0501042_0055963 3300049578 Bacteria 2815
1060 Ga0501042_0079039 3300049578 Bacteria 2356
1061 Ga0501043_0000017 3300049579 Bacteria 166630
1062 Ga0501043_0010087 3300049579 Bacteria 7407
1063 Ga0501043_0209553 3300049579 Bacteria 1511
1064 Ga0501043_0503702 3300049579 Bacteria 904
1065 Ga0501046_0000174 3300049580 Bacteria 65566
1066 Ga0501046_0000275 3300049580 Bacteria 52272
1067 Ga0501046_0050186 3300049580 Bacteria 3297
1068 Ga0501046_0062584 3300049580 Bacteria 2907
1069 Ga0501046_0076011 3300049580 Bacteria 2603
1070 Ga0501046_0154449 3300049580 Bacteria 1730
1071 Ga0501047_0000044 3300049581 Bacteria 174789
1072 Ga0501047_0010806 3300049581 Bacteria 8630
1073 Ga0501047_0019677 3300049581 Bacteria 6477
1074 Ga0501047_0143232 3300049581 Bacteria 2268
1075 Ga0501047_0195332 3300049581 Bacteria 1886
1076 Ga0501048_0000837 3300049582 Bacteria 22705
1077 Ga0501048_0006864 3300049582 Bacteria 8650
1078 Ga0501048_0036135 3300049582 Bacteria 3552
1079 Ga0501048_0079019 3300049582 Bacteria 2322
1080 Ga0501048_0106416 3300049582 Bacteria 1980
1081 Ga0501048_0280439 3300049582 Bacteria 1185
1082 Ga0501067_0011413 3300049583 Bacteria 4918
1083 Ga0501068_0000089 3300049584 Bacteria 38379
1084 Ga0501068_0008721 3300049584 Bacteria 5655
1085 Ga0501069_0005200 3300049585 Bacteria 6763
1086 Ga0501069_0158532 3300049585 Bacteria 1303
1087 Ga0501070_0015659 3300049586 Bacteria 6375
1088 Ga0501070_0034519 3300049586 Bacteria 4228
1089 Ga0501070_0058949 3300049586 Bacteria 3182
1090 Ga0501070_0085885 3300049586 Bacteria 2605
1091 Ga0501070_0113759 3300049586 Bacteria 2236
1092 Ga0501070_0113933 3300049586 Bacteria 2234
1093 Ga0501071_0000835 3300049587 Bacteria 16487
1094 Ga0501071_0001329 3300049587 Bacteria 14117
1095 Ga0501071_0018583 3300049587 Bacteria 4816
1096 Ga0501071_0046014 3300049587 Bacteria 3134
1097 Ga0501071_0127700 3300049587 Bacteria 1888
1098 Ga0501071_0187099 3300049587 Bacteria 1552
1099 Ga0501072_0000569 3300049588 Bacteria 26584
1100 Ga0501072_0003722 3300049588 Bacteria 11502
1101 Ga0501072_0005305 3300049588 Bacteria 9816
1102 Ga0501072_0212348 3300049588 Bacteria 1542
1103 Ga0501072_0434669 3300049588 Bacteria 1040
1104 Ga0501073_0000069 3300049589 Bacteria 63198
1105 Ga0501073_0099587 3300049589 Bacteria 2018
1106 Ga0501074_0000346 3300049590 Bacteria 27099
1107 Ga0501074_0012367 3300049590 Bacteria 6204
1108 Ga0501074_0059863 3300049590 Bacteria 2743
1109 Ga0501074_0223605 3300049590 Bacteria 1340
1110 Ga0501074_0600096 3300049590 Bacteria 779
1111 Ga0501075_0000011 3300049591 Bacteria 83082
1112 Ga0501075_0003173 3300049591 Bacteria 11007
1113 Ga0501075_0004743 3300049591 Bacteria 9242
1114 Ga0501075_0017422 3300049591 Bacteria 5190
1115 Ga0501075_0052860 3300049591 Bacteria 3055
1116 Ga0501075_0067175 3300049591 Bacteria 2707
1117 Ga0501075_0082419 3300049591 Bacteria 2436
1118 Ga0501075_0090844 3300049591 Bacteria 2317
1119 Ga0501076_0000116 3300049592 Bacteria 44179
1120 Ga0501076_0004572 3300049592 Bacteria 9850
1121 Ga0501076_0022327 3300049592 Bacteria 4864
1122 Ga0501076_0046875 3300049592 Bacteria 3416
1123 Ga0501076_0054576 3300049592 Bacteria 3167
1124 Ga0501076_0163471 3300049592 Bacteria 1814
1125 Ga0501076_0420969 3300049592 Bacteria 1099
1126 Ga0501077_0002528 3300049593 Bacteria 10954
1127 Ga0501077_0007172 3300049593 Bacteria 6872
1128 Ga0501077_0048514 3300049593 Bacteria 2698
1129 Ga0501079_0000021 3300049741 Bacteria 63849
1130 Ga0501079_0011151 3300049741 Bacteria 6855
1131 Ga0501079_0060546 3300049741 Bacteria 2920
1132 Ga0501079_0091240 3300049741 Bacteria 2360
1133 Ga0501079_0137161 3300049741 Bacteria 1905
1134 Ga0501080_0000541 3300049742 Bacteria 29739
1135 Ga0501080_0000613 3300049742 Bacteria 28256
1136 Ga0501080_0041399 3300049742 Bacteria 4293
1137 Ga0501080_0042217 3300049742 Bacteria 4248
1138 Ga0501080_0099389 3300049742 Bacteria 2700
1139 Ga0501080_0248884 3300049742 Bacteria 1621
1140 Ga0501080_0262150 3300049742 Bacteria 1574
1141 Ga0501080_0276630 3300049742 Bacteria 1527
1142 Ga0501081_0012368 3300049743 Bacteria 5607
1143 Ga0501081_0024760 3300049743 Bacteria 4032
1144 Ga0501081_0103516 3300049743 Bacteria 2014
1145 Ga0501081_0322453 3300049743 Bacteria 1136
1146 Ga0501083_0000838 3300049744 Bacteria 20228
1147 Ga0501083_0125880 3300049744 Bacteria 1679
1148 Ga0501283_006120 3300049779 Bacteria 1675
1149 Ga0501035_0000393 3300049822 Bacteria 49959
1150 Ga0501035_0028477 3300049822 Bacteria 5098
1151 Ga0501035_0428175 3300049822 Bacteria 1098
1152 Ga0501044_0000108 3300049823 Bacteria 100968
1153 Ga0501044_0036561 3300049823 Bacteria 5138
1154 Ga0501044_0070209 3300049823 Bacteria 3564
1155 Ga0501044_0397655 3300049823 Bacteria 1291
1156 Ga0501045_0000083 3300049824 Bacteria 45695
1157 Ga0501045_0003295 3300049824 Bacteria 11029
1158 Ga0501045_0007027 3300049824 Bacteria 7805
1159 Ga0501045_0052840 3300049824 Bacteria 2968
1160 Ga0501045_0088310 3300049824 Bacteria 2290
1161 Ga0501045_0097323 3300049824 Bacteria 2177
1162 nmdc:mga03n38_100614_c1 3300050490 Bacteria 1393
1163 nmdc:mga03n38_222895_c1 3300050490 Bacteria 985
1164 nmdc:mga03n38_303582_c1 3300050490 Bacteria 858
1165 nmdc:mga03n38_90463_c1 3300050490 Bacteria 1456
1166 nmdc:mga00v17_148995_c1 3300050491 Bacteria 1503
1167 nmdc:mga00v17_30571_c1 3300050491 Bacteria 3170
1168 nmdc:mga0yw44_28700_c1 3300050492 Bacteria 3204
1169 nmdc:mga0yw44_389259_c1 3300050492 Bacteria 942
1170 nmdc:mga0yw44_393770_c1 3300050492 Bacteria 936
1171 nmdc:mga0k408_14716_c1 3300050493 Bacteria 4317
1172 nmdc:mga0k408_150863_c1 3300050493 Bacteria 1384
1173 nmdc:mga0k408_42447_c1 3300050493 Bacteria 2620
1174 nmdc:mga0k408_57199_c1 3300050493 Bacteria 2264
1175 nmdc:mga06z11_102019_c1 3300050494 Bacteria 1576
1176 nmdc:mga06z11_126557_c1 3300050494 Bacteria 1430
1177 nmdc:mga06z11_16076_c1 3300050494 Bacteria 3360
1178 nmdc:mga06z11_22101_c1 3300050494 Bacteria 2966
1179 nmdc:mga06z11_2258_c1 3300050494 Bacteria 7330
1180 nmdc:mga04h51_1097_c1 3300050495 Bacteria 6232
1181 nmdc:mga07m45_155815_c1 3300050496 Bacteria 1325
1182 nmdc:mga07m45_86069_c1 3300050496 Bacteria 1798
1183 nmdc:mga05p37_120836_c1 3300050507 Bacteria 3218
1184 nmdc:mga05p37_148724_c1 3300050507 Bacteria 2866
1185 nmdc:mga05p37_171923_c1 3300050507 Bacteria 2642
1186 nmdc:mga05p37_185_c1 3300050507 Bacteria 61269
1187 nmdc:mga05p37_237852_c1 3300050507 Bacteria 2191
1188 nmdc:mga05p37_603703_c1 3300050507 Bacteria 1238
1189 nmdc:mga09592_216241_c1 3300050508 Bacteria 1661
1190 nmdc:mga09592_26221_c1 3300050508 Bacteria 4828
1191 nmdc:mga09592_48434_c1 3300050508 Bacteria 3583
1192 nmdc:mga0qj67_13296_c1 3300050509 Bacteria 6211
1193 nmdc:mga0qj67_14400_c1 3300050509 Bacteria 5979
1194 nmdc:mga0qj67_241468_c1 3300050509 Bacteria 1466
1195 nmdc:mga0qj67_54969_c1 3300050509 Bacteria 3153
1196 nmdc:mga0qj67_70071_c1 3300050509 Bacteria 2797
1197 nmdc:mga0qj67_7712_c1 3300050509 Bacteria 7955
1198 nmdc:mga06r32_14504_c2 3300050510 Bacteria 5622
1199 nmdc:mga06r32_251564_c1 3300050510 Bacteria 1755
1200 nmdc:mga06r32_291163_c1 3300050510 Bacteria 1620
1201 nmdc:mga06r32_34274_c1 3300050510 Bacteria 4787
1202 nmdc:mga06r32_489969_c1 3300050510 Bacteria 1207
1203 nmdc:mga06r32_549401_c1 3300050510 Bacteria 1129
1204 nmdc:mga08y16_103236_c1 3300050511 Bacteria 2968
1205 nmdc:mga08y16_143182_c1 3300050511 Bacteria 2485
1206 nmdc:mga08y16_17298_c1 3300050511 Bacteria 7590
1207 nmdc:mga08y16_218185_c1 3300050511 Bacteria 1975
1208 nmdc:mga08y16_224_c1 3300050511 Bacteria 50738
1209 nmdc:mga08y16_26751_c1 3300050511 Bacteria 6078
1210 nmdc:mga08y16_460582_c1 3300050511 Bacteria 1296
1211 nmdc:mga08y16_691535_c1 3300050511 Bacteria 1021
1212 nmdc:mga0n895_105375_c1 3300050512 Bacteria 2832
1213 nmdc:mga0n895_1398_c1 3300050512 Bacteria 17992
1214 nmdc:mga0n895_24213_c1 3300050512 Bacteria 5719
1215 nmdc:mga0n895_49171_c1 3300050512 Bacteria 4130
1216 nmdc:mga0n895_85508_c1 3300050512 Bacteria 3149
1217 nmdc:mga0rr50_55212_c1 3300050513 Bacteria 2963
1218 nmdc:mga0rr50_70509_c1 3300050513 Bacteria 2663
1219 nmdc:mga08x19_127824_c1 3300050514 Bacteria 1707
1220 nmdc:mga08x19_237_c1 3300050514 Bacteria 42162
1221 nmdc:mga08x19_44645_c1 3300050514 Bacteria 2830
1222 nmdc:mga08x19_4663_c1 3300050514 Bacteria 8134
1223 nmdc:mga0a205_167828_c1 3300050515 Bacteria 2090
1224 nmdc:mga0a205_183823_c1 3300050515 Bacteria 1984
1225 nmdc:mga0a205_421438_c1 3300050515 Bacteria 1197
1226 nmdc:mga0a205_927_c1 3300050515 Bacteria 24197
1227 nmdc:mga0sz30_33559_c1 3300050516 Bacteria 2134
1228 nmdc:mga0sz30_5376_c1 3300050516 Bacteria 4693
1229 Ga0495601_0106738 3300053077 Bacteria 1811
1230 Ga0495612_0013206 3300053078 Bacteria 3327
1231 Ga0500635_0014435 3300053080 Bacteria 2314
1232 Ga0495619_0000701 3300053085 Bacteria 21925
1233 Ga0495619_0042507 3300053085 Bacteria 2977
1234 Ga0495619_0134532 3300053085 Bacteria 1700
1235 Ga0495619_0161304 3300053085 Bacteria 1549
1236 Ga0495619_0177792 3300053085 Bacteria 1472
1237 Ga0500643_000373 3300053087 Bacteria 35007
1238 Ga0500647_0019184 3300053091 Bacteria 3173
1239 Ga0500647_0128774 3300053091 Bacteria 1194
1240 Ga0500651_0008303 3300053093 Bacteria 6101
1241 Ga0500566_0000174 3300053094 Bacteria 32668
1242 Ga0500566_0121836 3300053094 Bacteria 1405
1243 Ga0500650_0027058 3300053098 Bacteria 2578
1244 Ga0500556_0076518 3300053104 Bacteria 1258
1245 Ga0500569_037550 3300053109 Bacteria 1400
1246 Ga0500607_021746 3300053121 Bacteria 3610
1247 Ga0500642_0000127 3300053130 Bacteria 34341
1248 Ga0500642_0007115 3300053130 Bacteria 3739
1249 Ga0500658_0113169 3300053134 Bacteria 1196
1250 Ga0500568_0003938 3300053139 Bacteria 8082
1251 Ga0500573_0091335 3300053140 Bacteria 1719
1252 Ga0500590_043953 3300053148 Bacteria 2289
1253 Ga0500590_098831 3300053148 Bacteria 1405
1254 Ga0500616_0028333 3300053153 Bacteria 3087
1255 Ga0500619_000101 3300053154 Bacteria 22906
1256 Ga0500636_0003003 3300053177 Bacteria 9450
1257 Ga0500636_0086701 3300053177 Bacteria 1797
1258 Ga0500636_0264781 3300053177 Bacteria 868
1259 Ga0500625_045973 3300053729 Bacteria 2036
1260 Ga0500609_002948 3300053731 Bacteria 2422
1261 Ga0500601_001110 3300053737 Bacteria 3044
1262 Ga0501084_0001429 3300054114 Bacteria 18938
1263 Ga0501084_0002813 3300054114 Bacteria 14042
1264 Ga0501084_0033032 3300054114 Bacteria 4329
1265 Ga0501084_0044602 3300054114 Bacteria 3712
1266 Ga0501084_0107797 3300054114 Bacteria 2340
1267 Ga0501084_0119967 3300054114 Bacteria 2211
1268 Ga0501084_0137678 3300054114 Bacteria 2055
1269 Ga0501084_0188968 3300054114 Bacteria 1738
1270 Ga0501084_0248698 3300054114 Bacteria 1501
1271 Ga0501084_0351688 3300054114 Bacteria 1245
1272 Ga0501084_0413638 3300054114 Bacteria 1140
1273 Ga0590071_055710 3300059421 Bacteria 961
1274 Ga0590077_030192 3300059426 Bacteria 1181
1275 Ga0501082_0000807 3300060353 Bacteria 27511
1276 Ga0501082_0009986 3300060353 Bacteria 8184
1277 Ga0501082_0012212 3300060353 Bacteria 7380
1278 Ga0501082_0025869 3300060353 Bacteria 5059
1279 Ga0501082_0088946 3300060353 Bacteria 2666
1280 Ga0501082_0126553 3300060353 Bacteria 2216
1281 Ga0501082_0360815 3300060353 Bacteria 1267
1282 Ga0501082_0482755 3300060353 Bacteria 1083
1283 Ga0530510_0000146 3300061734 Bacteria 41786
1284 Ga0530510_0040585 3300061734 Bacteria 3359
1285 Ga0530510_0041312 3300061734 Bacteria 3330
1286 Ga0530510_0071132 3300061734 Bacteria 2525
1287 Ga0530510_0241692 3300061734 Bacteria 1344
1288 Ga0530510_0506470 3300061734 Bacteria 915

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049582 Ga0501048_0106416 Ga0501048_0106416_1007_1771 210
2 3300049590 Ga0501074_0600096 Ga0501074_0600096_20_676 212
3 3300047319 Ga0495674_0570629 Ga0495674_0570629_87_848 216
4 3300005328 Ga0070676_10081208 Ga0070676_100812082 228
5 3300005330 Ga0070690_100571774 Ga0070690_1005717741 228
6 3300005335 Ga0070666_10109371 Ga0070666_101093712 228
7 3300005338 Ga0068868_100095768 Ga0068868_1000957682 228
8 3300005340 Ga0070689_100277453 Ga0070689_1002774532 228
9 3300005356 Ga0070674_100061051 Ga0070674_1000610513 228
10 3300005364 Ga0070673_100836141 Ga0070673_1008361411 228
11 3300005364 Ga0070673_100945760 Ga0070673_1009457601 228
12 3300005367 Ga0070667_100335592 Ga0070667_1003355921 228
13 3300005441 Ga0070700_100273059 Ga0070700_1002730591 228
14 3300005456 Ga0070678_100926828 Ga0070678_1009268281 228
15 3300005457 Ga0070662_100217259 Ga0070662_1002172592 228
16 3300005617 Ga0068859_100274500 Ga0068859_1002745002 228
17 3300005618 Ga0068864_100309664 Ga0068864_1003096641 228
18 3300005618 Ga0068864_101007163 Ga0068864_1010071631 228
19 3300005841 Ga0068863_100177172 Ga0068863_1001771722 228
20 3300005841 Ga0068863_101054922 Ga0068863_1010549221 228
21 3300005843 Ga0068860_100142367 Ga0068860_1001423672 228
22 3300006237 Ga0097621_100174203 Ga0097621_1001742032 228
23 3300006358 Ga0068871_100742920 Ga0068871_1007429202 228
24 3300006881 Ga0068865_100116100 Ga0068865_1001161002 228
25 3300006931 Ga0097620_100274485 Ga0097620_1002744852 228
26 3300009148 Ga0105243_10311275 Ga0105243_103112752 228
27 3300009177 Ga0105248_11315078 Ga0105248_113150781 228
28 3300013306 Ga0163162_10254169 Ga0163162_102541693 228
29 3300014969 Ga0157376_10061439 Ga0157376_100614391 228
30 3300014969 Ga0157376_11159622 Ga0157376_111596221 228
31 3300017792 Ga0163161_10094745 Ga0163161_100947452 228
32 3300025893 Ga0207682_10050609 Ga0207682_100506092 228
33 3300025899 Ga0207642_10038003 Ga0207642_100380033 228
34 3300025907 Ga0207645_10042608 Ga0207645_100426082 228
35 3300025908 Ga0207643_10047192 Ga0207643_100471923 228
36 3300025926 Ga0207659_10024473 Ga0207659_100244733 228
37 3300025931 Ga0207644_10028414 Ga0207644_100284143 228
38 3300025933 Ga0207706_10039524 Ga0207706_100395242 228
39 3300025935 Ga0207709_10116889 Ga0207709_101168891 228
40 3300025937 Ga0207669_10022596 Ga0207669_100225963 228
41 3300025938 Ga0207704_10135121 Ga0207704_101351212 228
42 3300025940 Ga0207691_10200017 Ga0207691_102000171 228
43 3300025942 Ga0207689_10090571 Ga0207689_100905712 228
44 3300025960 Ga0207651_10029593 Ga0207651_100295932 228
45 3300025960 Ga0207651_10117247 Ga0207651_101172473 228
46 3300025961 Ga0207712_10054104 Ga0207712_100541042 228
47 3300026035 Ga0207703_10435245 Ga0207703_104352451 228
48 3300026075 Ga0207708_10139312 Ga0207708_101393122 228
49 3300026088 Ga0207641_10170386 Ga0207641_101703862 228
50 3300026095 Ga0207676_10004415 Ga0207676_100044156 228
51 3300026095 Ga0207676_11010937 Ga0207676_110109371 228
52 3300026118 Ga0207675_100063974 Ga0207675_1000639742 228
53 3300026121 Ga0207683_10160286 Ga0207683_101602862 228
54 3300028381 Ga0268264_10079591 Ga0268264_100795912 228
55 3300042436 Ga0439435_0119447 Ga0439435_0119447_51_806 228
56 3300045051 Ga0451576_0532206 Ga0451576_0532206_112_864 228
57 3300028577 Ga0265318_10010466 Ga0265318_100104664 229
58 3300031238 Ga0265332_10002444 Ga0265332_100024443 229
59 3300031239 Ga0265328_10026267 Ga0265328_100262672 229
60 3300031240 Ga0265320_10029069 Ga0265320_100290691 229
61 3300031242 Ga0265329_10004978 Ga0265329_100049782 229
62 3300031250 Ga0265331_10002990 Ga0265331_100029903 229
63 3300031344 Ga0265316_10015341 Ga0265316_100153415 229
64 3300031711 Ga0265314_10000245 Ga0265314_1000024516 229
65 3300031712 Ga0265342_10008315 Ga0265342_100083157 229
66 3300003792 Ga0055540_1006236 Ga0055540_10062365 233
67 3300003794 Ga0055531_10001449 Ga0055531_100014493 233
68 3300021361 Ga0213872_10050831 Ga0213872_100508312 233
69 3300025273 Ga0209673_1019247 Ga0209673_10192473 233
70 3300025303 Ga0209051_1000369 Ga0209051_100036932 233
71 3300025304 Ga0209257_1000317 Ga0209257_100031771 233
72 3300025941 Ga0207711_10202967 Ga0207711_102029673 233
73 3300039447 Ga0436361_0075293 Ga0436361_0075293_453_1211 233
74 3300048911 Ga0496108_0561733 Ga0496108_0561733_123_833 233
75 3300005336 Ga0070680_100097733 Ga0070680_1000977332 234
76 3300005445 Ga0070708_100492230 Ga0070708_1004922301 234
77 3300010159 Ga0099796_10143275 Ga0099796_101432751 234
78 3300007265 Ga0099794_10011812 Ga0099794_100118124 235
79 3300049571 Ga0501034_0514815 Ga0501034_0514815_258_1010 235
80 3300005445 Ga0070708_100288576 Ga0070708_1002885761 236
81 3300013297 Ga0157378_10009382 Ga0157378_100093823 236
82 3300046506 Ga0495583_0053826 Ga0495583_0053826_1098_1808 236
83 3300031507 Ga0307509_10084524 Ga0307509_100845243 237
84 3300031824 Ga0307413_10061935 Ga0307413_100619352 238
85 3300031995 Ga0307409_100106327 Ga0307409_1001063272 238
86 3300048912 Ga0496109_0014368 Ga0496109_0014368_5665_6417 238
87 3300048913 Ga0496110_0005352 Ga0496110_0005352_8346_9098 238
88 3300048915 Ga0496112_0004485 Ga0496112_0004485_10824_11576 238
89 3300048917 Ga0496114_0358657 Ga0496114_0358657_55_807 238
90 3300049568 Ga0501031_0002433 Ga0501031_0002433_4434_5183 238
91 3300049743 Ga0501081_0322453 Ga0501081_0322453_304_1056 239
92 3300060353 Ga0501082_0482755 Ga0501082_0482755_307_1059 239
93 3300009098 Ga0105245_10938520 Ga0105245_109385201 240
94 3300048907 Ga0496104_0019617 Ga0496104_0019617_5172_5924 240
95 3300048909 Ga0496106_0006989 Ga0496106_0006989_1436_2188 240
96 3300049571 Ga0501034_0014166 Ga0501034_0014166_826_1566 240
97 3300005459 Ga0068867_100145606 Ga0068867_1001456062 241
98 3300014326 Ga0157380_10195562 Ga0157380_101955622 241
99 3300026089 Ga0207648_10092144 Ga0207648_100921442 241
100 3300026121 Ga0207683_10284239 Ga0207683_102842393 241
101 3300007265 Ga0099794_10051542 Ga0099794_100515422 242
102 3300014326 Ga0157380_10039123 Ga0157380_100391235 242
103 3300025925 Ga0207650_10324423 Ga0207650_103244232 242
104 3300045051 Ga0451576_0194719 Ga0451576_0194719_991_1746 242
105 3300048904 Ga0496101_0010462 Ga0496101_0010462_272_1009 242
106 3300005329 Ga0070683_100043532 Ga0070683_1000435325 243
107 3300005330 Ga0070690_100154103 Ga0070690_1001541032 243
108 3300005331 Ga0070670_100031103 Ga0070670_1000311033 243
109 3300005340 Ga0070689_100007535 Ga0070689_1000075353 243
110 3300005341 Ga0070691_10144072 Ga0070691_101440721 243
111 3300005341 Ga0070691_10186388 Ga0070691_101863881 243
112 3300005345 Ga0070692_10264143 Ga0070692_102641431 243
113 3300005355 Ga0070671_100023957 Ga0070671_1000239574 243
114 3300005356 Ga0070674_100034983 Ga0070674_1000349834 243
115 3300005364 Ga0070673_100185130 Ga0070673_1001851302 243
116 3300005364 Ga0070673_100652908 Ga0070673_1006529081 243
117 3300005365 Ga0070688_100522181 Ga0070688_1005221811 243
118 3300005435 Ga0070714_100257950 Ga0070714_1002579502 243
119 3300005440 Ga0070705_100003253 Ga0070705_1000032536 243
120 3300005440 Ga0070705_100040925 Ga0070705_1000409253 243
121 3300005441 Ga0070700_100656663 Ga0070700_1006566631 243
122 3300005445 Ga0070708_100943617 Ga0070708_1009436171 243
123 3300005456 Ga0070678_100622561 Ga0070678_1006225612 243
124 3300005458 Ga0070681_10000916 Ga0070681_1000091622 243
125 3300005459 Ga0068867_100001160 Ga0068867_1000011603 243
126 3300005466 Ga0070685_10081051 Ga0070685_100810512 243
127 3300005467 Ga0070706_100360060 Ga0070706_1003600602 243
128 3300005471 Ga0070698_100685423 Ga0070698_1006854231 243
129 3300005518 Ga0070699_100446089 Ga0070699_1004460891 243
130 3300005535 Ga0070684_100031860 Ga0070684_1000318606 243
131 3300005536 Ga0070697_100043526 Ga0070697_1000435264 243
132 3300005543 Ga0070672_100112495 Ga0070672_1001124953 243
133 3300005544 Ga0070686_100017229 Ga0070686_1000172296 243
134 3300005545 Ga0070695_100004325 Ga0070695_1000043252 243
135 3300005545 Ga0070695_100019895 Ga0070695_1000198953 243
136 3300005546 Ga0070696_100007039 Ga0070696_1000070395 243
137 3300005546 Ga0070696_100105155 Ga0070696_1001051552 243
138 3300005546 Ga0070696_100199053 Ga0070696_1001990532 243
139 3300005549 Ga0070704_100438904 Ga0070704_1004389041 243
140 3300005615 Ga0070702_100068615 Ga0070702_1000686152 243
141 3300005617 Ga0068859_100157942 Ga0068859_1001579422 243
142 3300005617 Ga0068859_100290213 Ga0068859_1002902132 243
143 3300005618 Ga0068864_100023054 Ga0068864_1000230545 243
144 3300005719 Ga0068861_100019221 Ga0068861_1000192216 243
145 3300005841 Ga0068863_100759500 Ga0068863_1007595002 243
146 3300005843 Ga0068860_100386754 Ga0068860_1003867541 243
147 3300005985 Ga0081539_10002630 Ga0081539_1000263014 243
148 3300006237 Ga0097621_100009529 Ga0097621_1000095298 243
149 3300006358 Ga0068871_100419030 Ga0068871_1004190302 243
150 3300006844 Ga0075428_100003812 Ga0075428_1000038122 243
151 3300006846 Ga0075430_100077969 Ga0075430_1000779693 243
152 3300006846 Ga0075430_100226041 Ga0075430_1002260412 243
153 3300006847 Ga0075431_100291433 Ga0075431_1002914332 243
154 3300006852 Ga0075433_10006970 Ga0075433_100069705 243
155 3300006852 Ga0075433_10173759 Ga0075433_101737592 243
156 3300006871 Ga0075434_100001148 Ga0075434_10000114817 243
157 3300006880 Ga0075429_100040854 Ga0075429_1000408542 243
158 3300006880 Ga0075429_100086654 Ga0075429_1000866542 243
159 3300006914 Ga0075436_100000431 Ga0075436_10000043127 243
160 3300006914 Ga0075436_100001883 Ga0075436_10000188315 243
161 3300006914 Ga0075436_100039926 Ga0075436_1000399262 243
162 3300006914 Ga0075436_100050676 Ga0075436_1000506762 243
163 3300006914 Ga0075436_100055807 Ga0075436_1000558073 243
164 3300006931 Ga0097620_100157952 Ga0097620_1001579522 243
165 3300006931 Ga0097620_100290207 Ga0097620_1002902072 243
166 3300007076 Ga0075435_100001283 Ga0075435_10000128317 243
167 3300007076 Ga0075435_100014770 Ga0075435_1000147702 243
168 3300009094 Ga0111539_10023402 Ga0111539_100234024 243
169 3300009094 Ga0111539_10046787 Ga0111539_100467872 243
170 3300009094 Ga0111539_10300993 Ga0111539_103009932 243
171 3300009094 Ga0111539_10983089 Ga0111539_109830891 243
172 3300009094 Ga0111539_10989820 Ga0111539_109898202 243
173 3300009098 Ga0105245_10000086 Ga0105245_1000008658 243
174 3300009098 Ga0105245_10290624 Ga0105245_102906243 243
175 3300009147 Ga0114129_10151243 Ga0114129_101512432 243
176 3300009147 Ga0114129_10762280 Ga0114129_107622801 243
177 3300009148 Ga0105243_10000360 Ga0105243_100003606 243
178 3300009148 Ga0105243_10008145 Ga0105243_100081455 243
179 3300009174 Ga0105241_10020398 Ga0105241_100203982 243
180 3300009176 Ga0105242_10003774 Ga0105242_100037746 243
181 3300009176 Ga0105242_10012096 Ga0105242_100120962 243
182 3300009177 Ga0105248_10160072 Ga0105248_101600722 243
183 3300009177 Ga0105248_10541737 Ga0105248_105417372 243
184 3300009551 Ga0105238_10882833 Ga0105238_108828332 243
185 3300009553 Ga0105249_10000690 Ga0105249_1000069016 243
186 3300009553 Ga0105249_10011943 Ga0105249_100119435 243
187 3300010375 Ga0105239_10270013 Ga0105239_102700132 243
188 3300013297 Ga0157378_10001516 Ga0157378_1000151615 243
189 3300013306 Ga0163162_10039487 Ga0163162_100394875 243
190 3300013306 Ga0163162_10502740 Ga0163162_105027402 243
191 3300013308 Ga0157375_10139603 Ga0157375_101396032 243
192 3300014325 Ga0163163_10860553 Ga0163163_108605532 243
193 3300014745 Ga0157377_10037174 Ga0157377_100371742 243
194 3300014969 Ga0157376_10002221 Ga0157376_100022216 243
195 3300014969 Ga0157376_10008104 Ga0157376_100081044 243
196 3300025899 Ga0207642_10072559 Ga0207642_100725591 243
197 3300025907 Ga0207645_10070534 Ga0207645_100705342 243
198 3300025908 Ga0207643_10038546 Ga0207643_100385462 243
199 3300025910 Ga0207684_10101583 Ga0207684_101015832 243
200 3300025912 Ga0207707_10001576 Ga0207707_1000157621 243
201 3300025917 Ga0207660_10238924 Ga0207660_102389242 243
202 3300025922 Ga0207646_10365285 Ga0207646_103652852 243
203 3300025923 Ga0207681_10001932 Ga0207681_1000193214 243
204 3300025925 Ga0207650_10101071 Ga0207650_101010713 243
205 3300025927 Ga0207687_10173227 Ga0207687_101732272 243
206 3300025929 Ga0207664_10148323 Ga0207664_101483232 243
207 3300025936 Ga0207670_10014902 Ga0207670_100149024 243
208 3300025936 Ga0207670_10035833 Ga0207670_100358332 243
209 3300025937 Ga0207669_10023774 Ga0207669_100237744 243
210 3300025940 Ga0207691_10088217 Ga0207691_100882173 243
211 3300025942 Ga0207689_10038394 Ga0207689_100383943 243
212 3300025944 Ga0207661_10080436 Ga0207661_100804361 243
213 3300025960 Ga0207651_10128910 Ga0207651_101289102 243
214 3300025960 Ga0207651_10210603 Ga0207651_102106032 243
215 3300025961 Ga0207712_10008328 Ga0207712_100083285 243
216 3300025981 Ga0207640_10181520 Ga0207640_101815202 243
217 3300025981 Ga0207640_10385433 Ga0207640_103854332 243
218 3300026075 Ga0207708_10093652 Ga0207708_100936521 243
219 3300026075 Ga0207708_10227188 Ga0207708_102271882 243
220 3300026095 Ga0207676_10047826 Ga0207676_100478263 243
221 3300026116 Ga0207674_10185786 Ga0207674_101857862 243
222 3300026116 Ga0207674_10275169 Ga0207674_102751692 243
223 3300027360 Ga0209969_1018048 Ga0209969_10180481 243
224 3300027395 Ga0209996_1005842 Ga0209996_10058422 243
225 3300027682 Ga0209971_1009416 Ga0209971_10094162 243
226 3300027695 Ga0209966_1014624 Ga0209966_10146242 243
227 3300027907 Ga0207428_10013797 Ga0207428_100137972 243
228 3300027907 Ga0207428_10130760 Ga0207428_101307602 243
229 3300028380 Ga0268265_10002033 Ga0268265_100020334 243
230 3300028381 Ga0268264_10309156 Ga0268264_103091562 243
231 3300028563 Ga0265319_1079999 Ga0265319_10799992 243
232 3300031548 Ga0307408_100157637 Ga0307408_1001576372 243
233 3300031901 Ga0307406_10318118 Ga0307406_103181182 243
234 3300031903 Ga0307407_10115600 Ga0307407_101156001 243
235 3300032002 Ga0307416_100076909 Ga0307416_1000769094 243
236 3300032005 Ga0307411_10235812 Ga0307411_102358122 243
237 3300034818 Ga0373950_0018298 Ga0373950_0018298_182_922 243
238 3300035083 Ga0373926_0088564 Ga0373926_0088564_162_902 243
239 3300035085 Ga0373929_0008806 Ga0373929_0008806_1011_1748 243
240 3300035085 Ga0373929_0011614 Ga0373929_0011614_835_1575 243
241 3300035085 Ga0373929_0043119 Ga0373929_0043119_198_938 243
242 3300035089 Ga0373944_0012480 Ga0373944_0012480_1364_2104 243
243 3300035091 Ga0373951_0005556 Ga0373951_0005556_1372_2112 243
244 3300035092 Ga0373952_0006139 Ga0373952_0006139_683_1423 243
245 3300035112 Ga0373932_0004300 Ga0373932_0004300_1758_2498 243
246 3300035112 Ga0373932_0066187 Ga0373932_0066187_110_850 243
247 3300035114 Ga0373939_0015963 Ga0373939_0015963_961_1701 243
248 3300035116 Ga0373945_0004386 Ga0373945_0004386_3600_4340 243
249 3300035121 Ga0373960_0029936 Ga0373960_0029936_710_1450 243
250 3300035170 Ga0373943_0137670 Ga0373943_0137670_438_1178 243
251 3300035207 Ga0373942_0011396 Ga0373942_0011396_1358_2098 243
252 3300035691 Ga0373931_0006888 Ga0373931_0006888_3151_3891 243
253 3300035691 Ga0373931_0024087 Ga0373931_0024087_942_1682 243
254 3300035691 Ga0373931_0026893 Ga0373931_0026893_1787_2527 243
255 3300035692 Ga0373935_0120149 Ga0373935_0120149_60_800 243
256 3300035695 Ga0373927_0018106 Ga0373927_0018106_475_1215 243
257 3300035725 Ga0373947_0164254 Ga0373947_0164254_69_809 243
258 3300036401 Ga0373937_0225314 Ga0373937_0225314_19_759 243
259 3300037068 Ga0373925_0084632 Ga0373925_0084632_1173_1913 243
260 3300042001 Ga0439441_027153 Ga0439441_027153_306_1046 243
261 3300042013 Ga0439456_030969 Ga0439456_030969_222_962 243
262 3300042156 Ga0439446_0007953 Ga0439446_0007953_1652_2389 243
263 3300042436 Ga0439435_0012673 Ga0439435_0012673_623_1363 243
264 3300042876 Ga0451577_0025631 Ga0451577_0025631_784_1524 243
265 3300044673 Ga0453683_0201124 Ga0453683_0201124_122_862 243
266 3300044694 Ga0466963_0192617 Ga0466963_0192617_112_861 243
267 3300045051 Ga0451576_0003058 Ga0451576_0003058_17082_17822 243
268 3300045051 Ga0451576_0024160 Ga0451576_0024160_290_1030 243
269 3300045051 Ga0451576_0135192 Ga0451576_0135192_1659_2399 243
270 3300045051 Ga0451576_0938594 Ga0451576_0938594_129_869 243
271 3300045976 Ga0466967_0523322 Ga0466967_0523322_155_904 243
272 3300046454 Ga0495592_0001709 Ga0495592_0001709_4943_5683 243
273 3300046455 Ga0495603_0022391 Ga0495603_0022391_2671_3411 243
274 3300046461 Ga0495641_0047349 Ga0495641_0047349_83_823 243
275 3300046463 Ga0495653_0044851 Ga0495653_0044851_1966_2706 243
276 3300046472 Ga0495580_0005831 Ga0495580_0005831_4928_5668 243
277 3300046475 Ga0495639_0006521 Ga0495639_0006521_2882_3622 243
278 3300046511 Ga0495608_0007174 Ga0495608_0007174_5919_6659 243
279 3300046516 Ga0495628_0001353 Ga0495628_0001353_18630_19370 243
280 3300046516 Ga0495628_0364153 Ga0495628_0364153_131_871 243
281 3300046517 Ga0495630_0004252 Ga0495630_0004252_2262_3002 243
282 3300046517 Ga0495630_0024806 Ga0495630_0024806_377_1117 243
283 3300046526 Ga0495666_0024399 Ga0495666_0024399_1176_1916 243
284 3300046531 Ga0495665_0028674 Ga0495665_0028674_314_1054 243
285 3300046533 Ga0495640_0001127 Ga0495640_0001127_13062_13802 243
286 3300046533 Ga0495640_0046916 Ga0495640_0046916_1463_2203 243
287 3300046535 Ga0495586_0002131 Ga0495586_0002131_6193_6933 243
288 3300046535 Ga0495586_0020997 Ga0495586_0020997_1931_2671 243
289 3300046535 Ga0495586_0046702 Ga0495586_0046702_634_1374 243
290 3300046539 Ga0495621_0012895 Ga0495621_0012895_162_902 243
291 3300046543 Ga0495645_0043454 Ga0495645_0043454_1136_1876 243
292 3300046559 Ga0495667_0007620 Ga0495667_0007620_2325_3065 243
293 3300046615 Ga0495656_0028453 Ga0495656_0028453_165_905 243
294 3300046663 Ga0495635_0066981 Ga0495635_0066981_1313_2053 243
295 3300046663 Ga0495635_0090539 Ga0495635_0090539_480_1220 243
296 3300046664 Ga0495659_0138713 Ga0495659_0138713_157_897 243
297 3300046674 Ga0495588_0050203 Ga0495588_0050203_652_1392 243
298 3300046678 Ga0495599_0001302 Ga0495599_0001302_12422_13162 243
299 3300046681 Ga0495647_0000583 Ga0495647_0000583_9618_10358 243
300 3300046683 Ga0495658_0002859 Ga0495658_0002859_2742_3482 243
301 3300046684 Ga0495669_0200987 Ga0495669_0200987_100_840 243
302 3300046689 Ga0495613_0011558 Ga0495613_0011558_2744_3484 243
303 3300046689 Ga0495613_0277321 Ga0495613_0277321_169_909 243
304 3300047317 Ga0495604_0008849 Ga0495604_0008849_6131_6871 243
305 3300047318 Ga0495636_0003358 Ga0495636_0003358_3127_3867 243
306 3300047319 Ga0495674_0115472 Ga0495674_0115472_882_1622 243
307 3300047321 Ga0495676_0025504 Ga0495676_0025504_2007_2747 243
308 3300047322 Ga0495680_0013546 Ga0495680_0013546_6222_6962 243
309 3300048917 Ga0496114_0657747 Ga0496114_0657747_80_820 243
310 3300049568 Ga0501031_0010261 Ga0501031_0010261_1276_2016 243
311 3300049568 Ga0501031_0244256 Ga0501031_0244256_296_1036 243
312 3300049569 Ga0501032_0095248 Ga0501032_0095248_1138_1878 243
313 3300049571 Ga0501034_0526711 Ga0501034_0526711_50_790 243
314 3300049572 Ga0501036_0005674 Ga0501036_0005674_7934_8674 243
315 3300049572 Ga0501036_0268433 Ga0501036_0268433_366_1106 243
316 3300049572 Ga0501036_0314199 Ga0501036_0314199_76_816 243
317 3300049573 Ga0501037_0053793 Ga0501037_0053793_16_756 243
318 3300049574 Ga0501038_0001436 Ga0501038_0001436_14503_15243 243
319 3300049574 Ga0501038_0439717 Ga0501038_0439717_42_782 243
320 3300049575 Ga0501039_0000694 Ga0501039_0000694_14034_14774 243
321 3300049575 Ga0501039_0164874 Ga0501039_0164874_420_1160 243
322 3300049576 Ga0501040_0000067 Ga0501040_0000067_23501_24241 243
323 3300049576 Ga0501040_0037972 Ga0501040_0037972_1168_1908 243
324 3300049576 Ga0501040_0157012 Ga0501040_0157012_52_792 243
325 3300049577 Ga0501041_0000874 Ga0501041_0000874_3940_4680 243
326 3300049577 Ga0501041_0011051 Ga0501041_0011051_2884_3624 243
327 3300049577 Ga0501041_0013257 Ga0501041_0013257_3954_4694 243
328 3300049578 Ga0501042_0053316 Ga0501042_0053316_1212_1952 243
329 3300049578 Ga0501042_0079039 Ga0501042_0079039_1095_1835 243
330 3300049579 Ga0501043_0010087 Ga0501043_0010087_6617_7357 243
331 3300049580 Ga0501046_0000275 Ga0501046_0000275_25435_26175 243
332 3300049580 Ga0501046_0062584 Ga0501046_0062584_983_1723 243
333 3300049580 Ga0501046_0076011 Ga0501046_0076011_583_1323 243
334 3300049581 Ga0501047_0143232 Ga0501047_0143232_498_1238 243
335 3300049582 Ga0501048_0006864 Ga0501048_0006864_1116_1856 243
336 3300049584 Ga0501068_0008721 Ga0501068_0008721_523_1263 243
337 3300049586 Ga0501070_0085885 Ga0501070_0085885_643_1383 243
338 3300049587 Ga0501071_0000835 Ga0501071_0000835_5033_5773 243
339 3300049587 Ga0501071_0001329 Ga0501071_0001329_3055_3795 243
340 3300049588 Ga0501072_0000569 Ga0501072_0000569_24225_24965 243
341 3300049589 Ga0501073_0099587 Ga0501073_0099587_1102_1842 243
342 3300049591 Ga0501075_0000011 Ga0501075_0000011_25439_26179 243
343 3300049591 Ga0501075_0017422 Ga0501075_0017422_3380_4120 243
344 3300049591 Ga0501075_0052860 Ga0501075_0052860_1345_2085 243
345 3300049592 Ga0501076_0000116 Ga0501076_0000116_24495_25235 243
346 3300049592 Ga0501076_0163471 Ga0501076_0163471_494_1234 243
347 3300049593 Ga0501077_0002528 Ga0501077_0002528_1252_1992 243
348 3300049741 Ga0501079_0000021 Ga0501079_0000021_17958_18698 243
349 3300049741 Ga0501079_0091240 Ga0501079_0091240_226_966 243
350 3300049742 Ga0501080_0000541 Ga0501080_0000541_24568_25308 243
351 3300049742 Ga0501080_0099389 Ga0501080_0099389_951_1691 243
352 3300049822 Ga0501035_0028477 Ga0501035_0028477_1742_2482 243
353 3300049822 Ga0501035_0428175 Ga0501035_0428175_128_868 243
354 3300049823 Ga0501044_0070209 Ga0501044_0070209_122_862 243
355 3300049824 Ga0501045_0000083 Ga0501045_0000083_20721_21461 243
356 3300049824 Ga0501045_0097323 Ga0501045_0097323_543_1283 243
357 3300050507 nmdc:mga05p37_185_c1 nmdc:mga05p37_185_c1_13053_13793 243
358 3300050507 nmdc:mga05p37_603703_c1 nmdc:mga05p37_603703_c1_76_816 243
359 3300050508 nmdc:mga09592_216241_c1 nmdc:mga09592_216241_c1_814_1554 243
360 3300050508 nmdc:mga09592_48434_c1 nmdc:mga09592_48434_c1_705_1445 243
361 3300050509 nmdc:mga0qj67_14400_c1 nmdc:mga0qj67_14400_c1_644_1384 243
362 3300050509 nmdc:mga0qj67_241468_c1 nmdc:mga0qj67_241468_c1_632_1372 243
363 3300050509 nmdc:mga0qj67_70071_c1 nmdc:mga0qj67_70071_c1_1687_2427 243
364 3300050511 nmdc:mga08y16_17298_c1 nmdc:mga08y16_17298_c1_4764_5504 243
365 3300050511 nmdc:mga08y16_218185_c1 nmdc:mga08y16_218185_c1_448_1188 243
366 3300050511 nmdc:mga08y16_460582_c1 nmdc:mga08y16_460582_c1_185_925 243
367 3300050511 nmdc:mga08y16_691535_c1 nmdc:mga08y16_691535_c1_225_965 243
368 3300050512 nmdc:mga0n895_1398_c1 nmdc:mga0n895_1398_c1_10143_10883 243
369 3300050512 nmdc:mga0n895_49171_c1 nmdc:mga0n895_49171_c1_135_875 243
370 3300050513 nmdc:mga0rr50_55212_c1 nmdc:mga0rr50_55212_c1_333_1073 243
371 3300050514 nmdc:mga08x19_237_c1 nmdc:mga08x19_237_c1_26078_26815 243
372 3300050514 nmdc:mga08x19_44645_c1 nmdc:mga08x19_44645_c1_1453_2190 243
373 3300050515 nmdc:mga0a205_167828_c1 nmdc:mga0a205_167828_c1_768_1508 243
374 3300050515 nmdc:mga0a205_421438_c1 nmdc:mga0a205_421438_c1_291_1031 243
375 3300050515 nmdc:mga0a205_927_c1 nmdc:mga0a205_927_c1_10922_11662 243
376 3300053085 Ga0495619_0042507 Ga0495619_0042507_968_1708 243
377 3300053094 Ga0500566_0121836 Ga0500566_0121836_376_1116 243
378 3300054114 Ga0501084_0001429 Ga0501084_0001429_14291_15031 243
379 3300054114 Ga0501084_0107797 Ga0501084_0107797_1035_1775 243
380 3300054114 Ga0501084_0119967 Ga0501084_0119967_813_1553 243
381 3300059421 Ga0590071_055710 Ga0590071_055710_104_844 243
382 3300059426 Ga0590077_030192 Ga0590077_030192_37_777 243
383 3300060353 Ga0501082_0000807 Ga0501082_0000807_8825_9565 243
384 3300060353 Ga0501082_0025869 Ga0501082_0025869_3988_4728 243
385 3300060353 Ga0501082_0088946 Ga0501082_0088946_148_888 243
386 3300061734 Ga0530510_0000146 Ga0530510_0000146_16928_17668 243
387 iso_pu_bacteria 2507262055 2507507471 243
388 iso_pu_bacteria 2508501009 2508541586 243
389 iso_pu_bacteria 2508501042 2508692872 243
390 iso_pu_bacteria 2511231028 2511398096 243
391 iso_pu_bacteria 2513237092 2513621679 243
392 iso_pu_bacteria 2513237094 2513636886 243
393 iso_pu_bacteria 2513237102 2513703911 243
394 iso_pu_bacteria 2513237104 2513721500 243
395 iso_pu_bacteria 2513237139 2513878343 243
396 iso_pu_bacteria 2513237161 2514011729 243
397 iso_pu_bacteria 2515154112 2515626264 243
398 iso_pu_bacteria 2517093001 2517108201 243
399 iso_pu_bacteria 2524023205 2524436091 243
400 iso_pu_bacteria 2528768022 2528852853 243
401 iso_pu_bacteria 2558860112 2558913874 243
402 iso_pu_bacteria 2617270735 2617352731 243
403 iso_pu_bacteria 2744054633 2745080954 243
404 iso_pu_bacteria 2791355196 2793061069 243
405 iso_pu_bacteria 2802429603 2805920566 243
406 iso_pu_bacteria 2816332527 2818236754 243
407 iso_pu_bacteria 2824600985 2824602982 243
408 iso_pu_bacteria 2824609381 2824611795 243
409 iso_pu_bacteria 2824617872 2824622046 243
410 iso_pu_bacteria 2824626560 2824629310 243
411 iso_pu_bacteria 2824635225 2824642658 243
412 iso_pu_bacteria 2824644064 2824650498 243
413 iso_pu_bacteria 2824653114 2824655031 243
414 iso_pu_bacteria 2824671348 2824672309 243
415 iso_pu_bacteria 2824679649 2824682284 243
416 iso_pu_bacteria 2824687955 2824688808 243
417 iso_pu_bacteria 2824696289 2824702186 243
418 iso_pu_bacteria 2824704595 2824710659 243
419 iso_pu_bacteria 2824714736 2824720371 243
420 iso_pu_bacteria 2824723954 2824729064 243
421 iso_pu_bacteria 2824753945 2824762315 243
422 iso_pu_bacteria 2824763712 2824766540 243
423 iso_pu_bacteria 2824773399 2824776663 243
424 iso_pu_bacteria 2841941048 2841946408 243
425 iso_pu_bacteria 2841957949 2841965648 243
426 iso_pu_bacteria 2841974524 2841978410 243
427 iso_pu_bacteria 2847939898 2847947947 243
428 iso_pu_bacteria 2849076700 2849078205 243
429 iso_pu_bacteria 2874590934 2874598585 243
430 iso_pu_bacteria 2874645413 2874652039 243
431 iso_pu_bacteria 2876761206 2876768283 243
432 iso_pu_bacteria 2876771140 2876778624 243
433 iso_pu_bacteria 2876818435 2876823428 243
434 iso_pu_bacteria 2879074833 2879082417 243
435 iso_pu_bacteria 2879127579 2879131802 243
436 iso_pu_bacteria 2879142872 2879150138 243
437 iso_pu_bacteria 2888378607 2888385676 243
438 iso_pu_bacteria 2888388044 2888392591 243
439 iso_pu_bacteria 2888419890 2888425797 243
440 iso_pu_bacteria 2889914905 2889916923 243
441 iso_pu_bacteria 2904711408 2904711762 243
442 iso_pu_bacteria 2906626472 2906629343 243
443 iso_pu_bacteria 2922393267 2922396876 243
444 iso_pu_bacteria 2932794094 2932799627 243
445 iso_pu_bacteria 2935648319 2935651948 243
446 iso_pu_bacteria 2935656913 2935660079 243
447 iso_pu_bacteria 2935769743 2935776430 243
448 iso_pu_bacteria 2935777560 2935780831 243
449 iso_pu_bacteria 2935785616 2935792345 243
450 iso_pu_bacteria 2935793552 2935800480 243
451 iso_pu_bacteria 2935837841 2935842246 243
452 iso_pu_bacteria 2935883170 2935885712 243
453 iso_pu_bacteria 2935959822 2935962894 243
454 iso_pu_bacteria 2935975950 2935976339 243
455 iso_pu_bacteria 2935984226 2935987225 243
456 iso_pu_bacteria 2936011229 2936014495 243
457 iso_pu_bacteria 2936019824 2936023665 243
458 iso_pu_bacteria 2936028420 2936031308 243
459 iso_pu_bacteria 2936046547 2936049601 243
460 iso_pu_bacteria 2936055302 2936061183 243
461 iso_pu_bacteria 2941531003 2941531371 243
462 iso_pu_bacteria 3005483717 3005485594 243
463 iso_pu_bacteria 3005506211 3005508239 243
464 iso_pu_bacteria 3005587118 3005588256 243
465 iso_pu_bacteria 3005594810 3005600518 243
466 iso_pu_bacteria 8006926726 8006928631 243
467 iso_pu_bacteria 8016511872 8016520447 243
468 iso_pu_bacteria 8016522445 8016528509 243
469 iso_pu_bacteria 8016530956 8016533669 243
470 iso_pu_bacteria 8016557553 8016563590 243
471 iso_pu_bacteria 8016566248 8016571999 243
472 iso_pu_bacteria 8016575299 8016576204 243
473 iso_pu_bacteria 8016583857 8016594580 243
474 iso_pu_bacteria 8016595262 8016601326 243
475 iso_pu_bacteria 8016603502 8016609102 243
476 iso_pu_bacteria 8016613128 8016615801 243
477 iso_pu_bacteria 8016622563 8016625433 243
478 iso_pu_bacteria 8019530166 8019533449 243
479 iso_pu_bacteria 8019547302 8019552482 243
480 iso_pu_bacteria 8019619141 8019620014 243
481 iso_pu_bacteria 8019629233 8019633091 243
482 iso_pu_bacteria 8019638758 8019646811 243
483 iso_pu_bacteria 8019648815 8019649577 243
484 iso_pu_bacteria 8019659431 8019660972 243
485 iso_pu_bacteria 8019668869 8019670533 243
486 iso_pu_bacteria 8019678201 8019685701 243
487 3300005441 Ga0070700_100554647 Ga0070700_1005546471 244
488 3300021388 Ga0213875_10012736 Ga0213875_100127362 244
489 3300025920 Ga0207649_10201153 Ga0207649_102011532 244
490 3300037853 Ga0436364_0586291 Ga0436364_0586291_66603_67337 244
491 3300009177 Ga0105248_10044422 Ga0105248_100444223 245
492 3300021384 Ga0213876_10027678 Ga0213876_100276783 245
493 3300039437 Ga0436365_0401821 Ga0436365_0401821_214_954 245
494 3300049572 Ga0501036_0149482 Ga0501036_0149482_1172_1927 245
495 3300049574 Ga0501038_0037147 Ga0501038_0037147_2458_3213 245
496 3300049579 Ga0501043_0503702 Ga0501043_0503702_77_832 245
497 3300049580 Ga0501046_0154449 Ga0501046_0154449_254_1000 245
498 3300049581 Ga0501047_0019677 Ga0501047_0019677_2672_3427 245
499 3300049582 Ga0501048_0280439 Ga0501048_0280439_68_823 245
500 3300049823 Ga0501044_0036561 Ga0501044_0036561_2122_2877 245
501 iso_pu_bacteria 2838122688 2838127390 245
502 iso_pu_bacteria 2841949485 2841957126 245
503 iso_pu_bacteria 2841966195 2841972918 245
504 iso_pu_bacteria 2841983080 2841987488 245
505 iso_pu_bacteria 2842038055 2842040843 245
506 iso_pu_bacteria 2842045827 2842046212 245
507 iso_pu_bacteria 2844315083 2844320206 245
508 iso_pu_bacteria 2847930680 2847937525 245
509 iso_pu_bacteria 2857509624 2857511361 245
510 iso_pu_bacteria 2874612657 2874616776 245
511 iso_pu_bacteria 2874620515 2874628272 245
512 iso_pu_bacteria 2874628541 2874630135 245
513 iso_pu_bacteria 2879083081 2879084938 245
514 iso_pu_bacteria 2879099564 2879107906 245
515 iso_pu_bacteria 2881364244 2881370102 245
516 iso_pu_bacteria 2881665667 2881670104 245
517 iso_pu_bacteria 2885366525 2885370162 245
518 iso_pu_bacteria 2885409591 2885414354 245
519 iso_pu_bacteria 2903727486 2903731204 245
520 iso_pu_bacteria 2904666416 2904674109 245
521 iso_pu_bacteria 2906602504 2906610029 245
522 iso_pu_bacteria 2906643746 2906645521 245
523 iso_pu_bacteria 2929615660 2929621236 245
524 iso_pu_bacteria 2929624759 2929625933 245
525 iso_pu_bacteria 2932784394 2932785178 245
526 iso_pu_bacteria 2932801729 2932808782 245
527 iso_pu_bacteria 2932809354 2932810205 245
528 iso_pu_bacteria 2932818245 2932821778 245
529 iso_pu_bacteria 2932828146 2932829014 245
530 iso_pu_bacteria 2933577622 2933582895 245
531 iso_pu_bacteria 2935608549 2935610023 245
532 iso_pu_bacteria 2935616580 2935619566 245
533 iso_pu_bacteria 2935638405 2935638546 245
534 iso_pu_bacteria 2935665750 2935666602 245
535 iso_pu_bacteria 2935675223 2935682214 245
536 iso_pu_bacteria 2935684952 2935691130 245
537 iso_pu_bacteria 2935694250 2935694439 245
538 iso_pu_bacteria 2935703347 2935703552 245
539 iso_pu_bacteria 2935713505 2935718511 245
540 iso_pu_bacteria 2935722832 2935727509 245
541 iso_pu_bacteria 2935732158 2935736212 245
542 iso_pu_bacteria 2935741537 2935745592 245
543 iso_pu_bacteria 2935750917 2935755973 245
544 iso_pu_bacteria 2935760218 2935760765 245
545 iso_pu_bacteria 2935801545 2935801689 245
546 iso_pu_bacteria 2935810662 2935814895 245
547 iso_pu_bacteria 2935819856 2935823183 245
548 iso_pu_bacteria 2935827899 2935828040 245
549 iso_pu_bacteria 2935847175 2935848765 245
550 iso_pu_bacteria 2935855204 2935858118 245
551 iso_pu_bacteria 2935864058 2935868023 245
552 iso_pu_bacteria 2935873716 2935873954 245
553 iso_pu_bacteria 2935908558 2935909430 245
554 iso_pu_bacteria 2935916978 2935917153 245
555 iso_pu_bacteria 2935926038 2935926911 245
556 iso_pu_bacteria 2935934488 2935937245 245
557 iso_pu_bacteria 2935942939 2935944452 245
558 iso_pu_bacteria 2935951376 2935952889 245
559 iso_pu_bacteria 2935967501 2935969729 245
560 iso_pu_bacteria 2935992306 2935993122 245
561 iso_pu_bacteria 2936002035 2936003059 245
562 iso_pu_bacteria 2936037263 2936040462 245
563 iso_pu_bacteria 2940556831 2940562052 245
564 iso_pu_bacteria 2941538514 2941542294 245
565 iso_pu_bacteria 3005710791 3005715991 245
566 iso_pu_bacteria 3005718088 3005723347 245
567 iso_pu_bacteria 8017057580 8017065128 245
568 iso_pu_bacteria 8019576017 8019584518 245
569 iso_pu_bacteria 8019586578 8019592288 245
570 iso_pu_bacteria 8019597564 8019598996 245
571 iso_pu_bacteria 8019687851 8019691277 245
572 iso_pu_bacteria 8055742211 8055744902 245
573 iso_pu_bacteria 8056967851 8056974875 245
574 3300005329 Ga0070683_100012136 Ga0070683_1000121363 246
575 3300005336 Ga0070680_100010478 Ga0070680_1000104785 246
576 3300005336 Ga0070680_100126238 Ga0070680_1001262382 246
577 3300005336 Ga0070680_100171076 Ga0070680_1001710763 246
578 3300005366 Ga0070659_100107110 Ga0070659_1001071103 246
579 3300005434 Ga0070709_10083482 Ga0070709_100834823 246
580 3300005434 Ga0070709_10446400 Ga0070709_104464001 246
581 3300005435 Ga0070714_100165838 Ga0070714_1001658381 246
582 3300005458 Ga0070681_10334996 Ga0070681_103349962 246
583 3300005530 Ga0070679_100020326 Ga0070679_1000203266 246
584 3300005530 Ga0070679_100045886 Ga0070679_1000458864 246
585 3300005530 Ga0070679_100130755 Ga0070679_1001307551 246
586 3300005535 Ga0070684_100007833 Ga0070684_1000078334 246
587 3300005539 Ga0068853_100089144 Ga0068853_1000891443 246
588 3300005539 Ga0068853_100323594 Ga0068853_1003235942 246
589 3300005548 Ga0070665_100187732 Ga0070665_1001877322 246
590 3300005563 Ga0068855_100876680 Ga0068855_1008766801 246
591 3300005577 Ga0068857_100091731 Ga0068857_1000917313 246
592 3300005578 Ga0068854_100126259 Ga0068854_1001262592 246
593 3300005614 Ga0068856_100011621 Ga0068856_1000116216 246
594 3300005614 Ga0068856_100018079 Ga0068856_1000180793 246
595 3300005614 Ga0068856_100242713 Ga0068856_1002427132 246
596 3300005616 Ga0068852_100047090 Ga0068852_1000470905 246
597 3300005616 Ga0068852_100220473 Ga0068852_1002204732 246
598 3300005617 Ga0068859_101082384 Ga0068859_1010823841 246
599 3300005843 Ga0068860_100043129 Ga0068860_1000431292 246
600 3300006195 Ga0075366_10016147 Ga0075366_100161474 246
601 3300006931 Ga0097620_101082357 Ga0097620_1010823571 246
602 3300009093 Ga0105240_10061780 Ga0105240_100617802 246
603 3300009093 Ga0105240_10185517 Ga0105240_101855173 246
604 3300009093 Ga0105240_10354189 Ga0105240_103541892 246
605 3300009094 Ga0111539_11059332 Ga0111539_110593321 246
606 3300009545 Ga0105237_10019921 Ga0105237_100199214 246
607 3300009545 Ga0105237_10177319 Ga0105237_101773191 246
608 3300009551 Ga0105238_10013345 Ga0105238_100133456 246
609 3300009551 Ga0105238_10116350 Ga0105238_101163501 246
610 3300009551 Ga0105238_10352274 Ga0105238_103522742 246
611 3300010375 Ga0105239_10114449 Ga0105239_101144493 246
612 3300010375 Ga0105239_10626865 Ga0105239_106268651 246
613 3300013105 Ga0157369_10082359 Ga0157369_100823592 246
614 3300013105 Ga0157369_10120684 Ga0157369_101206844 246
615 3300013296 Ga0157374_10009522 Ga0157374_100095224 246
616 3300013306 Ga0163162_10333361 Ga0163162_103333612 246
617 3300020069 Ga0197907_10076814 Ga0197907_100768141 246
618 3300025900 Ga0207710_10249368 Ga0207710_102493682 246
619 3300025904 Ga0207647_10080520 Ga0207647_100805202 246
620 3300025906 Ga0207699_10018431 Ga0207699_100184313 246
621 3300025906 Ga0207699_10247025 Ga0207699_102470252 246
622 3300025912 Ga0207707_10000886 Ga0207707_100008864 246
623 3300025912 Ga0207707_10223411 Ga0207707_102234113 246
624 3300025913 Ga0207695_10100999 Ga0207695_101009992 246
625 3300025914 Ga0207671_10037498 Ga0207671_100374982 246
626 3300025915 Ga0207693_10040763 Ga0207693_100407632 246
627 3300025916 Ga0207663_10572132 Ga0207663_105721321 246
628 3300025917 Ga0207660_10016752 Ga0207660_100167524 246
629 3300025917 Ga0207660_10018336 Ga0207660_100183363 246
630 3300025917 Ga0207660_10061026 Ga0207660_100610261 246
631 3300025921 Ga0207652_10028071 Ga0207652_100280714 246
632 3300025921 Ga0207652_10145041 Ga0207652_101450412 246
633 3300025921 Ga0207652_10384907 Ga0207652_103849072 246
634 3300025924 Ga0207694_10276676 Ga0207694_102766762 246
635 3300025928 Ga0207700_10049267 Ga0207700_100492671 246
636 3300025929 Ga0207664_10108586 Ga0207664_101085862 246
637 3300025944 Ga0207661_10028588 Ga0207661_100285883 246
638 3300025944 Ga0207661_10042658 Ga0207661_100426583 246
639 3300025986 Ga0207658_10587423 Ga0207658_105874232 246
640 3300026041 Ga0207639_10053692 Ga0207639_100536923 246
641 3300026041 Ga0207639_10140624 Ga0207639_101406243 246
642 3300026041 Ga0207639_10337528 Ga0207639_103375281 246
643 3300026078 Ga0207702_10000052 Ga0207702_1000005284 246
644 3300026078 Ga0207702_10035413 Ga0207702_100354134 246
645 3300026095 Ga0207676_10791364 Ga0207676_107913641 246
646 3300026116 Ga0207674_10113796 Ga0207674_101137963 246
647 3300026121 Ga0207683_10953198 Ga0207683_109531981 246
648 3300026142 Ga0207698_10124070 Ga0207698_101240702 246
649 3300028381 Ga0268264_10142466 Ga0268264_101424661 246
650 3300031247 Ga0265340_10120833 Ga0265340_101208332 246
651 3300031249 Ga0265339_10152391 Ga0265339_101523911 246
652 3300031344 Ga0265316_10187146 Ga0265316_101871462 246
653 3300032002 Ga0307416_100042761 Ga0307416_1000427612 246
654 3300035086 Ga0373934_0009337 Ga0373934_0009337_189_938 246
655 3300035111 Ga0373923_0004076 Ga0373923_0004076_3877_4626 246
656 3300035111 Ga0373923_0062235 Ga0373923_0062235_194_943 246
657 3300035113 Ga0373936_0102151 Ga0373936_0102151_295_1044 246
658 3300035116 Ga0373945_0003594 Ga0373945_0003594_504_1253 246
659 3300035117 Ga0373953_0000715 Ga0373953_0000715_5956_6705 246
660 3300035118 Ga0373954_0000084 Ga0373954_0000084_30241_30990 246
661 3300035119 Ga0373956_0027703 Ga0373956_0027703_1092_1841 246
662 3300035120 Ga0373957_0004322 Ga0373957_0004322_647_1396 246
663 3300035172 Ga0373955_0000301 Ga0373955_0000301_4432_5181 246
664 3300035172 Ga0373955_0024108 Ga0373955_0024108_797_1546 246
665 3300035410 Ga0373924_0003265 Ga0373924_0003265_503_1252 246
666 3300035410 Ga0373924_0004344 Ga0373924_0004344_1522_2271 246
667 3300035695 Ga0373927_0266483 Ga0373927_0266483_134_883 246
668 3300035724 Ga0373933_0000951 Ga0373933_0000951_14555_15304 246
669 3300035724 Ga0373933_0032348 Ga0373933_0032348_924_1673 246
670 3300035725 Ga0373947_0026018 Ga0373947_0026018_2021_2770 246
671 3300036401 Ga0373937_0008455 Ga0373937_0008455_7813_8562 246
672 3300037418 Ga0395900_0008575 Ga0395900_0008575_1558_2307 246
673 3300037466 Ga0395898_0035192 Ga0395898_0035192_276_1025 246
674 3300038443 Ga0395901_0127744 Ga0395901_0127744_1572_2321 246
675 3300039437 Ga0436365_0812156 Ga0436365_0812156_65_814 246
676 3300039450 Ga0436363_0884224 Ga0436363_0884224_573_1322 246
677 3300044693 Ga0466961_0033127 Ga0466961_0033127_2436_3200 246
678 3300044735 Ga0466968_0286535 Ga0466968_0286535_11_760 246
679 3300044842 Ga0466957_0127298 Ga0466957_0127298_719_1483 246
680 3300045049 Ga0466959_0047848 Ga0466959_0047848_377_1141 246
681 3300045976 Ga0466967_0167498 Ga0466967_0167498_28_777 246
682 3300045976 Ga0466967_0234169 Ga0466967_0234169_496_1245 246
683 3300046454 Ga0495592_0016467 Ga0495592_0016467_574_1323 246
684 3300046454 Ga0495592_0059743 Ga0495592_0059743_1078_1827 246
685 3300046455 Ga0495603_0023839 Ga0495603_0023839_1633_2382 246
686 3300046459 Ga0495629_0003566 Ga0495629_0003566_4302_5051 246
687 3300046459 Ga0495629_0065560 Ga0495629_0065560_797_1546 246
688 3300046463 Ga0495653_0002541 Ga0495653_0002541_5978_6727 246
689 3300046472 Ga0495580_0018121 Ga0495580_0018121_777_1526 246
690 3300046473 Ga0495582_0016731 Ga0495582_0016731_293_1042 246
691 3300046475 Ga0495639_0051667 Ga0495639_0051667_152_901 246
692 3300046477 Ga0495664_0012490 Ga0495664_0012490_3506_4255 246
693 3300046477 Ga0495664_0103801 Ga0495664_0103801_314_1063 246
694 3300046511 Ga0495608_0030932 Ga0495608_0030932_1391_2140 246
695 3300046511 Ga0495608_0095790 Ga0495608_0095790_1090_1839 246
696 3300046514 Ga0495618_0020969 Ga0495618_0020969_2670_3419 246
697 3300046514 Ga0495618_0043985 Ga0495618_0043985_2034_2783 246
698 3300046516 Ga0495628_0010524 Ga0495628_0010524_5442_6191 246
699 3300046517 Ga0495630_0023538 Ga0495630_0023538_3155_3904 246
700 3300046526 Ga0495666_0064310 Ga0495666_0064310_202_951 246
701 3300046533 Ga0495640_0021531 Ga0495640_0021531_574_1323 246
702 3300046533 Ga0495640_0030787 Ga0495640_0030787_2490_3239 246
703 3300046536 Ga0495587_0008387 Ga0495587_0008387_4421_5170 246
704 3300046543 Ga0495645_0002913 Ga0495645_0002913_119_868 246
705 3300046543 Ga0495645_0021817 Ga0495645_0021817_1150_1899 246
706 3300046559 Ga0495667_0007315 Ga0495667_0007315_1525_2274 246
707 3300046642 Ga0495634_0012018 Ga0495634_0012018_3024_3773 246
708 3300046642 Ga0495634_0013010 Ga0495634_0013010_1894_2643 246
709 3300046663 Ga0495635_0002810 Ga0495635_0002810_4394_5143 246
710 3300046663 Ga0495635_0049929 Ga0495635_0049929_1949_2698 246
711 3300046674 Ga0495588_0064104 Ga0495588_0064104_1000_1749 246
712 3300046675 Ga0495657_0001354 Ga0495657_0001354_11043_11792 246
713 3300046678 Ga0495599_0005290 Ga0495599_0005290_6929_7678 246
714 3300046678 Ga0495599_0030205 Ga0495599_0030205_1690_2439 246
715 3300046679 Ga0495623_0017513 Ga0495623_0017513_1935_2684 246
716 3300046680 Ga0495646_0003632 Ga0495646_0003632_4118_4867 246
717 3300046681 Ga0495647_0009435 Ga0495647_0009435_899_1648 246
718 3300046683 Ga0495658_0038669 Ga0495658_0038669_1403_2152 246
719 3300046689 Ga0495613_0065191 Ga0495613_0065191_1439_2188 246
720 3300046689 Ga0495613_0118867 Ga0495613_0118867_1012_1761 246
721 3300046809 Ga0495600_0012950 Ga0495600_0012950_3338_4087 246
722 3300047319 Ga0495674_0018855 Ga0495674_0018855_123_872 246
723 3300047322 Ga0495680_0008905 Ga0495680_0008905_6801_7550 246
724 3300047322 Ga0495680_0210282 Ga0495680_0210282_614_1363 246
725 3300047444 Ga0495675_0006334 Ga0495675_0006334_1279_2028 246
726 3300047471 Ga0495684_0000777 Ga0495684_0000777_4446_5195 246
727 3300047471 Ga0495684_0004968 Ga0495684_0004968_8795_9544 246
728 3300047673 Ga0495593_0005870 Ga0495593_0005870_2110_2859 246
729 3300047673 Ga0495593_0044871 Ga0495593_0044871_88_837 246
730 3300048088 Ga0495602_0055388 Ga0495602_0055388_1353_2102 246
731 3300048915 Ga0496112_0330066 Ga0496112_0330066_689_1438 246
732 3300048917 Ga0496114_0014641 Ga0496114_0014641_4173_4922 246
733 3300049580 Ga0501046_0050186 Ga0501046_0050186_2221_2970 246
734 3300049581 Ga0501047_0010806 Ga0501047_0010806_4682_5431 246
735 3300049586 Ga0501070_0015659 Ga0501070_0015659_5535_6284 246
736 3300049590 Ga0501074_0059863 Ga0501074_0059863_1080_1829 246
737 3300050493 nmdc:mga0k408_14716_c1 nmdc:mga0k408_14716_c1_668_1417 246
738 3300053077 Ga0495601_0106738 Ga0495601_0106738_22_771 246
739 3300053078 Ga0495612_0013206 Ga0495612_0013206_727_1476 246
740 3300053085 Ga0495619_0000701 Ga0495619_0000701_16812_17561 246
741 3300053085 Ga0495619_0134532 Ga0495619_0134532_663_1412 246
742 3300003215 JGI25153J46596_10000317 JGI25153J46596_1000031728 247
743 3300003215 JGI25153J46596_10001194 JGI25153J46596_1000119413 247
744 3300003215 JGI25153J46596_10001553 JGI25153J46596_100015533 247
745 3300003215 JGI25153J46596_10006579 JGI25153J46596_100065793 247
746 3300003354 JGI25160J50197_1001548 JGI25160J50197_10015484 247
747 3300003354 JGI25160J50197_1006813 JGI25160J50197_10068132 247
748 3300003354 JGI25160J50197_1009493 JGI25160J50197_10094934 247
749 3300004625 Ga0055543_1030343 Ga0055543_10303431 247
750 3300005262 Ga0065165_1000747 Ga0065165_100074734 247
751 3300005262 Ga0065165_1001867 Ga0065165_10018674 247
752 3300005262 Ga0065165_1005506 Ga0065165_10055069 247
753 3300005262 Ga0065165_1022460 Ga0065165_10224602 247
754 3300005328 Ga0070676_10021860 Ga0070676_100218603 247
755 3300005329 Ga0070683_100012606 Ga0070683_1000126063 247
756 3300005329 Ga0070683_100143303 Ga0070683_1001433032 247
757 3300005330 Ga0070690_100053642 Ga0070690_1000536423 247
758 3300005331 Ga0070670_100001648 Ga0070670_10000164814 247
759 3300005331 Ga0070670_100353565 Ga0070670_1003535652 247
760 3300005333 Ga0070677_10110921 Ga0070677_101109212 247
761 3300005336 Ga0070680_100584232 Ga0070680_1005842321 247
762 3300005336 Ga0070680_100603539 Ga0070680_1006035391 247
763 3300005338 Ga0068868_100000130 Ga0068868_1000001308 247
764 3300005338 Ga0068868_100090667 Ga0068868_1000906673 247
765 3300005339 Ga0070660_100045797 Ga0070660_1000457973 247
766 3300005339 Ga0070660_100136044 Ga0070660_1001360442 247
767 3300005341 Ga0070691_10023957 Ga0070691_100239572 247
768 3300005341 Ga0070691_10055300 Ga0070691_100553001 247
769 3300005341 Ga0070691_10101246 Ga0070691_101012462 247
770 3300005341 Ga0070691_10106762 Ga0070691_101067622 247
771 3300005344 Ga0070661_100086188 Ga0070661_1000861882 247
772 3300005347 Ga0070668_100002013 Ga0070668_1000020132 247
773 3300005354 Ga0070675_100006171 Ga0070675_1000061718 247
774 3300005355 Ga0070671_100000330 Ga0070671_10000033014 247
775 3300005355 Ga0070671_100013367 Ga0070671_1000133674 247
776 3300005364 Ga0070673_100000435 Ga0070673_10000043513 247
777 3300005364 Ga0070673_100043909 Ga0070673_1000439092 247
778 3300005365 Ga0070688_100151679 Ga0070688_1001516792 247
779 3300005366 Ga0070659_100091369 Ga0070659_1000913692 247
780 3300005367 Ga0070667_100020332 Ga0070667_1000203325 247
781 3300005367 Ga0070667_100038796 Ga0070667_1000387963 247
782 3300005367 Ga0070667_100266954 Ga0070667_1002669542 247
783 3300005406 Ga0070703_10001535 Ga0070703_100015359 247
784 3300005406 Ga0070703_10042987 Ga0070703_100429871 247
785 3300005438 Ga0070701_10013024 Ga0070701_100130244 247
786 3300005440 Ga0070705_100000415 Ga0070705_1000004154 247
787 3300005441 Ga0070700_100002043 Ga0070700_1000020432 247
788 3300005441 Ga0070700_100074201 Ga0070700_1000742012 247
789 3300005444 Ga0070694_100004365 Ga0070694_1000043657 247
790 3300005455 Ga0070663_100125193 Ga0070663_1001251932 247
791 3300005455 Ga0070663_100130104 Ga0070663_1001301042 247
792 3300005455 Ga0070663_100353265 Ga0070663_1003532651 247
793 3300005456 Ga0070678_100000210 Ga0070678_10000021018 247
794 3300005457 Ga0070662_100048811 Ga0070662_1000488113 247
795 3300005458 Ga0070681_10009637 Ga0070681_100096371 247
796 3300005458 Ga0070681_10016908 Ga0070681_100169086 247
797 3300005458 Ga0070681_10029114 Ga0070681_100291143 247
798 3300005458 Ga0070681_10110336 Ga0070681_101103361 247
799 3300005459 Ga0068867_100004550 Ga0068867_1000045504 247
800 3300005459 Ga0068867_100009475 Ga0068867_1000094753 247
801 3300005459 Ga0068867_100125954 Ga0068867_1001259542 247
802 3300005467 Ga0070706_100009522 Ga0070706_1000095226 247
803 3300005468 Ga0070707_100272154 Ga0070707_1002721541 247
804 3300005468 Ga0070707_100452880 Ga0070707_1004528801 247
805 3300005518 Ga0070699_100000540 Ga0070699_10000054045 247
806 3300005518 Ga0070699_100076883 Ga0070699_1000768832 247
807 3300005518 Ga0070699_100256617 Ga0070699_1002566172 247
808 3300005530 Ga0070679_100003976 Ga0070679_10000397612 247
809 3300005530 Ga0070679_100014503 Ga0070679_1000145034 247
810 3300005530 Ga0070679_100091564 Ga0070679_1000915643 247
811 3300005530 Ga0070679_100246724 Ga0070679_1002467241 247
812 3300005535 Ga0070684_100054337 Ga0070684_1000543372 247
813 3300005535 Ga0070684_100067650 Ga0070684_1000676503 247
814 3300005536 Ga0070697_100035192 Ga0070697_1000351922 247
815 3300005536 Ga0070697_100069550 Ga0070697_1000695504 247
816 3300005536 Ga0070697_100103170 Ga0070697_1001031702 247
817 3300005539 Ga0068853_100003330 Ga0068853_1000033304 247
818 3300005539 Ga0068853_100032207 Ga0068853_1000322073 247
819 3300005539 Ga0068853_100573906 Ga0068853_1005739061 247
820 3300005543 Ga0070672_100003927 Ga0070672_1000039275 247
821 3300005545 Ga0070695_100000710 Ga0070695_10000071017 247
822 3300005545 Ga0070695_100015228 Ga0070695_1000152285 247
823 3300005545 Ga0070695_100153996 Ga0070695_1001539962 247
824 3300005546 Ga0070696_100022290 Ga0070696_1000222906 247
825 3300005546 Ga0070696_100257062 Ga0070696_1002570621 247
826 3300005547 Ga0070693_100086881 Ga0070693_1000868812 247
827 3300005548 Ga0070665_100071086 Ga0070665_1000710862 247
828 3300005548 Ga0070665_100128570 Ga0070665_1001285702 247
829 3300005549 Ga0070704_100000882 Ga0070704_10000088214 247
830 3300005549 Ga0070704_100356747 Ga0070704_1003567472 247
831 3300005563 Ga0068855_100007560 Ga0068855_1000075604 247
832 3300005563 Ga0068855_100178130 Ga0068855_1001781302 247
833 3300005563 Ga0068855_100196793 Ga0068855_1001967932 247
834 3300005563 Ga0068855_100216276 Ga0068855_1002162761 247
835 3300005563 Ga0068855_100467097 Ga0068855_1004670972 247
836 3300005564 Ga0070664_100026818 Ga0070664_1000268184 247
837 3300005577 Ga0068857_100002616 Ga0068857_1000026163 247
838 3300005577 Ga0068857_100010399 Ga0068857_1000103993 247
839 3300005577 Ga0068857_100022493 Ga0068857_1000224932 247
840 3300005577 Ga0068857_100395140 Ga0068857_1003951402 247
841 3300005578 Ga0068854_100007298 Ga0068854_1000072985 247
842 3300005614 Ga0068856_100334605 Ga0068856_1003346051 247
843 3300005616 Ga0068852_100000400 Ga0068852_1000004008 247
844 3300005616 Ga0068852_100156552 Ga0068852_1001565522 247
845 3300005616 Ga0068852_100360105 Ga0068852_1003601052 247
846 3300005616 Ga0068852_100713371 Ga0068852_1007133711 247
847 3300005617 Ga0068859_100001347 Ga0068859_10000134718 247
848 3300005617 Ga0068859_100004592 Ga0068859_10000459212 247
849 3300005617 Ga0068859_100066061 Ga0068859_1000660614 247
850 3300005618 Ga0068864_100001786 Ga0068864_1000017867 247
851 3300005719 Ga0068861_100002626 Ga0068861_10000262617 247
852 3300005719 Ga0068861_100230289 Ga0068861_1002302891 247
853 3300005719 Ga0068861_100340735 Ga0068861_1003407352 247
854 3300005719 Ga0068861_100644440 Ga0068861_1006444401 247
855 3300005840 Ga0068870_10035490 Ga0068870_100354903 247
856 3300005840 Ga0068870_10135581 Ga0068870_101355811 247
857 3300005841 Ga0068863_100025164 Ga0068863_1000251642 247
858 3300005841 Ga0068863_100039160 Ga0068863_1000391603 247
859 3300005842 Ga0068858_100005298 Ga0068858_10000529810 247
860 3300005842 Ga0068858_100421503 Ga0068858_1004215032 247
861 3300005843 Ga0068860_100006411 Ga0068860_10000641112 247
862 3300005844 Ga0068862_100032090 Ga0068862_1000320904 247
863 3300005844 Ga0068862_100108368 Ga0068862_1001083682 247
864 3300005844 Ga0068862_100171477 Ga0068862_1001714772 247
865 3300005983 Ga0081540_1000455 Ga0081540_100045514 247
866 3300005983 Ga0081540_1019188 Ga0081540_10191886 247
867 3300006028 Ga0070717_10001973 Ga0070717_1000197314 247
868 3300006042 Ga0075368_10000176 Ga0075368_1000017610 247
869 3300006042 Ga0075368_10008020 Ga0075368_100080203 247
870 3300006048 Ga0075363_100006512 Ga0075363_1000065125 247
871 3300006048 Ga0075363_100008153 Ga0075363_1000081533 247
872 3300006048 Ga0075363_100011597 Ga0075363_1000115974 247
873 3300006048 Ga0075363_100202052 Ga0075363_1002020522 247
874 3300006051 Ga0075364_10000375 Ga0075364_100003759 247
875 3300006163 Ga0070715_10099188 Ga0070715_100991882 247
876 3300006173 Ga0070716_100204847 Ga0070716_1002048472 247
877 3300006175 Ga0070712_100160328 Ga0070712_1001603282 247
878 3300006177 Ga0075362_10120141 Ga0075362_101201411 247
879 3300006178 Ga0075367_10000439 Ga0075367_1000043913 247
880 3300006178 Ga0075367_10012388 Ga0075367_100123882 247
881 3300006195 Ga0075366_10008178 Ga0075366_100081782 247
882 3300006195 Ga0075366_10044599 Ga0075366_100445992 247
883 3300006195 Ga0075366_10307762 Ga0075366_103077622 247
884 3300006237 Ga0097621_100001929 Ga0097621_1000019295 247
885 3300006358 Ga0068871_100757569 Ga0068871_1007575691 247
886 3300006844 Ga0075428_100105066 Ga0075428_1001050663 247
887 3300006844 Ga0075428_100236451 Ga0075428_1002364513 247
888 3300006844 Ga0075428_100276416 Ga0075428_1002764162 247
889 3300006846 Ga0075430_100010264 Ga0075430_1000102642 247
890 3300006847 Ga0075431_100006349 Ga0075431_1000063498 247
891 3300006847 Ga0075431_100094748 Ga0075431_1000947482 247
892 3300006847 Ga0075431_100325936 Ga0075431_1003259362 247
893 3300006847 Ga0075431_100592979 Ga0075431_1005929791 247
894 3300006871 Ga0075434_100344115 Ga0075434_1003441151 247
895 3300006871 Ga0075434_100404736 Ga0075434_1004047362 247
896 3300006880 Ga0075429_100023937 Ga0075429_1000239372 247
897 3300006880 Ga0075429_100243255 Ga0075429_1002432552 247
898 3300006881 Ga0068865_100293563 Ga0068865_1002935631 247
899 3300006914 Ga0075436_100002000 Ga0075436_1000020006 247
900 3300006931 Ga0097620_100001347 Ga0097620_10000134718 247
901 3300006931 Ga0097620_100004592 Ga0097620_1000045924 247
902 3300006931 Ga0097620_100066063 Ga0097620_1000660634 247
903 3300006942 Ga0099824_1014958 Ga0099824_10149586 247
904 3300007076 Ga0075435_100015371 Ga0075435_10001537110 247
905 3300007076 Ga0075435_100107534 Ga0075435_1001075343 247
906 3300009093 Ga0105240_10045969 Ga0105240_100459691 247
907 3300009093 Ga0105240_10119203 Ga0105240_101192032 247
908 3300009093 Ga0105240_10128638 Ga0105240_101286383 247
909 3300009094 Ga0111539_10001755 Ga0111539_1000175517 247
910 3300009094 Ga0111539_10117520 Ga0111539_101175202 247
911 3300009094 Ga0111539_10156457 Ga0111539_101564572 247
912 3300009094 Ga0111539_10613135 Ga0111539_106131352 247
913 3300009094 Ga0111539_11081060 Ga0111539_110810601 247
914 3300009094 Ga0111539_11318560 Ga0111539_113185601 247
915 3300009147 Ga0114129_10339853 Ga0114129_103398533 247
916 3300009174 Ga0105241_10003630 Ga0105241_1000363011 247
917 3300009174 Ga0105241_10012445 Ga0105241_100124454 247
918 3300009174 Ga0105241_10115152 Ga0105241_101151522 247
919 3300009174 Ga0105241_10749501 Ga0105241_107495011 247
920 3300009176 Ga0105242_10241689 Ga0105242_102416892 247
921 3300009176 Ga0105242_10292686 Ga0105242_102926862 247
922 3300009545 Ga0105237_10016707 Ga0105237_100167074 247
923 3300009545 Ga0105237_10047919 Ga0105237_100479194 247
924 3300009545 Ga0105237_10175693 Ga0105237_101756932 247
925 3300009545 Ga0105237_10179144 Ga0105237_101791443 247
926 3300009551 Ga0105238_10051160 Ga0105238_100511604 247
927 3300009553 Ga0105249_10002066 Ga0105249_100020669 247
928 3300009553 Ga0105249_10673243 Ga0105249_106732432 247
929 3300010375 Ga0105239_10025561 Ga0105239_100255615 247
930 3300010375 Ga0105239_10728912 Ga0105239_107289121 247
931 3300013104 Ga0157370_10037070 Ga0157370_100370706 247
932 3300013104 Ga0157370_10059717 Ga0157370_100597174 247
933 3300013104 Ga0157370_10112112 Ga0157370_101121122 247
934 3300013104 Ga0157370_10865256 Ga0157370_108652561 247
935 3300013105 Ga0157369_10022801 Ga0157369_100228013 247
936 3300013296 Ga0157374_10002510 Ga0157374_100025106 247
937 3300013296 Ga0157374_10102381 Ga0157374_101023813 247
938 3300013297 Ga0157378_10004019 Ga0157378_100040196 247
939 3300013306 Ga0163162_10150206 Ga0163162_101502062 247
940 3300013306 Ga0163162_10311474 Ga0163162_103114742 247
941 3300013306 Ga0163162_10374774 Ga0163162_103747742 247
942 3300013307 Ga0157372_10061585 Ga0157372_100615852 247
943 3300013308 Ga0157375_10026695 Ga0157375_100266952 247
944 3300013308 Ga0157375_10040858 Ga0157375_100408582 247
945 3300013308 Ga0157375_10091204 Ga0157375_100912042 247
946 3300013308 Ga0157375_11065180 Ga0157375_110651801 247
947 3300013308 Ga0157375_11114810 Ga0157375_111148101 247
948 3300014325 Ga0163163_10051526 Ga0163163_100515263 247
949 3300014326 Ga0157380_10015244 Ga0157380_100152442 247
950 3300014326 Ga0157380_10050244 Ga0157380_100502444 247
951 3300014326 Ga0157380_10079215 Ga0157380_100792153 247
952 3300014326 Ga0157380_10329298 Ga0157380_103292982 247
953 3300014745 Ga0157377_10048220 Ga0157377_100482202 247
954 3300014969 Ga0157376_10020365 Ga0157376_100203653 247
955 3300021384 Ga0213876_10002898 Ga0213876_1000289810 247
956 3300021384 Ga0213876_10003579 Ga0213876_1000357910 247
957 3300025230 Ga0209563_104872 Ga0209563_1048722 247
958 3300025245 Ga0207425_1010355 Ga0207425_10103555 247
959 3300025253 Ga0209677_104551 Ga0209677_1045511 247
960 3300025254 Ga0209148_1000479 Ga0209148_100047927 247
961 3300025261 Ga0209233_1005481 Ga0209233_10054813 247
962 3300025261 Ga0209233_1022311 Ga0209233_10223112 247
963 3300025272 Ga0209455_1000521 Ga0209455_100052111 247
964 3300025295 Ga0209564_1007463 Ga0209564_10074634 247
965 3300025295 Ga0209564_1048876 Ga0209564_10488761 247
966 3300025297 Ga0209758_1000011 Ga0209758_1000011519 247
967 3300025297 Ga0209758_1000120 Ga0209758_100012018 247
968 3300025297 Ga0209758_1003647 Ga0209758_10036477 247
969 3300025297 Ga0209758_1005738 Ga0209758_10057382 247
970 3300025299 Ga0209256_1001013 Ga0209256_100101322 247
971 3300025299 Ga0209256_1020612 Ga0209256_10206122 247
972 3300025302 Ga0207426_1000458 Ga0207426_100045834 247
973 3300025302 Ga0207426_1001355 Ga0207426_10013555 247
974 3300025302 Ga0207426_1003487 Ga0207426_10034875 247
975 3300025302 Ga0207426_1033497 Ga0207426_10334972 247
976 3300025304 Ga0209257_1001101 Ga0209257_100110127 247
977 3300025321 Ga0207656_10114613 Ga0207656_101146132 247
978 3300025885 Ga0207653_10006836 Ga0207653_100068366 247
979 3300025893 Ga0207682_10104079 Ga0207682_101040792 247
980 3300025901 Ga0207688_10005840 Ga0207688_100058406 247
981 3300025901 Ga0207688_10064140 Ga0207688_100641403 247
982 3300025901 Ga0207688_10115519 Ga0207688_101155192 247
983 3300025905 Ga0207685_10078916 Ga0207685_100789162 247
984 3300025907 Ga0207645_10019696 Ga0207645_100196963 247
985 3300025908 Ga0207643_10040021 Ga0207643_100400212 247
986 3300025909 Ga0207705_10050894 Ga0207705_100508943 247
987 3300025909 Ga0207705_10100427 Ga0207705_101004271 247
988 3300025909 Ga0207705_10375523 Ga0207705_103755232 247
989 3300025910 Ga0207684_10213044 Ga0207684_102130441 247
990 3300025911 Ga0207654_10022029 Ga0207654_100220293 247
991 3300025912 Ga0207707_10001907 Ga0207707_100019077 247
992 3300025912 Ga0207707_10031180 Ga0207707_100311803 247
993 3300025912 Ga0207707_10036585 Ga0207707_100365853 247
994 3300025912 Ga0207707_10105975 Ga0207707_101059752 247
995 3300025912 Ga0207707_10224565 Ga0207707_102245652 247
996 3300025912 Ga0207707_10272849 Ga0207707_102728492 247
997 3300025912 Ga0207707_10306170 Ga0207707_103061702 247
998 3300025913 Ga0207695_10000008 Ga0207695_10000008984 247
999 3300025913 Ga0207695_10074780 Ga0207695_100747802 247
1000 3300025913 Ga0207695_10088068 Ga0207695_100880682 247
1001 3300025913 Ga0207695_10351826 Ga0207695_103518262 247
1002 3300025914 Ga0207671_10075242 Ga0207671_100752422 247
1003 3300025915 Ga0207693_10145318 Ga0207693_101453182 247
1004 3300025917 Ga0207660_10008004 Ga0207660_100080042 247
1005 3300025917 Ga0207660_10231000 Ga0207660_102310002 247
1006 3300025918 Ga0207662_10190082 Ga0207662_101900822 247
1007 3300025919 Ga0207657_10017806 Ga0207657_100178062 247
1008 3300025919 Ga0207657_10047173 Ga0207657_100471732 247
1009 3300025920 Ga0207649_10013276 Ga0207649_100132763 247
1010 3300025920 Ga0207649_10192440 Ga0207649_101924402 247
1011 3300025921 Ga0207652_10028625 Ga0207652_100286252 247
1012 3300025921 Ga0207652_10165535 Ga0207652_101655352 247
1013 3300025921 Ga0207652_10239627 Ga0207652_102396272 247
1014 3300025922 Ga0207646_10073903 Ga0207646_100739032 247
1015 3300025922 Ga0207646_10641091 Ga0207646_106410911 247
1016 3300025924 Ga0207694_10017635 Ga0207694_100176352 247
1017 3300025925 Ga0207650_10062660 Ga0207650_100626601 247
1018 3300025926 Ga0207659_10008337 Ga0207659_100083374 247
1019 3300025931 Ga0207644_10000662 Ga0207644_1000066218 247
1020 3300025931 Ga0207644_10101300 Ga0207644_101013002 247
1021 3300025933 Ga0207706_10075564 Ga0207706_100755643 247
1022 3300025934 Ga0207686_10281531 Ga0207686_102815312 247
1023 3300025935 Ga0207709_10204687 Ga0207709_102046871 247
1024 3300025938 Ga0207704_10291416 Ga0207704_102914162 247
1025 3300025939 Ga0207665_10704104 Ga0207665_107041041 247
1026 3300025940 Ga0207691_10002630 Ga0207691_1000263011 247
1027 3300025942 Ga0207689_10122781 Ga0207689_101227814 247
1028 3300025944 Ga0207661_10040759 Ga0207661_100407595 247
1029 3300025944 Ga0207661_10051634 Ga0207661_100516342 247
1030 3300025945 Ga0207679_10000999 Ga0207679_1000099911 247
1031 3300025945 Ga0207679_10287696 Ga0207679_102876962 247
1032 3300025949 Ga0207667_10022102 Ga0207667_100221023 247
1033 3300025949 Ga0207667_10033353 Ga0207667_100333534 247
1034 3300025949 Ga0207667_10203396 Ga0207667_102033962 247
1035 3300025960 Ga0207651_10000539 Ga0207651_1000053913 247
1036 3300025960 Ga0207651_10028595 Ga0207651_100285957 247
1037 3300025972 Ga0207668_10020017 Ga0207668_100200172 247
1038 3300025981 Ga0207640_10002923 Ga0207640_100029234 247
1039 3300025981 Ga0207640_10098327 Ga0207640_100983272 247
1040 3300025986 Ga0207658_10067312 Ga0207658_100673124 247
1041 3300025986 Ga0207658_10067700 Ga0207658_100677003 247
1042 3300025986 Ga0207658_10813997 Ga0207658_108139971 247
1043 3300026023 Ga0207677_10006479 Ga0207677_100064795 247
1044 3300026023 Ga0207677_10050315 Ga0207677_100503153 247
1045 3300026035 Ga0207703_10001771 Ga0207703_1000177110 247
1046 3300026035 Ga0207703_10116025 Ga0207703_101160253 247
1047 3300026035 Ga0207703_10212189 Ga0207703_102121891 247
1048 3300026067 Ga0207678_10036030 Ga0207678_100360303 247
1049 3300026067 Ga0207678_10178085 Ga0207678_101780852 247
1050 3300026075 Ga0207708_10001813 Ga0207708_100018139 247
1051 3300026075 Ga0207708_10156445 Ga0207708_101564451 247
1052 3300026078 Ga0207702_10614122 Ga0207702_106141221 247
1053 3300026088 Ga0207641_10050841 Ga0207641_100508413 247
1054 3300026088 Ga0207641_10355003 Ga0207641_103550032 247
1055 3300026089 Ga0207648_10001802 Ga0207648_100018028 247
1056 3300026089 Ga0207648_10012847 Ga0207648_100128477 247
1057 3300026089 Ga0207648_10236908 Ga0207648_102369082 247
1058 3300026095 Ga0207676_10010216 Ga0207676_100102164 247
1059 3300026095 Ga0207676_10014329 Ga0207676_100143294 247
1060 3300026095 Ga0207676_10523919 Ga0207676_105239191 247
1061 3300026116 Ga0207674_10002489 Ga0207674_1000248917 247
1062 3300026116 Ga0207674_10002494 Ga0207674_1000249422 247
1063 3300026116 Ga0207674_10013097 Ga0207674_100130978 247
1064 3300026116 Ga0207674_10308643 Ga0207674_103086432 247
1065 3300026118 Ga0207675_100001457 Ga0207675_10000145716 247
1066 3300026118 Ga0207675_100261260 Ga0207675_1002612602 247
1067 3300026118 Ga0207675_100571763 Ga0207675_1005717632 247
1068 3300026118 Ga0207675_100635994 Ga0207675_1006359941 247
1069 3300026118 Ga0207675_100834745 Ga0207675_1008347451 247
1070 3300026121 Ga0207683_10006114 Ga0207683_100061146 247
1071 3300026121 Ga0207683_10030306 Ga0207683_100303063 247
1072 3300026121 Ga0207683_10103223 Ga0207683_101032232 247
1073 3300026142 Ga0207698_10174151 Ga0207698_101741512 247
1074 3300026142 Ga0207698_10450068 Ga0207698_104500682 247
1075 3300027296 Ga0209389_1000043 Ga0209389_10000436 247
1076 3300027296 Ga0209389_1000077 Ga0209389_100007772 247
1077 3300027357 Ga0209589_1000047 Ga0209589_1000047105 247
1078 3300027360 Ga0209969_1001449 Ga0209969_10014492 247
1079 3300027361 Ga0209489_100075 Ga0209489_100075137 247
1080 3300027361 Ga0209489_100251 Ga0209489_10025172 247
1081 3300027363 Ga0209700_100271 Ga0209700_10027172 247
1082 3300027378 Ga0209981_1002479 Ga0209981_10024793 247
1083 3300027866 Ga0209813_10000818 Ga0209813_100008183 247
1084 3300027866 Ga0209813_10002644 Ga0209813_100026443 247
1085 3300027876 Ga0209974_10004349 Ga0209974_100043495 247
1086 3300027907 Ga0207428_10002848 Ga0207428_1000284817 247
1087 3300027907 Ga0207428_10035406 Ga0207428_100354065 247
1088 3300028379 Ga0268266_10118526 Ga0268266_101185262 247
1089 3300028379 Ga0268266_10957672 Ga0268266_109576721 247
1090 3300028380 Ga0268265_10002314 Ga0268265_1000231411 247
1091 3300028380 Ga0268265_10177827 Ga0268265_101778272 247
1092 3300028380 Ga0268265_10416984 Ga0268265_104169842 247
1093 3300028380 Ga0268265_11031378 Ga0268265_110313781 247
1094 3300028381 Ga0268264_10000030 Ga0268264_10000030230 247
1095 3300028381 Ga0268264_10001973 Ga0268264_100019737 247
1096 3300028381 Ga0268264_10003102 Ga0268264_1000310214 247
1097 3300028381 Ga0268264_10409806 Ga0268264_104098062 247
1098 3300030521 Ga0307511_10039065 Ga0307511_100390654 247
1099 3300031249 Ga0265339_10009845 Ga0265339_100098452 247
1100 3300031456 Ga0307513_10000034 Ga0307513_1000003454 247
1101 3300031456 Ga0307513_10007609 Ga0307513_100076096 247
1102 3300031507 Ga0307509_10274920 Ga0307509_102749202 247
1103 3300031548 Ga0307408_100728188 Ga0307408_1007281881 247
1104 3300031616 Ga0307508_10003532 Ga0307508_1000353212 247
1105 3300031616 Ga0307508_10161807 Ga0307508_101618071 247
1106 3300031616 Ga0307508_10186206 Ga0307508_101862062 247
1107 3300031711 Ga0265314_10002700 Ga0265314_1000270012 247
1108 3300031711 Ga0265314_10046257 Ga0265314_100462573 247
1109 3300031711 Ga0265314_10139617 Ga0265314_101396172 247
1110 3300031711 Ga0265314_10236417 Ga0265314_102364172 247
1111 3300031730 Ga0307516_10018252 Ga0307516_100182524 247
1112 3300031731 Ga0307405_10377919 Ga0307405_103779192 247
1113 3300031824 Ga0307413_10682957 Ga0307413_106829571 247
1114 3300031838 Ga0307518_10200924 Ga0307518_102009242 247
1115 3300031852 Ga0307410_10709754 Ga0307410_107097541 247
1116 3300032005 Ga0307411_10162153 Ga0307411_101621532 247
1117 3300033179 Ga0307507_10026861 Ga0307507_100268614 247
1118 3300033180 Ga0307510_10017164 Ga0307510_100171646 247
1119 3300034957 Ga0373938_0004232 Ga0373938_0004232_234_986 247
1120 3300035083 Ga0373926_0038226 Ga0373926_0038226_273_1025 247
1121 3300035113 Ga0373936_0045218 Ga0373936_0045218_858_1610 247
1122 3300035121 Ga0373960_0002619 Ga0373960_0002619_1758_2510 247
1123 3300035691 Ga0373931_0000116 Ga0373931_0000116_27720_28472 247
1124 3300035691 Ga0373931_0111062 Ga0373931_0111062_601_1353 247
1125 3300035692 Ga0373935_0026781 Ga0373935_0026781_2321_3073 247
1126 3300035692 Ga0373935_0173688 Ga0373935_0173688_578_1330 247
1127 3300035695 Ga0373927_0038713 Ga0373927_0038713_1984_2736 247
1128 3300035695 Ga0373927_0046867 Ga0373927_0046867_401_1153 247
1129 3300035695 Ga0373927_0085133 Ga0373927_0085133_1149_1901 247
1130 3300035695 Ga0373927_0240362 Ga0373927_0240362_68_820 247
1131 3300035725 Ga0373947_0022472 Ga0373947_0022472_2412_3164 247
1132 3300036401 Ga0373937_0390306 Ga0373937_0390306_372_1124 247
1133 3300037068 Ga0373925_0016726 Ga0373925_0016726_476_1228 247
1134 3300037068 Ga0373925_0024885 Ga0373925_0024885_1625_2377 247
1135 3300037068 Ga0373925_0178949 Ga0373925_0178949_153_905 247
1136 3300037068 Ga0373925_0432399 Ga0373925_0432399_169_921 247
1137 3300037418 Ga0395900_0001310 Ga0395900_0001310_665_1408 247
1138 3300037418 Ga0395900_0334580 Ga0395900_0334580_264_1079 247
1139 3300037418 Ga0395900_0415545 Ga0395900_0415545_131_883 247
1140 3300037466 Ga0395898_0011039 Ga0395898_0011039_434_1177 247
1141 3300037466 Ga0395898_0086895 Ga0395898_0086895_1543_2295 247
1142 3300037466 Ga0395898_0089354 Ga0395898_0089354_1338_2180 247
1143 3300037466 Ga0395898_0245347 Ga0395898_0245347_658_1413 247
1144 3300037471 Ga0395905_0028793 Ga0395905_0028793_3642_4394 247
1145 3300038443 Ga0395901_0024836 Ga0395901_0024836_4312_5055 247
1146 3300039437 Ga0436365_0991677 Ga0436365_0991677_47_934 247
1147 3300039437 Ga0436365_1236739 Ga0436365_1236739_27589_28341 247
1148 3300039437 Ga0436365_1491363 Ga0436365_1491363_1520_2272 247
1149 3300039438 Ga0436360_0222734 Ga0436360_0222734_284_1036 247
1150 3300039438 Ga0436360_1227094 Ga0436360_1227094_212_964 247
1151 3300039447 Ga0436361_0975863 Ga0436361_0975863_375_1127 247
1152 3300039447 Ga0436361_1096819 Ga0436361_1096819_404_1156 247
1153 3300039450 Ga0436363_1119093 Ga0436363_1119093_259_1011 247
1154 3300039453 Ga0436362_0093970 Ga0436362_0093970_212_964 247
1155 3300039453 Ga0436362_0548217 Ga0436362_0548217_1966_2718 247
1156 3300041452 Ga0451793_0601538 Ga0451793_0601538_803_1546 247
1157 3300041486 Ga0451807_2436701 Ga0451807_2436701_127_870 247
1158 3300041492 Ga0451835_1188482 Ga0451835_1188482_56_799 247
1159 3300041507 Ga0451851_0511660 Ga0451851_0511660_76_819 247
1160 3300044656 Ga0466969_0071333 Ga0466969_0071333_795_1538 247
1161 3300044656 Ga0466969_0128632 Ga0466969_0128632_389_1132 247
1162 3300044658 Ga0466972_0000079 Ga0466972_0000079_82293_83036 247
1163 3300044658 Ga0466972_0004993 Ga0466972_0004993_422_1165 247
1164 3300044658 Ga0466972_0060127 Ga0466972_0060127_78_821 247
1165 3300044684 Ga0466966_0000191 Ga0466966_0000191_16845_17588 247
1166 3300044693 Ga0466961_0000005 Ga0466961_0000005_56871_57614 247
1167 3300044694 Ga0466963_0134668 Ga0466963_0134668_180_923 247
1168 3300044694 Ga0466963_0329166 Ga0466963_0329166_76_837 247
1169 3300044706 Ga0466964_0011528 Ga0466964_0011528_144_887 247
1170 3300044765 Ga0466970_0159152 Ga0466970_0159152_417_1160 247
1171 3300044901 Ga0466960_0022513 Ga0466960_0022513_1801_2544 247
1172 3300045049 Ga0466959_0000654 Ga0466959_0000654_15549_16292 247
1173 3300045051 Ga0451576_0491751 Ga0451576_0491751_163_918 247
1174 3300045976 Ga0466967_0056368 Ga0466967_0056368_605_1348 247
1175 3300045976 Ga0466967_0247653 Ga0466967_0247653_635_1519 247
1176 3300045976 Ga0466967_0398772 Ga0466967_0398772_533_1276 247
1177 3300046454 Ga0495592_0029039 Ga0495592_0029039_707_1450 247
1178 3300046455 Ga0495603_0045351 Ga0495603_0045351_816_1568 247
1179 3300046457 Ga0495590_0067357 Ga0495590_0067357_106_849 247
1180 3300046462 Ga0495651_0001292 Ga0495651_0001292_18337_19080 247
1181 3300046475 Ga0495639_0198840 Ga0495639_0198840_46_798 247
1182 3300046477 Ga0495664_0365399 Ga0495664_0365399_20_772 247
1183 3300046511 Ga0495608_0139730 Ga0495608_0139730_790_1533 247
1184 3300046516 Ga0495628_0018938 Ga0495628_0018938_3875_4618 247
1185 3300046524 Ga0495648_0028398 Ga0495648_0028398_1989_2732 247
1186 3300046525 Ga0495663_0100065 Ga0495663_0100065_28_780 247
1187 3300046529 Ga0495652_0006590 Ga0495652_0006590_5068_5811 247
1188 3300046529 Ga0495652_0230362 Ga0495652_0230362_511_1263 247
1189 3300046529 Ga0495652_0427058 Ga0495652_0427058_52_795 247
1190 3300046538 Ga0495609_0121254 Ga0495609_0121254_105_848 247
1191 3300046539 Ga0495621_0054227 Ga0495621_0054227_392_1144 247
1192 3300046542 Ga0495597_0078838 Ga0495597_0078838_37_780 247
1193 3300046557 Ga0495622_0007219 Ga0495622_0007219_2510_3253 247
1194 3300046557 Ga0495622_0009262 Ga0495622_0009262_529_1272 247
1195 3300046557 Ga0495622_0095691 Ga0495622_0095691_55_807 247
1196 3300046616 Ga0495668_0209470 Ga0495668_0209470_180_923 247
1197 3300046642 Ga0495634_0178489 Ga0495634_0178489_471_1214 247
1198 3300046648 Ga0495611_0026243 Ga0495611_0026243_1180_1923 247
1199 3300046663 Ga0495635_0002472 Ga0495635_0002472_5824_6567 247
1200 3300046674 Ga0495588_0004811 Ga0495588_0004811_1198_1941 247
1201 3300046675 Ga0495657_0004748 Ga0495657_0004748_7881_8624 247
1202 3300046678 Ga0495599_0081921 Ga0495599_0081921_850_1593 247
1203 3300046679 Ga0495623_0027704 Ga0495623_0027704_1371_2114 247
1204 3300046681 Ga0495647_0078863 Ga0495647_0078863_320_1072 247
1205 3300046683 Ga0495658_0097178 Ga0495658_0097178_253_1005 247
1206 3300046689 Ga0495613_0020813 Ga0495613_0020813_2652_3395 247
1207 3300046689 Ga0495613_0162640 Ga0495613_0162640_732_1484 247
1208 3300046690 Ga0495624_0007439 Ga0495624_0007439_5802_6545 247
1209 3300046794 Ga0495589_0075661 Ga0495589_0075661_799_1542 247
1210 3300046809 Ga0495600_0000887 Ga0495600_0000887_14794_15537 247
1211 3300046809 Ga0495600_0002308 Ga0495600_0002308_4358_5101 247
1212 3300046809 Ga0495600_0116846 Ga0495600_0116846_830_1582 247
1213 3300047315 Ga0495581_0007913 Ga0495581_0007913_3804_4547 247
1214 3300047321 Ga0495676_0031801 Ga0495676_0031801_547_1290 247
1215 3300047321 Ga0495676_0250756 Ga0495676_0250756_390_1142 247
1216 3300047322 Ga0495680_0004106 Ga0495680_0004106_727_1470 247
1217 3300047444 Ga0495675_0014844 Ga0495675_0014844_1499_2242 247
1218 3300047444 Ga0495675_0153474 Ga0495675_0153474_57_809 247
1219 3300047471 Ga0495684_0368462 Ga0495684_0368462_96_848 247
1220 3300047471 Ga0495684_0421971 Ga0495684_0421971_62_805 247
1221 3300047472 Ga0495686_0089415 Ga0495686_0089415_162_914 247
1222 3300047673 Ga0495593_0018091 Ga0495593_0018091_1794_2537 247
1223 3300047673 Ga0495593_0153959 Ga0495593_0153959_157_900 247
1224 3300048088 Ga0495602_0048917 Ga0495602_0048917_2554_3297 247
1225 3300048088 Ga0495602_0083357 Ga0495602_0083357_1167_1919 247
1226 3300048903 Ga0496100_0354358 Ga0496100_0354358_59_811 247
1227 3300048903 Ga0496100_0386626 Ga0496100_0386626_88_831 247
1228 3300048904 Ga0496101_0195605 Ga0496101_0195605_481_1233 247
1229 3300048905 Ga0496102_0004180 Ga0496102_0004180_7600_8352 247
1230 3300048905 Ga0496102_0037694 Ga0496102_0037694_3403_4155 247
1231 3300048905 Ga0496102_0298173 Ga0496102_0298173_50_802 247
1232 3300048905 Ga0496102_0611487 Ga0496102_0611487_148_900 247
1233 3300048906 Ga0496103_0010570 Ga0496103_0010570_4662_5414 247
1234 3300048906 Ga0496103_0020026 Ga0496103_0020026_2281_3024 247
1235 3300048906 Ga0496103_0079575 Ga0496103_0079575_664_1416 247
1236 3300048907 Ga0496104_0000887 Ga0496104_0000887_1445_2197 247
1237 3300048907 Ga0496104_0003143 Ga0496104_0003143_3569_4321 247
1238 3300048907 Ga0496104_0004370 Ga0496104_0004370_5767_6510 247
1239 3300048907 Ga0496104_0037883 Ga0496104_0037883_311_1063 247
1240 3300048907 Ga0496104_0249331 Ga0496104_0249331_801_1544 247
1241 3300048908 Ga0496105_0015706 Ga0496105_0015706_3743_4495 247
1242 3300048908 Ga0496105_0022134 Ga0496105_0022134_168_920 247
1243 3300048908 Ga0496105_0025293 Ga0496105_0025293_1531_2274 247
1244 3300048909 Ga0496106_0005519 Ga0496106_0005519_2938_3690 247
1245 3300048909 Ga0496106_0012569 Ga0496106_0012569_187_939 247
1246 3300048909 Ga0496106_0032551 Ga0496106_0032551_1390_2133 247
1247 3300048909 Ga0496106_0111916 Ga0496106_0111916_350_1102 247
1248 3300048910 Ga0496107_0053363 Ga0496107_0053363_509_1252 247
1249 3300048910 Ga0496107_0145016 Ga0496107_0145016_812_1564 247
1250 3300048911 Ga0496108_0001980 Ga0496108_0001980_11764_12516 247
1251 3300048911 Ga0496108_0003753 Ga0496108_0003753_1644_2396 247
1252 3300048911 Ga0496108_0009913 Ga0496108_0009913_2499_3251 247
1253 3300048911 Ga0496108_0041408 Ga0496108_0041408_182_934 247
1254 3300048912 Ga0496109_0043521 Ga0496109_0043521_109_861 247
1255 3300048912 Ga0496109_0072366 Ga0496109_0072366_411_1154 247
1256 3300048912 Ga0496109_0230160 Ga0496109_0230160_792_1535 247
1257 3300048912 Ga0496109_0368026 Ga0496109_0368026_270_1022 247
1258 3300048913 Ga0496110_0000895 Ga0496110_0000895_9442_10194 247
1259 3300048913 Ga0496110_0031997 Ga0496110_0031997_1474_2226 247
1260 3300048913 Ga0496110_0143275 Ga0496110_0143275_992_1744 247
1261 3300048913 Ga0496110_0550857 Ga0496110_0550857_190_933 247
1262 3300048914 Ga0496111_0011980 Ga0496111_0011980_1162_1914 247
1263 3300048914 Ga0496111_0029520 Ga0496111_0029520_2263_3015 247
1264 3300048914 Ga0496111_0064293 Ga0496111_0064293_679_1431 247
1265 3300048914 Ga0496111_0093348 Ga0496111_0093348_1303_2055 247
1266 3300048915 Ga0496112_0086125 Ga0496112_0086125_169_921 247
1267 3300048915 Ga0496112_0112237 Ga0496112_0112237_1432_2184 247
1268 3300048916 Ga0496113_0157676 Ga0496113_0157676_817_1560 247
1269 3300048916 Ga0496113_0248641 Ga0496113_0248641_464_1216 247
1270 3300048917 Ga0496114_0034538 Ga0496114_0034538_897_1649 247
1271 3300048917 Ga0496114_0200320 Ga0496114_0200320_150_902 247
1272 3300048918 Ga0496115_0096434 Ga0496115_0096434_1221_1964 247
1273 3300048919 Ga0496116_0022844 Ga0496116_0022844_67_810 247
1274 3300048919 Ga0496116_0083636 Ga0496116_0083636_992_1744 247
1275 3300048921 Ga0496118_0006235 Ga0496118_0006235_5907_6659 247
1276 3300048921 Ga0496118_0046707 Ga0496118_0046707_1402_2145 247
1277 3300048921 Ga0496118_0262934 Ga0496118_0262934_45_788 247
1278 3300048922 Ga0496119_0004854 Ga0496119_0004854_5079_5831 247
1279 3300048922 Ga0496119_0012751 Ga0496119_0012751_4136_4879 247
1280 3300048923 Ga0496120_0027812 Ga0496120_0027812_1349_2092 247
1281 3300048924 Ga0496121_0002635 Ga0496121_0002635_4367_5119 247
1282 3300048924 Ga0496121_0115874 Ga0496121_0115874_1122_1865 247
1283 3300048924 Ga0496121_0240280 Ga0496121_0240280_270_1013 247
1284 3300048925 Ga0496122_0058473 Ga0496122_0058473_1875_2618 247
1285 3300048927 Ga0496124_0004890 Ga0496124_0004890_8642_9394 247
1286 3300048928 Ga0496125_0017937 Ga0496125_0017937_5041_5784 247
1287 3300048928 Ga0496125_0197232 Ga0496125_0197232_395_1147 247
1288 3300048929 Ga0496126_0002122 Ga0496126_0002122_11668_12420 247
1289 3300048929 Ga0496126_0029792 Ga0496126_0029792_1934_2677 247
1290 3300048929 Ga0496126_0045231 Ga0496126_0045231_1396_2139 247
1291 3300048929 Ga0496126_0404681 Ga0496126_0404681_347_1090 247
1292 3300049568 Ga0501031_0002180 Ga0501031_0002180_8206_9003 247
1293 3300049569 Ga0501032_0000136 Ga0501032_0000136_27984_28781 247
1294 3300049570 Ga0501033_0000202 Ga0501033_0000202_47970_48767 247
1295 3300049571 Ga0501034_0000113 Ga0501034_0000113_94920_95717 247
1296 3300049571 Ga0501034_0029250 Ga0501034_0029250_206_961 247
1297 3300049571 Ga0501034_0102984 Ga0501034_0102984_1405_2157 247
1298 3300049571 Ga0501034_0253230 Ga0501034_0253230_285_1037 247
1299 3300049572 Ga0501036_0000059 Ga0501036_0000059_63208_64005 247
1300 3300049572 Ga0501036_0424980 Ga0501036_0424980_242_994 247
1301 3300049573 Ga0501037_0000214 Ga0501037_0000214_11719_12516 247
1302 3300049574 Ga0501038_0002810 Ga0501038_0002810_691_1488 247
1303 3300049574 Ga0501038_0115598 Ga0501038_0115598_260_1012 247
1304 3300049575 Ga0501039_0001981 Ga0501039_0001981_4482_5279 247
1305 3300049575 Ga0501039_0053131 Ga0501039_0053131_729_1481 247
1306 3300049577 Ga0501041_0039663 Ga0501041_0039663_601_1353 247
1307 3300049577 Ga0501041_0086153 Ga0501041_0086153_768_1520 247
1308 3300049578 Ga0501042_0055963 Ga0501042_0055963_257_1054 247
1309 3300049579 Ga0501043_0000017 Ga0501043_0000017_1426_2223 247
1310 3300049579 Ga0501043_0209553 Ga0501043_0209553_726_1478 247
1311 3300049580 Ga0501046_0000174 Ga0501046_0000174_34965_35762 247
1312 3300049581 Ga0501047_0000044 Ga0501047_0000044_157537_158334 247
1313 3300049581 Ga0501047_0195332 Ga0501047_0195332_1054_1809 247
1314 3300049582 Ga0501048_0000837 Ga0501048_0000837_12517_13314 247
1315 3300049582 Ga0501048_0036135 Ga0501048_0036135_2511_3263 247
1316 3300049582 Ga0501048_0079019 Ga0501048_0079019_300_1052 247
1317 3300049583 Ga0501067_0011413 Ga0501067_0011413_2767_3564 247
1318 3300049584 Ga0501068_0000089 Ga0501068_0000089_36188_36985 247
1319 3300049585 Ga0501069_0005200 Ga0501069_0005200_4297_5094 247
1320 3300049585 Ga0501069_0158532 Ga0501069_0158532_246_998 247
1321 3300049586 Ga0501070_0034519 Ga0501070_0034519_2711_3508 247
1322 3300049586 Ga0501070_0058949 Ga0501070_0058949_145_897 247
1323 3300049586 Ga0501070_0113759 Ga0501070_0113759_355_1107 247
1324 3300049586 Ga0501070_0113933 Ga0501070_0113933_116_868 247
1325 3300049587 Ga0501071_0018583 Ga0501071_0018583_1723_2475 247
1326 3300049587 Ga0501071_0046014 Ga0501071_0046014_2348_3100 247
1327 3300049587 Ga0501071_0127700 Ga0501071_0127700_1094_1846 247
1328 3300049587 Ga0501071_0187099 Ga0501071_0187099_177_929 247
1329 3300049588 Ga0501072_0003722 Ga0501072_0003722_1296_2093 247
1330 3300049588 Ga0501072_0005305 Ga0501072_0005305_4828_5580 247
1331 3300049588 Ga0501072_0212348 Ga0501072_0212348_678_1430 247
1332 3300049588 Ga0501072_0434669 Ga0501072_0434669_33_785 247
1333 3300049589 Ga0501073_0000069 Ga0501073_0000069_19674_20471 247
1334 3300049590 Ga0501074_0000346 Ga0501074_0000346_1676_2473 247
1335 3300049590 Ga0501074_0012367 Ga0501074_0012367_1313_2119 247
1336 3300049590 Ga0501074_0223605 Ga0501074_0223605_47_799 247
1337 3300049591 Ga0501075_0003173 Ga0501075_0003173_5815_6567 247
1338 3300049591 Ga0501075_0004743 Ga0501075_0004743_7538_8290 247
1339 3300049591 Ga0501075_0067175 Ga0501075_0067175_945_1697 247
1340 3300049591 Ga0501075_0082419 Ga0501075_0082419_209_961 247
1341 3300049591 Ga0501075_0090844 Ga0501075_0090844_1184_1936 247
1342 3300049592 Ga0501076_0004572 Ga0501076_0004572_7183_7935 247
1343 3300049592 Ga0501076_0022327 Ga0501076_0022327_619_1371 247
1344 3300049592 Ga0501076_0046875 Ga0501076_0046875_2351_3103 247
1345 3300049592 Ga0501076_0054576 Ga0501076_0054576_1075_1827 247
1346 3300049592 Ga0501076_0420969 Ga0501076_0420969_256_1011 247
1347 3300049593 Ga0501077_0007172 Ga0501077_0007172_2947_3699 247
1348 3300049593 Ga0501077_0048514 Ga0501077_0048514_1234_1986 247
1349 3300049741 Ga0501079_0011151 Ga0501079_0011151_100_897 247
1350 3300049741 Ga0501079_0060546 Ga0501079_0060546_2035_2787 247
1351 3300049741 Ga0501079_0137161 Ga0501079_0137161_532_1284 247
1352 3300049742 Ga0501080_0000613 Ga0501080_0000613_15240_16037 247
1353 3300049742 Ga0501080_0041399 Ga0501080_0041399_2499_3251 247
1354 3300049742 Ga0501080_0042217 Ga0501080_0042217_1509_2261 247
1355 3300049742 Ga0501080_0248884 Ga0501080_0248884_421_1173 247
1356 3300049742 Ga0501080_0262150 Ga0501080_0262150_36_788 247
1357 3300049742 Ga0501080_0276630 Ga0501080_0276630_610_1362 247
1358 3300049743 Ga0501081_0012368 Ga0501081_0012368_1994_2746 247
1359 3300049743 Ga0501081_0024760 Ga0501081_0024760_1558_2310 247
1360 3300049743 Ga0501081_0103516 Ga0501081_0103516_108_860 247
1361 3300049744 Ga0501083_0000838 Ga0501083_0000838_9611_10408 247
1362 3300049744 Ga0501083_0125880 Ga0501083_0125880_414_1166 247
1363 3300049779 Ga0501283_006120 Ga0501283_006120_576_1331 247
1364 3300049822 Ga0501035_0000393 Ga0501035_0000393_13398_14195 247
1365 3300049823 Ga0501044_0000108 Ga0501044_0000108_90758_91555 247
1366 3300049823 Ga0501044_0397655 Ga0501044_0397655_522_1274 247
1367 3300049824 Ga0501045_0003295 Ga0501045_0003295_9456_10208 247
1368 3300049824 Ga0501045_0007027 Ga0501045_0007027_1316_2113 247
1369 3300049824 Ga0501045_0052840 Ga0501045_0052840_1593_2345 247
1370 3300049824 Ga0501045_0088310 Ga0501045_0088310_1368_2120 247
1371 3300050490 nmdc:mga03n38_100614_c1 nmdc:mga03n38_100614_c1_569_1324 247
1372 3300050490 nmdc:mga03n38_222895_c1 nmdc:mga03n38_222895_c1_231_974 247
1373 3300050490 nmdc:mga03n38_303582_c1 nmdc:mga03n38_303582_c1_79_831 247
1374 3300050490 nmdc:mga03n38_90463_c1 nmdc:mga03n38_90463_c1_329_1081 247
1375 3300050491 nmdc:mga00v17_148995_c1 nmdc:mga00v17_148995_c1_711_1469 247
1376 3300050491 nmdc:mga00v17_30571_c1 nmdc:mga00v17_30571_c1_718_1470 247
1377 3300050492 nmdc:mga0yw44_28700_c1 nmdc:mga0yw44_28700_c1_2148_2900 247
1378 3300050492 nmdc:mga0yw44_389259_c1 nmdc:mga0yw44_389259_c1_98_841 247
1379 3300050492 nmdc:mga0yw44_393770_c1 nmdc:mga0yw44_393770_c1_86_829 247
1380 3300050493 nmdc:mga0k408_150863_c1 nmdc:mga0k408_150863_c1_137_889 247
1381 3300050493 nmdc:mga0k408_42447_c1 nmdc:mga0k408_42447_c1_1688_2431 247
1382 3300050493 nmdc:mga0k408_57199_c1 nmdc:mga0k408_57199_c1_541_1296 247
1383 3300050494 nmdc:mga06z11_102019_c1 nmdc:mga06z11_102019_c1_48_791 247
1384 3300050494 nmdc:mga06z11_126557_c1 nmdc:mga06z11_126557_c1_183_935 247
1385 3300050494 nmdc:mga06z11_16076_c1 nmdc:mga06z11_16076_c1_1152_1904 247
1386 3300050494 nmdc:mga06z11_22101_c1 nmdc:mga06z11_22101_c1_1882_2634 247
1387 3300050494 nmdc:mga06z11_2258_c1 nmdc:mga06z11_2258_c1_1209_1961 247
1388 3300050495 nmdc:mga04h51_1097_c1 nmdc:mga04h51_1097_c1_181_933 247
1389 3300050496 nmdc:mga07m45_155815_c1 nmdc:mga07m45_155815_c1_262_1005 247
1390 3300050496 nmdc:mga07m45_86069_c1 nmdc:mga07m45_86069_c1_309_1052 247
1391 3300050507 nmdc:mga05p37_120836_c1 nmdc:mga05p37_120836_c1_1871_2623 247
1392 3300050507 nmdc:mga05p37_148724_c1 nmdc:mga05p37_148724_c1_1481_2233 247
1393 3300050507 nmdc:mga05p37_171923_c1 nmdc:mga05p37_171923_c1_1350_2102 247
1394 3300050507 nmdc:mga05p37_237852_c1 nmdc:mga05p37_237852_c1_724_1476 247
1395 3300050508 nmdc:mga09592_26221_c1 nmdc:mga09592_26221_c1_2649_3401 247
1396 3300050509 nmdc:mga0qj67_13296_c1 nmdc:mga0qj67_13296_c1_710_1465 247
1397 3300050509 nmdc:mga0qj67_54969_c1 nmdc:mga0qj67_54969_c1_1877_2629 247
1398 3300050509 nmdc:mga0qj67_7712_c1 nmdc:mga0qj67_7712_c1_5308_6060 247
1399 3300050510 nmdc:mga06r32_14504_c2 nmdc:mga06r32_14504_c2_143_898 247
1400 3300050510 nmdc:mga06r32_251564_c1 nmdc:mga06r32_251564_c1_648_1400 247
1401 3300050510 nmdc:mga06r32_291163_c1 nmdc:mga06r32_291163_c1_27_779 247
1402 3300050510 nmdc:mga06r32_34274_c1 nmdc:mga06r32_34274_c1_2934_3686 247
1403 3300050510 nmdc:mga06r32_489969_c1 nmdc:mga06r32_489969_c1_170_922 247
1404 3300050510 nmdc:mga06r32_549401_c1 nmdc:mga06r32_549401_c1_111_863 247
1405 3300050511 nmdc:mga08y16_103236_c1 nmdc:mga08y16_103236_c1_662_1414 247
1406 3300050511 nmdc:mga08y16_143182_c1 nmdc:mga08y16_143182_c1_1207_1962 247
1407 3300050511 nmdc:mga08y16_224_c1 nmdc:mga08y16_224_c1_15837_16589 247
1408 3300050511 nmdc:mga08y16_26751_c1 nmdc:mga08y16_26751_c1_4602_5354 247
1409 3300050512 nmdc:mga0n895_105375_c1 nmdc:mga0n895_105375_c1_422_1174 247
1410 3300050512 nmdc:mga0n895_24213_c1 nmdc:mga0n895_24213_c1_4597_5352 247
1411 3300050512 nmdc:mga0n895_85508_c1 nmdc:mga0n895_85508_c1_2131_2883 247
1412 3300050513 nmdc:mga0rr50_70509_c1 nmdc:mga0rr50_70509_c1_1154_1906 247
1413 3300050514 nmdc:mga08x19_127824_c1 nmdc:mga08x19_127824_c1_276_1028 247
1414 3300050514 nmdc:mga08x19_4663_c1 nmdc:mga08x19_4663_c1_1640_2392 247
1415 3300050515 nmdc:mga0a205_183823_c1 nmdc:mga0a205_183823_c1_1028_1780 247
1416 3300050516 nmdc:mga0sz30_33559_c1 nmdc:mga0sz30_33559_c1_611_1354 247
1417 3300050516 nmdc:mga0sz30_5376_c1 nmdc:mga0sz30_5376_c1_3863_4606 247
1418 3300053080 Ga0500635_0014435 Ga0500635_0014435_14_766 247
1419 3300053085 Ga0495619_0161304 Ga0495619_0161304_688_1440 247
1420 3300053085 Ga0495619_0177792 Ga0495619_0177792_596_1339 247
1421 3300053087 Ga0500643_000373 Ga0500643_000373_33161_33904 247
1422 3300053091 Ga0500647_0019184 Ga0500647_0019184_1806_2549 247
1423 3300053091 Ga0500647_0128774 Ga0500647_0128774_84_836 247
1424 3300053093 Ga0500651_0008303 Ga0500651_0008303_3146_3901 247
1425 3300053094 Ga0500566_0000174 Ga0500566_0000174_1485_2228 247
1426 3300053098 Ga0500650_0027058 Ga0500650_0027058_1783_2526 247
1427 3300053104 Ga0500556_0076518 Ga0500556_0076518_365_1108 247
1428 3300053109 Ga0500569_037550 Ga0500569_037550_553_1296 247
1429 3300053121 Ga0500607_021746 Ga0500607_021746_2447_3190 247
1430 3300053130 Ga0500642_0000127 Ga0500642_0000127_3624_4367 247
1431 3300053130 Ga0500642_0007115 Ga0500642_0007115_464_1207 247
1432 3300053134 Ga0500658_0113169 Ga0500658_0113169_58_810 247
1433 3300053139 Ga0500568_0003938 Ga0500568_0003938_3299_4042 247
1434 3300053140 Ga0500573_0091335 Ga0500573_0091335_338_1090 247
1435 3300053148 Ga0500590_043953 Ga0500590_043953_318_1073 247
1436 3300053148 Ga0500590_098831 Ga0500590_098831_265_1017 247
1437 3300053153 Ga0500616_0028333 Ga0500616_0028333_713_1456 247
1438 3300053154 Ga0500619_000101 Ga0500619_000101_3587_4342 247
1439 3300053177 Ga0500636_0003003 Ga0500636_0003003_1901_2644 247
1440 3300053177 Ga0500636_0086701 Ga0500636_0086701_982_1734 247
1441 3300053177 Ga0500636_0264781 Ga0500636_0264781_98_850 247
1442 3300053729 Ga0500625_045973 Ga0500625_045973_135_1031 247
1443 3300053731 Ga0500609_002948 Ga0500609_002948_487_1230 247
1444 3300053737 Ga0500601_001110 Ga0500601_001110_109_852 247
1445 3300054114 Ga0501084_0002813 Ga0501084_0002813_5010_5762 247
1446 3300054114 Ga0501084_0033032 Ga0501084_0033032_3518_4270 247
1447 3300054114 Ga0501084_0044602 Ga0501084_0044602_348_1145 247
1448 3300054114 Ga0501084_0137678 Ga0501084_0137678_787_1539 247
1449 3300054114 Ga0501084_0188968 Ga0501084_0188968_758_1510 247
1450 3300054114 Ga0501084_0248698 Ga0501084_0248698_10_762 247
1451 3300054114 Ga0501084_0351688 Ga0501084_0351688_458_1210 247
1452 3300054114 Ga0501084_0413638 Ga0501084_0413638_244_1002 247
1453 3300060353 Ga0501082_0009986 Ga0501082_0009986_2765_3517 247
1454 3300060353 Ga0501082_0012212 Ga0501082_0012212_5633_6430 247
1455 3300060353 Ga0501082_0126553 Ga0501082_0126553_91_843 247
1456 3300060353 Ga0501082_0360815 Ga0501082_0360815_342_1094 247
1457 3300061734 Ga0530510_0040585 Ga0530510_0040585_990_1742 247
1458 3300061734 Ga0530510_0041312 Ga0530510_0041312_1442_2194 247
1459 3300061734 Ga0530510_0071132 Ga0530510_0071132_907_1659 247
1460 3300061734 Ga0530510_0241692 Ga0530510_0241692_85_837 247
1461 3300061734 Ga0530510_0506470 Ga0530510_0506470_64_816 247

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

52

243

0.93

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

58

290

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3grp-assembly1.cif.gz_D 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae 0.9659 6 242
3grp-assembly1.cif.gz_C 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae 0.9583 5 242
5cdy-assembly1.cif.gz_B the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9433 6 241
3gaf-assembly1.cif.gz_A 2.2a crystal structure of 7-alpha-hydroxysteroid dehydrogenase from brucella melitensis 0.943 1 241
4wk6-assembly1.cif.gz_C crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) (g141a) from vibrio cholerae in complex with nadph 0.9426 3 242
ID Description Score Start End Superfamily
3grpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9583 5 242 3.40.50.720
af_P0AET8_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9382 2 247 3.40.50.720
af_G5EGA6_1_260_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9366 6 245 3.40.50.720
af_P9WGQ5_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.935 1 243 3.40.50.720
3rihC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9347 3 247 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0S6US13-F1-model_v4 7-alpha-hydroxysteroid dehydrogenase 0.9918 1 247
AF-A0A0S6US13-F1-model_v4 7-alpha-hydroxysteroid dehydrogenase 0.9878 1 247
AF-A0A3P4B666-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase FabG (EC 1.1.1.100) 0.976 1 247 GO:0004316
AF-A0A1Q7I980-F1-model_v4 3-oxoacyl-ACP reductase 0.9759 1 172 GO:0016020
GO:0016491
AF-A0A1L3F6G0-F1-model_v4 3-oxoacyl-ACP reductase 0.9729 1 247

Feature Viewer

pLDDT pTM Quality
93.29 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map