F494133
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1461 | 645 | 1288 | 247 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0247653|Ga0466967_0247653_635_1519 |
| Length | 294 |
| Sequence | LLRLYFYFACKPVYPFPRTVAGYYIGGVHGAIGPESIRVRGSKQMDLELKSKAAVVTGASIGIGRAIAKGLALEGVRVVAVARRKDLLTALDEETRVAGGAPIIPVVQDIVQGDAATKLAATAVAELGHVDILVNNAGGSRPLPVDAPDRDWDEAIALNFTSYRKVAHALLPHMIERRWGRIINITGKSEPEGLNAAFAAKAAVHAWAKGLSREIGKYGITVNCIPPGRIMSEQIRRNYPEDYRKRFAEEEIPVGYWGEPEDLAALAVFLASPRARYVTGTVIPVDGGLRRYQF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 8 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 9 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 10 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 11 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 12 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 13 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 14 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 15 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 16 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 17 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 18 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 19 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 20 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 21 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 22 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 23 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 24 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 25 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 26 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 27 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 28 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 29 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 30 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 31 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 32 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 33 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 34 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 35 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 36 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 37 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 38 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 39 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 40 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 41 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 42 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 43 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 44 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 45 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 46 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 47 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 48 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 49 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 50 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 51 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 52 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 53 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 54 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 55 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 56 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 57 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 58 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 59 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 60 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 61 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 62 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 63 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 64 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 65 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 66 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 67 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 68 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 69 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 70 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 71 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 72 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 73 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 74 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 75 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 76 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 77 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 78 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 79 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 80 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 81 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 82 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 83 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 84 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 85 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 86 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 87 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 88 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 89 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 90 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 91 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 92 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 93 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 94 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 95 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 96 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 97 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 98 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 99 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 100 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 101 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 102 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 103 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 104 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 105 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 106 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 107 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 108 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 109 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 110 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 111 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 112 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 113 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 114 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 115 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 116 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 117 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 118 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 119 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 120 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 121 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 122 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 123 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 124 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 125 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 126 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 127 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 128 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 129 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 130 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 131 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 132 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 133 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 134 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 135 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 136 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 137 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 138 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 139 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 140 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 141 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 142 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 143 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 144 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 145 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 146 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 147 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 148 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 149 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 150 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 151 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 152 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 154 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 155 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 159 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 160 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 162 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 163 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 165 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 171 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 174 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 175 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 177 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 179 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 180 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 185 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 186 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 187 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 188 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 189 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 190 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 192 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 193 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 194 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 195 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 197 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 198 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 202 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 203 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 205 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 206 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 207 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 209 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 210 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 211 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 212 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 213 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 214 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 215 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 216 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 217 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 218 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 219 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 221 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 222 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 223 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 224 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 225 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 226 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 227 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 228 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 229 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 231 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 232 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 233 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 234 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 235 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 236 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 237 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 238 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 239 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 241 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 242 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 243 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 244 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 246 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 248 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 249 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 250 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 251 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 252 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 253 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 254 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 255 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 256 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 257 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 258 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 259 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 260 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 261 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 262 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 263 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 264 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 265 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 266 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 267 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 268 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 269 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 270 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 271 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 272 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 274 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 276 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 277 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 278 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 279 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 280 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 281 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 282 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 283 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 284 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 285 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 350 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 351 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 353 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 354 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 359 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 361 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 365 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 366 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 367 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 368 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 369 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 370 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 371 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 372 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 373 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 374 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 375 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 376 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 377 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 378 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 379 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 380 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 381 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 382 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 383 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 384 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 385 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 386 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 387 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 388 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 389 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 390 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 391 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 392 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 393 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 394 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 395 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 396 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 397 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 398 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 399 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 400 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 401 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 402 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 403 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 404 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 405 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 406 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 407 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 408 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 409 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 410 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 411 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 412 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 413 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 414 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 415 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 416 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 417 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 418 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 419 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 420 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 421 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 422 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 423 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 424 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 425 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 426 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 427 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 428 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 429 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 430 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 431 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 432 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 433 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 434 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 435 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 436 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 437 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 438 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 439 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 440 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 441 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 442 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 443 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 444 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 445 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 446 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 447 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 448 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 449 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 450 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 451 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 452 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 453 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 454 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 455 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 515 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 516 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 517 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 518 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 519 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 520 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 521 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 522 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 523 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 524 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 525 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 526 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 527 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 528 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 529 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 530 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 531 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 532 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 533 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 534 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 535 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 536 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 537 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 538 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 539 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 540 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 541 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 542 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 543 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 544 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 545 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 546 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 547 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 548 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 549 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 550 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 551 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 552 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 553 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 554 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 555 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 556 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 557 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 558 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 559 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 560 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 561 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 562 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 563 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 564 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 565 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 566 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 567 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 568 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 569 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 570 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 571 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 572 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 573 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 574 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 575 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 576 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 577 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 578 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 579 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 580 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 581 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 582 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 583 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 584 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 585 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 586 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 587 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 588 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 589 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 590 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 593 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 595 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 596 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 597 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 598 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 599 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 600 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 601 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 602 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 603 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 604 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 605 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 606 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 607 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 608 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 609 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 610 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 611 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 612 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 613 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 614 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 615 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 616 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 617 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 618 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 619 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 620 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 621 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 622 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 623 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 624 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 625 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 626 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 627 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 628 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 629 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 630 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 631 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 632 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 633 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 634 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 635 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 636 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 637 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 638 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 639 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 640 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 641 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 642 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 643 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 644 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 645 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.09 |
| Metatranscriptomes | 0.07 |
| Isolates | 11.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.98 |
| Nodule | 9.17 |
| Rhizoplane | 4.11 |
| Rhizosphere | 73.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10000317 | 3300003215 | Bacteria | 35509 |
| 2 | JGI25153J46596_10001194 | 3300003215 | Bacteria | 15699 |
| 3 | JGI25153J46596_10001553 | 3300003215 | Bacteria | 13646 |
| 4 | JGI25153J46596_10006579 | 3300003215 | Bacteria | 5858 |
| 5 | JGI25160J50197_1001548 | 3300003354 | Bacteria | 11381 |
| 6 | JGI25160J50197_1006813 | 3300003354 | Bacteria | 4574 |
| 7 | JGI25160J50197_1009493 | 3300003354 | Bacteria | 3603 |
| 8 | Ga0055540_1006236 | 3300003792 | Bacteria | 4784 |
| 9 | Ga0055531_10001449 | 3300003794 | Bacteria | 17511 |
| 10 | Ga0055543_1030343 | 3300004625 | Bacteria | 946 |
| 11 | Ga0065165_1000747 | 3300005262 | Bacteria | 44635 |
| 12 | Ga0065165_1001867 | 3300005262 | Bacteria | 20445 |
| 13 | Ga0065165_1005506 | 3300005262 | Bacteria | 7079 |
| 14 | Ga0065165_1022460 | 3300005262 | Bacteria | 2161 |
| 15 | Ga0070676_10021860 | 3300005328 | Bacteria | 3583 |
| 16 | Ga0070676_10081208 | 3300005328 | Bacteria | 1967 |
| 17 | Ga0070683_100012136 | 3300005329 | Bacteria | 7477 |
| 18 | Ga0070683_100012606 | 3300005329 | Bacteria | 7350 |
| 19 | Ga0070683_100043532 | 3300005329 | Bacteria | 4138 |
| 20 | Ga0070683_100143303 | 3300005329 | Bacteria | 2264 |
| 21 | Ga0070690_100053642 | 3300005330 | Bacteria | 2579 |
| 22 | Ga0070690_100154103 | 3300005330 | Bacteria | 1570 |
| 23 | Ga0070690_100571774 | 3300005330 | Bacteria | 854 |
| 24 | Ga0070670_100001648 | 3300005331 | Bacteria | 18088 |
| 25 | Ga0070670_100031103 | 3300005331 | Bacteria | 4597 |
| 26 | Ga0070670_100353565 | 3300005331 | Bacteria | 1291 |
| 27 | Ga0070677_10110921 | 3300005333 | Unclassified | 1224 |
| 28 | Ga0070666_10109371 | 3300005335 | Bacteria | 1910 |
| 29 | Ga0070680_100010478 | 3300005336 | Bacteria | 7148 |
| 30 | Ga0070680_100097733 | 3300005336 | Bacteria | 2435 |
| 31 | Ga0070680_100126238 | 3300005336 | Bacteria | 2138 |
| 32 | Ga0070680_100171076 | 3300005336 | Bacteria | 1828 |
| 33 | Ga0070680_100584232 | 3300005336 | Bacteria | 958 |
| 34 | Ga0070680_100603539 | 3300005336 | Bacteria | 942 |
| 35 | Ga0068868_100000130 | 3300005338 | Bacteria | 48331 |
| 36 | Ga0068868_100090667 | 3300005338 | Bacteria | 2462 |
| 37 | Ga0068868_100095768 | 3300005338 | Bacteria | 2396 |
| 38 | Ga0070660_100045797 | 3300005339 | Bacteria | 3350 |
| 39 | Ga0070660_100136044 | 3300005339 | Unclassified | 1969 |
| 40 | Ga0070689_100007535 | 3300005340 | Bacteria | 7619 |
| 41 | Ga0070689_100277453 | 3300005340 | Bacteria | 1389 |
| 42 | Ga0070691_10023957 | 3300005341 | Bacteria | 2835 |
| 43 | Ga0070691_10055300 | 3300005341 | Bacteria | 1901 |
| 44 | Ga0070691_10101246 | 3300005341 | Bacteria | 1431 |
| 45 | Ga0070691_10106762 | 3300005341 | Unclassified | 1396 |
| 46 | Ga0070691_10144072 | 3300005341 | Bacteria | 1217 |
| 47 | Ga0070691_10186388 | 3300005341 | Bacteria | 1083 |
| 48 | Ga0070661_100086188 | 3300005344 | Bacteria | 2322 |
| 49 | Ga0070692_10264143 | 3300005345 | Bacteria | 1036 |
| 50 | Ga0070668_100002013 | 3300005347 | Bacteria | 14865 |
| 51 | Ga0070675_100006171 | 3300005354 | Bacteria | 9188 |
| 52 | Ga0070671_100000330 | 3300005355 | Bacteria | 32427 |
| 53 | Ga0070671_100013367 | 3300005355 | Bacteria | 6617 |
| 54 | Ga0070671_100023957 | 3300005355 | Bacteria | 4994 |
| 55 | Ga0070674_100034983 | 3300005356 | Bacteria | 3360 |
| 56 | Ga0070674_100061051 | 3300005356 | Bacteria | 2629 |
| 57 | Ga0070673_100000435 | 3300005364 | Bacteria | 22065 |
| 58 | Ga0070673_100043909 | 3300005364 | Bacteria | 3458 |
| 59 | Ga0070673_100185130 | 3300005364 | Bacteria | 1785 |
| 60 | Ga0070673_100652908 | 3300005364 | Bacteria | 963 |
| 61 | Ga0070673_100836141 | 3300005364 | Bacteria | 851 |
| 62 | Ga0070673_100945760 | 3300005364 | Bacteria | 800 |
| 63 | Ga0070688_100151679 | 3300005365 | Bacteria | 1585 |
| 64 | Ga0070688_100522181 | 3300005365 | Bacteria | 899 |
| 65 | Ga0070659_100091369 | 3300005366 | Unclassified | 2440 |
| 66 | Ga0070659_100107110 | 3300005366 | Bacteria | 2254 |
| 67 | Ga0070667_100020332 | 3300005367 | Bacteria | 5511 |
| 68 | Ga0070667_100038796 | 3300005367 | Bacteria | 3993 |
| 69 | Ga0070667_100266954 | 3300005367 | Bacteria | 1533 |
| 70 | Ga0070667_100335592 | 3300005367 | Bacteria | 1366 |
| 71 | Ga0070703_10001535 | 3300005406 | Bacteria | 6889 |
| 72 | Ga0070703_10042987 | 3300005406 | Bacteria | 1415 |
| 73 | Ga0070709_10083482 | 3300005434 | Bacteria | 2090 |
| 74 | Ga0070709_10446400 | 3300005434 | Bacteria | 974 |
| 75 | Ga0070714_100165838 | 3300005435 | Bacteria | 2002 |
| 76 | Ga0070714_100257950 | 3300005435 | Bacteria | 1614 |
| 77 | Ga0070701_10013024 | 3300005438 | Bacteria | 3773 |
| 78 | Ga0070705_100000415 | 3300005440 | Bacteria | 24569 |
| 79 | Ga0070705_100003253 | 3300005440 | Bacteria | 7985 |
| 80 | Ga0070705_100040925 | 3300005440 | Bacteria | 2639 |
| 81 | Ga0070700_100002043 | 3300005441 | Bacteria | 10255 |
| 82 | Ga0070700_100074201 | 3300005441 | Bacteria | 2179 |
| 83 | Ga0070700_100273059 | 3300005441 | Bacteria | 1222 |
| 84 | Ga0070700_100554647 | 3300005441 | Bacteria | 893 |
| 85 | Ga0070700_100656663 | 3300005441 | Bacteria | 829 |
| 86 | Ga0070694_100004365 | 3300005444 | Bacteria | 8504 |
| 87 | Ga0070708_100288576 | 3300005445 | Bacteria | 1545 |
| 88 | Ga0070708_100492230 | 3300005445 | Bacteria | 1157 |
| 89 | Ga0070708_100943617 | 3300005445 | Bacteria | 809 |
| 90 | Ga0070663_100125193 | 3300005455 | Unclassified | 1946 |
| 91 | Ga0070663_100130104 | 3300005455 | Bacteria | 1911 |
| 92 | Ga0070663_100353265 | 3300005455 | Bacteria | 1191 |
| 93 | Ga0070678_100000210 | 3300005456 | Bacteria | 26068 |
| 94 | Ga0070678_100622561 | 3300005456 | Bacteria | 966 |
| 95 | Ga0070678_100926828 | 3300005456 | Bacteria | 797 |
| 96 | Ga0070662_100048811 | 3300005457 | Bacteria | 3051 |
| 97 | Ga0070662_100217259 | 3300005457 | Bacteria | 1524 |
| 98 | Ga0070681_10000916 | 3300005458 | Bacteria | 24937 |
| 99 | Ga0070681_10009637 | 3300005458 | Bacteria | 9499 |
| 100 | Ga0070681_10016908 | 3300005458 | Bacteria | 7287 |
| 101 | Ga0070681_10029114 | 3300005458 | Bacteria | 5545 |
| 102 | Ga0070681_10110336 | 3300005458 | Bacteria | 2691 |
| 103 | Ga0070681_10334996 | 3300005458 | Bacteria | 1423 |
| 104 | Ga0068867_100001160 | 3300005459 | Bacteria | 18024 |
| 105 | Ga0068867_100004550 | 3300005459 | Bacteria | 9752 |
| 106 | Ga0068867_100009475 | 3300005459 | Bacteria | 6867 |
| 107 | Ga0068867_100125954 | 3300005459 | Bacteria | 1985 |
| 108 | Ga0068867_100145606 | 3300005459 | Bacteria | 1856 |
| 109 | Ga0070685_10081051 | 3300005466 | Bacteria | 1945 |
| 110 | Ga0070706_100009522 | 3300005467 | Bacteria | 9033 |
| 111 | Ga0070706_100360060 | 3300005467 | Bacteria | 1356 |
| 112 | Ga0070707_100272154 | 3300005468 | Bacteria | 1646 |
| 113 | Ga0070707_100452880 | 3300005468 | Bacteria | 1244 |
| 114 | Ga0070698_100685423 | 3300005471 | Bacteria | 967 |
| 115 | Ga0070699_100000540 | 3300005518 | Bacteria | 35757 |
| 116 | Ga0070699_100076883 | 3300005518 | Bacteria | 2906 |
| 117 | Ga0070699_100256617 | 3300005518 | Bacteria | 1563 |
| 118 | Ga0070699_100446089 | 3300005518 | Bacteria | 1173 |
| 119 | Ga0070679_100003976 | 3300005530 | Bacteria | 13614 |
| 120 | Ga0070679_100014503 | 3300005530 | Bacteria | 7570 |
| 121 | Ga0070679_100020326 | 3300005530 | Bacteria | 6471 |
| 122 | Ga0070679_100045886 | 3300005530 | Bacteria | 4354 |
| 123 | Ga0070679_100091564 | 3300005530 | Bacteria | 3029 |
| 124 | Ga0070679_100130755 | 3300005530 | Bacteria | 2492 |
| 125 | Ga0070679_100246724 | 3300005530 | Bacteria | 1742 |
| 126 | Ga0070684_100007833 | 3300005535 | Bacteria | 8332 |
| 127 | Ga0070684_100031860 | 3300005535 | Bacteria | 4491 |
| 128 | Ga0070684_100054337 | 3300005535 | Bacteria | 3490 |
| 129 | Ga0070684_100067650 | 3300005535 | Bacteria | 3139 |
| 130 | Ga0070697_100035192 | 3300005536 | Bacteria | 4039 |
| 131 | Ga0070697_100043526 | 3300005536 | Bacteria | 3636 |
| 132 | Ga0070697_100069550 | 3300005536 | Bacteria | 2884 |
| 133 | Ga0070697_100103170 | 3300005536 | Bacteria | 2370 |
| 134 | Ga0068853_100003330 | 3300005539 | Bacteria | 12297 |
| 135 | Ga0068853_100032207 | 3300005539 | Bacteria | 4440 |
| 136 | Ga0068853_100089144 | 3300005539 | Bacteria | 2709 |
| 137 | Ga0068853_100323594 | 3300005539 | Bacteria | 1430 |
| 138 | Ga0068853_100573906 | 3300005539 | Bacteria | 1070 |
| 139 | Ga0070672_100003927 | 3300005543 | Bacteria | 9689 |
| 140 | Ga0070672_100112495 | 3300005543 | Bacteria | 2221 |
| 141 | Ga0070686_100017229 | 3300005544 | Bacteria | 4218 |
| 142 | Ga0070695_100000710 | 3300005545 | Bacteria | 17788 |
| 143 | Ga0070695_100004325 | 3300005545 | Bacteria | 8317 |
| 144 | Ga0070695_100015228 | 3300005545 | Bacteria | 4641 |
| 145 | Ga0070695_100019895 | 3300005545 | Bacteria | 4094 |
| 146 | Ga0070695_100153996 | 3300005545 | Bacteria | 1607 |
| 147 | Ga0070696_100007039 | 3300005546 | Bacteria | 7509 |
| 148 | Ga0070696_100022290 | 3300005546 | Bacteria | 4301 |
| 149 | Ga0070696_100105155 | 3300005546 | Bacteria | 2027 |
| 150 | Ga0070696_100199053 | 3300005546 | Bacteria | 1495 |
| 151 | Ga0070696_100257062 | 3300005546 | Bacteria | 1323 |
| 152 | Ga0070693_100086881 | 3300005547 | Bacteria | 1877 |
| 153 | Ga0070665_100071086 | 3300005548 | Bacteria | 3486 |
| 154 | Ga0070665_100128570 | 3300005548 | Bacteria | 2536 |
| 155 | Ga0070665_100187732 | 3300005548 | Bacteria | 2068 |
| 156 | Ga0070704_100000882 | 3300005549 | Bacteria | 15016 |
| 157 | Ga0070704_100356747 | 3300005549 | Bacteria | 1236 |
| 158 | Ga0070704_100438904 | 3300005549 | Bacteria | 1122 |
| 159 | Ga0068855_100007560 | 3300005563 | Bacteria | 13147 |
| 160 | Ga0068855_100178130 | 3300005563 | Bacteria | 2404 |
| 161 | Ga0068855_100196793 | 3300005563 | Bacteria | 2270 |
| 162 | Ga0068855_100216276 | 3300005563 | Bacteria | 2151 |
| 163 | Ga0068855_100467097 | 3300005563 | Bacteria | 1375 |
| 164 | Ga0068855_100876680 | 3300005563 | Bacteria | 949 |
| 165 | Ga0070664_100026818 | 3300005564 | Bacteria | 4784 |
| 166 | Ga0068857_100002616 | 3300005577 | Bacteria | 14779 |
| 167 | Ga0068857_100010399 | 3300005577 | Bacteria | 8086 |
| 168 | Ga0068857_100022493 | 3300005577 | Bacteria | 5547 |
| 169 | Ga0068857_100091731 | 3300005577 | Bacteria | 2719 |
| 170 | Ga0068857_100395140 | 3300005577 | Bacteria | 1286 |
| 171 | Ga0068854_100007298 | 3300005578 | Bacteria | 7061 |
| 172 | Ga0068854_100126259 | 3300005578 | Bacteria | 1949 |
| 173 | Ga0068856_100011621 | 3300005614 | Bacteria | 8539 |
| 174 | Ga0068856_100018079 | 3300005614 | Bacteria | 6834 |
| 175 | Ga0068856_100242713 | 3300005614 | Bacteria | 1817 |
| 176 | Ga0068856_100334605 | 3300005614 | Bacteria | 1532 |
| 177 | Ga0070702_100068615 | 3300005615 | Bacteria | 2087 |
| 178 | Ga0068852_100000400 | 3300005616 | Bacteria | 29058 |
| 179 | Ga0068852_100047090 | 3300005616 | Bacteria | 3676 |
| 180 | Ga0068852_100156552 | 3300005616 | Bacteria | 2123 |
| 181 | Ga0068852_100220473 | 3300005616 | Bacteria | 1804 |
| 182 | Ga0068852_100360105 | 3300005616 | Bacteria | 1423 |
| 183 | Ga0068852_100713371 | 3300005616 | Bacteria | 1013 |
| 184 | Ga0068859_100001347 | 3300005617 | Bacteria | 25058 |
| 185 | Ga0068859_100004592 | 3300005617 | Bacteria | 14085 |
| 186 | Ga0068859_100066061 | 3300005617 | Bacteria | 3652 |
| 187 | Ga0068859_100157942 | 3300005617 | Bacteria | 2346 |
| 188 | Ga0068859_100274500 | 3300005617 | Bacteria | 1778 |
| 189 | Ga0068859_100290213 | 3300005617 | Bacteria | 1729 |
| 190 | Ga0068859_101082384 | 3300005617 | Bacteria | 881 |
| 191 | Ga0068864_100001786 | 3300005618 | Bacteria | 17662 |
| 192 | Ga0068864_100023054 | 3300005618 | Bacteria | 5226 |
| 193 | Ga0068864_100309664 | 3300005618 | Bacteria | 1480 |
| 194 | Ga0068864_101007163 | 3300005618 | Bacteria | 826 |
| 195 | Ga0068861_100002626 | 3300005719 | Bacteria | 11748 |
| 196 | Ga0068861_100019221 | 3300005719 | Bacteria | 4881 |
| 197 | Ga0068861_100230289 | 3300005719 | Bacteria | 1571 |
| 198 | Ga0068861_100340735 | 3300005719 | Bacteria | 1312 |
| 199 | Ga0068861_100644440 | 3300005719 | Bacteria | 978 |
| 200 | Ga0068870_10035490 | 3300005840 | Bacteria | 2559 |
| 201 | Ga0068870_10135581 | 3300005840 | Bacteria | 1435 |
| 202 | Ga0068863_100025164 | 3300005841 | Bacteria | 5676 |
| 203 | Ga0068863_100039160 | 3300005841 | Bacteria | 4510 |
| 204 | Ga0068863_100177172 | 3300005841 | Bacteria | 2046 |
| 205 | Ga0068863_100759500 | 3300005841 | Bacteria | 966 |
| 206 | Ga0068863_101054922 | 3300005841 | Bacteria | 816 |
| 207 | Ga0068858_100005298 | 3300005842 | Bacteria | 12648 |
| 208 | Ga0068858_100421503 | 3300005842 | Bacteria | 1283 |
| 209 | Ga0068860_100006411 | 3300005843 | Bacteria | 11811 |
| 210 | Ga0068860_100043129 | 3300005843 | Bacteria | 4305 |
| 211 | Ga0068860_100142367 | 3300005843 | Bacteria | 2305 |
| 212 | Ga0068860_100386754 | 3300005843 | Bacteria | 1382 |
| 213 | Ga0068862_100032090 | 3300005844 | Bacteria | 4437 |
| 214 | Ga0068862_100108368 | 3300005844 | Bacteria | 2436 |
| 215 | Ga0068862_100171477 | 3300005844 | Bacteria | 1943 |
| 216 | Ga0081540_1000455 | 3300005983 | Bacteria | 40662 |
| 217 | Ga0081540_1019188 | 3300005983 | Bacteria | 4166 |
| 218 | Ga0081539_10002630 | 3300005985 | Bacteria | 24552 |
| 219 | Ga0070717_10001973 | 3300006028 | Bacteria | 14345 |
| 220 | Ga0075368_10000176 | 3300006042 | Bacteria | 17416 |
| 221 | Ga0075368_10008020 | 3300006042 | Bacteria | 3745 |
| 222 | Ga0075363_100006512 | 3300006048 | Bacteria | 5312 |
| 223 | Ga0075363_100008153 | 3300006048 | Bacteria | 4863 |
| 224 | Ga0075363_100011597 | 3300006048 | Bacteria | 4225 |
| 225 | Ga0075363_100202052 | 3300006048 | Bacteria | 1136 |
| 226 | Ga0075364_10000375 | 3300006051 | Bacteria | 22017 |
| 227 | Ga0070715_10099188 | 3300006163 | Bacteria | 1355 |
| 228 | Ga0070716_100204847 | 3300006173 | Bacteria | 1314 |
| 229 | Ga0070712_100160328 | 3300006175 | Bacteria | 1736 |
| 230 | Ga0075362_10120141 | 3300006177 | Bacteria | 1243 |
| 231 | Ga0075367_10000439 | 3300006178 | Bacteria | 15444 |
| 232 | Ga0075367_10012388 | 3300006178 | Bacteria | 4544 |
| 233 | Ga0075366_10008178 | 3300006195 | Bacteria | 5803 |
| 234 | Ga0075366_10016147 | 3300006195 | Bacteria | 4288 |
| 235 | Ga0075366_10044599 | 3300006195 | Bacteria | 2628 |
| 236 | Ga0075366_10307762 | 3300006195 | Bacteria | 970 |
| 237 | Ga0097621_100001929 | 3300006237 | Bacteria | 14157 |
| 238 | Ga0097621_100009529 | 3300006237 | Bacteria | 7052 |
| 239 | Ga0097621_100174203 | 3300006237 | Bacteria | 1856 |
| 240 | Ga0068871_100419030 | 3300006358 | Bacteria | 1195 |
| 241 | Ga0068871_100742920 | 3300006358 | Bacteria | 901 |
| 242 | Ga0068871_100757569 | 3300006358 | Bacteria | 893 |
| 243 | Ga0075428_100003812 | 3300006844 | Bacteria | 16545 |
| 244 | Ga0075428_100105066 | 3300006844 | Bacteria | 3080 |
| 245 | Ga0075428_100236451 | 3300006844 | Bacteria | 1971 |
| 246 | Ga0075428_100276416 | 3300006844 | Bacteria | 1807 |
| 247 | Ga0075430_100010264 | 3300006846 | Bacteria | 7930 |
| 248 | Ga0075430_100077969 | 3300006846 | Bacteria | 2778 |
| 249 | Ga0075430_100226041 | 3300006846 | Bacteria | 1552 |
| 250 | Ga0075431_100006349 | 3300006847 | Bacteria | 11742 |
| 251 | Ga0075431_100094748 | 3300006847 | Bacteria | 3081 |
| 252 | Ga0075431_100291433 | 3300006847 | Bacteria | 1651 |
| 253 | Ga0075431_100325936 | 3300006847 | Bacteria | 1548 |
| 254 | Ga0075431_100592979 | 3300006847 | Bacteria | 1093 |
| 255 | Ga0075433_10006970 | 3300006852 | Bacteria | 8959 |
| 256 | Ga0075433_10173759 | 3300006852 | Bacteria | 1917 |
| 257 | Ga0075434_100001148 | 3300006871 | Bacteria | 21880 |
| 258 | Ga0075434_100344115 | 3300006871 | Bacteria | 1512 |
| 259 | Ga0075434_100404736 | 3300006871 | Bacteria | 1386 |
| 260 | Ga0075429_100023937 | 3300006880 | Bacteria | 5298 |
| 261 | Ga0075429_100040854 | 3300006880 | Bacteria | 4038 |
| 262 | Ga0075429_100086654 | 3300006880 | Bacteria | 2729 |
| 263 | Ga0075429_100243255 | 3300006880 | Bacteria | 1576 |
| 264 | Ga0068865_100116100 | 3300006881 | Bacteria | 1982 |
| 265 | Ga0068865_100293563 | 3300006881 | Bacteria | 1298 |
| 266 | Ga0075436_100000431 | 3300006914 | Bacteria | 26895 |
| 267 | Ga0075436_100001883 | 3300006914 | Bacteria | 14419 |
| 268 | Ga0075436_100002000 | 3300006914 | Bacteria | 14080 |
| 269 | Ga0075436_100039926 | 3300006914 | Bacteria | 3238 |
| 270 | Ga0075436_100050676 | 3300006914 | Bacteria | 2865 |
| 271 | Ga0075436_100055807 | 3300006914 | Bacteria | 2728 |
| 272 | Ga0097620_100001347 | 3300006931 | Bacteria | 25058 |
| 273 | Ga0097620_100004592 | 3300006931 | Bacteria | 14085 |
| 274 | Ga0097620_100066063 | 3300006931 | Bacteria | 3652 |
| 275 | Ga0097620_100157952 | 3300006931 | Bacteria | 2346 |
| 276 | Ga0097620_100274485 | 3300006931 | Bacteria | 1778 |
| 277 | Ga0097620_100290207 | 3300006931 | Bacteria | 1729 |
| 278 | Ga0097620_101082357 | 3300006931 | Bacteria | 881 |
| 279 | Ga0099824_1014958 | 3300006942 | Bacteria | 7524 |
| 280 | Ga0075435_100001283 | 3300007076 | Bacteria | 16141 |
| 281 | Ga0075435_100014770 | 3300007076 | Bacteria | 5852 |
| 282 | Ga0075435_100015371 | 3300007076 | Bacteria | 5753 |
| 283 | Ga0075435_100107534 | 3300007076 | Bacteria | 2317 |
| 284 | Ga0099794_10011812 | 3300007265 | Bacteria | 3751 |
| 285 | Ga0099794_10051542 | 3300007265 | Bacteria | 1981 |
| 286 | Ga0105240_10045969 | 3300009093 | Bacteria | 5535 |
| 287 | Ga0105240_10061780 | 3300009093 | Bacteria | 4667 |
| 288 | Ga0105240_10119203 | 3300009093 | Bacteria | 3179 |
| 289 | Ga0105240_10128638 | 3300009093 | Bacteria | 3040 |
| 290 | Ga0105240_10185517 | 3300009093 | Bacteria | 2450 |
| 291 | Ga0105240_10354189 | 3300009093 | Bacteria | 1664 |
| 292 | Ga0111539_10001755 | 3300009094 | Bacteria | 28803 |
| 293 | Ga0111539_10023402 | 3300009094 | Bacteria | 7589 |
| 294 | Ga0111539_10046787 | 3300009094 | Bacteria | 5174 |
| 295 | Ga0111539_10117520 | 3300009094 | Bacteria | 3117 |
| 296 | Ga0111539_10156457 | 3300009094 | Bacteria | 2667 |
| 297 | Ga0111539_10300993 | 3300009094 | Bacteria | 1866 |
| 298 | Ga0111539_10613135 | 3300009094 | Bacteria | 1267 |
| 299 | Ga0111539_10983089 | 3300009094 | Bacteria | 981 |
| 300 | Ga0111539_10989820 | 3300009094 | Bacteria | 978 |
| 301 | Ga0111539_11059332 | 3300009094 | Bacteria | 942 |
| 302 | Ga0111539_11081060 | 3300009094 | Bacteria | 932 |
| 303 | Ga0111539_11318560 | 3300009094 | Bacteria | 838 |
| 304 | Ga0105245_10000086 | 3300009098 | Bacteria | 93019 |
| 305 | Ga0105245_10290624 | 3300009098 | Bacteria | 1601 |
| 306 | Ga0105245_10938520 | 3300009098 | Bacteria | 908 |
| 307 | Ga0114129_10151243 | 3300009147 | Bacteria | 3176 |
| 308 | Ga0114129_10339853 | 3300009147 | Bacteria | 1991 |
| 309 | Ga0114129_10762280 | 3300009147 | Bacteria | 1238 |
| 310 | Ga0105243_10000360 | 3300009148 | Bacteria | 48717 |
| 311 | Ga0105243_10008145 | 3300009148 | Bacteria | 8047 |
| 312 | Ga0105243_10311275 | 3300009148 | Bacteria | 1431 |
| 313 | Ga0105241_10003630 | 3300009174 | Bacteria | 11467 |
| 314 | Ga0105241_10012445 | 3300009174 | Bacteria | 6236 |
| 315 | Ga0105241_10020398 | 3300009174 | Bacteria | 4897 |
| 316 | Ga0105241_10115152 | 3300009174 | Bacteria | 2158 |
| 317 | Ga0105241_10749501 | 3300009174 | Bacteria | 895 |
| 318 | Ga0105242_10003774 | 3300009176 | Bacteria | 11777 |
| 319 | Ga0105242_10012096 | 3300009176 | Bacteria | 6640 |
| 320 | Ga0105242_10241689 | 3300009176 | Bacteria | 1623 |
| 321 | Ga0105242_10292686 | 3300009176 | Unclassified | 1483 |
| 322 | Ga0105248_10044422 | 3300009177 | Bacteria | 4982 |
| 323 | Ga0105248_10160072 | 3300009177 | Bacteria | 2540 |
| 324 | Ga0105248_10541737 | 3300009177 | Bacteria | 1313 |
| 325 | Ga0105248_11315078 | 3300009177 | Bacteria | 818 |
| 326 | Ga0105237_10016707 | 3300009545 | Bacteria | 7619 |
| 327 | Ga0105237_10019921 | 3300009545 | Bacteria | 6926 |
| 328 | Ga0105237_10047919 | 3300009545 | Bacteria | 4297 |
| 329 | Ga0105237_10175693 | 3300009545 | Bacteria | 2142 |
| 330 | Ga0105237_10177319 | 3300009545 | Bacteria | 2131 |
| 331 | Ga0105237_10179144 | 3300009545 | Bacteria | 2120 |
| 332 | Ga0105238_10013345 | 3300009551 | Bacteria | 8287 |
| 333 | Ga0105238_10051160 | 3300009551 | Bacteria | 4155 |
| 334 | Ga0105238_10116350 | 3300009551 | Bacteria | 2653 |
| 335 | Ga0105238_10352274 | 3300009551 | Bacteria | 1461 |
| 336 | Ga0105238_10882833 | 3300009551 | Bacteria | 912 |
| 337 | Ga0105249_10000690 | 3300009553 | Bacteria | 30677 |
| 338 | Ga0105249_10002066 | 3300009553 | Bacteria | 17401 |
| 339 | Ga0105249_10011943 | 3300009553 | Bacteria | 7639 |
| 340 | Ga0105249_10673243 | 3300009553 | Bacteria | 1093 |
| 341 | Ga0099796_10143275 | 3300010159 | Bacteria | 935 |
| 342 | Ga0105239_10025561 | 3300010375 | Bacteria | 6500 |
| 343 | Ga0105239_10114449 | 3300010375 | Bacteria | 2992 |
| 344 | Ga0105239_10270013 | 3300010375 | Bacteria | 1913 |
| 345 | Ga0105239_10626865 | 3300010375 | Bacteria | 1227 |
| 346 | Ga0105239_10728912 | 3300010375 | Bacteria | 1134 |
| 347 | Ga0157370_10037070 | 3300013104 | Bacteria | 4728 |
| 348 | Ga0157370_10059717 | 3300013104 | Bacteria | 3623 |
| 349 | Ga0157370_10112112 | 3300013104 | Bacteria | 2549 |
| 350 | Ga0157370_10865256 | 3300013104 | Bacteria | 821 |
| 351 | Ga0157369_10022801 | 3300013105 | Bacteria | 6981 |
| 352 | Ga0157369_10082359 | 3300013105 | Bacteria | 3442 |
| 353 | Ga0157369_10120684 | 3300013105 | Bacteria | 2782 |
| 354 | Ga0157374_10002510 | 3300013296 | Bacteria | 15487 |
| 355 | Ga0157374_10009522 | 3300013296 | Bacteria | 8341 |
| 356 | Ga0157374_10102381 | 3300013296 | Bacteria | 2746 |
| 357 | Ga0157378_10001516 | 3300013297 | Bacteria | 21037 |
| 358 | Ga0157378_10004019 | 3300013297 | Bacteria | 12985 |
| 359 | Ga0157378_10009382 | 3300013297 | Bacteria | 8525 |
| 360 | Ga0163162_10039487 | 3300013306 | Bacteria | 4717 |
| 361 | Ga0163162_10150206 | 3300013306 | Bacteria | 2447 |
| 362 | Ga0163162_10254169 | 3300013306 | Bacteria | 1889 |
| 363 | Ga0163162_10311474 | 3300013306 | Bacteria | 1707 |
| 364 | Ga0163162_10333361 | 3300013306 | Bacteria | 1650 |
| 365 | Ga0163162_10374774 | 3300013306 | Bacteria | 1556 |
| 366 | Ga0163162_10502740 | 3300013306 | Bacteria | 1342 |
| 367 | Ga0157372_10061585 | 3300013307 | Bacteria | 4202 |
| 368 | Ga0157375_10026695 | 3300013308 | Bacteria | 5387 |
| 369 | Ga0157375_10040858 | 3300013308 | Bacteria | 4474 |
| 370 | Ga0157375_10091204 | 3300013308 | Bacteria | 3108 |
| 371 | Ga0157375_10139603 | 3300013308 | Bacteria | 2549 |
| 372 | Ga0157375_11065180 | 3300013308 | Bacteria | 945 |
| 373 | Ga0157375_11114810 | 3300013308 | Bacteria | 924 |
| 374 | Ga0163163_10051526 | 3300014325 | Bacteria | 4059 |
| 375 | Ga0163163_10860553 | 3300014325 | Bacteria | 970 |
| 376 | Ga0157380_10015244 | 3300014326 | Bacteria | 5645 |
| 377 | Ga0157380_10039123 | 3300014326 | Bacteria | 3686 |
| 378 | Ga0157380_10050244 | 3300014326 | Bacteria | 3293 |
| 379 | Ga0157380_10079215 | 3300014326 | Bacteria | 2683 |
| 380 | Ga0157380_10195562 | 3300014326 | Bacteria | 1789 |
| 381 | Ga0157380_10329298 | 3300014326 | Bacteria | 1420 |
| 382 | Ga0157377_10037174 | 3300014745 | Bacteria | 2682 |
| 383 | Ga0157377_10048220 | 3300014745 | Bacteria | 2389 |
| 384 | Ga0157376_10002221 | 3300014969 | Bacteria | 13093 |
| 385 | Ga0157376_10008104 | 3300014969 | Bacteria | 7551 |
| 386 | Ga0157376_10020365 | 3300014969 | Bacteria | 5129 |
| 387 | Ga0157376_10061439 | 3300014969 | Bacteria | 3158 |
| 388 | Ga0157376_11159622 | 3300014969 | Bacteria | 800 |
| 389 | Ga0163161_10094745 | 3300017792 | Bacteria | 2214 |
| 390 | Ga0197907_10076814 | 3300020069 | Bacteria | 1344 |
| 391 | Ga0213872_10050831 | 3300021361 | Bacteria | 1881 |
| 392 | Ga0213876_10002898 | 3300021384 | Bacteria | 9954 |
| 393 | Ga0213876_10003579 | 3300021384 | Bacteria | 8838 |
| 394 | Ga0213876_10027678 | 3300021384 | Bacteria | 2990 |
| 395 | Ga0213875_10012736 | 3300021388 | Bacteria | 4141 |
| 396 | Ga0209563_104872 | 3300025230 | Bacteria | 2509 |
| 397 | Ga0207425_1010355 | 3300025245 | Bacteria | 2273 |
| 398 | Ga0209677_104551 | 3300025253 | Bacteria | 3951 |
| 399 | Ga0209148_1000479 | 3300025254 | Bacteria | 42062 |
| 400 | Ga0209233_1005481 | 3300025261 | Bacteria | 4204 |
| 401 | Ga0209233_1022311 | 3300025261 | Bacteria | 1623 |
| 402 | Ga0209455_1000521 | 3300025272 | Bacteria | 27243 |
| 403 | Ga0209673_1019247 | 3300025273 | Bacteria | 2457 |
| 404 | Ga0209564_1007463 | 3300025295 | Bacteria | 5643 |
| 405 | Ga0209564_1048876 | 3300025295 | Bacteria | 1052 |
| 406 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 407 | Ga0209758_1000120 | 3300025297 | Bacteria | 192212 |
| 408 | Ga0209758_1003647 | 3300025297 | Bacteria | 13738 |
| 409 | Ga0209758_1005738 | 3300025297 | Bacteria | 9349 |
| 410 | Ga0209256_1001013 | 3300025299 | Bacteria | 33164 |
| 411 | Ga0209256_1020612 | 3300025299 | Bacteria | 2052 |
| 412 | Ga0207426_1000458 | 3300025302 | Bacteria | 64019 |
| 413 | Ga0207426_1001355 | 3300025302 | Bacteria | 20765 |
| 414 | Ga0207426_1003487 | 3300025302 | Bacteria | 8493 |
| 415 | Ga0207426_1033497 | 3300025302 | Bacteria | 1656 |
| 416 | Ga0209051_1000369 | 3300025303 | Bacteria | 64656 |
| 417 | Ga0209257_1000317 | 3300025304 | Bacteria | 101723 |
| 418 | Ga0209257_1001101 | 3300025304 | Bacteria | 35153 |
| 419 | Ga0207656_10114613 | 3300025321 | Bacteria | 1249 |
| 420 | Ga0207653_10006836 | 3300025885 | Bacteria | 3562 |
| 421 | Ga0207682_10050609 | 3300025893 | Bacteria | 1718 |
| 422 | Ga0207682_10104079 | 3300025893 | Unclassified | 1244 |
| 423 | Ga0207642_10038003 | 3300025899 | Bacteria | 2079 |
| 424 | Ga0207642_10072559 | 3300025899 | Bacteria | 1643 |
| 425 | Ga0207710_10249368 | 3300025900 | Bacteria | 887 |
| 426 | Ga0207688_10005840 | 3300025901 | Bacteria | 6698 |
| 427 | Ga0207688_10064140 | 3300025901 | Bacteria | 2073 |
| 428 | Ga0207688_10115519 | 3300025901 | Unclassified | 1562 |
| 429 | Ga0207647_10080520 | 3300025904 | Bacteria | 1953 |
| 430 | Ga0207685_10078916 | 3300025905 | Bacteria | 1356 |
| 431 | Ga0207699_10018431 | 3300025906 | Bacteria | 3699 |
| 432 | Ga0207699_10247025 | 3300025906 | Bacteria | 1228 |
| 433 | Ga0207645_10019696 | 3300025907 | Bacteria | 4422 |
| 434 | Ga0207645_10042608 | 3300025907 | Bacteria | 2904 |
| 435 | Ga0207645_10070534 | 3300025907 | Bacteria | 2235 |
| 436 | Ga0207643_10038546 | 3300025908 | Bacteria | 2684 |
| 437 | Ga0207643_10040021 | 3300025908 | Bacteria | 2638 |
| 438 | Ga0207643_10047192 | 3300025908 | Bacteria | 2436 |
| 439 | Ga0207705_10050894 | 3300025909 | Bacteria | 2982 |
| 440 | Ga0207705_10100427 | 3300025909 | Bacteria | 2128 |
| 441 | Ga0207705_10375523 | 3300025909 | Bacteria | 1098 |
| 442 | Ga0207684_10101583 | 3300025910 | Bacteria | 2459 |
| 443 | Ga0207684_10213044 | 3300025910 | Bacteria | 1666 |
| 444 | Ga0207654_10022029 | 3300025911 | Bacteria | 3395 |
| 445 | Ga0207707_10000886 | 3300025912 | Bacteria | 29266 |
| 446 | Ga0207707_10001576 | 3300025912 | Bacteria | 21009 |
| 447 | Ga0207707_10001907 | 3300025912 | Bacteria | 18977 |
| 448 | Ga0207707_10031180 | 3300025912 | Bacteria | 4664 |
| 449 | Ga0207707_10036585 | 3300025912 | Bacteria | 4291 |
| 450 | Ga0207707_10105975 | 3300025912 | Bacteria | 2457 |
| 451 | Ga0207707_10223411 | 3300025912 | Bacteria | 1639 |
| 452 | Ga0207707_10224565 | 3300025912 | Bacteria | 1635 |
| 453 | Ga0207707_10272849 | 3300025912 | Bacteria | 1466 |
| 454 | Ga0207707_10306170 | 3300025912 | Bacteria | 1373 |
| 455 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 456 | Ga0207695_10074780 | 3300025913 | Bacteria | 3448 |
| 457 | Ga0207695_10088068 | 3300025913 | Bacteria | 3126 |
| 458 | Ga0207695_10100999 | 3300025913 | Bacteria | 2880 |
| 459 | Ga0207695_10351826 | 3300025913 | Bacteria | 1360 |
| 460 | Ga0207671_10037498 | 3300025914 | Bacteria | 3595 |
| 461 | Ga0207671_10075242 | 3300025914 | Bacteria | 2525 |
| 462 | Ga0207693_10040763 | 3300025915 | Bacteria | 3657 |
| 463 | Ga0207693_10145318 | 3300025915 | Bacteria | 1865 |
| 464 | Ga0207663_10572132 | 3300025916 | Bacteria | 885 |
| 465 | Ga0207660_10008004 | 3300025917 | Bacteria | 6833 |
| 466 | Ga0207660_10016752 | 3300025917 | Bacteria | 4859 |
| 467 | Ga0207660_10018336 | 3300025917 | Bacteria | 4662 |
| 468 | Ga0207660_10061026 | 3300025917 | Bacteria | 2713 |
| 469 | Ga0207660_10231000 | 3300025917 | Bacteria | 1454 |
| 470 | Ga0207660_10238924 | 3300025917 | Bacteria | 1431 |
| 471 | Ga0207662_10190082 | 3300025918 | Bacteria | 1325 |
| 472 | Ga0207657_10017806 | 3300025919 | Bacteria | 6801 |
| 473 | Ga0207657_10047173 | 3300025919 | Bacteria | 3769 |
| 474 | Ga0207649_10013276 | 3300025920 | Bacteria | 4594 |
| 475 | Ga0207649_10192440 | 3300025920 | Bacteria | 1436 |
| 476 | Ga0207649_10201153 | 3300025920 | Bacteria | 1407 |
| 477 | Ga0207652_10028071 | 3300025921 | Bacteria | 4693 |
| 478 | Ga0207652_10028625 | 3300025921 | Bacteria | 4651 |
| 479 | Ga0207652_10145041 | 3300025921 | Bacteria | 2124 |
| 480 | Ga0207652_10165535 | 3300025921 | Bacteria | 1983 |
| 481 | Ga0207652_10239627 | 3300025921 | Bacteria | 1635 |
| 482 | Ga0207652_10384907 | 3300025921 | Bacteria | 1266 |
| 483 | Ga0207646_10073903 | 3300025922 | Bacteria | 3045 |
| 484 | Ga0207646_10365285 | 3300025922 | Bacteria | 1304 |
| 485 | Ga0207646_10641091 | 3300025922 | Bacteria | 952 |
| 486 | Ga0207681_10001932 | 3300025923 | Bacteria | 13279 |
| 487 | Ga0207694_10017635 | 3300025924 | Bacteria | 5397 |
| 488 | Ga0207694_10276676 | 3300025924 | Bacteria | 1378 |
| 489 | Ga0207650_10062660 | 3300025925 | Bacteria | 2779 |
| 490 | Ga0207650_10101071 | 3300025925 | Bacteria | 2219 |
| 491 | Ga0207650_10324423 | 3300025925 | Bacteria | 1262 |
| 492 | Ga0207659_10008337 | 3300025926 | Bacteria | 6427 |
| 493 | Ga0207659_10024473 | 3300025926 | Bacteria | 4046 |
| 494 | Ga0207687_10173227 | 3300025927 | Bacteria | 1666 |
| 495 | Ga0207700_10049267 | 3300025928 | Bacteria | 3133 |
| 496 | Ga0207664_10108586 | 3300025929 | Bacteria | 2304 |
| 497 | Ga0207664_10148323 | 3300025929 | Bacteria | 1991 |
| 498 | Ga0207644_10000662 | 3300025931 | Bacteria | 21756 |
| 499 | Ga0207644_10028414 | 3300025931 | Bacteria | 3871 |
| 500 | Ga0207644_10101300 | 3300025931 | Bacteria | 2164 |
| 501 | Ga0207706_10039524 | 3300025933 | Bacteria | 4183 |
| 502 | Ga0207706_10075564 | 3300025933 | Bacteria | 2963 |
| 503 | Ga0207686_10281531 | 3300025934 | Unclassified | 1228 |
| 504 | Ga0207709_10116889 | 3300025935 | Bacteria | 1794 |
| 505 | Ga0207709_10204687 | 3300025935 | Bacteria | 1412 |
| 506 | Ga0207670_10014902 | 3300025936 | Bacteria | 4630 |
| 507 | Ga0207670_10035833 | 3300025936 | Bacteria | 3221 |
| 508 | Ga0207669_10022596 | 3300025937 | Bacteria | 3344 |
| 509 | Ga0207669_10023774 | 3300025937 | Bacteria | 3280 |
| 510 | Ga0207704_10135121 | 3300025938 | Bacteria | 1715 |
| 511 | Ga0207704_10291416 | 3300025938 | Bacteria | 1246 |
| 512 | Ga0207665_10704104 | 3300025939 | Bacteria | 794 |
| 513 | Ga0207691_10002630 | 3300025940 | Bacteria | 17536 |
| 514 | Ga0207691_10088217 | 3300025940 | Bacteria | 2782 |
| 515 | Ga0207691_10200017 | 3300025940 | Bacteria | 1739 |
| 516 | Ga0207711_10202967 | 3300025941 | Bacteria | 1810 |
| 517 | Ga0207689_10038394 | 3300025942 | Bacteria | 3967 |
| 518 | Ga0207689_10090571 | 3300025942 | Bacteria | 2513 |
| 519 | Ga0207689_10122781 | 3300025942 | Bacteria | 2136 |
| 520 | Ga0207661_10028588 | 3300025944 | Bacteria | 4271 |
| 521 | Ga0207661_10040759 | 3300025944 | Bacteria | 3652 |
| 522 | Ga0207661_10042658 | 3300025944 | Bacteria | 3577 |
| 523 | Ga0207661_10051634 | 3300025944 | Bacteria | 3281 |
| 524 | Ga0207661_10080436 | 3300025944 | Bacteria | 2689 |
| 525 | Ga0207679_10000999 | 3300025945 | Bacteria | 18145 |
| 526 | Ga0207679_10287696 | 3300025945 | Bacteria | 1412 |
| 527 | Ga0207667_10022102 | 3300025949 | Bacteria | 7037 |
| 528 | Ga0207667_10033353 | 3300025949 | Bacteria | 5536 |
| 529 | Ga0207667_10203396 | 3300025949 | Bacteria | 2031 |
| 530 | Ga0207651_10000539 | 3300025960 | Bacteria | 15885 |
| 531 | Ga0207651_10028595 | 3300025960 | Bacteria | 3519 |
| 532 | Ga0207651_10029593 | 3300025960 | Bacteria | 3472 |
| 533 | Ga0207651_10117247 | 3300025960 | Bacteria | 2011 |
| 534 | Ga0207651_10128910 | 3300025960 | Bacteria | 1933 |
| 535 | Ga0207651_10210603 | 3300025960 | Bacteria | 1564 |
| 536 | Ga0207712_10008328 | 3300025961 | Bacteria | 6555 |
| 537 | Ga0207712_10054104 | 3300025961 | Bacteria | 2818 |
| 538 | Ga0207668_10020017 | 3300025972 | Bacteria | 4244 |
| 539 | Ga0207640_10002923 | 3300025981 | Bacteria | 9178 |
| 540 | Ga0207640_10098327 | 3300025981 | Bacteria | 2046 |
| 541 | Ga0207640_10181520 | 3300025981 | Bacteria | 1578 |
| 542 | Ga0207640_10385433 | 3300025981 | Bacteria | 1137 |
| 543 | Ga0207658_10067312 | 3300025986 | Bacteria | 2697 |
| 544 | Ga0207658_10067700 | 3300025986 | Bacteria | 2691 |
| 545 | Ga0207658_10587423 | 3300025986 | Bacteria | 1000 |
| 546 | Ga0207658_10813997 | 3300025986 | Bacteria | 848 |
| 547 | Ga0207677_10006479 | 3300026023 | Bacteria | 6428 |
| 548 | Ga0207677_10050315 | 3300026023 | Bacteria | 2818 |
| 549 | Ga0207703_10001771 | 3300026035 | Bacteria | 19284 |
| 550 | Ga0207703_10116025 | 3300026035 | Bacteria | 2291 |
| 551 | Ga0207703_10212189 | 3300026035 | Bacteria | 1727 |
| 552 | Ga0207703_10435245 | 3300026035 | Bacteria | 1223 |
| 553 | Ga0207639_10053692 | 3300026041 | Bacteria | 3076 |
| 554 | Ga0207639_10140624 | 3300026041 | Bacteria | 2010 |
| 555 | Ga0207639_10337528 | 3300026041 | Bacteria | 1343 |
| 556 | Ga0207678_10036030 | 3300026067 | Bacteria | 4307 |
| 557 | Ga0207678_10178085 | 3300026067 | Unclassified | 1816 |
| 558 | Ga0207708_10001813 | 3300026075 | Bacteria | 15767 |
| 559 | Ga0207708_10093652 | 3300026075 | Bacteria | 2319 |
| 560 | Ga0207708_10139312 | 3300026075 | Bacteria | 1902 |
| 561 | Ga0207708_10156445 | 3300026075 | Bacteria | 1797 |
| 562 | Ga0207708_10227188 | 3300026075 | Bacteria | 1497 |
| 563 | Ga0207702_10000052 | 3300026078 | Bacteria | 137784 |
| 564 | Ga0207702_10035413 | 3300026078 | Bacteria | 4174 |
| 565 | Ga0207702_10614122 | 3300026078 | Bacteria | 1067 |
| 566 | Ga0207641_10050841 | 3300026088 | Bacteria | 3508 |
| 567 | Ga0207641_10170386 | 3300026088 | Bacteria | 1986 |
| 568 | Ga0207641_10355003 | 3300026088 | Unclassified | 1398 |
| 569 | Ga0207648_10001802 | 3300026089 | Bacteria | 23480 |
| 570 | Ga0207648_10012847 | 3300026089 | Bacteria | 7820 |
| 571 | Ga0207648_10092144 | 3300026089 | Bacteria | 2649 |
| 572 | Ga0207648_10236908 | 3300026089 | Bacteria | 1624 |
| 573 | Ga0207676_10004415 | 3300026095 | Bacteria | 9944 |
| 574 | Ga0207676_10010216 | 3300026095 | Bacteria | 6678 |
| 575 | Ga0207676_10014329 | 3300026095 | Bacteria | 5703 |
| 576 | Ga0207676_10047826 | 3300026095 | Bacteria | 3317 |
| 577 | Ga0207676_10523919 | 3300026095 | Bacteria | 1129 |
| 578 | Ga0207676_10791364 | 3300026095 | Bacteria | 925 |
| 579 | Ga0207676_11010937 | 3300026095 | Bacteria | 819 |
| 580 | Ga0207674_10002489 | 3300026116 | Bacteria | 23224 |
| 581 | Ga0207674_10002494 | 3300026116 | Bacteria | 23211 |
| 582 | Ga0207674_10013097 | 3300026116 | Bacteria | 9231 |
| 583 | Ga0207674_10113796 | 3300026116 | Bacteria | 2678 |
| 584 | Ga0207674_10185786 | 3300026116 | Bacteria | 2029 |
| 585 | Ga0207674_10275169 | 3300026116 | Bacteria | 1631 |
| 586 | Ga0207674_10308643 | 3300026116 | Bacteria | 1531 |
| 587 | Ga0207675_100001457 | 3300026118 | Bacteria | 23724 |
| 588 | Ga0207675_100063974 | 3300026118 | Bacteria | 3437 |
| 589 | Ga0207675_100261260 | 3300026118 | Bacteria | 1678 |
| 590 | Ga0207675_100571763 | 3300026118 | Bacteria | 1131 |
| 591 | Ga0207675_100635994 | 3300026118 | Bacteria | 1072 |
| 592 | Ga0207675_100834745 | 3300026118 | Bacteria | 936 |
| 593 | Ga0207683_10006114 | 3300026121 | Bacteria | 10311 |
| 594 | Ga0207683_10030306 | 3300026121 | Bacteria | 4687 |
| 595 | Ga0207683_10103223 | 3300026121 | Bacteria | 2546 |
| 596 | Ga0207683_10160286 | 3300026121 | Bacteria | 2033 |
| 597 | Ga0207683_10284239 | 3300026121 | Bacteria | 1512 |
| 598 | Ga0207683_10953198 | 3300026121 | Bacteria | 797 |
| 599 | Ga0207698_10124070 | 3300026142 | Bacteria | 2192 |
| 600 | Ga0207698_10174151 | 3300026142 | Bacteria | 1898 |
| 601 | Ga0207698_10450068 | 3300026142 | Bacteria | 1243 |
| 602 | Ga0209389_1000043 | 3300027296 | Bacteria | 123224 |
| 603 | Ga0209389_1000077 | 3300027296 | Bacteria | 91273 |
| 604 | Ga0209589_1000047 | 3300027357 | Bacteria | 118659 |
| 605 | Ga0209969_1001449 | 3300027360 | Bacteria | 3269 |
| 606 | Ga0209969_1018048 | 3300027360 | Bacteria | 1041 |
| 607 | Ga0209489_100075 | 3300027361 | Bacteria | 136991 |
| 608 | Ga0209489_100251 | 3300027361 | Bacteria | 91273 |
| 609 | Ga0209700_100271 | 3300027363 | Bacteria | 91215 |
| 610 | Ga0209981_1002479 | 3300027378 | Bacteria | 2353 |
| 611 | Ga0209996_1005842 | 3300027395 | Bacteria | 1580 |
| 612 | Ga0209971_1009416 | 3300027682 | Bacteria | 2314 |
| 613 | Ga0209966_1014624 | 3300027695 | Bacteria | 1467 |
| 614 | Ga0209813_10000818 | 3300027866 | Bacteria | 7060 |
| 615 | Ga0209813_10002644 | 3300027866 | Bacteria | 4118 |
| 616 | Ga0209974_10004349 | 3300027876 | Bacteria | 5038 |
| 617 | Ga0207428_10002848 | 3300027907 | Bacteria | 17167 |
| 618 | Ga0207428_10013797 | 3300027907 | Bacteria | 7042 |
| 619 | Ga0207428_10035406 | 3300027907 | Bacteria | 4081 |
| 620 | Ga0207428_10130760 | 3300027907 | Bacteria | 1921 |
| 621 | Ga0268266_10118526 | 3300028379 | Bacteria | 2353 |
| 622 | Ga0268266_10957672 | 3300028379 | Bacteria | 828 |
| 623 | Ga0268265_10002033 | 3300028380 | Bacteria | 15864 |
| 624 | Ga0268265_10002314 | 3300028380 | Bacteria | 14497 |
| 625 | Ga0268265_10177827 | 3300028380 | Bacteria | 1825 |
| 626 | Ga0268265_10416984 | 3300028380 | Bacteria | 1245 |
| 627 | Ga0268265_11031378 | 3300028380 | Bacteria | 814 |
| 628 | Ga0268264_10000030 | 3300028381 | Bacteria | 418542 |
| 629 | Ga0268264_10001973 | 3300028381 | Bacteria | 18439 |
| 630 | Ga0268264_10003102 | 3300028381 | Bacteria | 14386 |
| 631 | Ga0268264_10079591 | 3300028381 | Bacteria | 2796 |
| 632 | Ga0268264_10142466 | 3300028381 | Bacteria | 2139 |
| 633 | Ga0268264_10309156 | 3300028381 | Bacteria | 1491 |
| 634 | Ga0268264_10409806 | 3300028381 | Bacteria | 1305 |
| 635 | Ga0265319_1079999 | 3300028563 | Bacteria | 1039 |
| 636 | Ga0265318_10010466 | 3300028577 | Bacteria | 4039 |
| 637 | Ga0307511_10039065 | 3300030521 | Bacteria | 4061 |
| 638 | Ga0265332_10002444 | 3300031238 | Bacteria | 9471 |
| 639 | Ga0265328_10026267 | 3300031239 | Bacteria | 2189 |
| 640 | Ga0265320_10029069 | 3300031240 | Bacteria | 2863 |
| 641 | Ga0265329_10004978 | 3300031242 | Bacteria | 5437 |
| 642 | Ga0265340_10120833 | 3300031247 | Bacteria | 1205 |
| 643 | Ga0265339_10009845 | 3300031249 | Bacteria | 5970 |
| 644 | Ga0265339_10152391 | 3300031249 | Bacteria | 1168 |
| 645 | Ga0265331_10002990 | 3300031250 | Bacteria | 11119 |
| 646 | Ga0265316_10015341 | 3300031344 | Bacteria | 6703 |
| 647 | Ga0265316_10187146 | 3300031344 | Bacteria | 1540 |
| 648 | Ga0307513_10000034 | 3300031456 | Bacteria | 185012 |
| 649 | Ga0307513_10007609 | 3300031456 | Bacteria | 13999 |
| 650 | Ga0307509_10084524 | 3300031507 | Bacteria | 3268 |
| 651 | Ga0307509_10274920 | 3300031507 | Bacteria | 1449 |
| 652 | Ga0307408_100157637 | 3300031548 | Bacteria | 1800 |
| 653 | Ga0307408_100728188 | 3300031548 | Bacteria | 894 |
| 654 | Ga0307508_10003532 | 3300031616 | Bacteria | 15752 |
| 655 | Ga0307508_10161807 | 3300031616 | Bacteria | 1841 |
| 656 | Ga0307508_10186206 | 3300031616 | Bacteria | 1678 |
| 657 | Ga0265314_10000245 | 3300031711 | Bacteria | 79757 |
| 658 | Ga0265314_10002700 | 3300031711 | Bacteria | 17767 |
| 659 | Ga0265314_10046257 | 3300031711 | Bacteria | 3071 |
| 660 | Ga0265314_10139617 | 3300031711 | Bacteria | 1500 |
| 661 | Ga0265314_10236417 | 3300031711 | Bacteria | 1057 |
| 662 | Ga0265342_10008315 | 3300031712 | Bacteria | 7461 |
| 663 | Ga0307516_10018252 | 3300031730 | Bacteria | 7295 |
| 664 | Ga0307405_10377919 | 3300031731 | Bacteria | 1102 |
| 665 | Ga0307413_10061935 | 3300031824 | Bacteria | 2312 |
| 666 | Ga0307413_10682957 | 3300031824 | Bacteria | 851 |
| 667 | Ga0307518_10200924 | 3300031838 | Bacteria | 1324 |
| 668 | Ga0307410_10709754 | 3300031852 | Bacteria | 848 |
| 669 | Ga0307406_10318118 | 3300031901 | Bacteria | 1203 |
| 670 | Ga0307407_10115600 | 3300031903 | Bacteria | 1692 |
| 671 | Ga0307409_100106327 | 3300031995 | Bacteria | 2342 |
| 672 | Ga0307416_100042761 | 3300032002 | Bacteria | 3541 |
| 673 | Ga0307416_100076909 | 3300032002 | Bacteria | 2800 |
| 674 | Ga0307411_10162153 | 3300032005 | Bacteria | 1676 |
| 675 | Ga0307411_10235812 | 3300032005 | Bacteria | 1429 |
| 676 | Ga0307507_10026861 | 3300033179 | Bacteria | 6192 |
| 677 | Ga0307510_10017164 | 3300033180 | Bacteria | 8539 |
| 678 | Ga0373950_0018298 | 3300034818 | Bacteria | 1215 |
| 679 | Ga0373938_0004232 | 3300034957 | Bacteria | 2386 |
| 680 | Ga0373926_0038226 | 3300035083 | Bacteria | 1709 |
| 681 | Ga0373926_0088564 | 3300035083 | Bacteria | 1149 |
| 682 | Ga0373929_0008806 | 3300035085 | Bacteria | 1865 |
| 683 | Ga0373929_0011614 | 3300035085 | Bacteria | 1662 |
| 684 | Ga0373929_0043119 | 3300035085 | Bacteria | 1009 |
| 685 | Ga0373934_0009337 | 3300035086 | Bacteria | 3672 |
| 686 | Ga0373944_0012480 | 3300035089 | Bacteria | 2342 |
| 687 | Ga0373951_0005556 | 3300035091 | Bacteria | 2924 |
| 688 | Ga0373952_0006139 | 3300035092 | Bacteria | 2215 |
| 689 | Ga0373923_0004076 | 3300035111 | Bacteria | 4801 |
| 690 | Ga0373923_0062235 | 3300035111 | Bacteria | 1587 |
| 691 | Ga0373932_0004300 | 3300035112 | Bacteria | 3378 |
| 692 | Ga0373932_0066187 | 3300035112 | Bacteria | 1110 |
| 693 | Ga0373936_0045218 | 3300035113 | Bacteria | 1773 |
| 694 | Ga0373936_0102151 | 3300035113 | Bacteria | 1210 |
| 695 | Ga0373939_0015963 | 3300035114 | Bacteria | 1973 |
| 696 | Ga0373945_0003594 | 3300035116 | Bacteria | 4885 |
| 697 | Ga0373945_0004386 | 3300035116 | Bacteria | 4481 |
| 698 | Ga0373953_0000715 | 3300035117 | Bacteria | 9186 |
| 699 | Ga0373954_0000084 | 3300035118 | Bacteria | 33354 |
| 700 | Ga0373956_0027703 | 3300035119 | Bacteria | 2462 |
| 701 | Ga0373957_0004322 | 3300035120 | Bacteria | 4310 |
| 702 | Ga0373960_0002619 | 3300035121 | Bacteria | 4069 |
| 703 | Ga0373960_0029936 | 3300035121 | Bacteria | 1513 |
| 704 | Ga0373943_0137670 | 3300035170 | Bacteria | 1312 |
| 705 | Ga0373955_0000301 | 3300035172 | Bacteria | 20395 |
| 706 | Ga0373955_0024108 | 3300035172 | Bacteria | 3107 |
| 707 | Ga0373942_0011396 | 3300035207 | Bacteria | 2108 |
| 708 | Ga0373924_0003265 | 3300035410 | Bacteria | 5550 |
| 709 | Ga0373924_0004344 | 3300035410 | Bacteria | 4949 |
| 710 | Ga0373931_0000116 | 3300035691 | Bacteria | 36224 |
| 711 | Ga0373931_0006888 | 3300035691 | Bacteria | 5345 |
| 712 | Ga0373931_0024087 | 3300035691 | Bacteria | 3079 |
| 713 | Ga0373931_0026893 | 3300035691 | Bacteria | 2932 |
| 714 | Ga0373931_0111062 | 3300035691 | Bacteria | 1555 |
| 715 | Ga0373935_0026781 | 3300035692 | Bacteria | 3563 |
| 716 | Ga0373935_0120149 | 3300035692 | Bacteria | 1754 |
| 717 | Ga0373935_0173688 | 3300035692 | Bacteria | 1475 |
| 718 | Ga0373927_0018106 | 3300035695 | Bacteria | 4632 |
| 719 | Ga0373927_0038713 | 3300035695 | Bacteria | 3095 |
| 720 | Ga0373927_0046867 | 3300035695 | Bacteria | 2796 |
| 721 | Ga0373927_0085133 | 3300035695 | Bacteria | 2051 |
| 722 | Ga0373927_0240362 | 3300035695 | Bacteria | 1190 |
| 723 | Ga0373927_0266483 | 3300035695 | Bacteria | 1126 |
| 724 | Ga0373933_0000951 | 3300035724 | Bacteria | 17668 |
| 725 | Ga0373933_0032348 | 3300035724 | Bacteria | 3040 |
| 726 | Ga0373947_0022472 | 3300035725 | Bacteria | 3659 |
| 727 | Ga0373947_0026018 | 3300035725 | Bacteria | 3415 |
| 728 | Ga0373947_0164254 | 3300035725 | Bacteria | 1437 |
| 729 | Ga0373937_0008455 | 3300036401 | Bacteria | 8945 |
| 730 | Ga0373937_0225314 | 3300036401 | Bacteria | 1765 |
| 731 | Ga0373937_0390306 | 3300036401 | Bacteria | 1320 |
| 732 | Ga0373925_0016726 | 3300037068 | Bacteria | 5312 |
| 733 | Ga0373925_0024885 | 3300037068 | Bacteria | 4373 |
| 734 | Ga0373925_0084632 | 3300037068 | Bacteria | 2417 |
| 735 | Ga0373925_0178949 | 3300037068 | Bacteria | 1677 |
| 736 | Ga0373925_0432399 | 3300037068 | Bacteria | 1076 |
| 737 | Ga0395900_0001310 | 3300037418 | Bacteria | 30209 |
| 738 | Ga0395900_0008575 | 3300037418 | Bacteria | 10508 |
| 739 | Ga0395900_0334580 | 3300037418 | Bacteria | 1491 |
| 740 | Ga0395900_0415545 | 3300037418 | Bacteria | 1307 |
| 741 | Ga0395898_0011039 | 3300037466 | Bacteria | 9411 |
| 742 | Ga0395898_0035192 | 3300037466 | Bacteria | 4984 |
| 743 | Ga0395898_0086895 | 3300037466 | Bacteria | 3013 |
| 744 | Ga0395898_0089354 | 3300037466 | Bacteria | 2965 |
| 745 | Ga0395898_0245347 | 3300037466 | Bacteria | 1708 |
| 746 | Ga0395905_0028793 | 3300037471 | Bacteria | 5234 |
| 747 | Ga0436364_0586291 | 3300037853 | Bacteria | 97560 |
| 748 | Ga0395901_0024836 | 3300038443 | Bacteria | 6151 |
| 749 | Ga0395901_0127744 | 3300038443 | Bacteria | 2672 |
| 750 | Ga0436365_0401821 | 3300039437 | Bacteria | 2515 |
| 751 | Ga0436365_0812156 | 3300039437 | Bacteria | 1069 |
| 752 | Ga0436365_0991677 | 3300039437 | Bacteria | 1200 |
| 753 | Ga0436365_1236739 | 3300039437 | Bacteria | 30341 |
| 754 | Ga0436365_1491363 | 3300039437 | Bacteria | 7723 |
| 755 | Ga0436360_0222734 | 3300039438 | Bacteria | 1174 |
| 756 | Ga0436360_1227094 | 3300039438 | Bacteria | 4421 |
| 757 | Ga0436361_0075293 | 3300039447 | Bacteria | 1881 |
| 758 | Ga0436361_0975863 | 3300039447 | Bacteria | 3276 |
| 759 | Ga0436361_1096819 | 3300039447 | Bacteria | 2130 |
| 760 | Ga0436363_0884224 | 3300039450 | Bacteria | 6818 |
| 761 | Ga0436363_1119093 | 3300039450 | Bacteria | 1482 |
| 762 | Ga0436362_0093970 | 3300039453 | Bacteria | 1166 |
| 763 | Ga0436362_0548217 | 3300039453 | Bacteria | 3819 |
| 764 | Ga0451793_0601538 | 3300041452 | Bacteria | 2473 |
| 765 | Ga0451807_2436701 | 3300041486 | Bacteria | 1158 |
| 766 | Ga0451835_1188482 | 3300041492 | Bacteria | 943 |
| 767 | Ga0451851_0511660 | 3300041507 | Bacteria | 1156 |
| 768 | Ga0439441_027153 | 3300042001 | Bacteria | 1091 |
| 769 | Ga0439456_030969 | 3300042013 | Bacteria | 1145 |
| 770 | Ga0439446_0007953 | 3300042156 | Bacteria | 2802 |
| 771 | Ga0439435_0012673 | 3300042436 | Bacteria | 2048 |
| 772 | Ga0439435_0119447 | 3300042436 | Bacteria | 825 |
| 773 | Ga0451577_0025631 | 3300042876 | Bacteria | 5349 |
| 774 | Ga0466969_0071333 | 3300044656 | Bacteria | 1670 |
| 775 | Ga0466969_0128632 | 3300044656 | Bacteria | 1175 |
| 776 | Ga0466972_0000079 | 3300044658 | Bacteria | 90348 |
| 777 | Ga0466972_0004993 | 3300044658 | Bacteria | 6655 |
| 778 | Ga0466972_0060127 | 3300044658 | Bacteria | 1823 |
| 779 | Ga0453683_0201124 | 3300044673 | Bacteria | 1265 |
| 780 | Ga0466966_0000191 | 3300044684 | Bacteria | 40906 |
| 781 | Ga0466961_0000005 | 3300044693 | Bacteria | 173105 |
| 782 | Ga0466961_0033127 | 3300044693 | Bacteria | 3321 |
| 783 | Ga0466963_0134668 | 3300044694 | Bacteria | 1709 |
| 784 | Ga0466963_0192617 | 3300044694 | Bacteria | 1424 |
| 785 | Ga0466963_0329166 | 3300044694 | Bacteria | 1075 |
| 786 | Ga0466964_0011528 | 3300044706 | Bacteria | 3341 |
| 787 | Ga0466968_0286535 | 3300044735 | Bacteria | 789 |
| 788 | Ga0466970_0159152 | 3300044765 | Bacteria | 1249 |
| 789 | Ga0466957_0127298 | 3300044842 | Bacteria | 1628 |
| 790 | Ga0466960_0022513 | 3300044901 | Bacteria | 2818 |
| 791 | Ga0466959_0000654 | 3300045049 | Bacteria | 20198 |
| 792 | Ga0466959_0047848 | 3300045049 | Bacteria | 3145 |
| 793 | Ga0451576_0003058 | 3300045051 | Bacteria | 23525 |
| 794 | Ga0451576_0024160 | 3300045051 | Bacteria | 6567 |
| 795 | Ga0451576_0135192 | 3300045051 | Bacteria | 2571 |
| 796 | Ga0451576_0194719 | 3300045051 | Bacteria | 2117 |
| 797 | Ga0451576_0491751 | 3300045051 | Bacteria | 1289 |
| 798 | Ga0451576_0532206 | 3300045051 | Bacteria | 1235 |
| 799 | Ga0451576_0938594 | 3300045051 | Bacteria | 907 |
| 800 | Ga0466967_0056368 | 3300045976 | Bacteria | 3464 |
| 801 | Ga0466967_0167498 | 3300045976 | Bacteria | 2065 |
| 802 | Ga0466967_0234169 | 3300045976 | Bacteria | 1749 |
| 803 | Ga0466967_0247653 | 3300045976 | Bacteria | 1701 |
| 804 | Ga0466967_0398772 | 3300045976 | Bacteria | 1338 |
| 805 | Ga0466967_0523322 | 3300045976 | Bacteria | 1165 |
| 806 | Ga0495592_0001709 | 3300046454 | Bacteria | 15422 |
| 807 | Ga0495592_0016467 | 3300046454 | Bacteria | 5609 |
| 808 | Ga0495592_0029039 | 3300046454 | Bacteria | 4187 |
| 809 | Ga0495592_0059743 | 3300046454 | Bacteria | 2806 |
| 810 | Ga0495603_0022391 | 3300046455 | Bacteria | 3826 |
| 811 | Ga0495603_0023839 | 3300046455 | Bacteria | 3702 |
| 812 | Ga0495603_0045351 | 3300046455 | Bacteria | 2622 |
| 813 | Ga0495590_0067357 | 3300046457 | Bacteria | 1255 |
| 814 | Ga0495629_0003566 | 3300046459 | Bacteria | 11757 |
| 815 | Ga0495629_0065560 | 3300046459 | Bacteria | 2535 |
| 816 | Ga0495641_0047349 | 3300046461 | Bacteria | 1974 |
| 817 | Ga0495651_0001292 | 3300046462 | Bacteria | 19438 |
| 818 | Ga0495653_0002541 | 3300046463 | Bacteria | 14539 |
| 819 | Ga0495653_0044851 | 3300046463 | Bacteria | 3430 |
| 820 | Ga0495580_0005831 | 3300046472 | Bacteria | 10102 |
| 821 | Ga0495580_0018121 | 3300046472 | Bacteria | 5247 |
| 822 | Ga0495582_0016731 | 3300046473 | Bacteria | 4016 |
| 823 | Ga0495639_0006521 | 3300046475 | Bacteria | 5021 |
| 824 | Ga0495639_0051667 | 3300046475 | Bacteria | 1869 |
| 825 | Ga0495639_0198840 | 3300046475 | Bacteria | 981 |
| 826 | Ga0495664_0012490 | 3300046477 | Bacteria | 4810 |
| 827 | Ga0495664_0103801 | 3300046477 | Bacteria | 1713 |
| 828 | Ga0495664_0365399 | 3300046477 | Bacteria | 868 |
| 829 | Ga0495583_0053826 | 3300046506 | Bacteria | 1825 |
| 830 | Ga0495608_0007174 | 3300046511 | Bacteria | 7881 |
| 831 | Ga0495608_0030932 | 3300046511 | Bacteria | 3620 |
| 832 | Ga0495608_0095790 | 3300046511 | Bacteria | 1917 |
| 833 | Ga0495608_0139730 | 3300046511 | Bacteria | 1546 |
| 834 | Ga0495618_0020969 | 3300046514 | Bacteria | 4025 |
| 835 | Ga0495618_0043985 | 3300046514 | Bacteria | 2817 |
| 836 | Ga0495628_0001353 | 3300046516 | Bacteria | 22476 |
| 837 | Ga0495628_0010524 | 3300046516 | Bacteria | 7852 |
| 838 | Ga0495628_0018938 | 3300046516 | Bacteria | 5696 |
| 839 | Ga0495628_0364153 | 3300046516 | Bacteria | 1061 |
| 840 | Ga0495630_0004252 | 3300046517 | Bacteria | 10039 |
| 841 | Ga0495630_0023538 | 3300046517 | Bacteria | 4553 |
| 842 | Ga0495630_0024806 | 3300046517 | Bacteria | 4433 |
| 843 | Ga0495648_0028398 | 3300046524 | Bacteria | 3727 |
| 844 | Ga0495663_0100065 | 3300046525 | Bacteria | 954 |
| 845 | Ga0495666_0024399 | 3300046526 | Bacteria | 2987 |
| 846 | Ga0495666_0064310 | 3300046526 | Bacteria | 1751 |
| 847 | Ga0495652_0006590 | 3300046529 | Bacteria | 10786 |
| 848 | Ga0495652_0230362 | 3300046529 | Bacteria | 1386 |
| 849 | Ga0495652_0427058 | 3300046529 | Bacteria | 933 |
| 850 | Ga0495665_0028674 | 3300046531 | Bacteria | 2983 |
| 851 | Ga0495640_0001127 | 3300046533 | Bacteria | 20904 |
| 852 | Ga0495640_0021531 | 3300046533 | Bacteria | 4730 |
| 853 | Ga0495640_0030787 | 3300046533 | Bacteria | 3838 |
| 854 | Ga0495640_0046916 | 3300046533 | Bacteria | 2991 |
| 855 | Ga0495586_0002131 | 3300046535 | Bacteria | 10752 |
| 856 | Ga0495586_0020997 | 3300046535 | Bacteria | 3480 |
| 857 | Ga0495586_0046702 | 3300046535 | Bacteria | 2335 |
| 858 | Ga0495587_0008387 | 3300046536 | Bacteria | 6650 |
| 859 | Ga0495609_0121254 | 3300046538 | Bacteria | 1124 |
| 860 | Ga0495621_0012895 | 3300046539 | Bacteria | 2615 |
| 861 | Ga0495621_0054227 | 3300046539 | Bacteria | 1441 |
| 862 | Ga0495597_0078838 | 3300046542 | Bacteria | 1411 |
| 863 | Ga0495645_0002913 | 3300046543 | Bacteria | 11620 |
| 864 | Ga0495645_0021817 | 3300046543 | Bacteria | 4629 |
| 865 | Ga0495645_0043454 | 3300046543 | Bacteria | 3278 |
| 866 | Ga0495622_0007219 | 3300046557 | Bacteria | 5160 |
| 867 | Ga0495622_0009262 | 3300046557 | Bacteria | 4557 |
| 868 | Ga0495622_0095691 | 3300046557 | Bacteria | 1363 |
| 869 | Ga0495667_0007315 | 3300046559 | Bacteria | 7491 |
| 870 | Ga0495667_0007620 | 3300046559 | Bacteria | 7343 |
| 871 | Ga0495656_0028453 | 3300046615 | Bacteria | 2242 |
| 872 | Ga0495668_0209470 | 3300046616 | Bacteria | 1067 |
| 873 | Ga0495634_0012018 | 3300046642 | Bacteria | 6277 |
| 874 | Ga0495634_0013010 | 3300046642 | Bacteria | 6019 |
| 875 | Ga0495634_0178489 | 3300046642 | Bacteria | 1331 |
| 876 | Ga0495611_0026243 | 3300046648 | Bacteria | 2541 |
| 877 | Ga0495635_0002472 | 3300046663 | Bacteria | 12617 |
| 878 | Ga0495635_0002810 | 3300046663 | Bacteria | 11943 |
| 879 | Ga0495635_0049929 | 3300046663 | Bacteria | 2884 |
| 880 | Ga0495635_0066981 | 3300046663 | Bacteria | 2463 |
| 881 | Ga0495635_0090539 | 3300046663 | Bacteria | 2092 |
| 882 | Ga0495659_0138713 | 3300046664 | Bacteria | 969 |
| 883 | Ga0495588_0004811 | 3300046674 | Bacteria | 5976 |
| 884 | Ga0495588_0050203 | 3300046674 | Bacteria | 2146 |
| 885 | Ga0495588_0064104 | 3300046674 | Bacteria | 1906 |
| 886 | Ga0495657_0001354 | 3300046675 | Bacteria | 21307 |
| 887 | Ga0495657_0004748 | 3300046675 | Bacteria | 10827 |
| 888 | Ga0495599_0001302 | 3300046678 | Bacteria | 14182 |
| 889 | Ga0495599_0005290 | 3300046678 | Bacteria | 7698 |
| 890 | Ga0495599_0030205 | 3300046678 | Bacteria | 3399 |
| 891 | Ga0495599_0081921 | 3300046678 | Bacteria | 2016 |
| 892 | Ga0495623_0017513 | 3300046679 | Bacteria | 4628 |
| 893 | Ga0495623_0027704 | 3300046679 | Bacteria | 3648 |
| 894 | Ga0495646_0003632 | 3300046680 | Bacteria | 9626 |
| 895 | Ga0495647_0000583 | 3300046681 | Bacteria | 10814 |
| 896 | Ga0495647_0009435 | 3300046681 | Bacteria | 3307 |
| 897 | Ga0495647_0078863 | 3300046681 | Bacteria | 1332 |
| 898 | Ga0495658_0002859 | 3300046683 | Bacteria | 8673 |
| 899 | Ga0495658_0038669 | 3300046683 | Bacteria | 2643 |
| 900 | Ga0495658_0097178 | 3300046683 | Bacteria | 1753 |
| 901 | Ga0495669_0200987 | 3300046684 | Bacteria | 952 |
| 902 | Ga0495613_0011558 | 3300046689 | Bacteria | 6563 |
| 903 | Ga0495613_0020813 | 3300046689 | Bacteria | 4890 |
| 904 | Ga0495613_0065191 | 3300046689 | Bacteria | 2662 |
| 905 | Ga0495613_0118867 | 3300046689 | Bacteria | 1899 |
| 906 | Ga0495613_0162640 | 3300046689 | Bacteria | 1587 |
| 907 | Ga0495613_0277321 | 3300046689 | Bacteria | 1165 |
| 908 | Ga0495624_0007439 | 3300046690 | Bacteria | 7686 |
| 909 | Ga0495589_0075661 | 3300046794 | Bacteria | 1642 |
| 910 | Ga0495600_0000887 | 3300046809 | Bacteria | 16014 |
| 911 | Ga0495600_0002308 | 3300046809 | Bacteria | 10889 |
| 912 | Ga0495600_0012950 | 3300046809 | Bacteria | 5228 |
| 913 | Ga0495600_0116846 | 3300046809 | Bacteria | 1736 |
| 914 | Ga0495581_0007913 | 3300047315 | Bacteria | 6156 |
| 915 | Ga0495604_0008849 | 3300047317 | Bacteria | 7957 |
| 916 | Ga0495636_0003358 | 3300047318 | Bacteria | 6202 |
| 917 | Ga0495674_0018855 | 3300047319 | Bacteria | 6417 |
| 918 | Ga0495674_0115472 | 3300047319 | Bacteria | 2272 |
| 919 | Ga0495674_0570629 | 3300047319 | Bacteria | 899 |
| 920 | Ga0495676_0025504 | 3300047321 | Bacteria | 5103 |
| 921 | Ga0495676_0031801 | 3300047321 | Bacteria | 4459 |
| 922 | Ga0495676_0250756 | 3300047321 | Bacteria | 1208 |
| 923 | Ga0495680_0004106 | 3300047322 | Bacteria | 14003 |
| 924 | Ga0495680_0008905 | 3300047322 | Bacteria | 9074 |
| 925 | Ga0495680_0013546 | 3300047322 | Bacteria | 7107 |
| 926 | Ga0495680_0210282 | 3300047322 | Bacteria | 1393 |
| 927 | Ga0495675_0006334 | 3300047444 | Bacteria | 7245 |
| 928 | Ga0495675_0014844 | 3300047444 | Bacteria | 4926 |
| 929 | Ga0495675_0153474 | 3300047444 | Bacteria | 1422 |
| 930 | Ga0495684_0000777 | 3300047471 | Bacteria | 25850 |
| 931 | Ga0495684_0004968 | 3300047471 | Bacteria | 10383 |
| 932 | Ga0495684_0368462 | 3300047471 | Bacteria | 1016 |
| 933 | Ga0495684_0421971 | 3300047471 | Bacteria | 932 |
| 934 | Ga0495686_0089415 | 3300047472 | Bacteria | 1871 |
| 935 | Ga0495593_0005870 | 3300047673 | Bacteria | 7235 |
| 936 | Ga0495593_0018091 | 3300047673 | Bacteria | 3963 |
| 937 | Ga0495593_0044871 | 3300047673 | Bacteria | 2362 |
| 938 | Ga0495593_0153959 | 3300047673 | Bacteria | 1162 |
| 939 | Ga0495602_0048917 | 3300048088 | Bacteria | 3793 |
| 940 | Ga0495602_0055388 | 3300048088 | Bacteria | 3492 |
| 941 | Ga0495602_0083357 | 3300048088 | Bacteria | 2679 |
| 942 | Ga0496100_0354358 | 3300048903 | Bacteria | 1109 |
| 943 | Ga0496100_0386626 | 3300048903 | Bacteria | 1063 |
| 944 | Ga0496101_0010462 | 3300048904 | Bacteria | 6126 |
| 945 | Ga0496101_0195605 | 3300048904 | Bacteria | 1562 |
| 946 | Ga0496102_0004180 | 3300048905 | Bacteria | 12212 |
| 947 | Ga0496102_0037694 | 3300048905 | Bacteria | 4362 |
| 948 | Ga0496102_0298173 | 3300048905 | Bacteria | 1519 |
| 949 | Ga0496102_0611487 | 3300048905 | Bacteria | 1013 |
| 950 | Ga0496103_0010570 | 3300048906 | Bacteria | 5464 |
| 951 | Ga0496103_0020026 | 3300048906 | Bacteria | 4017 |
| 952 | Ga0496103_0079575 | 3300048906 | Bacteria | 2060 |
| 953 | Ga0496104_0000887 | 3300048907 | Bacteria | 25727 |
| 954 | Ga0496104_0003143 | 3300048907 | Bacteria | 14231 |
| 955 | Ga0496104_0004370 | 3300048907 | Bacteria | 12305 |
| 956 | Ga0496104_0019617 | 3300048907 | Bacteria | 6189 |
| 957 | Ga0496104_0037883 | 3300048907 | Bacteria | 4509 |
| 958 | Ga0496104_0249331 | 3300048907 | Bacteria | 1688 |
| 959 | Ga0496105_0015706 | 3300048908 | Bacteria | 6041 |
| 960 | Ga0496105_0022134 | 3300048908 | Bacteria | 5149 |
| 961 | Ga0496105_0025293 | 3300048908 | Bacteria | 4831 |
| 962 | Ga0496106_0005519 | 3300048909 | Bacteria | 9359 |
| 963 | Ga0496106_0006989 | 3300048909 | Bacteria | 8338 |
| 964 | Ga0496106_0012569 | 3300048909 | Bacteria | 6251 |
| 965 | Ga0496106_0032551 | 3300048909 | Bacteria | 3888 |
| 966 | Ga0496106_0111916 | 3300048909 | Bacteria | 2127 |
| 967 | Ga0496107_0053363 | 3300048910 | Bacteria | 2916 |
| 968 | Ga0496107_0145016 | 3300048910 | Bacteria | 1755 |
| 969 | Ga0496108_0001980 | 3300048911 | Bacteria | 16402 |
| 970 | Ga0496108_0003753 | 3300048911 | Bacteria | 12174 |
| 971 | Ga0496108_0009913 | 3300048911 | Bacteria | 7723 |
| 972 | Ga0496108_0041408 | 3300048911 | Bacteria | 3846 |
| 973 | Ga0496108_0561733 | 3300048911 | Bacteria | 995 |
| 974 | Ga0496109_0014368 | 3300048912 | Bacteria | 6889 |
| 975 | Ga0496109_0043521 | 3300048912 | Bacteria | 4070 |
| 976 | Ga0496109_0072366 | 3300048912 | Bacteria | 3167 |
| 977 | Ga0496109_0230160 | 3300048912 | Bacteria | 1744 |
| 978 | Ga0496109_0368026 | 3300048912 | Bacteria | 1358 |
| 979 | Ga0496110_0000895 | 3300048913 | Bacteria | 20991 |
| 980 | Ga0496110_0005352 | 3300048913 | Bacteria | 10053 |
| 981 | Ga0496110_0031997 | 3300048913 | Bacteria | 4540 |
| 982 | Ga0496110_0143275 | 3300048913 | Bacteria | 2161 |
| 983 | Ga0496110_0550857 | 3300048913 | Bacteria | 1048 |
| 984 | Ga0496111_0011980 | 3300048914 | Bacteria | 5861 |
| 985 | Ga0496111_0029520 | 3300048914 | Bacteria | 3895 |
| 986 | Ga0496111_0064293 | 3300048914 | Bacteria | 2661 |
| 987 | Ga0496111_0093348 | 3300048914 | Bacteria | 2206 |
| 988 | Ga0496112_0004485 | 3300048915 | Bacteria | 11845 |
| 989 | Ga0496112_0086125 | 3300048915 | Bacteria | 3109 |
| 990 | Ga0496112_0112237 | 3300048915 | Bacteria | 2695 |
| 991 | Ga0496112_0330066 | 3300048915 | Bacteria | 1469 |
| 992 | Ga0496113_0157676 | 3300048916 | Bacteria | 1793 |
| 993 | Ga0496113_0248641 | 3300048916 | Bacteria | 1419 |
| 994 | Ga0496114_0014641 | 3300048917 | Bacteria | 6301 |
| 995 | Ga0496114_0034538 | 3300048917 | Bacteria | 4173 |
| 996 | Ga0496114_0200320 | 3300048917 | Unclassified | 1749 |
| 997 | Ga0496114_0358657 | 3300048917 | Bacteria | 1290 |
| 998 | Ga0496114_0657747 | 3300048917 | Bacteria | 921 |
| 999 | Ga0496115_0096434 | 3300048918 | Bacteria | 2421 |
| 1000 | Ga0496116_0022844 | 3300048919 | Bacteria | 4673 |
| 1001 | Ga0496116_0083636 | 3300048919 | Bacteria | 1969 |
| 1002 | Ga0496118_0006235 | 3300048921 | Bacteria | 13179 |
| 1003 | Ga0496118_0046707 | 3300048921 | Bacteria | 3365 |
| 1004 | Ga0496118_0262934 | 3300048921 | Bacteria | 972 |
| 1005 | Ga0496119_0004854 | 3300048922 | Bacteria | 13172 |
| 1006 | Ga0496119_0012751 | 3300048922 | Bacteria | 6787 |
| 1007 | Ga0496120_0027812 | 3300048923 | Bacteria | 3473 |
| 1008 | Ga0496121_0002635 | 3300048924 | Bacteria | 27038 |
| 1009 | Ga0496121_0115874 | 3300048924 | Bacteria | 2033 |
| 1010 | Ga0496121_0240280 | 3300048924 | Bacteria | 1262 |
| 1011 | Ga0496122_0058473 | 3300048925 | Bacteria | 2854 |
| 1012 | Ga0496124_0004890 | 3300048927 | Bacteria | 15418 |
| 1013 | Ga0496125_0017937 | 3300048928 | Bacteria | 6728 |
| 1014 | Ga0496125_0197232 | 3300048928 | Bacteria | 1322 |
| 1015 | Ga0496126_0002122 | 3300048929 | Bacteria | 27701 |
| 1016 | Ga0496126_0029792 | 3300048929 | Bacteria | 5181 |
| 1017 | Ga0496126_0045231 | 3300048929 | Bacteria | 4047 |
| 1018 | Ga0496126_0404681 | 3300048929 | Bacteria | 1106 |
| 1019 | Ga0501031_0002180 | 3300049568 | Bacteria | 12363 |
| 1020 | Ga0501031_0002433 | 3300049568 | Bacteria | 11846 |
| 1021 | Ga0501031_0010261 | 3300049568 | Bacteria | 6100 |
| 1022 | Ga0501031_0244256 | 3300049568 | Bacteria | 1167 |
| 1023 | Ga0501032_0000136 | 3300049569 | Bacteria | 59896 |
| 1024 | Ga0501032_0095248 | 3300049569 | Bacteria | 1974 |
| 1025 | Ga0501033_0000202 | 3300049570 | Bacteria | 57109 |
| 1026 | Ga0501034_0000113 | 3300049571 | Bacteria | 149824 |
| 1027 | Ga0501034_0014166 | 3300049571 | Bacteria | 8219 |
| 1028 | Ga0501034_0029250 | 3300049571 | Bacteria | 5601 |
| 1029 | Ga0501034_0102984 | 3300049571 | Bacteria | 2848 |
| 1030 | Ga0501034_0253230 | 3300049571 | Bacteria | 1705 |
| 1031 | Ga0501034_0514815 | 3300049571 | Bacteria | 1109 |
| 1032 | Ga0501034_0526711 | 3300049571 | Bacteria | 1093 |
| 1033 | Ga0501036_0000059 | 3300049572 | Bacteria | 72347 |
| 1034 | Ga0501036_0005674 | 3300049572 | Bacteria | 10126 |
| 1035 | Ga0501036_0149482 | 3300049572 | Bacteria | 1970 |
| 1036 | Ga0501036_0268433 | 3300049572 | Bacteria | 1429 |
| 1037 | Ga0501036_0314199 | 3300049572 | Bacteria | 1310 |
| 1038 | Ga0501036_0424980 | 3300049572 | Bacteria | 1108 |
| 1039 | Ga0501037_0000214 | 3300049573 | Bacteria | 51638 |
| 1040 | Ga0501037_0053793 | 3300049573 | Bacteria | 2945 |
| 1041 | Ga0501038_0001436 | 3300049574 | Bacteria | 21855 |
| 1042 | Ga0501038_0002810 | 3300049574 | Bacteria | 16214 |
| 1043 | Ga0501038_0037147 | 3300049574 | Bacteria | 4273 |
| 1044 | Ga0501038_0115598 | 3300049574 | Bacteria | 2218 |
| 1045 | Ga0501038_0439717 | 3300049574 | Bacteria | 1004 |
| 1046 | Ga0501039_0000694 | 3300049575 | Bacteria | 24174 |
| 1047 | Ga0501039_0001981 | 3300049575 | Bacteria | 15182 |
| 1048 | Ga0501039_0053131 | 3300049575 | Bacteria | 3135 |
| 1049 | Ga0501039_0164874 | 3300049575 | Bacteria | 1742 |
| 1050 | Ga0501040_0000067 | 3300049576 | Bacteria | 50568 |
| 1051 | Ga0501040_0037972 | 3300049576 | Bacteria | 3274 |
| 1052 | Ga0501040_0157012 | 3300049576 | Bacteria | 1607 |
| 1053 | Ga0501041_0000874 | 3300049577 | Bacteria | 16264 |
| 1054 | Ga0501041_0011051 | 3300049577 | Bacteria | 5332 |
| 1055 | Ga0501041_0013257 | 3300049577 | Bacteria | 4883 |
| 1056 | Ga0501041_0039663 | 3300049577 | Bacteria | 2858 |
| 1057 | Ga0501041_0086153 | 3300049577 | Bacteria | 1938 |
| 1058 | Ga0501042_0053316 | 3300049578 | Bacteria | 2885 |
| 1059 | Ga0501042_0055963 | 3300049578 | Bacteria | 2815 |
| 1060 | Ga0501042_0079039 | 3300049578 | Bacteria | 2356 |
| 1061 | Ga0501043_0000017 | 3300049579 | Bacteria | 166630 |
| 1062 | Ga0501043_0010087 | 3300049579 | Bacteria | 7407 |
| 1063 | Ga0501043_0209553 | 3300049579 | Bacteria | 1511 |
| 1064 | Ga0501043_0503702 | 3300049579 | Bacteria | 904 |
| 1065 | Ga0501046_0000174 | 3300049580 | Bacteria | 65566 |
| 1066 | Ga0501046_0000275 | 3300049580 | Bacteria | 52272 |
| 1067 | Ga0501046_0050186 | 3300049580 | Bacteria | 3297 |
| 1068 | Ga0501046_0062584 | 3300049580 | Bacteria | 2907 |
| 1069 | Ga0501046_0076011 | 3300049580 | Bacteria | 2603 |
| 1070 | Ga0501046_0154449 | 3300049580 | Bacteria | 1730 |
| 1071 | Ga0501047_0000044 | 3300049581 | Bacteria | 174789 |
| 1072 | Ga0501047_0010806 | 3300049581 | Bacteria | 8630 |
| 1073 | Ga0501047_0019677 | 3300049581 | Bacteria | 6477 |
| 1074 | Ga0501047_0143232 | 3300049581 | Bacteria | 2268 |
| 1075 | Ga0501047_0195332 | 3300049581 | Bacteria | 1886 |
| 1076 | Ga0501048_0000837 | 3300049582 | Bacteria | 22705 |
| 1077 | Ga0501048_0006864 | 3300049582 | Bacteria | 8650 |
| 1078 | Ga0501048_0036135 | 3300049582 | Bacteria | 3552 |
| 1079 | Ga0501048_0079019 | 3300049582 | Bacteria | 2322 |
| 1080 | Ga0501048_0106416 | 3300049582 | Bacteria | 1980 |
| 1081 | Ga0501048_0280439 | 3300049582 | Bacteria | 1185 |
| 1082 | Ga0501067_0011413 | 3300049583 | Bacteria | 4918 |
| 1083 | Ga0501068_0000089 | 3300049584 | Bacteria | 38379 |
| 1084 | Ga0501068_0008721 | 3300049584 | Bacteria | 5655 |
| 1085 | Ga0501069_0005200 | 3300049585 | Bacteria | 6763 |
| 1086 | Ga0501069_0158532 | 3300049585 | Bacteria | 1303 |
| 1087 | Ga0501070_0015659 | 3300049586 | Bacteria | 6375 |
| 1088 | Ga0501070_0034519 | 3300049586 | Bacteria | 4228 |
| 1089 | Ga0501070_0058949 | 3300049586 | Bacteria | 3182 |
| 1090 | Ga0501070_0085885 | 3300049586 | Bacteria | 2605 |
| 1091 | Ga0501070_0113759 | 3300049586 | Bacteria | 2236 |
| 1092 | Ga0501070_0113933 | 3300049586 | Bacteria | 2234 |
| 1093 | Ga0501071_0000835 | 3300049587 | Bacteria | 16487 |
| 1094 | Ga0501071_0001329 | 3300049587 | Bacteria | 14117 |
| 1095 | Ga0501071_0018583 | 3300049587 | Bacteria | 4816 |
| 1096 | Ga0501071_0046014 | 3300049587 | Bacteria | 3134 |
| 1097 | Ga0501071_0127700 | 3300049587 | Bacteria | 1888 |
| 1098 | Ga0501071_0187099 | 3300049587 | Bacteria | 1552 |
| 1099 | Ga0501072_0000569 | 3300049588 | Bacteria | 26584 |
| 1100 | Ga0501072_0003722 | 3300049588 | Bacteria | 11502 |
| 1101 | Ga0501072_0005305 | 3300049588 | Bacteria | 9816 |
| 1102 | Ga0501072_0212348 | 3300049588 | Bacteria | 1542 |
| 1103 | Ga0501072_0434669 | 3300049588 | Bacteria | 1040 |
| 1104 | Ga0501073_0000069 | 3300049589 | Bacteria | 63198 |
| 1105 | Ga0501073_0099587 | 3300049589 | Bacteria | 2018 |
| 1106 | Ga0501074_0000346 | 3300049590 | Bacteria | 27099 |
| 1107 | Ga0501074_0012367 | 3300049590 | Bacteria | 6204 |
| 1108 | Ga0501074_0059863 | 3300049590 | Bacteria | 2743 |
| 1109 | Ga0501074_0223605 | 3300049590 | Bacteria | 1340 |
| 1110 | Ga0501074_0600096 | 3300049590 | Bacteria | 779 |
| 1111 | Ga0501075_0000011 | 3300049591 | Bacteria | 83082 |
| 1112 | Ga0501075_0003173 | 3300049591 | Bacteria | 11007 |
| 1113 | Ga0501075_0004743 | 3300049591 | Bacteria | 9242 |
| 1114 | Ga0501075_0017422 | 3300049591 | Bacteria | 5190 |
| 1115 | Ga0501075_0052860 | 3300049591 | Bacteria | 3055 |
| 1116 | Ga0501075_0067175 | 3300049591 | Bacteria | 2707 |
| 1117 | Ga0501075_0082419 | 3300049591 | Bacteria | 2436 |
| 1118 | Ga0501075_0090844 | 3300049591 | Bacteria | 2317 |
| 1119 | Ga0501076_0000116 | 3300049592 | Bacteria | 44179 |
| 1120 | Ga0501076_0004572 | 3300049592 | Bacteria | 9850 |
| 1121 | Ga0501076_0022327 | 3300049592 | Bacteria | 4864 |
| 1122 | Ga0501076_0046875 | 3300049592 | Bacteria | 3416 |
| 1123 | Ga0501076_0054576 | 3300049592 | Bacteria | 3167 |
| 1124 | Ga0501076_0163471 | 3300049592 | Bacteria | 1814 |
| 1125 | Ga0501076_0420969 | 3300049592 | Bacteria | 1099 |
| 1126 | Ga0501077_0002528 | 3300049593 | Bacteria | 10954 |
| 1127 | Ga0501077_0007172 | 3300049593 | Bacteria | 6872 |
| 1128 | Ga0501077_0048514 | 3300049593 | Bacteria | 2698 |
| 1129 | Ga0501079_0000021 | 3300049741 | Bacteria | 63849 |
| 1130 | Ga0501079_0011151 | 3300049741 | Bacteria | 6855 |
| 1131 | Ga0501079_0060546 | 3300049741 | Bacteria | 2920 |
| 1132 | Ga0501079_0091240 | 3300049741 | Bacteria | 2360 |
| 1133 | Ga0501079_0137161 | 3300049741 | Bacteria | 1905 |
| 1134 | Ga0501080_0000541 | 3300049742 | Bacteria | 29739 |
| 1135 | Ga0501080_0000613 | 3300049742 | Bacteria | 28256 |
| 1136 | Ga0501080_0041399 | 3300049742 | Bacteria | 4293 |
| 1137 | Ga0501080_0042217 | 3300049742 | Bacteria | 4248 |
| 1138 | Ga0501080_0099389 | 3300049742 | Bacteria | 2700 |
| 1139 | Ga0501080_0248884 | 3300049742 | Bacteria | 1621 |
| 1140 | Ga0501080_0262150 | 3300049742 | Bacteria | 1574 |
| 1141 | Ga0501080_0276630 | 3300049742 | Bacteria | 1527 |
| 1142 | Ga0501081_0012368 | 3300049743 | Bacteria | 5607 |
| 1143 | Ga0501081_0024760 | 3300049743 | Bacteria | 4032 |
| 1144 | Ga0501081_0103516 | 3300049743 | Bacteria | 2014 |
| 1145 | Ga0501081_0322453 | 3300049743 | Bacteria | 1136 |
| 1146 | Ga0501083_0000838 | 3300049744 | Bacteria | 20228 |
| 1147 | Ga0501083_0125880 | 3300049744 | Bacteria | 1679 |
| 1148 | Ga0501283_006120 | 3300049779 | Bacteria | 1675 |
| 1149 | Ga0501035_0000393 | 3300049822 | Bacteria | 49959 |
| 1150 | Ga0501035_0028477 | 3300049822 | Bacteria | 5098 |
| 1151 | Ga0501035_0428175 | 3300049822 | Bacteria | 1098 |
| 1152 | Ga0501044_0000108 | 3300049823 | Bacteria | 100968 |
| 1153 | Ga0501044_0036561 | 3300049823 | Bacteria | 5138 |
| 1154 | Ga0501044_0070209 | 3300049823 | Bacteria | 3564 |
| 1155 | Ga0501044_0397655 | 3300049823 | Bacteria | 1291 |
| 1156 | Ga0501045_0000083 | 3300049824 | Bacteria | 45695 |
| 1157 | Ga0501045_0003295 | 3300049824 | Bacteria | 11029 |
| 1158 | Ga0501045_0007027 | 3300049824 | Bacteria | 7805 |
| 1159 | Ga0501045_0052840 | 3300049824 | Bacteria | 2968 |
| 1160 | Ga0501045_0088310 | 3300049824 | Bacteria | 2290 |
| 1161 | Ga0501045_0097323 | 3300049824 | Bacteria | 2177 |
| 1162 | nmdc:mga03n38_100614_c1 | 3300050490 | Bacteria | 1393 |
| 1163 | nmdc:mga03n38_222895_c1 | 3300050490 | Bacteria | 985 |
| 1164 | nmdc:mga03n38_303582_c1 | 3300050490 | Bacteria | 858 |
| 1165 | nmdc:mga03n38_90463_c1 | 3300050490 | Bacteria | 1456 |
| 1166 | nmdc:mga00v17_148995_c1 | 3300050491 | Bacteria | 1503 |
| 1167 | nmdc:mga00v17_30571_c1 | 3300050491 | Bacteria | 3170 |
| 1168 | nmdc:mga0yw44_28700_c1 | 3300050492 | Bacteria | 3204 |
| 1169 | nmdc:mga0yw44_389259_c1 | 3300050492 | Bacteria | 942 |
| 1170 | nmdc:mga0yw44_393770_c1 | 3300050492 | Bacteria | 936 |
| 1171 | nmdc:mga0k408_14716_c1 | 3300050493 | Bacteria | 4317 |
| 1172 | nmdc:mga0k408_150863_c1 | 3300050493 | Bacteria | 1384 |
| 1173 | nmdc:mga0k408_42447_c1 | 3300050493 | Bacteria | 2620 |
| 1174 | nmdc:mga0k408_57199_c1 | 3300050493 | Bacteria | 2264 |
| 1175 | nmdc:mga06z11_102019_c1 | 3300050494 | Bacteria | 1576 |
| 1176 | nmdc:mga06z11_126557_c1 | 3300050494 | Bacteria | 1430 |
| 1177 | nmdc:mga06z11_16076_c1 | 3300050494 | Bacteria | 3360 |
| 1178 | nmdc:mga06z11_22101_c1 | 3300050494 | Bacteria | 2966 |
| 1179 | nmdc:mga06z11_2258_c1 | 3300050494 | Bacteria | 7330 |
| 1180 | nmdc:mga04h51_1097_c1 | 3300050495 | Bacteria | 6232 |
| 1181 | nmdc:mga07m45_155815_c1 | 3300050496 | Bacteria | 1325 |
| 1182 | nmdc:mga07m45_86069_c1 | 3300050496 | Bacteria | 1798 |
| 1183 | nmdc:mga05p37_120836_c1 | 3300050507 | Bacteria | 3218 |
| 1184 | nmdc:mga05p37_148724_c1 | 3300050507 | Bacteria | 2866 |
| 1185 | nmdc:mga05p37_171923_c1 | 3300050507 | Bacteria | 2642 |
| 1186 | nmdc:mga05p37_185_c1 | 3300050507 | Bacteria | 61269 |
| 1187 | nmdc:mga05p37_237852_c1 | 3300050507 | Bacteria | 2191 |
| 1188 | nmdc:mga05p37_603703_c1 | 3300050507 | Bacteria | 1238 |
| 1189 | nmdc:mga09592_216241_c1 | 3300050508 | Bacteria | 1661 |
| 1190 | nmdc:mga09592_26221_c1 | 3300050508 | Bacteria | 4828 |
| 1191 | nmdc:mga09592_48434_c1 | 3300050508 | Bacteria | 3583 |
| 1192 | nmdc:mga0qj67_13296_c1 | 3300050509 | Bacteria | 6211 |
| 1193 | nmdc:mga0qj67_14400_c1 | 3300050509 | Bacteria | 5979 |
| 1194 | nmdc:mga0qj67_241468_c1 | 3300050509 | Bacteria | 1466 |
| 1195 | nmdc:mga0qj67_54969_c1 | 3300050509 | Bacteria | 3153 |
| 1196 | nmdc:mga0qj67_70071_c1 | 3300050509 | Bacteria | 2797 |
| 1197 | nmdc:mga0qj67_7712_c1 | 3300050509 | Bacteria | 7955 |
| 1198 | nmdc:mga06r32_14504_c2 | 3300050510 | Bacteria | 5622 |
| 1199 | nmdc:mga06r32_251564_c1 | 3300050510 | Bacteria | 1755 |
| 1200 | nmdc:mga06r32_291163_c1 | 3300050510 | Bacteria | 1620 |
| 1201 | nmdc:mga06r32_34274_c1 | 3300050510 | Bacteria | 4787 |
| 1202 | nmdc:mga06r32_489969_c1 | 3300050510 | Bacteria | 1207 |
| 1203 | nmdc:mga06r32_549401_c1 | 3300050510 | Bacteria | 1129 |
| 1204 | nmdc:mga08y16_103236_c1 | 3300050511 | Bacteria | 2968 |
| 1205 | nmdc:mga08y16_143182_c1 | 3300050511 | Bacteria | 2485 |
| 1206 | nmdc:mga08y16_17298_c1 | 3300050511 | Bacteria | 7590 |
| 1207 | nmdc:mga08y16_218185_c1 | 3300050511 | Bacteria | 1975 |
| 1208 | nmdc:mga08y16_224_c1 | 3300050511 | Bacteria | 50738 |
| 1209 | nmdc:mga08y16_26751_c1 | 3300050511 | Bacteria | 6078 |
| 1210 | nmdc:mga08y16_460582_c1 | 3300050511 | Bacteria | 1296 |
| 1211 | nmdc:mga08y16_691535_c1 | 3300050511 | Bacteria | 1021 |
| 1212 | nmdc:mga0n895_105375_c1 | 3300050512 | Bacteria | 2832 |
| 1213 | nmdc:mga0n895_1398_c1 | 3300050512 | Bacteria | 17992 |
| 1214 | nmdc:mga0n895_24213_c1 | 3300050512 | Bacteria | 5719 |
| 1215 | nmdc:mga0n895_49171_c1 | 3300050512 | Bacteria | 4130 |
| 1216 | nmdc:mga0n895_85508_c1 | 3300050512 | Bacteria | 3149 |
| 1217 | nmdc:mga0rr50_55212_c1 | 3300050513 | Bacteria | 2963 |
| 1218 | nmdc:mga0rr50_70509_c1 | 3300050513 | Bacteria | 2663 |
| 1219 | nmdc:mga08x19_127824_c1 | 3300050514 | Bacteria | 1707 |
| 1220 | nmdc:mga08x19_237_c1 | 3300050514 | Bacteria | 42162 |
| 1221 | nmdc:mga08x19_44645_c1 | 3300050514 | Bacteria | 2830 |
| 1222 | nmdc:mga08x19_4663_c1 | 3300050514 | Bacteria | 8134 |
| 1223 | nmdc:mga0a205_167828_c1 | 3300050515 | Bacteria | 2090 |
| 1224 | nmdc:mga0a205_183823_c1 | 3300050515 | Bacteria | 1984 |
| 1225 | nmdc:mga0a205_421438_c1 | 3300050515 | Bacteria | 1197 |
| 1226 | nmdc:mga0a205_927_c1 | 3300050515 | Bacteria | 24197 |
| 1227 | nmdc:mga0sz30_33559_c1 | 3300050516 | Bacteria | 2134 |
| 1228 | nmdc:mga0sz30_5376_c1 | 3300050516 | Bacteria | 4693 |
| 1229 | Ga0495601_0106738 | 3300053077 | Bacteria | 1811 |
| 1230 | Ga0495612_0013206 | 3300053078 | Bacteria | 3327 |
| 1231 | Ga0500635_0014435 | 3300053080 | Bacteria | 2314 |
| 1232 | Ga0495619_0000701 | 3300053085 | Bacteria | 21925 |
| 1233 | Ga0495619_0042507 | 3300053085 | Bacteria | 2977 |
| 1234 | Ga0495619_0134532 | 3300053085 | Bacteria | 1700 |
| 1235 | Ga0495619_0161304 | 3300053085 | Bacteria | 1549 |
| 1236 | Ga0495619_0177792 | 3300053085 | Bacteria | 1472 |
| 1237 | Ga0500643_000373 | 3300053087 | Bacteria | 35007 |
| 1238 | Ga0500647_0019184 | 3300053091 | Bacteria | 3173 |
| 1239 | Ga0500647_0128774 | 3300053091 | Bacteria | 1194 |
| 1240 | Ga0500651_0008303 | 3300053093 | Bacteria | 6101 |
| 1241 | Ga0500566_0000174 | 3300053094 | Bacteria | 32668 |
| 1242 | Ga0500566_0121836 | 3300053094 | Bacteria | 1405 |
| 1243 | Ga0500650_0027058 | 3300053098 | Bacteria | 2578 |
| 1244 | Ga0500556_0076518 | 3300053104 | Bacteria | 1258 |
| 1245 | Ga0500569_037550 | 3300053109 | Bacteria | 1400 |
| 1246 | Ga0500607_021746 | 3300053121 | Bacteria | 3610 |
| 1247 | Ga0500642_0000127 | 3300053130 | Bacteria | 34341 |
| 1248 | Ga0500642_0007115 | 3300053130 | Bacteria | 3739 |
| 1249 | Ga0500658_0113169 | 3300053134 | Bacteria | 1196 |
| 1250 | Ga0500568_0003938 | 3300053139 | Bacteria | 8082 |
| 1251 | Ga0500573_0091335 | 3300053140 | Bacteria | 1719 |
| 1252 | Ga0500590_043953 | 3300053148 | Bacteria | 2289 |
| 1253 | Ga0500590_098831 | 3300053148 | Bacteria | 1405 |
| 1254 | Ga0500616_0028333 | 3300053153 | Bacteria | 3087 |
| 1255 | Ga0500619_000101 | 3300053154 | Bacteria | 22906 |
| 1256 | Ga0500636_0003003 | 3300053177 | Bacteria | 9450 |
| 1257 | Ga0500636_0086701 | 3300053177 | Bacteria | 1797 |
| 1258 | Ga0500636_0264781 | 3300053177 | Bacteria | 868 |
| 1259 | Ga0500625_045973 | 3300053729 | Bacteria | 2036 |
| 1260 | Ga0500609_002948 | 3300053731 | Bacteria | 2422 |
| 1261 | Ga0500601_001110 | 3300053737 | Bacteria | 3044 |
| 1262 | Ga0501084_0001429 | 3300054114 | Bacteria | 18938 |
| 1263 | Ga0501084_0002813 | 3300054114 | Bacteria | 14042 |
| 1264 | Ga0501084_0033032 | 3300054114 | Bacteria | 4329 |
| 1265 | Ga0501084_0044602 | 3300054114 | Bacteria | 3712 |
| 1266 | Ga0501084_0107797 | 3300054114 | Bacteria | 2340 |
| 1267 | Ga0501084_0119967 | 3300054114 | Bacteria | 2211 |
| 1268 | Ga0501084_0137678 | 3300054114 | Bacteria | 2055 |
| 1269 | Ga0501084_0188968 | 3300054114 | Bacteria | 1738 |
| 1270 | Ga0501084_0248698 | 3300054114 | Bacteria | 1501 |
| 1271 | Ga0501084_0351688 | 3300054114 | Bacteria | 1245 |
| 1272 | Ga0501084_0413638 | 3300054114 | Bacteria | 1140 |
| 1273 | Ga0590071_055710 | 3300059421 | Bacteria | 961 |
| 1274 | Ga0590077_030192 | 3300059426 | Bacteria | 1181 |
| 1275 | Ga0501082_0000807 | 3300060353 | Bacteria | 27511 |
| 1276 | Ga0501082_0009986 | 3300060353 | Bacteria | 8184 |
| 1277 | Ga0501082_0012212 | 3300060353 | Bacteria | 7380 |
| 1278 | Ga0501082_0025869 | 3300060353 | Bacteria | 5059 |
| 1279 | Ga0501082_0088946 | 3300060353 | Bacteria | 2666 |
| 1280 | Ga0501082_0126553 | 3300060353 | Bacteria | 2216 |
| 1281 | Ga0501082_0360815 | 3300060353 | Bacteria | 1267 |
| 1282 | Ga0501082_0482755 | 3300060353 | Bacteria | 1083 |
| 1283 | Ga0530510_0000146 | 3300061734 | Bacteria | 41786 |
| 1284 | Ga0530510_0040585 | 3300061734 | Bacteria | 3359 |
| 1285 | Ga0530510_0041312 | 3300061734 | Bacteria | 3330 |
| 1286 | Ga0530510_0071132 | 3300061734 | Bacteria | 2525 |
| 1287 | Ga0530510_0241692 | 3300061734 | Bacteria | 1344 |
| 1288 | Ga0530510_0506470 | 3300061734 | Bacteria | 915 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049582 | Ga0501048_0106416 | Ga0501048_0106416_1007_1771 | 210 |
| 2 | 3300049590 | Ga0501074_0600096 | Ga0501074_0600096_20_676 | 212 |
| 3 | 3300047319 | Ga0495674_0570629 | Ga0495674_0570629_87_848 | 216 |
| 4 | 3300005328 | Ga0070676_10081208 | Ga0070676_100812082 | 228 |
| 5 | 3300005330 | Ga0070690_100571774 | Ga0070690_1005717741 | 228 |
| 6 | 3300005335 | Ga0070666_10109371 | Ga0070666_101093712 | 228 |
| 7 | 3300005338 | Ga0068868_100095768 | Ga0068868_1000957682 | 228 |
| 8 | 3300005340 | Ga0070689_100277453 | Ga0070689_1002774532 | 228 |
| 9 | 3300005356 | Ga0070674_100061051 | Ga0070674_1000610513 | 228 |
| 10 | 3300005364 | Ga0070673_100836141 | Ga0070673_1008361411 | 228 |
| 11 | 3300005364 | Ga0070673_100945760 | Ga0070673_1009457601 | 228 |
| 12 | 3300005367 | Ga0070667_100335592 | Ga0070667_1003355921 | 228 |
| 13 | 3300005441 | Ga0070700_100273059 | Ga0070700_1002730591 | 228 |
| 14 | 3300005456 | Ga0070678_100926828 | Ga0070678_1009268281 | 228 |
| 15 | 3300005457 | Ga0070662_100217259 | Ga0070662_1002172592 | 228 |
| 16 | 3300005617 | Ga0068859_100274500 | Ga0068859_1002745002 | 228 |
| 17 | 3300005618 | Ga0068864_100309664 | Ga0068864_1003096641 | 228 |
| 18 | 3300005618 | Ga0068864_101007163 | Ga0068864_1010071631 | 228 |
| 19 | 3300005841 | Ga0068863_100177172 | Ga0068863_1001771722 | 228 |
| 20 | 3300005841 | Ga0068863_101054922 | Ga0068863_1010549221 | 228 |
| 21 | 3300005843 | Ga0068860_100142367 | Ga0068860_1001423672 | 228 |
| 22 | 3300006237 | Ga0097621_100174203 | Ga0097621_1001742032 | 228 |
| 23 | 3300006358 | Ga0068871_100742920 | Ga0068871_1007429202 | 228 |
| 24 | 3300006881 | Ga0068865_100116100 | Ga0068865_1001161002 | 228 |
| 25 | 3300006931 | Ga0097620_100274485 | Ga0097620_1002744852 | 228 |
| 26 | 3300009148 | Ga0105243_10311275 | Ga0105243_103112752 | 228 |
| 27 | 3300009177 | Ga0105248_11315078 | Ga0105248_113150781 | 228 |
| 28 | 3300013306 | Ga0163162_10254169 | Ga0163162_102541693 | 228 |
| 29 | 3300014969 | Ga0157376_10061439 | Ga0157376_100614391 | 228 |
| 30 | 3300014969 | Ga0157376_11159622 | Ga0157376_111596221 | 228 |
| 31 | 3300017792 | Ga0163161_10094745 | Ga0163161_100947452 | 228 |
| 32 | 3300025893 | Ga0207682_10050609 | Ga0207682_100506092 | 228 |
| 33 | 3300025899 | Ga0207642_10038003 | Ga0207642_100380033 | 228 |
| 34 | 3300025907 | Ga0207645_10042608 | Ga0207645_100426082 | 228 |
| 35 | 3300025908 | Ga0207643_10047192 | Ga0207643_100471923 | 228 |
| 36 | 3300025926 | Ga0207659_10024473 | Ga0207659_100244733 | 228 |
| 37 | 3300025931 | Ga0207644_10028414 | Ga0207644_100284143 | 228 |
| 38 | 3300025933 | Ga0207706_10039524 | Ga0207706_100395242 | 228 |
| 39 | 3300025935 | Ga0207709_10116889 | Ga0207709_101168891 | 228 |
| 40 | 3300025937 | Ga0207669_10022596 | Ga0207669_100225963 | 228 |
| 41 | 3300025938 | Ga0207704_10135121 | Ga0207704_101351212 | 228 |
| 42 | 3300025940 | Ga0207691_10200017 | Ga0207691_102000171 | 228 |
| 43 | 3300025942 | Ga0207689_10090571 | Ga0207689_100905712 | 228 |
| 44 | 3300025960 | Ga0207651_10029593 | Ga0207651_100295932 | 228 |
| 45 | 3300025960 | Ga0207651_10117247 | Ga0207651_101172473 | 228 |
| 46 | 3300025961 | Ga0207712_10054104 | Ga0207712_100541042 | 228 |
| 47 | 3300026035 | Ga0207703_10435245 | Ga0207703_104352451 | 228 |
| 48 | 3300026075 | Ga0207708_10139312 | Ga0207708_101393122 | 228 |
| 49 | 3300026088 | Ga0207641_10170386 | Ga0207641_101703862 | 228 |
| 50 | 3300026095 | Ga0207676_10004415 | Ga0207676_100044156 | 228 |
| 51 | 3300026095 | Ga0207676_11010937 | Ga0207676_110109371 | 228 |
| 52 | 3300026118 | Ga0207675_100063974 | Ga0207675_1000639742 | 228 |
| 53 | 3300026121 | Ga0207683_10160286 | Ga0207683_101602862 | 228 |
| 54 | 3300028381 | Ga0268264_10079591 | Ga0268264_100795912 | 228 |
| 55 | 3300042436 | Ga0439435_0119447 | Ga0439435_0119447_51_806 | 228 |
| 56 | 3300045051 | Ga0451576_0532206 | Ga0451576_0532206_112_864 | 228 |
| 57 | 3300028577 | Ga0265318_10010466 | Ga0265318_100104664 | 229 |
| 58 | 3300031238 | Ga0265332_10002444 | Ga0265332_100024443 | 229 |
| 59 | 3300031239 | Ga0265328_10026267 | Ga0265328_100262672 | 229 |
| 60 | 3300031240 | Ga0265320_10029069 | Ga0265320_100290691 | 229 |
| 61 | 3300031242 | Ga0265329_10004978 | Ga0265329_100049782 | 229 |
| 62 | 3300031250 | Ga0265331_10002990 | Ga0265331_100029903 | 229 |
| 63 | 3300031344 | Ga0265316_10015341 | Ga0265316_100153415 | 229 |
| 64 | 3300031711 | Ga0265314_10000245 | Ga0265314_1000024516 | 229 |
| 65 | 3300031712 | Ga0265342_10008315 | Ga0265342_100083157 | 229 |
| 66 | 3300003792 | Ga0055540_1006236 | Ga0055540_10062365 | 233 |
| 67 | 3300003794 | Ga0055531_10001449 | Ga0055531_100014493 | 233 |
| 68 | 3300021361 | Ga0213872_10050831 | Ga0213872_100508312 | 233 |
| 69 | 3300025273 | Ga0209673_1019247 | Ga0209673_10192473 | 233 |
| 70 | 3300025303 | Ga0209051_1000369 | Ga0209051_100036932 | 233 |
| 71 | 3300025304 | Ga0209257_1000317 | Ga0209257_100031771 | 233 |
| 72 | 3300025941 | Ga0207711_10202967 | Ga0207711_102029673 | 233 |
| 73 | 3300039447 | Ga0436361_0075293 | Ga0436361_0075293_453_1211 | 233 |
| 74 | 3300048911 | Ga0496108_0561733 | Ga0496108_0561733_123_833 | 233 |
| 75 | 3300005336 | Ga0070680_100097733 | Ga0070680_1000977332 | 234 |
| 76 | 3300005445 | Ga0070708_100492230 | Ga0070708_1004922301 | 234 |
| 77 | 3300010159 | Ga0099796_10143275 | Ga0099796_101432751 | 234 |
| 78 | 3300007265 | Ga0099794_10011812 | Ga0099794_100118124 | 235 |
| 79 | 3300049571 | Ga0501034_0514815 | Ga0501034_0514815_258_1010 | 235 |
| 80 | 3300005445 | Ga0070708_100288576 | Ga0070708_1002885761 | 236 |
| 81 | 3300013297 | Ga0157378_10009382 | Ga0157378_100093823 | 236 |
| 82 | 3300046506 | Ga0495583_0053826 | Ga0495583_0053826_1098_1808 | 236 |
| 83 | 3300031507 | Ga0307509_10084524 | Ga0307509_100845243 | 237 |
| 84 | 3300031824 | Ga0307413_10061935 | Ga0307413_100619352 | 238 |
| 85 | 3300031995 | Ga0307409_100106327 | Ga0307409_1001063272 | 238 |
| 86 | 3300048912 | Ga0496109_0014368 | Ga0496109_0014368_5665_6417 | 238 |
| 87 | 3300048913 | Ga0496110_0005352 | Ga0496110_0005352_8346_9098 | 238 |
| 88 | 3300048915 | Ga0496112_0004485 | Ga0496112_0004485_10824_11576 | 238 |
| 89 | 3300048917 | Ga0496114_0358657 | Ga0496114_0358657_55_807 | 238 |
| 90 | 3300049568 | Ga0501031_0002433 | Ga0501031_0002433_4434_5183 | 238 |
| 91 | 3300049743 | Ga0501081_0322453 | Ga0501081_0322453_304_1056 | 239 |
| 92 | 3300060353 | Ga0501082_0482755 | Ga0501082_0482755_307_1059 | 239 |
| 93 | 3300009098 | Ga0105245_10938520 | Ga0105245_109385201 | 240 |
| 94 | 3300048907 | Ga0496104_0019617 | Ga0496104_0019617_5172_5924 | 240 |
| 95 | 3300048909 | Ga0496106_0006989 | Ga0496106_0006989_1436_2188 | 240 |
| 96 | 3300049571 | Ga0501034_0014166 | Ga0501034_0014166_826_1566 | 240 |
| 97 | 3300005459 | Ga0068867_100145606 | Ga0068867_1001456062 | 241 |
| 98 | 3300014326 | Ga0157380_10195562 | Ga0157380_101955622 | 241 |
| 99 | 3300026089 | Ga0207648_10092144 | Ga0207648_100921442 | 241 |
| 100 | 3300026121 | Ga0207683_10284239 | Ga0207683_102842393 | 241 |
| 101 | 3300007265 | Ga0099794_10051542 | Ga0099794_100515422 | 242 |
| 102 | 3300014326 | Ga0157380_10039123 | Ga0157380_100391235 | 242 |
| 103 | 3300025925 | Ga0207650_10324423 | Ga0207650_103244232 | 242 |
| 104 | 3300045051 | Ga0451576_0194719 | Ga0451576_0194719_991_1746 | 242 |
| 105 | 3300048904 | Ga0496101_0010462 | Ga0496101_0010462_272_1009 | 242 |
| 106 | 3300005329 | Ga0070683_100043532 | Ga0070683_1000435325 | 243 |
| 107 | 3300005330 | Ga0070690_100154103 | Ga0070690_1001541032 | 243 |
| 108 | 3300005331 | Ga0070670_100031103 | Ga0070670_1000311033 | 243 |
| 109 | 3300005340 | Ga0070689_100007535 | Ga0070689_1000075353 | 243 |
| 110 | 3300005341 | Ga0070691_10144072 | Ga0070691_101440721 | 243 |
| 111 | 3300005341 | Ga0070691_10186388 | Ga0070691_101863881 | 243 |
| 112 | 3300005345 | Ga0070692_10264143 | Ga0070692_102641431 | 243 |
| 113 | 3300005355 | Ga0070671_100023957 | Ga0070671_1000239574 | 243 |
| 114 | 3300005356 | Ga0070674_100034983 | Ga0070674_1000349834 | 243 |
| 115 | 3300005364 | Ga0070673_100185130 | Ga0070673_1001851302 | 243 |
| 116 | 3300005364 | Ga0070673_100652908 | Ga0070673_1006529081 | 243 |
| 117 | 3300005365 | Ga0070688_100522181 | Ga0070688_1005221811 | 243 |
| 118 | 3300005435 | Ga0070714_100257950 | Ga0070714_1002579502 | 243 |
| 119 | 3300005440 | Ga0070705_100003253 | Ga0070705_1000032536 | 243 |
| 120 | 3300005440 | Ga0070705_100040925 | Ga0070705_1000409253 | 243 |
| 121 | 3300005441 | Ga0070700_100656663 | Ga0070700_1006566631 | 243 |
| 122 | 3300005445 | Ga0070708_100943617 | Ga0070708_1009436171 | 243 |
| 123 | 3300005456 | Ga0070678_100622561 | Ga0070678_1006225612 | 243 |
| 124 | 3300005458 | Ga0070681_10000916 | Ga0070681_1000091622 | 243 |
| 125 | 3300005459 | Ga0068867_100001160 | Ga0068867_1000011603 | 243 |
| 126 | 3300005466 | Ga0070685_10081051 | Ga0070685_100810512 | 243 |
| 127 | 3300005467 | Ga0070706_100360060 | Ga0070706_1003600602 | 243 |
| 128 | 3300005471 | Ga0070698_100685423 | Ga0070698_1006854231 | 243 |
| 129 | 3300005518 | Ga0070699_100446089 | Ga0070699_1004460891 | 243 |
| 130 | 3300005535 | Ga0070684_100031860 | Ga0070684_1000318606 | 243 |
| 131 | 3300005536 | Ga0070697_100043526 | Ga0070697_1000435264 | 243 |
| 132 | 3300005543 | Ga0070672_100112495 | Ga0070672_1001124953 | 243 |
| 133 | 3300005544 | Ga0070686_100017229 | Ga0070686_1000172296 | 243 |
| 134 | 3300005545 | Ga0070695_100004325 | Ga0070695_1000043252 | 243 |
| 135 | 3300005545 | Ga0070695_100019895 | Ga0070695_1000198953 | 243 |
| 136 | 3300005546 | Ga0070696_100007039 | Ga0070696_1000070395 | 243 |
| 137 | 3300005546 | Ga0070696_100105155 | Ga0070696_1001051552 | 243 |
| 138 | 3300005546 | Ga0070696_100199053 | Ga0070696_1001990532 | 243 |
| 139 | 3300005549 | Ga0070704_100438904 | Ga0070704_1004389041 | 243 |
| 140 | 3300005615 | Ga0070702_100068615 | Ga0070702_1000686152 | 243 |
| 141 | 3300005617 | Ga0068859_100157942 | Ga0068859_1001579422 | 243 |
| 142 | 3300005617 | Ga0068859_100290213 | Ga0068859_1002902132 | 243 |
| 143 | 3300005618 | Ga0068864_100023054 | Ga0068864_1000230545 | 243 |
| 144 | 3300005719 | Ga0068861_100019221 | Ga0068861_1000192216 | 243 |
| 145 | 3300005841 | Ga0068863_100759500 | Ga0068863_1007595002 | 243 |
| 146 | 3300005843 | Ga0068860_100386754 | Ga0068860_1003867541 | 243 |
| 147 | 3300005985 | Ga0081539_10002630 | Ga0081539_1000263014 | 243 |
| 148 | 3300006237 | Ga0097621_100009529 | Ga0097621_1000095298 | 243 |
| 149 | 3300006358 | Ga0068871_100419030 | Ga0068871_1004190302 | 243 |
| 150 | 3300006844 | Ga0075428_100003812 | Ga0075428_1000038122 | 243 |
| 151 | 3300006846 | Ga0075430_100077969 | Ga0075430_1000779693 | 243 |
| 152 | 3300006846 | Ga0075430_100226041 | Ga0075430_1002260412 | 243 |
| 153 | 3300006847 | Ga0075431_100291433 | Ga0075431_1002914332 | 243 |
| 154 | 3300006852 | Ga0075433_10006970 | Ga0075433_100069705 | 243 |
| 155 | 3300006852 | Ga0075433_10173759 | Ga0075433_101737592 | 243 |
| 156 | 3300006871 | Ga0075434_100001148 | Ga0075434_10000114817 | 243 |
| 157 | 3300006880 | Ga0075429_100040854 | Ga0075429_1000408542 | 243 |
| 158 | 3300006880 | Ga0075429_100086654 | Ga0075429_1000866542 | 243 |
| 159 | 3300006914 | Ga0075436_100000431 | Ga0075436_10000043127 | 243 |
| 160 | 3300006914 | Ga0075436_100001883 | Ga0075436_10000188315 | 243 |
| 161 | 3300006914 | Ga0075436_100039926 | Ga0075436_1000399262 | 243 |
| 162 | 3300006914 | Ga0075436_100050676 | Ga0075436_1000506762 | 243 |
| 163 | 3300006914 | Ga0075436_100055807 | Ga0075436_1000558073 | 243 |
| 164 | 3300006931 | Ga0097620_100157952 | Ga0097620_1001579522 | 243 |
| 165 | 3300006931 | Ga0097620_100290207 | Ga0097620_1002902072 | 243 |
| 166 | 3300007076 | Ga0075435_100001283 | Ga0075435_10000128317 | 243 |
| 167 | 3300007076 | Ga0075435_100014770 | Ga0075435_1000147702 | 243 |
| 168 | 3300009094 | Ga0111539_10023402 | Ga0111539_100234024 | 243 |
| 169 | 3300009094 | Ga0111539_10046787 | Ga0111539_100467872 | 243 |
| 170 | 3300009094 | Ga0111539_10300993 | Ga0111539_103009932 | 243 |
| 171 | 3300009094 | Ga0111539_10983089 | Ga0111539_109830891 | 243 |
| 172 | 3300009094 | Ga0111539_10989820 | Ga0111539_109898202 | 243 |
| 173 | 3300009098 | Ga0105245_10000086 | Ga0105245_1000008658 | 243 |
| 174 | 3300009098 | Ga0105245_10290624 | Ga0105245_102906243 | 243 |
| 175 | 3300009147 | Ga0114129_10151243 | Ga0114129_101512432 | 243 |
| 176 | 3300009147 | Ga0114129_10762280 | Ga0114129_107622801 | 243 |
| 177 | 3300009148 | Ga0105243_10000360 | Ga0105243_100003606 | 243 |
| 178 | 3300009148 | Ga0105243_10008145 | Ga0105243_100081455 | 243 |
| 179 | 3300009174 | Ga0105241_10020398 | Ga0105241_100203982 | 243 |
| 180 | 3300009176 | Ga0105242_10003774 | Ga0105242_100037746 | 243 |
| 181 | 3300009176 | Ga0105242_10012096 | Ga0105242_100120962 | 243 |
| 182 | 3300009177 | Ga0105248_10160072 | Ga0105248_101600722 | 243 |
| 183 | 3300009177 | Ga0105248_10541737 | Ga0105248_105417372 | 243 |
| 184 | 3300009551 | Ga0105238_10882833 | Ga0105238_108828332 | 243 |
| 185 | 3300009553 | Ga0105249_10000690 | Ga0105249_1000069016 | 243 |
| 186 | 3300009553 | Ga0105249_10011943 | Ga0105249_100119435 | 243 |
| 187 | 3300010375 | Ga0105239_10270013 | Ga0105239_102700132 | 243 |
| 188 | 3300013297 | Ga0157378_10001516 | Ga0157378_1000151615 | 243 |
| 189 | 3300013306 | Ga0163162_10039487 | Ga0163162_100394875 | 243 |
| 190 | 3300013306 | Ga0163162_10502740 | Ga0163162_105027402 | 243 |
| 191 | 3300013308 | Ga0157375_10139603 | Ga0157375_101396032 | 243 |
| 192 | 3300014325 | Ga0163163_10860553 | Ga0163163_108605532 | 243 |
| 193 | 3300014745 | Ga0157377_10037174 | Ga0157377_100371742 | 243 |
| 194 | 3300014969 | Ga0157376_10002221 | Ga0157376_100022216 | 243 |
| 195 | 3300014969 | Ga0157376_10008104 | Ga0157376_100081044 | 243 |
| 196 | 3300025899 | Ga0207642_10072559 | Ga0207642_100725591 | 243 |
| 197 | 3300025907 | Ga0207645_10070534 | Ga0207645_100705342 | 243 |
| 198 | 3300025908 | Ga0207643_10038546 | Ga0207643_100385462 | 243 |
| 199 | 3300025910 | Ga0207684_10101583 | Ga0207684_101015832 | 243 |
| 200 | 3300025912 | Ga0207707_10001576 | Ga0207707_1000157621 | 243 |
| 201 | 3300025917 | Ga0207660_10238924 | Ga0207660_102389242 | 243 |
| 202 | 3300025922 | Ga0207646_10365285 | Ga0207646_103652852 | 243 |
| 203 | 3300025923 | Ga0207681_10001932 | Ga0207681_1000193214 | 243 |
| 204 | 3300025925 | Ga0207650_10101071 | Ga0207650_101010713 | 243 |
| 205 | 3300025927 | Ga0207687_10173227 | Ga0207687_101732272 | 243 |
| 206 | 3300025929 | Ga0207664_10148323 | Ga0207664_101483232 | 243 |
| 207 | 3300025936 | Ga0207670_10014902 | Ga0207670_100149024 | 243 |
| 208 | 3300025936 | Ga0207670_10035833 | Ga0207670_100358332 | 243 |
| 209 | 3300025937 | Ga0207669_10023774 | Ga0207669_100237744 | 243 |
| 210 | 3300025940 | Ga0207691_10088217 | Ga0207691_100882173 | 243 |
| 211 | 3300025942 | Ga0207689_10038394 | Ga0207689_100383943 | 243 |
| 212 | 3300025944 | Ga0207661_10080436 | Ga0207661_100804361 | 243 |
| 213 | 3300025960 | Ga0207651_10128910 | Ga0207651_101289102 | 243 |
| 214 | 3300025960 | Ga0207651_10210603 | Ga0207651_102106032 | 243 |
| 215 | 3300025961 | Ga0207712_10008328 | Ga0207712_100083285 | 243 |
| 216 | 3300025981 | Ga0207640_10181520 | Ga0207640_101815202 | 243 |
| 217 | 3300025981 | Ga0207640_10385433 | Ga0207640_103854332 | 243 |
| 218 | 3300026075 | Ga0207708_10093652 | Ga0207708_100936521 | 243 |
| 219 | 3300026075 | Ga0207708_10227188 | Ga0207708_102271882 | 243 |
| 220 | 3300026095 | Ga0207676_10047826 | Ga0207676_100478263 | 243 |
| 221 | 3300026116 | Ga0207674_10185786 | Ga0207674_101857862 | 243 |
| 222 | 3300026116 | Ga0207674_10275169 | Ga0207674_102751692 | 243 |
| 223 | 3300027360 | Ga0209969_1018048 | Ga0209969_10180481 | 243 |
| 224 | 3300027395 | Ga0209996_1005842 | Ga0209996_10058422 | 243 |
| 225 | 3300027682 | Ga0209971_1009416 | Ga0209971_10094162 | 243 |
| 226 | 3300027695 | Ga0209966_1014624 | Ga0209966_10146242 | 243 |
| 227 | 3300027907 | Ga0207428_10013797 | Ga0207428_100137972 | 243 |
| 228 | 3300027907 | Ga0207428_10130760 | Ga0207428_101307602 | 243 |
| 229 | 3300028380 | Ga0268265_10002033 | Ga0268265_100020334 | 243 |
| 230 | 3300028381 | Ga0268264_10309156 | Ga0268264_103091562 | 243 |
| 231 | 3300028563 | Ga0265319_1079999 | Ga0265319_10799992 | 243 |
| 232 | 3300031548 | Ga0307408_100157637 | Ga0307408_1001576372 | 243 |
| 233 | 3300031901 | Ga0307406_10318118 | Ga0307406_103181182 | 243 |
| 234 | 3300031903 | Ga0307407_10115600 | Ga0307407_101156001 | 243 |
| 235 | 3300032002 | Ga0307416_100076909 | Ga0307416_1000769094 | 243 |
| 236 | 3300032005 | Ga0307411_10235812 | Ga0307411_102358122 | 243 |
| 237 | 3300034818 | Ga0373950_0018298 | Ga0373950_0018298_182_922 | 243 |
| 238 | 3300035083 | Ga0373926_0088564 | Ga0373926_0088564_162_902 | 243 |
| 239 | 3300035085 | Ga0373929_0008806 | Ga0373929_0008806_1011_1748 | 243 |
| 240 | 3300035085 | Ga0373929_0011614 | Ga0373929_0011614_835_1575 | 243 |
| 241 | 3300035085 | Ga0373929_0043119 | Ga0373929_0043119_198_938 | 243 |
| 242 | 3300035089 | Ga0373944_0012480 | Ga0373944_0012480_1364_2104 | 243 |
| 243 | 3300035091 | Ga0373951_0005556 | Ga0373951_0005556_1372_2112 | 243 |
| 244 | 3300035092 | Ga0373952_0006139 | Ga0373952_0006139_683_1423 | 243 |
| 245 | 3300035112 | Ga0373932_0004300 | Ga0373932_0004300_1758_2498 | 243 |
| 246 | 3300035112 | Ga0373932_0066187 | Ga0373932_0066187_110_850 | 243 |
| 247 | 3300035114 | Ga0373939_0015963 | Ga0373939_0015963_961_1701 | 243 |
| 248 | 3300035116 | Ga0373945_0004386 | Ga0373945_0004386_3600_4340 | 243 |
| 249 | 3300035121 | Ga0373960_0029936 | Ga0373960_0029936_710_1450 | 243 |
| 250 | 3300035170 | Ga0373943_0137670 | Ga0373943_0137670_438_1178 | 243 |
| 251 | 3300035207 | Ga0373942_0011396 | Ga0373942_0011396_1358_2098 | 243 |
| 252 | 3300035691 | Ga0373931_0006888 | Ga0373931_0006888_3151_3891 | 243 |
| 253 | 3300035691 | Ga0373931_0024087 | Ga0373931_0024087_942_1682 | 243 |
| 254 | 3300035691 | Ga0373931_0026893 | Ga0373931_0026893_1787_2527 | 243 |
| 255 | 3300035692 | Ga0373935_0120149 | Ga0373935_0120149_60_800 | 243 |
| 256 | 3300035695 | Ga0373927_0018106 | Ga0373927_0018106_475_1215 | 243 |
| 257 | 3300035725 | Ga0373947_0164254 | Ga0373947_0164254_69_809 | 243 |
| 258 | 3300036401 | Ga0373937_0225314 | Ga0373937_0225314_19_759 | 243 |
| 259 | 3300037068 | Ga0373925_0084632 | Ga0373925_0084632_1173_1913 | 243 |
| 260 | 3300042001 | Ga0439441_027153 | Ga0439441_027153_306_1046 | 243 |
| 261 | 3300042013 | Ga0439456_030969 | Ga0439456_030969_222_962 | 243 |
| 262 | 3300042156 | Ga0439446_0007953 | Ga0439446_0007953_1652_2389 | 243 |
| 263 | 3300042436 | Ga0439435_0012673 | Ga0439435_0012673_623_1363 | 243 |
| 264 | 3300042876 | Ga0451577_0025631 | Ga0451577_0025631_784_1524 | 243 |
| 265 | 3300044673 | Ga0453683_0201124 | Ga0453683_0201124_122_862 | 243 |
| 266 | 3300044694 | Ga0466963_0192617 | Ga0466963_0192617_112_861 | 243 |
| 267 | 3300045051 | Ga0451576_0003058 | Ga0451576_0003058_17082_17822 | 243 |
| 268 | 3300045051 | Ga0451576_0024160 | Ga0451576_0024160_290_1030 | 243 |
| 269 | 3300045051 | Ga0451576_0135192 | Ga0451576_0135192_1659_2399 | 243 |
| 270 | 3300045051 | Ga0451576_0938594 | Ga0451576_0938594_129_869 | 243 |
| 271 | 3300045976 | Ga0466967_0523322 | Ga0466967_0523322_155_904 | 243 |
| 272 | 3300046454 | Ga0495592_0001709 | Ga0495592_0001709_4943_5683 | 243 |
| 273 | 3300046455 | Ga0495603_0022391 | Ga0495603_0022391_2671_3411 | 243 |
| 274 | 3300046461 | Ga0495641_0047349 | Ga0495641_0047349_83_823 | 243 |
| 275 | 3300046463 | Ga0495653_0044851 | Ga0495653_0044851_1966_2706 | 243 |
| 276 | 3300046472 | Ga0495580_0005831 | Ga0495580_0005831_4928_5668 | 243 |
| 277 | 3300046475 | Ga0495639_0006521 | Ga0495639_0006521_2882_3622 | 243 |
| 278 | 3300046511 | Ga0495608_0007174 | Ga0495608_0007174_5919_6659 | 243 |
| 279 | 3300046516 | Ga0495628_0001353 | Ga0495628_0001353_18630_19370 | 243 |
| 280 | 3300046516 | Ga0495628_0364153 | Ga0495628_0364153_131_871 | 243 |
| 281 | 3300046517 | Ga0495630_0004252 | Ga0495630_0004252_2262_3002 | 243 |
| 282 | 3300046517 | Ga0495630_0024806 | Ga0495630_0024806_377_1117 | 243 |
| 283 | 3300046526 | Ga0495666_0024399 | Ga0495666_0024399_1176_1916 | 243 |
| 284 | 3300046531 | Ga0495665_0028674 | Ga0495665_0028674_314_1054 | 243 |
| 285 | 3300046533 | Ga0495640_0001127 | Ga0495640_0001127_13062_13802 | 243 |
| 286 | 3300046533 | Ga0495640_0046916 | Ga0495640_0046916_1463_2203 | 243 |
| 287 | 3300046535 | Ga0495586_0002131 | Ga0495586_0002131_6193_6933 | 243 |
| 288 | 3300046535 | Ga0495586_0020997 | Ga0495586_0020997_1931_2671 | 243 |
| 289 | 3300046535 | Ga0495586_0046702 | Ga0495586_0046702_634_1374 | 243 |
| 290 | 3300046539 | Ga0495621_0012895 | Ga0495621_0012895_162_902 | 243 |
| 291 | 3300046543 | Ga0495645_0043454 | Ga0495645_0043454_1136_1876 | 243 |
| 292 | 3300046559 | Ga0495667_0007620 | Ga0495667_0007620_2325_3065 | 243 |
| 293 | 3300046615 | Ga0495656_0028453 | Ga0495656_0028453_165_905 | 243 |
| 294 | 3300046663 | Ga0495635_0066981 | Ga0495635_0066981_1313_2053 | 243 |
| 295 | 3300046663 | Ga0495635_0090539 | Ga0495635_0090539_480_1220 | 243 |
| 296 | 3300046664 | Ga0495659_0138713 | Ga0495659_0138713_157_897 | 243 |
| 297 | 3300046674 | Ga0495588_0050203 | Ga0495588_0050203_652_1392 | 243 |
| 298 | 3300046678 | Ga0495599_0001302 | Ga0495599_0001302_12422_13162 | 243 |
| 299 | 3300046681 | Ga0495647_0000583 | Ga0495647_0000583_9618_10358 | 243 |
| 300 | 3300046683 | Ga0495658_0002859 | Ga0495658_0002859_2742_3482 | 243 |
| 301 | 3300046684 | Ga0495669_0200987 | Ga0495669_0200987_100_840 | 243 |
| 302 | 3300046689 | Ga0495613_0011558 | Ga0495613_0011558_2744_3484 | 243 |
| 303 | 3300046689 | Ga0495613_0277321 | Ga0495613_0277321_169_909 | 243 |
| 304 | 3300047317 | Ga0495604_0008849 | Ga0495604_0008849_6131_6871 | 243 |
| 305 | 3300047318 | Ga0495636_0003358 | Ga0495636_0003358_3127_3867 | 243 |
| 306 | 3300047319 | Ga0495674_0115472 | Ga0495674_0115472_882_1622 | 243 |
| 307 | 3300047321 | Ga0495676_0025504 | Ga0495676_0025504_2007_2747 | 243 |
| 308 | 3300047322 | Ga0495680_0013546 | Ga0495680_0013546_6222_6962 | 243 |
| 309 | 3300048917 | Ga0496114_0657747 | Ga0496114_0657747_80_820 | 243 |
| 310 | 3300049568 | Ga0501031_0010261 | Ga0501031_0010261_1276_2016 | 243 |
| 311 | 3300049568 | Ga0501031_0244256 | Ga0501031_0244256_296_1036 | 243 |
| 312 | 3300049569 | Ga0501032_0095248 | Ga0501032_0095248_1138_1878 | 243 |
| 313 | 3300049571 | Ga0501034_0526711 | Ga0501034_0526711_50_790 | 243 |
| 314 | 3300049572 | Ga0501036_0005674 | Ga0501036_0005674_7934_8674 | 243 |
| 315 | 3300049572 | Ga0501036_0268433 | Ga0501036_0268433_366_1106 | 243 |
| 316 | 3300049572 | Ga0501036_0314199 | Ga0501036_0314199_76_816 | 243 |
| 317 | 3300049573 | Ga0501037_0053793 | Ga0501037_0053793_16_756 | 243 |
| 318 | 3300049574 | Ga0501038_0001436 | Ga0501038_0001436_14503_15243 | 243 |
| 319 | 3300049574 | Ga0501038_0439717 | Ga0501038_0439717_42_782 | 243 |
| 320 | 3300049575 | Ga0501039_0000694 | Ga0501039_0000694_14034_14774 | 243 |
| 321 | 3300049575 | Ga0501039_0164874 | Ga0501039_0164874_420_1160 | 243 |
| 322 | 3300049576 | Ga0501040_0000067 | Ga0501040_0000067_23501_24241 | 243 |
| 323 | 3300049576 | Ga0501040_0037972 | Ga0501040_0037972_1168_1908 | 243 |
| 324 | 3300049576 | Ga0501040_0157012 | Ga0501040_0157012_52_792 | 243 |
| 325 | 3300049577 | Ga0501041_0000874 | Ga0501041_0000874_3940_4680 | 243 |
| 326 | 3300049577 | Ga0501041_0011051 | Ga0501041_0011051_2884_3624 | 243 |
| 327 | 3300049577 | Ga0501041_0013257 | Ga0501041_0013257_3954_4694 | 243 |
| 328 | 3300049578 | Ga0501042_0053316 | Ga0501042_0053316_1212_1952 | 243 |
| 329 | 3300049578 | Ga0501042_0079039 | Ga0501042_0079039_1095_1835 | 243 |
| 330 | 3300049579 | Ga0501043_0010087 | Ga0501043_0010087_6617_7357 | 243 |
| 331 | 3300049580 | Ga0501046_0000275 | Ga0501046_0000275_25435_26175 | 243 |
| 332 | 3300049580 | Ga0501046_0062584 | Ga0501046_0062584_983_1723 | 243 |
| 333 | 3300049580 | Ga0501046_0076011 | Ga0501046_0076011_583_1323 | 243 |
| 334 | 3300049581 | Ga0501047_0143232 | Ga0501047_0143232_498_1238 | 243 |
| 335 | 3300049582 | Ga0501048_0006864 | Ga0501048_0006864_1116_1856 | 243 |
| 336 | 3300049584 | Ga0501068_0008721 | Ga0501068_0008721_523_1263 | 243 |
| 337 | 3300049586 | Ga0501070_0085885 | Ga0501070_0085885_643_1383 | 243 |
| 338 | 3300049587 | Ga0501071_0000835 | Ga0501071_0000835_5033_5773 | 243 |
| 339 | 3300049587 | Ga0501071_0001329 | Ga0501071_0001329_3055_3795 | 243 |
| 340 | 3300049588 | Ga0501072_0000569 | Ga0501072_0000569_24225_24965 | 243 |
| 341 | 3300049589 | Ga0501073_0099587 | Ga0501073_0099587_1102_1842 | 243 |
| 342 | 3300049591 | Ga0501075_0000011 | Ga0501075_0000011_25439_26179 | 243 |
| 343 | 3300049591 | Ga0501075_0017422 | Ga0501075_0017422_3380_4120 | 243 |
| 344 | 3300049591 | Ga0501075_0052860 | Ga0501075_0052860_1345_2085 | 243 |
| 345 | 3300049592 | Ga0501076_0000116 | Ga0501076_0000116_24495_25235 | 243 |
| 346 | 3300049592 | Ga0501076_0163471 | Ga0501076_0163471_494_1234 | 243 |
| 347 | 3300049593 | Ga0501077_0002528 | Ga0501077_0002528_1252_1992 | 243 |
| 348 | 3300049741 | Ga0501079_0000021 | Ga0501079_0000021_17958_18698 | 243 |
| 349 | 3300049741 | Ga0501079_0091240 | Ga0501079_0091240_226_966 | 243 |
| 350 | 3300049742 | Ga0501080_0000541 | Ga0501080_0000541_24568_25308 | 243 |
| 351 | 3300049742 | Ga0501080_0099389 | Ga0501080_0099389_951_1691 | 243 |
| 352 | 3300049822 | Ga0501035_0028477 | Ga0501035_0028477_1742_2482 | 243 |
| 353 | 3300049822 | Ga0501035_0428175 | Ga0501035_0428175_128_868 | 243 |
| 354 | 3300049823 | Ga0501044_0070209 | Ga0501044_0070209_122_862 | 243 |
| 355 | 3300049824 | Ga0501045_0000083 | Ga0501045_0000083_20721_21461 | 243 |
| 356 | 3300049824 | Ga0501045_0097323 | Ga0501045_0097323_543_1283 | 243 |
| 357 | 3300050507 | nmdc:mga05p37_185_c1 | nmdc:mga05p37_185_c1_13053_13793 | 243 |
| 358 | 3300050507 | nmdc:mga05p37_603703_c1 | nmdc:mga05p37_603703_c1_76_816 | 243 |
| 359 | 3300050508 | nmdc:mga09592_216241_c1 | nmdc:mga09592_216241_c1_814_1554 | 243 |
| 360 | 3300050508 | nmdc:mga09592_48434_c1 | nmdc:mga09592_48434_c1_705_1445 | 243 |
| 361 | 3300050509 | nmdc:mga0qj67_14400_c1 | nmdc:mga0qj67_14400_c1_644_1384 | 243 |
| 362 | 3300050509 | nmdc:mga0qj67_241468_c1 | nmdc:mga0qj67_241468_c1_632_1372 | 243 |
| 363 | 3300050509 | nmdc:mga0qj67_70071_c1 | nmdc:mga0qj67_70071_c1_1687_2427 | 243 |
| 364 | 3300050511 | nmdc:mga08y16_17298_c1 | nmdc:mga08y16_17298_c1_4764_5504 | 243 |
| 365 | 3300050511 | nmdc:mga08y16_218185_c1 | nmdc:mga08y16_218185_c1_448_1188 | 243 |
| 366 | 3300050511 | nmdc:mga08y16_460582_c1 | nmdc:mga08y16_460582_c1_185_925 | 243 |
| 367 | 3300050511 | nmdc:mga08y16_691535_c1 | nmdc:mga08y16_691535_c1_225_965 | 243 |
| 368 | 3300050512 | nmdc:mga0n895_1398_c1 | nmdc:mga0n895_1398_c1_10143_10883 | 243 |
| 369 | 3300050512 | nmdc:mga0n895_49171_c1 | nmdc:mga0n895_49171_c1_135_875 | 243 |
| 370 | 3300050513 | nmdc:mga0rr50_55212_c1 | nmdc:mga0rr50_55212_c1_333_1073 | 243 |
| 371 | 3300050514 | nmdc:mga08x19_237_c1 | nmdc:mga08x19_237_c1_26078_26815 | 243 |
| 372 | 3300050514 | nmdc:mga08x19_44645_c1 | nmdc:mga08x19_44645_c1_1453_2190 | 243 |
| 373 | 3300050515 | nmdc:mga0a205_167828_c1 | nmdc:mga0a205_167828_c1_768_1508 | 243 |
| 374 | 3300050515 | nmdc:mga0a205_421438_c1 | nmdc:mga0a205_421438_c1_291_1031 | 243 |
| 375 | 3300050515 | nmdc:mga0a205_927_c1 | nmdc:mga0a205_927_c1_10922_11662 | 243 |
| 376 | 3300053085 | Ga0495619_0042507 | Ga0495619_0042507_968_1708 | 243 |
| 377 | 3300053094 | Ga0500566_0121836 | Ga0500566_0121836_376_1116 | 243 |
| 378 | 3300054114 | Ga0501084_0001429 | Ga0501084_0001429_14291_15031 | 243 |
| 379 | 3300054114 | Ga0501084_0107797 | Ga0501084_0107797_1035_1775 | 243 |
| 380 | 3300054114 | Ga0501084_0119967 | Ga0501084_0119967_813_1553 | 243 |
| 381 | 3300059421 | Ga0590071_055710 | Ga0590071_055710_104_844 | 243 |
| 382 | 3300059426 | Ga0590077_030192 | Ga0590077_030192_37_777 | 243 |
| 383 | 3300060353 | Ga0501082_0000807 | Ga0501082_0000807_8825_9565 | 243 |
| 384 | 3300060353 | Ga0501082_0025869 | Ga0501082_0025869_3988_4728 | 243 |
| 385 | 3300060353 | Ga0501082_0088946 | Ga0501082_0088946_148_888 | 243 |
| 386 | 3300061734 | Ga0530510_0000146 | Ga0530510_0000146_16928_17668 | 243 |
| 387 | iso_pu_bacteria | 2507262055 | 2507507471 | 243 |
| 388 | iso_pu_bacteria | 2508501009 | 2508541586 | 243 |
| 389 | iso_pu_bacteria | 2508501042 | 2508692872 | 243 |
| 390 | iso_pu_bacteria | 2511231028 | 2511398096 | 243 |
| 391 | iso_pu_bacteria | 2513237092 | 2513621679 | 243 |
| 392 | iso_pu_bacteria | 2513237094 | 2513636886 | 243 |
| 393 | iso_pu_bacteria | 2513237102 | 2513703911 | 243 |
| 394 | iso_pu_bacteria | 2513237104 | 2513721500 | 243 |
| 395 | iso_pu_bacteria | 2513237139 | 2513878343 | 243 |
| 396 | iso_pu_bacteria | 2513237161 | 2514011729 | 243 |
| 397 | iso_pu_bacteria | 2515154112 | 2515626264 | 243 |
| 398 | iso_pu_bacteria | 2517093001 | 2517108201 | 243 |
| 399 | iso_pu_bacteria | 2524023205 | 2524436091 | 243 |
| 400 | iso_pu_bacteria | 2528768022 | 2528852853 | 243 |
| 401 | iso_pu_bacteria | 2558860112 | 2558913874 | 243 |
| 402 | iso_pu_bacteria | 2617270735 | 2617352731 | 243 |
| 403 | iso_pu_bacteria | 2744054633 | 2745080954 | 243 |
| 404 | iso_pu_bacteria | 2791355196 | 2793061069 | 243 |
| 405 | iso_pu_bacteria | 2802429603 | 2805920566 | 243 |
| 406 | iso_pu_bacteria | 2816332527 | 2818236754 | 243 |
| 407 | iso_pu_bacteria | 2824600985 | 2824602982 | 243 |
| 408 | iso_pu_bacteria | 2824609381 | 2824611795 | 243 |
| 409 | iso_pu_bacteria | 2824617872 | 2824622046 | 243 |
| 410 | iso_pu_bacteria | 2824626560 | 2824629310 | 243 |
| 411 | iso_pu_bacteria | 2824635225 | 2824642658 | 243 |
| 412 | iso_pu_bacteria | 2824644064 | 2824650498 | 243 |
| 413 | iso_pu_bacteria | 2824653114 | 2824655031 | 243 |
| 414 | iso_pu_bacteria | 2824671348 | 2824672309 | 243 |
| 415 | iso_pu_bacteria | 2824679649 | 2824682284 | 243 |
| 416 | iso_pu_bacteria | 2824687955 | 2824688808 | 243 |
| 417 | iso_pu_bacteria | 2824696289 | 2824702186 | 243 |
| 418 | iso_pu_bacteria | 2824704595 | 2824710659 | 243 |
| 419 | iso_pu_bacteria | 2824714736 | 2824720371 | 243 |
| 420 | iso_pu_bacteria | 2824723954 | 2824729064 | 243 |
| 421 | iso_pu_bacteria | 2824753945 | 2824762315 | 243 |
| 422 | iso_pu_bacteria | 2824763712 | 2824766540 | 243 |
| 423 | iso_pu_bacteria | 2824773399 | 2824776663 | 243 |
| 424 | iso_pu_bacteria | 2841941048 | 2841946408 | 243 |
| 425 | iso_pu_bacteria | 2841957949 | 2841965648 | 243 |
| 426 | iso_pu_bacteria | 2841974524 | 2841978410 | 243 |
| 427 | iso_pu_bacteria | 2847939898 | 2847947947 | 243 |
| 428 | iso_pu_bacteria | 2849076700 | 2849078205 | 243 |
| 429 | iso_pu_bacteria | 2874590934 | 2874598585 | 243 |
| 430 | iso_pu_bacteria | 2874645413 | 2874652039 | 243 |
| 431 | iso_pu_bacteria | 2876761206 | 2876768283 | 243 |
| 432 | iso_pu_bacteria | 2876771140 | 2876778624 | 243 |
| 433 | iso_pu_bacteria | 2876818435 | 2876823428 | 243 |
| 434 | iso_pu_bacteria | 2879074833 | 2879082417 | 243 |
| 435 | iso_pu_bacteria | 2879127579 | 2879131802 | 243 |
| 436 | iso_pu_bacteria | 2879142872 | 2879150138 | 243 |
| 437 | iso_pu_bacteria | 2888378607 | 2888385676 | 243 |
| 438 | iso_pu_bacteria | 2888388044 | 2888392591 | 243 |
| 439 | iso_pu_bacteria | 2888419890 | 2888425797 | 243 |
| 440 | iso_pu_bacteria | 2889914905 | 2889916923 | 243 |
| 441 | iso_pu_bacteria | 2904711408 | 2904711762 | 243 |
| 442 | iso_pu_bacteria | 2906626472 | 2906629343 | 243 |
| 443 | iso_pu_bacteria | 2922393267 | 2922396876 | 243 |
| 444 | iso_pu_bacteria | 2932794094 | 2932799627 | 243 |
| 445 | iso_pu_bacteria | 2935648319 | 2935651948 | 243 |
| 446 | iso_pu_bacteria | 2935656913 | 2935660079 | 243 |
| 447 | iso_pu_bacteria | 2935769743 | 2935776430 | 243 |
| 448 | iso_pu_bacteria | 2935777560 | 2935780831 | 243 |
| 449 | iso_pu_bacteria | 2935785616 | 2935792345 | 243 |
| 450 | iso_pu_bacteria | 2935793552 | 2935800480 | 243 |
| 451 | iso_pu_bacteria | 2935837841 | 2935842246 | 243 |
| 452 | iso_pu_bacteria | 2935883170 | 2935885712 | 243 |
| 453 | iso_pu_bacteria | 2935959822 | 2935962894 | 243 |
| 454 | iso_pu_bacteria | 2935975950 | 2935976339 | 243 |
| 455 | iso_pu_bacteria | 2935984226 | 2935987225 | 243 |
| 456 | iso_pu_bacteria | 2936011229 | 2936014495 | 243 |
| 457 | iso_pu_bacteria | 2936019824 | 2936023665 | 243 |
| 458 | iso_pu_bacteria | 2936028420 | 2936031308 | 243 |
| 459 | iso_pu_bacteria | 2936046547 | 2936049601 | 243 |
| 460 | iso_pu_bacteria | 2936055302 | 2936061183 | 243 |
| 461 | iso_pu_bacteria | 2941531003 | 2941531371 | 243 |
| 462 | iso_pu_bacteria | 3005483717 | 3005485594 | 243 |
| 463 | iso_pu_bacteria | 3005506211 | 3005508239 | 243 |
| 464 | iso_pu_bacteria | 3005587118 | 3005588256 | 243 |
| 465 | iso_pu_bacteria | 3005594810 | 3005600518 | 243 |
| 466 | iso_pu_bacteria | 8006926726 | 8006928631 | 243 |
| 467 | iso_pu_bacteria | 8016511872 | 8016520447 | 243 |
| 468 | iso_pu_bacteria | 8016522445 | 8016528509 | 243 |
| 469 | iso_pu_bacteria | 8016530956 | 8016533669 | 243 |
| 470 | iso_pu_bacteria | 8016557553 | 8016563590 | 243 |
| 471 | iso_pu_bacteria | 8016566248 | 8016571999 | 243 |
| 472 | iso_pu_bacteria | 8016575299 | 8016576204 | 243 |
| 473 | iso_pu_bacteria | 8016583857 | 8016594580 | 243 |
| 474 | iso_pu_bacteria | 8016595262 | 8016601326 | 243 |
| 475 | iso_pu_bacteria | 8016603502 | 8016609102 | 243 |
| 476 | iso_pu_bacteria | 8016613128 | 8016615801 | 243 |
| 477 | iso_pu_bacteria | 8016622563 | 8016625433 | 243 |
| 478 | iso_pu_bacteria | 8019530166 | 8019533449 | 243 |
| 479 | iso_pu_bacteria | 8019547302 | 8019552482 | 243 |
| 480 | iso_pu_bacteria | 8019619141 | 8019620014 | 243 |
| 481 | iso_pu_bacteria | 8019629233 | 8019633091 | 243 |
| 482 | iso_pu_bacteria | 8019638758 | 8019646811 | 243 |
| 483 | iso_pu_bacteria | 8019648815 | 8019649577 | 243 |
| 484 | iso_pu_bacteria | 8019659431 | 8019660972 | 243 |
| 485 | iso_pu_bacteria | 8019668869 | 8019670533 | 243 |
| 486 | iso_pu_bacteria | 8019678201 | 8019685701 | 243 |
| 487 | 3300005441 | Ga0070700_100554647 | Ga0070700_1005546471 | 244 |
| 488 | 3300021388 | Ga0213875_10012736 | Ga0213875_100127362 | 244 |
| 489 | 3300025920 | Ga0207649_10201153 | Ga0207649_102011532 | 244 |
| 490 | 3300037853 | Ga0436364_0586291 | Ga0436364_0586291_66603_67337 | 244 |
| 491 | 3300009177 | Ga0105248_10044422 | Ga0105248_100444223 | 245 |
| 492 | 3300021384 | Ga0213876_10027678 | Ga0213876_100276783 | 245 |
| 493 | 3300039437 | Ga0436365_0401821 | Ga0436365_0401821_214_954 | 245 |
| 494 | 3300049572 | Ga0501036_0149482 | Ga0501036_0149482_1172_1927 | 245 |
| 495 | 3300049574 | Ga0501038_0037147 | Ga0501038_0037147_2458_3213 | 245 |
| 496 | 3300049579 | Ga0501043_0503702 | Ga0501043_0503702_77_832 | 245 |
| 497 | 3300049580 | Ga0501046_0154449 | Ga0501046_0154449_254_1000 | 245 |
| 498 | 3300049581 | Ga0501047_0019677 | Ga0501047_0019677_2672_3427 | 245 |
| 499 | 3300049582 | Ga0501048_0280439 | Ga0501048_0280439_68_823 | 245 |
| 500 | 3300049823 | Ga0501044_0036561 | Ga0501044_0036561_2122_2877 | 245 |
| 501 | iso_pu_bacteria | 2838122688 | 2838127390 | 245 |
| 502 | iso_pu_bacteria | 2841949485 | 2841957126 | 245 |
| 503 | iso_pu_bacteria | 2841966195 | 2841972918 | 245 |
| 504 | iso_pu_bacteria | 2841983080 | 2841987488 | 245 |
| 505 | iso_pu_bacteria | 2842038055 | 2842040843 | 245 |
| 506 | iso_pu_bacteria | 2842045827 | 2842046212 | 245 |
| 507 | iso_pu_bacteria | 2844315083 | 2844320206 | 245 |
| 508 | iso_pu_bacteria | 2847930680 | 2847937525 | 245 |
| 509 | iso_pu_bacteria | 2857509624 | 2857511361 | 245 |
| 510 | iso_pu_bacteria | 2874612657 | 2874616776 | 245 |
| 511 | iso_pu_bacteria | 2874620515 | 2874628272 | 245 |
| 512 | iso_pu_bacteria | 2874628541 | 2874630135 | 245 |
| 513 | iso_pu_bacteria | 2879083081 | 2879084938 | 245 |
| 514 | iso_pu_bacteria | 2879099564 | 2879107906 | 245 |
| 515 | iso_pu_bacteria | 2881364244 | 2881370102 | 245 |
| 516 | iso_pu_bacteria | 2881665667 | 2881670104 | 245 |
| 517 | iso_pu_bacteria | 2885366525 | 2885370162 | 245 |
| 518 | iso_pu_bacteria | 2885409591 | 2885414354 | 245 |
| 519 | iso_pu_bacteria | 2903727486 | 2903731204 | 245 |
| 520 | iso_pu_bacteria | 2904666416 | 2904674109 | 245 |
| 521 | iso_pu_bacteria | 2906602504 | 2906610029 | 245 |
| 522 | iso_pu_bacteria | 2906643746 | 2906645521 | 245 |
| 523 | iso_pu_bacteria | 2929615660 | 2929621236 | 245 |
| 524 | iso_pu_bacteria | 2929624759 | 2929625933 | 245 |
| 525 | iso_pu_bacteria | 2932784394 | 2932785178 | 245 |
| 526 | iso_pu_bacteria | 2932801729 | 2932808782 | 245 |
| 527 | iso_pu_bacteria | 2932809354 | 2932810205 | 245 |
| 528 | iso_pu_bacteria | 2932818245 | 2932821778 | 245 |
| 529 | iso_pu_bacteria | 2932828146 | 2932829014 | 245 |
| 530 | iso_pu_bacteria | 2933577622 | 2933582895 | 245 |
| 531 | iso_pu_bacteria | 2935608549 | 2935610023 | 245 |
| 532 | iso_pu_bacteria | 2935616580 | 2935619566 | 245 |
| 533 | iso_pu_bacteria | 2935638405 | 2935638546 | 245 |
| 534 | iso_pu_bacteria | 2935665750 | 2935666602 | 245 |
| 535 | iso_pu_bacteria | 2935675223 | 2935682214 | 245 |
| 536 | iso_pu_bacteria | 2935684952 | 2935691130 | 245 |
| 537 | iso_pu_bacteria | 2935694250 | 2935694439 | 245 |
| 538 | iso_pu_bacteria | 2935703347 | 2935703552 | 245 |
| 539 | iso_pu_bacteria | 2935713505 | 2935718511 | 245 |
| 540 | iso_pu_bacteria | 2935722832 | 2935727509 | 245 |
| 541 | iso_pu_bacteria | 2935732158 | 2935736212 | 245 |
| 542 | iso_pu_bacteria | 2935741537 | 2935745592 | 245 |
| 543 | iso_pu_bacteria | 2935750917 | 2935755973 | 245 |
| 544 | iso_pu_bacteria | 2935760218 | 2935760765 | 245 |
| 545 | iso_pu_bacteria | 2935801545 | 2935801689 | 245 |
| 546 | iso_pu_bacteria | 2935810662 | 2935814895 | 245 |
| 547 | iso_pu_bacteria | 2935819856 | 2935823183 | 245 |
| 548 | iso_pu_bacteria | 2935827899 | 2935828040 | 245 |
| 549 | iso_pu_bacteria | 2935847175 | 2935848765 | 245 |
| 550 | iso_pu_bacteria | 2935855204 | 2935858118 | 245 |
| 551 | iso_pu_bacteria | 2935864058 | 2935868023 | 245 |
| 552 | iso_pu_bacteria | 2935873716 | 2935873954 | 245 |
| 553 | iso_pu_bacteria | 2935908558 | 2935909430 | 245 |
| 554 | iso_pu_bacteria | 2935916978 | 2935917153 | 245 |
| 555 | iso_pu_bacteria | 2935926038 | 2935926911 | 245 |
| 556 | iso_pu_bacteria | 2935934488 | 2935937245 | 245 |
| 557 | iso_pu_bacteria | 2935942939 | 2935944452 | 245 |
| 558 | iso_pu_bacteria | 2935951376 | 2935952889 | 245 |
| 559 | iso_pu_bacteria | 2935967501 | 2935969729 | 245 |
| 560 | iso_pu_bacteria | 2935992306 | 2935993122 | 245 |
| 561 | iso_pu_bacteria | 2936002035 | 2936003059 | 245 |
| 562 | iso_pu_bacteria | 2936037263 | 2936040462 | 245 |
| 563 | iso_pu_bacteria | 2940556831 | 2940562052 | 245 |
| 564 | iso_pu_bacteria | 2941538514 | 2941542294 | 245 |
| 565 | iso_pu_bacteria | 3005710791 | 3005715991 | 245 |
| 566 | iso_pu_bacteria | 3005718088 | 3005723347 | 245 |
| 567 | iso_pu_bacteria | 8017057580 | 8017065128 | 245 |
| 568 | iso_pu_bacteria | 8019576017 | 8019584518 | 245 |
| 569 | iso_pu_bacteria | 8019586578 | 8019592288 | 245 |
| 570 | iso_pu_bacteria | 8019597564 | 8019598996 | 245 |
| 571 | iso_pu_bacteria | 8019687851 | 8019691277 | 245 |
| 572 | iso_pu_bacteria | 8055742211 | 8055744902 | 245 |
| 573 | iso_pu_bacteria | 8056967851 | 8056974875 | 245 |
| 574 | 3300005329 | Ga0070683_100012136 | Ga0070683_1000121363 | 246 |
| 575 | 3300005336 | Ga0070680_100010478 | Ga0070680_1000104785 | 246 |
| 576 | 3300005336 | Ga0070680_100126238 | Ga0070680_1001262382 | 246 |
| 577 | 3300005336 | Ga0070680_100171076 | Ga0070680_1001710763 | 246 |
| 578 | 3300005366 | Ga0070659_100107110 | Ga0070659_1001071103 | 246 |
| 579 | 3300005434 | Ga0070709_10083482 | Ga0070709_100834823 | 246 |
| 580 | 3300005434 | Ga0070709_10446400 | Ga0070709_104464001 | 246 |
| 581 | 3300005435 | Ga0070714_100165838 | Ga0070714_1001658381 | 246 |
| 582 | 3300005458 | Ga0070681_10334996 | Ga0070681_103349962 | 246 |
| 583 | 3300005530 | Ga0070679_100020326 | Ga0070679_1000203266 | 246 |
| 584 | 3300005530 | Ga0070679_100045886 | Ga0070679_1000458864 | 246 |
| 585 | 3300005530 | Ga0070679_100130755 | Ga0070679_1001307551 | 246 |
| 586 | 3300005535 | Ga0070684_100007833 | Ga0070684_1000078334 | 246 |
| 587 | 3300005539 | Ga0068853_100089144 | Ga0068853_1000891443 | 246 |
| 588 | 3300005539 | Ga0068853_100323594 | Ga0068853_1003235942 | 246 |
| 589 | 3300005548 | Ga0070665_100187732 | Ga0070665_1001877322 | 246 |
| 590 | 3300005563 | Ga0068855_100876680 | Ga0068855_1008766801 | 246 |
| 591 | 3300005577 | Ga0068857_100091731 | Ga0068857_1000917313 | 246 |
| 592 | 3300005578 | Ga0068854_100126259 | Ga0068854_1001262592 | 246 |
| 593 | 3300005614 | Ga0068856_100011621 | Ga0068856_1000116216 | 246 |
| 594 | 3300005614 | Ga0068856_100018079 | Ga0068856_1000180793 | 246 |
| 595 | 3300005614 | Ga0068856_100242713 | Ga0068856_1002427132 | 246 |
| 596 | 3300005616 | Ga0068852_100047090 | Ga0068852_1000470905 | 246 |
| 597 | 3300005616 | Ga0068852_100220473 | Ga0068852_1002204732 | 246 |
| 598 | 3300005617 | Ga0068859_101082384 | Ga0068859_1010823841 | 246 |
| 599 | 3300005843 | Ga0068860_100043129 | Ga0068860_1000431292 | 246 |
| 600 | 3300006195 | Ga0075366_10016147 | Ga0075366_100161474 | 246 |
| 601 | 3300006931 | Ga0097620_101082357 | Ga0097620_1010823571 | 246 |
| 602 | 3300009093 | Ga0105240_10061780 | Ga0105240_100617802 | 246 |
| 603 | 3300009093 | Ga0105240_10185517 | Ga0105240_101855173 | 246 |
| 604 | 3300009093 | Ga0105240_10354189 | Ga0105240_103541892 | 246 |
| 605 | 3300009094 | Ga0111539_11059332 | Ga0111539_110593321 | 246 |
| 606 | 3300009545 | Ga0105237_10019921 | Ga0105237_100199214 | 246 |
| 607 | 3300009545 | Ga0105237_10177319 | Ga0105237_101773191 | 246 |
| 608 | 3300009551 | Ga0105238_10013345 | Ga0105238_100133456 | 246 |
| 609 | 3300009551 | Ga0105238_10116350 | Ga0105238_101163501 | 246 |
| 610 | 3300009551 | Ga0105238_10352274 | Ga0105238_103522742 | 246 |
| 611 | 3300010375 | Ga0105239_10114449 | Ga0105239_101144493 | 246 |
| 612 | 3300010375 | Ga0105239_10626865 | Ga0105239_106268651 | 246 |
| 613 | 3300013105 | Ga0157369_10082359 | Ga0157369_100823592 | 246 |
| 614 | 3300013105 | Ga0157369_10120684 | Ga0157369_101206844 | 246 |
| 615 | 3300013296 | Ga0157374_10009522 | Ga0157374_100095224 | 246 |
| 616 | 3300013306 | Ga0163162_10333361 | Ga0163162_103333612 | 246 |
| 617 | 3300020069 | Ga0197907_10076814 | Ga0197907_100768141 | 246 |
| 618 | 3300025900 | Ga0207710_10249368 | Ga0207710_102493682 | 246 |
| 619 | 3300025904 | Ga0207647_10080520 | Ga0207647_100805202 | 246 |
| 620 | 3300025906 | Ga0207699_10018431 | Ga0207699_100184313 | 246 |
| 621 | 3300025906 | Ga0207699_10247025 | Ga0207699_102470252 | 246 |
| 622 | 3300025912 | Ga0207707_10000886 | Ga0207707_100008864 | 246 |
| 623 | 3300025912 | Ga0207707_10223411 | Ga0207707_102234113 | 246 |
| 624 | 3300025913 | Ga0207695_10100999 | Ga0207695_101009992 | 246 |
| 625 | 3300025914 | Ga0207671_10037498 | Ga0207671_100374982 | 246 |
| 626 | 3300025915 | Ga0207693_10040763 | Ga0207693_100407632 | 246 |
| 627 | 3300025916 | Ga0207663_10572132 | Ga0207663_105721321 | 246 |
| 628 | 3300025917 | Ga0207660_10016752 | Ga0207660_100167524 | 246 |
| 629 | 3300025917 | Ga0207660_10018336 | Ga0207660_100183363 | 246 |
| 630 | 3300025917 | Ga0207660_10061026 | Ga0207660_100610261 | 246 |
| 631 | 3300025921 | Ga0207652_10028071 | Ga0207652_100280714 | 246 |
| 632 | 3300025921 | Ga0207652_10145041 | Ga0207652_101450412 | 246 |
| 633 | 3300025921 | Ga0207652_10384907 | Ga0207652_103849072 | 246 |
| 634 | 3300025924 | Ga0207694_10276676 | Ga0207694_102766762 | 246 |
| 635 | 3300025928 | Ga0207700_10049267 | Ga0207700_100492671 | 246 |
| 636 | 3300025929 | Ga0207664_10108586 | Ga0207664_101085862 | 246 |
| 637 | 3300025944 | Ga0207661_10028588 | Ga0207661_100285883 | 246 |
| 638 | 3300025944 | Ga0207661_10042658 | Ga0207661_100426583 | 246 |
| 639 | 3300025986 | Ga0207658_10587423 | Ga0207658_105874232 | 246 |
| 640 | 3300026041 | Ga0207639_10053692 | Ga0207639_100536923 | 246 |
| 641 | 3300026041 | Ga0207639_10140624 | Ga0207639_101406243 | 246 |
| 642 | 3300026041 | Ga0207639_10337528 | Ga0207639_103375281 | 246 |
| 643 | 3300026078 | Ga0207702_10000052 | Ga0207702_1000005284 | 246 |
| 644 | 3300026078 | Ga0207702_10035413 | Ga0207702_100354134 | 246 |
| 645 | 3300026095 | Ga0207676_10791364 | Ga0207676_107913641 | 246 |
| 646 | 3300026116 | Ga0207674_10113796 | Ga0207674_101137963 | 246 |
| 647 | 3300026121 | Ga0207683_10953198 | Ga0207683_109531981 | 246 |
| 648 | 3300026142 | Ga0207698_10124070 | Ga0207698_101240702 | 246 |
| 649 | 3300028381 | Ga0268264_10142466 | Ga0268264_101424661 | 246 |
| 650 | 3300031247 | Ga0265340_10120833 | Ga0265340_101208332 | 246 |
| 651 | 3300031249 | Ga0265339_10152391 | Ga0265339_101523911 | 246 |
| 652 | 3300031344 | Ga0265316_10187146 | Ga0265316_101871462 | 246 |
| 653 | 3300032002 | Ga0307416_100042761 | Ga0307416_1000427612 | 246 |
| 654 | 3300035086 | Ga0373934_0009337 | Ga0373934_0009337_189_938 | 246 |
| 655 | 3300035111 | Ga0373923_0004076 | Ga0373923_0004076_3877_4626 | 246 |
| 656 | 3300035111 | Ga0373923_0062235 | Ga0373923_0062235_194_943 | 246 |
| 657 | 3300035113 | Ga0373936_0102151 | Ga0373936_0102151_295_1044 | 246 |
| 658 | 3300035116 | Ga0373945_0003594 | Ga0373945_0003594_504_1253 | 246 |
| 659 | 3300035117 | Ga0373953_0000715 | Ga0373953_0000715_5956_6705 | 246 |
| 660 | 3300035118 | Ga0373954_0000084 | Ga0373954_0000084_30241_30990 | 246 |
| 661 | 3300035119 | Ga0373956_0027703 | Ga0373956_0027703_1092_1841 | 246 |
| 662 | 3300035120 | Ga0373957_0004322 | Ga0373957_0004322_647_1396 | 246 |
| 663 | 3300035172 | Ga0373955_0000301 | Ga0373955_0000301_4432_5181 | 246 |
| 664 | 3300035172 | Ga0373955_0024108 | Ga0373955_0024108_797_1546 | 246 |
| 665 | 3300035410 | Ga0373924_0003265 | Ga0373924_0003265_503_1252 | 246 |
| 666 | 3300035410 | Ga0373924_0004344 | Ga0373924_0004344_1522_2271 | 246 |
| 667 | 3300035695 | Ga0373927_0266483 | Ga0373927_0266483_134_883 | 246 |
| 668 | 3300035724 | Ga0373933_0000951 | Ga0373933_0000951_14555_15304 | 246 |
| 669 | 3300035724 | Ga0373933_0032348 | Ga0373933_0032348_924_1673 | 246 |
| 670 | 3300035725 | Ga0373947_0026018 | Ga0373947_0026018_2021_2770 | 246 |
| 671 | 3300036401 | Ga0373937_0008455 | Ga0373937_0008455_7813_8562 | 246 |
| 672 | 3300037418 | Ga0395900_0008575 | Ga0395900_0008575_1558_2307 | 246 |
| 673 | 3300037466 | Ga0395898_0035192 | Ga0395898_0035192_276_1025 | 246 |
| 674 | 3300038443 | Ga0395901_0127744 | Ga0395901_0127744_1572_2321 | 246 |
| 675 | 3300039437 | Ga0436365_0812156 | Ga0436365_0812156_65_814 | 246 |
| 676 | 3300039450 | Ga0436363_0884224 | Ga0436363_0884224_573_1322 | 246 |
| 677 | 3300044693 | Ga0466961_0033127 | Ga0466961_0033127_2436_3200 | 246 |
| 678 | 3300044735 | Ga0466968_0286535 | Ga0466968_0286535_11_760 | 246 |
| 679 | 3300044842 | Ga0466957_0127298 | Ga0466957_0127298_719_1483 | 246 |
| 680 | 3300045049 | Ga0466959_0047848 | Ga0466959_0047848_377_1141 | 246 |
| 681 | 3300045976 | Ga0466967_0167498 | Ga0466967_0167498_28_777 | 246 |
| 682 | 3300045976 | Ga0466967_0234169 | Ga0466967_0234169_496_1245 | 246 |
| 683 | 3300046454 | Ga0495592_0016467 | Ga0495592_0016467_574_1323 | 246 |
| 684 | 3300046454 | Ga0495592_0059743 | Ga0495592_0059743_1078_1827 | 246 |
| 685 | 3300046455 | Ga0495603_0023839 | Ga0495603_0023839_1633_2382 | 246 |
| 686 | 3300046459 | Ga0495629_0003566 | Ga0495629_0003566_4302_5051 | 246 |
| 687 | 3300046459 | Ga0495629_0065560 | Ga0495629_0065560_797_1546 | 246 |
| 688 | 3300046463 | Ga0495653_0002541 | Ga0495653_0002541_5978_6727 | 246 |
| 689 | 3300046472 | Ga0495580_0018121 | Ga0495580_0018121_777_1526 | 246 |
| 690 | 3300046473 | Ga0495582_0016731 | Ga0495582_0016731_293_1042 | 246 |
| 691 | 3300046475 | Ga0495639_0051667 | Ga0495639_0051667_152_901 | 246 |
| 692 | 3300046477 | Ga0495664_0012490 | Ga0495664_0012490_3506_4255 | 246 |
| 693 | 3300046477 | Ga0495664_0103801 | Ga0495664_0103801_314_1063 | 246 |
| 694 | 3300046511 | Ga0495608_0030932 | Ga0495608_0030932_1391_2140 | 246 |
| 695 | 3300046511 | Ga0495608_0095790 | Ga0495608_0095790_1090_1839 | 246 |
| 696 | 3300046514 | Ga0495618_0020969 | Ga0495618_0020969_2670_3419 | 246 |
| 697 | 3300046514 | Ga0495618_0043985 | Ga0495618_0043985_2034_2783 | 246 |
| 698 | 3300046516 | Ga0495628_0010524 | Ga0495628_0010524_5442_6191 | 246 |
| 699 | 3300046517 | Ga0495630_0023538 | Ga0495630_0023538_3155_3904 | 246 |
| 700 | 3300046526 | Ga0495666_0064310 | Ga0495666_0064310_202_951 | 246 |
| 701 | 3300046533 | Ga0495640_0021531 | Ga0495640_0021531_574_1323 | 246 |
| 702 | 3300046533 | Ga0495640_0030787 | Ga0495640_0030787_2490_3239 | 246 |
| 703 | 3300046536 | Ga0495587_0008387 | Ga0495587_0008387_4421_5170 | 246 |
| 704 | 3300046543 | Ga0495645_0002913 | Ga0495645_0002913_119_868 | 246 |
| 705 | 3300046543 | Ga0495645_0021817 | Ga0495645_0021817_1150_1899 | 246 |
| 706 | 3300046559 | Ga0495667_0007315 | Ga0495667_0007315_1525_2274 | 246 |
| 707 | 3300046642 | Ga0495634_0012018 | Ga0495634_0012018_3024_3773 | 246 |
| 708 | 3300046642 | Ga0495634_0013010 | Ga0495634_0013010_1894_2643 | 246 |
| 709 | 3300046663 | Ga0495635_0002810 | Ga0495635_0002810_4394_5143 | 246 |
| 710 | 3300046663 | Ga0495635_0049929 | Ga0495635_0049929_1949_2698 | 246 |
| 711 | 3300046674 | Ga0495588_0064104 | Ga0495588_0064104_1000_1749 | 246 |
| 712 | 3300046675 | Ga0495657_0001354 | Ga0495657_0001354_11043_11792 | 246 |
| 713 | 3300046678 | Ga0495599_0005290 | Ga0495599_0005290_6929_7678 | 246 |
| 714 | 3300046678 | Ga0495599_0030205 | Ga0495599_0030205_1690_2439 | 246 |
| 715 | 3300046679 | Ga0495623_0017513 | Ga0495623_0017513_1935_2684 | 246 |
| 716 | 3300046680 | Ga0495646_0003632 | Ga0495646_0003632_4118_4867 | 246 |
| 717 | 3300046681 | Ga0495647_0009435 | Ga0495647_0009435_899_1648 | 246 |
| 718 | 3300046683 | Ga0495658_0038669 | Ga0495658_0038669_1403_2152 | 246 |
| 719 | 3300046689 | Ga0495613_0065191 | Ga0495613_0065191_1439_2188 | 246 |
| 720 | 3300046689 | Ga0495613_0118867 | Ga0495613_0118867_1012_1761 | 246 |
| 721 | 3300046809 | Ga0495600_0012950 | Ga0495600_0012950_3338_4087 | 246 |
| 722 | 3300047319 | Ga0495674_0018855 | Ga0495674_0018855_123_872 | 246 |
| 723 | 3300047322 | Ga0495680_0008905 | Ga0495680_0008905_6801_7550 | 246 |
| 724 | 3300047322 | Ga0495680_0210282 | Ga0495680_0210282_614_1363 | 246 |
| 725 | 3300047444 | Ga0495675_0006334 | Ga0495675_0006334_1279_2028 | 246 |
| 726 | 3300047471 | Ga0495684_0000777 | Ga0495684_0000777_4446_5195 | 246 |
| 727 | 3300047471 | Ga0495684_0004968 | Ga0495684_0004968_8795_9544 | 246 |
| 728 | 3300047673 | Ga0495593_0005870 | Ga0495593_0005870_2110_2859 | 246 |
| 729 | 3300047673 | Ga0495593_0044871 | Ga0495593_0044871_88_837 | 246 |
| 730 | 3300048088 | Ga0495602_0055388 | Ga0495602_0055388_1353_2102 | 246 |
| 731 | 3300048915 | Ga0496112_0330066 | Ga0496112_0330066_689_1438 | 246 |
| 732 | 3300048917 | Ga0496114_0014641 | Ga0496114_0014641_4173_4922 | 246 |
| 733 | 3300049580 | Ga0501046_0050186 | Ga0501046_0050186_2221_2970 | 246 |
| 734 | 3300049581 | Ga0501047_0010806 | Ga0501047_0010806_4682_5431 | 246 |
| 735 | 3300049586 | Ga0501070_0015659 | Ga0501070_0015659_5535_6284 | 246 |
| 736 | 3300049590 | Ga0501074_0059863 | Ga0501074_0059863_1080_1829 | 246 |
| 737 | 3300050493 | nmdc:mga0k408_14716_c1 | nmdc:mga0k408_14716_c1_668_1417 | 246 |
| 738 | 3300053077 | Ga0495601_0106738 | Ga0495601_0106738_22_771 | 246 |
| 739 | 3300053078 | Ga0495612_0013206 | Ga0495612_0013206_727_1476 | 246 |
| 740 | 3300053085 | Ga0495619_0000701 | Ga0495619_0000701_16812_17561 | 246 |
| 741 | 3300053085 | Ga0495619_0134532 | Ga0495619_0134532_663_1412 | 246 |
| 742 | 3300003215 | JGI25153J46596_10000317 | JGI25153J46596_1000031728 | 247 |
| 743 | 3300003215 | JGI25153J46596_10001194 | JGI25153J46596_1000119413 | 247 |
| 744 | 3300003215 | JGI25153J46596_10001553 | JGI25153J46596_100015533 | 247 |
| 745 | 3300003215 | JGI25153J46596_10006579 | JGI25153J46596_100065793 | 247 |
| 746 | 3300003354 | JGI25160J50197_1001548 | JGI25160J50197_10015484 | 247 |
| 747 | 3300003354 | JGI25160J50197_1006813 | JGI25160J50197_10068132 | 247 |
| 748 | 3300003354 | JGI25160J50197_1009493 | JGI25160J50197_10094934 | 247 |
| 749 | 3300004625 | Ga0055543_1030343 | Ga0055543_10303431 | 247 |
| 750 | 3300005262 | Ga0065165_1000747 | Ga0065165_100074734 | 247 |
| 751 | 3300005262 | Ga0065165_1001867 | Ga0065165_10018674 | 247 |
| 752 | 3300005262 | Ga0065165_1005506 | Ga0065165_10055069 | 247 |
| 753 | 3300005262 | Ga0065165_1022460 | Ga0065165_10224602 | 247 |
| 754 | 3300005328 | Ga0070676_10021860 | Ga0070676_100218603 | 247 |
| 755 | 3300005329 | Ga0070683_100012606 | Ga0070683_1000126063 | 247 |
| 756 | 3300005329 | Ga0070683_100143303 | Ga0070683_1001433032 | 247 |
| 757 | 3300005330 | Ga0070690_100053642 | Ga0070690_1000536423 | 247 |
| 758 | 3300005331 | Ga0070670_100001648 | Ga0070670_10000164814 | 247 |
| 759 | 3300005331 | Ga0070670_100353565 | Ga0070670_1003535652 | 247 |
| 760 | 3300005333 | Ga0070677_10110921 | Ga0070677_101109212 | 247 |
| 761 | 3300005336 | Ga0070680_100584232 | Ga0070680_1005842321 | 247 |
| 762 | 3300005336 | Ga0070680_100603539 | Ga0070680_1006035391 | 247 |
| 763 | 3300005338 | Ga0068868_100000130 | Ga0068868_1000001308 | 247 |
| 764 | 3300005338 | Ga0068868_100090667 | Ga0068868_1000906673 | 247 |
| 765 | 3300005339 | Ga0070660_100045797 | Ga0070660_1000457973 | 247 |
| 766 | 3300005339 | Ga0070660_100136044 | Ga0070660_1001360442 | 247 |
| 767 | 3300005341 | Ga0070691_10023957 | Ga0070691_100239572 | 247 |
| 768 | 3300005341 | Ga0070691_10055300 | Ga0070691_100553001 | 247 |
| 769 | 3300005341 | Ga0070691_10101246 | Ga0070691_101012462 | 247 |
| 770 | 3300005341 | Ga0070691_10106762 | Ga0070691_101067622 | 247 |
| 771 | 3300005344 | Ga0070661_100086188 | Ga0070661_1000861882 | 247 |
| 772 | 3300005347 | Ga0070668_100002013 | Ga0070668_1000020132 | 247 |
| 773 | 3300005354 | Ga0070675_100006171 | Ga0070675_1000061718 | 247 |
| 774 | 3300005355 | Ga0070671_100000330 | Ga0070671_10000033014 | 247 |
| 775 | 3300005355 | Ga0070671_100013367 | Ga0070671_1000133674 | 247 |
| 776 | 3300005364 | Ga0070673_100000435 | Ga0070673_10000043513 | 247 |
| 777 | 3300005364 | Ga0070673_100043909 | Ga0070673_1000439092 | 247 |
| 778 | 3300005365 | Ga0070688_100151679 | Ga0070688_1001516792 | 247 |
| 779 | 3300005366 | Ga0070659_100091369 | Ga0070659_1000913692 | 247 |
| 780 | 3300005367 | Ga0070667_100020332 | Ga0070667_1000203325 | 247 |
| 781 | 3300005367 | Ga0070667_100038796 | Ga0070667_1000387963 | 247 |
| 782 | 3300005367 | Ga0070667_100266954 | Ga0070667_1002669542 | 247 |
| 783 | 3300005406 | Ga0070703_10001535 | Ga0070703_100015359 | 247 |
| 784 | 3300005406 | Ga0070703_10042987 | Ga0070703_100429871 | 247 |
| 785 | 3300005438 | Ga0070701_10013024 | Ga0070701_100130244 | 247 |
| 786 | 3300005440 | Ga0070705_100000415 | Ga0070705_1000004154 | 247 |
| 787 | 3300005441 | Ga0070700_100002043 | Ga0070700_1000020432 | 247 |
| 788 | 3300005441 | Ga0070700_100074201 | Ga0070700_1000742012 | 247 |
| 789 | 3300005444 | Ga0070694_100004365 | Ga0070694_1000043657 | 247 |
| 790 | 3300005455 | Ga0070663_100125193 | Ga0070663_1001251932 | 247 |
| 791 | 3300005455 | Ga0070663_100130104 | Ga0070663_1001301042 | 247 |
| 792 | 3300005455 | Ga0070663_100353265 | Ga0070663_1003532651 | 247 |
| 793 | 3300005456 | Ga0070678_100000210 | Ga0070678_10000021018 | 247 |
| 794 | 3300005457 | Ga0070662_100048811 | Ga0070662_1000488113 | 247 |
| 795 | 3300005458 | Ga0070681_10009637 | Ga0070681_100096371 | 247 |
| 796 | 3300005458 | Ga0070681_10016908 | Ga0070681_100169086 | 247 |
| 797 | 3300005458 | Ga0070681_10029114 | Ga0070681_100291143 | 247 |
| 798 | 3300005458 | Ga0070681_10110336 | Ga0070681_101103361 | 247 |
| 799 | 3300005459 | Ga0068867_100004550 | Ga0068867_1000045504 | 247 |
| 800 | 3300005459 | Ga0068867_100009475 | Ga0068867_1000094753 | 247 |
| 801 | 3300005459 | Ga0068867_100125954 | Ga0068867_1001259542 | 247 |
| 802 | 3300005467 | Ga0070706_100009522 | Ga0070706_1000095226 | 247 |
| 803 | 3300005468 | Ga0070707_100272154 | Ga0070707_1002721541 | 247 |
| 804 | 3300005468 | Ga0070707_100452880 | Ga0070707_1004528801 | 247 |
| 805 | 3300005518 | Ga0070699_100000540 | Ga0070699_10000054045 | 247 |
| 806 | 3300005518 | Ga0070699_100076883 | Ga0070699_1000768832 | 247 |
| 807 | 3300005518 | Ga0070699_100256617 | Ga0070699_1002566172 | 247 |
| 808 | 3300005530 | Ga0070679_100003976 | Ga0070679_10000397612 | 247 |
| 809 | 3300005530 | Ga0070679_100014503 | Ga0070679_1000145034 | 247 |
| 810 | 3300005530 | Ga0070679_100091564 | Ga0070679_1000915643 | 247 |
| 811 | 3300005530 | Ga0070679_100246724 | Ga0070679_1002467241 | 247 |
| 812 | 3300005535 | Ga0070684_100054337 | Ga0070684_1000543372 | 247 |
| 813 | 3300005535 | Ga0070684_100067650 | Ga0070684_1000676503 | 247 |
| 814 | 3300005536 | Ga0070697_100035192 | Ga0070697_1000351922 | 247 |
| 815 | 3300005536 | Ga0070697_100069550 | Ga0070697_1000695504 | 247 |
| 816 | 3300005536 | Ga0070697_100103170 | Ga0070697_1001031702 | 247 |
| 817 | 3300005539 | Ga0068853_100003330 | Ga0068853_1000033304 | 247 |
| 818 | 3300005539 | Ga0068853_100032207 | Ga0068853_1000322073 | 247 |
| 819 | 3300005539 | Ga0068853_100573906 | Ga0068853_1005739061 | 247 |
| 820 | 3300005543 | Ga0070672_100003927 | Ga0070672_1000039275 | 247 |
| 821 | 3300005545 | Ga0070695_100000710 | Ga0070695_10000071017 | 247 |
| 822 | 3300005545 | Ga0070695_100015228 | Ga0070695_1000152285 | 247 |
| 823 | 3300005545 | Ga0070695_100153996 | Ga0070695_1001539962 | 247 |
| 824 | 3300005546 | Ga0070696_100022290 | Ga0070696_1000222906 | 247 |
| 825 | 3300005546 | Ga0070696_100257062 | Ga0070696_1002570621 | 247 |
| 826 | 3300005547 | Ga0070693_100086881 | Ga0070693_1000868812 | 247 |
| 827 | 3300005548 | Ga0070665_100071086 | Ga0070665_1000710862 | 247 |
| 828 | 3300005548 | Ga0070665_100128570 | Ga0070665_1001285702 | 247 |
| 829 | 3300005549 | Ga0070704_100000882 | Ga0070704_10000088214 | 247 |
| 830 | 3300005549 | Ga0070704_100356747 | Ga0070704_1003567472 | 247 |
| 831 | 3300005563 | Ga0068855_100007560 | Ga0068855_1000075604 | 247 |
| 832 | 3300005563 | Ga0068855_100178130 | Ga0068855_1001781302 | 247 |
| 833 | 3300005563 | Ga0068855_100196793 | Ga0068855_1001967932 | 247 |
| 834 | 3300005563 | Ga0068855_100216276 | Ga0068855_1002162761 | 247 |
| 835 | 3300005563 | Ga0068855_100467097 | Ga0068855_1004670972 | 247 |
| 836 | 3300005564 | Ga0070664_100026818 | Ga0070664_1000268184 | 247 |
| 837 | 3300005577 | Ga0068857_100002616 | Ga0068857_1000026163 | 247 |
| 838 | 3300005577 | Ga0068857_100010399 | Ga0068857_1000103993 | 247 |
| 839 | 3300005577 | Ga0068857_100022493 | Ga0068857_1000224932 | 247 |
| 840 | 3300005577 | Ga0068857_100395140 | Ga0068857_1003951402 | 247 |
| 841 | 3300005578 | Ga0068854_100007298 | Ga0068854_1000072985 | 247 |
| 842 | 3300005614 | Ga0068856_100334605 | Ga0068856_1003346051 | 247 |
| 843 | 3300005616 | Ga0068852_100000400 | Ga0068852_1000004008 | 247 |
| 844 | 3300005616 | Ga0068852_100156552 | Ga0068852_1001565522 | 247 |
| 845 | 3300005616 | Ga0068852_100360105 | Ga0068852_1003601052 | 247 |
| 846 | 3300005616 | Ga0068852_100713371 | Ga0068852_1007133711 | 247 |
| 847 | 3300005617 | Ga0068859_100001347 | Ga0068859_10000134718 | 247 |
| 848 | 3300005617 | Ga0068859_100004592 | Ga0068859_10000459212 | 247 |
| 849 | 3300005617 | Ga0068859_100066061 | Ga0068859_1000660614 | 247 |
| 850 | 3300005618 | Ga0068864_100001786 | Ga0068864_1000017867 | 247 |
| 851 | 3300005719 | Ga0068861_100002626 | Ga0068861_10000262617 | 247 |
| 852 | 3300005719 | Ga0068861_100230289 | Ga0068861_1002302891 | 247 |
| 853 | 3300005719 | Ga0068861_100340735 | Ga0068861_1003407352 | 247 |
| 854 | 3300005719 | Ga0068861_100644440 | Ga0068861_1006444401 | 247 |
| 855 | 3300005840 | Ga0068870_10035490 | Ga0068870_100354903 | 247 |
| 856 | 3300005840 | Ga0068870_10135581 | Ga0068870_101355811 | 247 |
| 857 | 3300005841 | Ga0068863_100025164 | Ga0068863_1000251642 | 247 |
| 858 | 3300005841 | Ga0068863_100039160 | Ga0068863_1000391603 | 247 |
| 859 | 3300005842 | Ga0068858_100005298 | Ga0068858_10000529810 | 247 |
| 860 | 3300005842 | Ga0068858_100421503 | Ga0068858_1004215032 | 247 |
| 861 | 3300005843 | Ga0068860_100006411 | Ga0068860_10000641112 | 247 |
| 862 | 3300005844 | Ga0068862_100032090 | Ga0068862_1000320904 | 247 |
| 863 | 3300005844 | Ga0068862_100108368 | Ga0068862_1001083682 | 247 |
| 864 | 3300005844 | Ga0068862_100171477 | Ga0068862_1001714772 | 247 |
| 865 | 3300005983 | Ga0081540_1000455 | Ga0081540_100045514 | 247 |
| 866 | 3300005983 | Ga0081540_1019188 | Ga0081540_10191886 | 247 |
| 867 | 3300006028 | Ga0070717_10001973 | Ga0070717_1000197314 | 247 |
| 868 | 3300006042 | Ga0075368_10000176 | Ga0075368_1000017610 | 247 |
| 869 | 3300006042 | Ga0075368_10008020 | Ga0075368_100080203 | 247 |
| 870 | 3300006048 | Ga0075363_100006512 | Ga0075363_1000065125 | 247 |
| 871 | 3300006048 | Ga0075363_100008153 | Ga0075363_1000081533 | 247 |
| 872 | 3300006048 | Ga0075363_100011597 | Ga0075363_1000115974 | 247 |
| 873 | 3300006048 | Ga0075363_100202052 | Ga0075363_1002020522 | 247 |
| 874 | 3300006051 | Ga0075364_10000375 | Ga0075364_100003759 | 247 |
| 875 | 3300006163 | Ga0070715_10099188 | Ga0070715_100991882 | 247 |
| 876 | 3300006173 | Ga0070716_100204847 | Ga0070716_1002048472 | 247 |
| 877 | 3300006175 | Ga0070712_100160328 | Ga0070712_1001603282 | 247 |
| 878 | 3300006177 | Ga0075362_10120141 | Ga0075362_101201411 | 247 |
| 879 | 3300006178 | Ga0075367_10000439 | Ga0075367_1000043913 | 247 |
| 880 | 3300006178 | Ga0075367_10012388 | Ga0075367_100123882 | 247 |
| 881 | 3300006195 | Ga0075366_10008178 | Ga0075366_100081782 | 247 |
| 882 | 3300006195 | Ga0075366_10044599 | Ga0075366_100445992 | 247 |
| 883 | 3300006195 | Ga0075366_10307762 | Ga0075366_103077622 | 247 |
| 884 | 3300006237 | Ga0097621_100001929 | Ga0097621_1000019295 | 247 |
| 885 | 3300006358 | Ga0068871_100757569 | Ga0068871_1007575691 | 247 |
| 886 | 3300006844 | Ga0075428_100105066 | Ga0075428_1001050663 | 247 |
| 887 | 3300006844 | Ga0075428_100236451 | Ga0075428_1002364513 | 247 |
| 888 | 3300006844 | Ga0075428_100276416 | Ga0075428_1002764162 | 247 |
| 889 | 3300006846 | Ga0075430_100010264 | Ga0075430_1000102642 | 247 |
| 890 | 3300006847 | Ga0075431_100006349 | Ga0075431_1000063498 | 247 |
| 891 | 3300006847 | Ga0075431_100094748 | Ga0075431_1000947482 | 247 |
| 892 | 3300006847 | Ga0075431_100325936 | Ga0075431_1003259362 | 247 |
| 893 | 3300006847 | Ga0075431_100592979 | Ga0075431_1005929791 | 247 |
| 894 | 3300006871 | Ga0075434_100344115 | Ga0075434_1003441151 | 247 |
| 895 | 3300006871 | Ga0075434_100404736 | Ga0075434_1004047362 | 247 |
| 896 | 3300006880 | Ga0075429_100023937 | Ga0075429_1000239372 | 247 |
| 897 | 3300006880 | Ga0075429_100243255 | Ga0075429_1002432552 | 247 |
| 898 | 3300006881 | Ga0068865_100293563 | Ga0068865_1002935631 | 247 |
| 899 | 3300006914 | Ga0075436_100002000 | Ga0075436_1000020006 | 247 |
| 900 | 3300006931 | Ga0097620_100001347 | Ga0097620_10000134718 | 247 |
| 901 | 3300006931 | Ga0097620_100004592 | Ga0097620_1000045924 | 247 |
| 902 | 3300006931 | Ga0097620_100066063 | Ga0097620_1000660634 | 247 |
| 903 | 3300006942 | Ga0099824_1014958 | Ga0099824_10149586 | 247 |
| 904 | 3300007076 | Ga0075435_100015371 | Ga0075435_10001537110 | 247 |
| 905 | 3300007076 | Ga0075435_100107534 | Ga0075435_1001075343 | 247 |
| 906 | 3300009093 | Ga0105240_10045969 | Ga0105240_100459691 | 247 |
| 907 | 3300009093 | Ga0105240_10119203 | Ga0105240_101192032 | 247 |
| 908 | 3300009093 | Ga0105240_10128638 | Ga0105240_101286383 | 247 |
| 909 | 3300009094 | Ga0111539_10001755 | Ga0111539_1000175517 | 247 |
| 910 | 3300009094 | Ga0111539_10117520 | Ga0111539_101175202 | 247 |
| 911 | 3300009094 | Ga0111539_10156457 | Ga0111539_101564572 | 247 |
| 912 | 3300009094 | Ga0111539_10613135 | Ga0111539_106131352 | 247 |
| 913 | 3300009094 | Ga0111539_11081060 | Ga0111539_110810601 | 247 |
| 914 | 3300009094 | Ga0111539_11318560 | Ga0111539_113185601 | 247 |
| 915 | 3300009147 | Ga0114129_10339853 | Ga0114129_103398533 | 247 |
| 916 | 3300009174 | Ga0105241_10003630 | Ga0105241_1000363011 | 247 |
| 917 | 3300009174 | Ga0105241_10012445 | Ga0105241_100124454 | 247 |
| 918 | 3300009174 | Ga0105241_10115152 | Ga0105241_101151522 | 247 |
| 919 | 3300009174 | Ga0105241_10749501 | Ga0105241_107495011 | 247 |
| 920 | 3300009176 | Ga0105242_10241689 | Ga0105242_102416892 | 247 |
| 921 | 3300009176 | Ga0105242_10292686 | Ga0105242_102926862 | 247 |
| 922 | 3300009545 | Ga0105237_10016707 | Ga0105237_100167074 | 247 |
| 923 | 3300009545 | Ga0105237_10047919 | Ga0105237_100479194 | 247 |
| 924 | 3300009545 | Ga0105237_10175693 | Ga0105237_101756932 | 247 |
| 925 | 3300009545 | Ga0105237_10179144 | Ga0105237_101791443 | 247 |
| 926 | 3300009551 | Ga0105238_10051160 | Ga0105238_100511604 | 247 |
| 927 | 3300009553 | Ga0105249_10002066 | Ga0105249_100020669 | 247 |
| 928 | 3300009553 | Ga0105249_10673243 | Ga0105249_106732432 | 247 |
| 929 | 3300010375 | Ga0105239_10025561 | Ga0105239_100255615 | 247 |
| 930 | 3300010375 | Ga0105239_10728912 | Ga0105239_107289121 | 247 |
| 931 | 3300013104 | Ga0157370_10037070 | Ga0157370_100370706 | 247 |
| 932 | 3300013104 | Ga0157370_10059717 | Ga0157370_100597174 | 247 |
| 933 | 3300013104 | Ga0157370_10112112 | Ga0157370_101121122 | 247 |
| 934 | 3300013104 | Ga0157370_10865256 | Ga0157370_108652561 | 247 |
| 935 | 3300013105 | Ga0157369_10022801 | Ga0157369_100228013 | 247 |
| 936 | 3300013296 | Ga0157374_10002510 | Ga0157374_100025106 | 247 |
| 937 | 3300013296 | Ga0157374_10102381 | Ga0157374_101023813 | 247 |
| 938 | 3300013297 | Ga0157378_10004019 | Ga0157378_100040196 | 247 |
| 939 | 3300013306 | Ga0163162_10150206 | Ga0163162_101502062 | 247 |
| 940 | 3300013306 | Ga0163162_10311474 | Ga0163162_103114742 | 247 |
| 941 | 3300013306 | Ga0163162_10374774 | Ga0163162_103747742 | 247 |
| 942 | 3300013307 | Ga0157372_10061585 | Ga0157372_100615852 | 247 |
| 943 | 3300013308 | Ga0157375_10026695 | Ga0157375_100266952 | 247 |
| 944 | 3300013308 | Ga0157375_10040858 | Ga0157375_100408582 | 247 |
| 945 | 3300013308 | Ga0157375_10091204 | Ga0157375_100912042 | 247 |
| 946 | 3300013308 | Ga0157375_11065180 | Ga0157375_110651801 | 247 |
| 947 | 3300013308 | Ga0157375_11114810 | Ga0157375_111148101 | 247 |
| 948 | 3300014325 | Ga0163163_10051526 | Ga0163163_100515263 | 247 |
| 949 | 3300014326 | Ga0157380_10015244 | Ga0157380_100152442 | 247 |
| 950 | 3300014326 | Ga0157380_10050244 | Ga0157380_100502444 | 247 |
| 951 | 3300014326 | Ga0157380_10079215 | Ga0157380_100792153 | 247 |
| 952 | 3300014326 | Ga0157380_10329298 | Ga0157380_103292982 | 247 |
| 953 | 3300014745 | Ga0157377_10048220 | Ga0157377_100482202 | 247 |
| 954 | 3300014969 | Ga0157376_10020365 | Ga0157376_100203653 | 247 |
| 955 | 3300021384 | Ga0213876_10002898 | Ga0213876_1000289810 | 247 |
| 956 | 3300021384 | Ga0213876_10003579 | Ga0213876_1000357910 | 247 |
| 957 | 3300025230 | Ga0209563_104872 | Ga0209563_1048722 | 247 |
| 958 | 3300025245 | Ga0207425_1010355 | Ga0207425_10103555 | 247 |
| 959 | 3300025253 | Ga0209677_104551 | Ga0209677_1045511 | 247 |
| 960 | 3300025254 | Ga0209148_1000479 | Ga0209148_100047927 | 247 |
| 961 | 3300025261 | Ga0209233_1005481 | Ga0209233_10054813 | 247 |
| 962 | 3300025261 | Ga0209233_1022311 | Ga0209233_10223112 | 247 |
| 963 | 3300025272 | Ga0209455_1000521 | Ga0209455_100052111 | 247 |
| 964 | 3300025295 | Ga0209564_1007463 | Ga0209564_10074634 | 247 |
| 965 | 3300025295 | Ga0209564_1048876 | Ga0209564_10488761 | 247 |
| 966 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011519 | 247 |
| 967 | 3300025297 | Ga0209758_1000120 | Ga0209758_100012018 | 247 |
| 968 | 3300025297 | Ga0209758_1003647 | Ga0209758_10036477 | 247 |
| 969 | 3300025297 | Ga0209758_1005738 | Ga0209758_10057382 | 247 |
| 970 | 3300025299 | Ga0209256_1001013 | Ga0209256_100101322 | 247 |
| 971 | 3300025299 | Ga0209256_1020612 | Ga0209256_10206122 | 247 |
| 972 | 3300025302 | Ga0207426_1000458 | Ga0207426_100045834 | 247 |
| 973 | 3300025302 | Ga0207426_1001355 | Ga0207426_10013555 | 247 |
| 974 | 3300025302 | Ga0207426_1003487 | Ga0207426_10034875 | 247 |
| 975 | 3300025302 | Ga0207426_1033497 | Ga0207426_10334972 | 247 |
| 976 | 3300025304 | Ga0209257_1001101 | Ga0209257_100110127 | 247 |
| 977 | 3300025321 | Ga0207656_10114613 | Ga0207656_101146132 | 247 |
| 978 | 3300025885 | Ga0207653_10006836 | Ga0207653_100068366 | 247 |
| 979 | 3300025893 | Ga0207682_10104079 | Ga0207682_101040792 | 247 |
| 980 | 3300025901 | Ga0207688_10005840 | Ga0207688_100058406 | 247 |
| 981 | 3300025901 | Ga0207688_10064140 | Ga0207688_100641403 | 247 |
| 982 | 3300025901 | Ga0207688_10115519 | Ga0207688_101155192 | 247 |
| 983 | 3300025905 | Ga0207685_10078916 | Ga0207685_100789162 | 247 |
| 984 | 3300025907 | Ga0207645_10019696 | Ga0207645_100196963 | 247 |
| 985 | 3300025908 | Ga0207643_10040021 | Ga0207643_100400212 | 247 |
| 986 | 3300025909 | Ga0207705_10050894 | Ga0207705_100508943 | 247 |
| 987 | 3300025909 | Ga0207705_10100427 | Ga0207705_101004271 | 247 |
| 988 | 3300025909 | Ga0207705_10375523 | Ga0207705_103755232 | 247 |
| 989 | 3300025910 | Ga0207684_10213044 | Ga0207684_102130441 | 247 |
| 990 | 3300025911 | Ga0207654_10022029 | Ga0207654_100220293 | 247 |
| 991 | 3300025912 | Ga0207707_10001907 | Ga0207707_100019077 | 247 |
| 992 | 3300025912 | Ga0207707_10031180 | Ga0207707_100311803 | 247 |
| 993 | 3300025912 | Ga0207707_10036585 | Ga0207707_100365853 | 247 |
| 994 | 3300025912 | Ga0207707_10105975 | Ga0207707_101059752 | 247 |
| 995 | 3300025912 | Ga0207707_10224565 | Ga0207707_102245652 | 247 |
| 996 | 3300025912 | Ga0207707_10272849 | Ga0207707_102728492 | 247 |
| 997 | 3300025912 | Ga0207707_10306170 | Ga0207707_103061702 | 247 |
| 998 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008984 | 247 |
| 999 | 3300025913 | Ga0207695_10074780 | Ga0207695_100747802 | 247 |
| 1000 | 3300025913 | Ga0207695_10088068 | Ga0207695_100880682 | 247 |
| 1001 | 3300025913 | Ga0207695_10351826 | Ga0207695_103518262 | 247 |
| 1002 | 3300025914 | Ga0207671_10075242 | Ga0207671_100752422 | 247 |
| 1003 | 3300025915 | Ga0207693_10145318 | Ga0207693_101453182 | 247 |
| 1004 | 3300025917 | Ga0207660_10008004 | Ga0207660_100080042 | 247 |
| 1005 | 3300025917 | Ga0207660_10231000 | Ga0207660_102310002 | 247 |
| 1006 | 3300025918 | Ga0207662_10190082 | Ga0207662_101900822 | 247 |
| 1007 | 3300025919 | Ga0207657_10017806 | Ga0207657_100178062 | 247 |
| 1008 | 3300025919 | Ga0207657_10047173 | Ga0207657_100471732 | 247 |
| 1009 | 3300025920 | Ga0207649_10013276 | Ga0207649_100132763 | 247 |
| 1010 | 3300025920 | Ga0207649_10192440 | Ga0207649_101924402 | 247 |
| 1011 | 3300025921 | Ga0207652_10028625 | Ga0207652_100286252 | 247 |
| 1012 | 3300025921 | Ga0207652_10165535 | Ga0207652_101655352 | 247 |
| 1013 | 3300025921 | Ga0207652_10239627 | Ga0207652_102396272 | 247 |
| 1014 | 3300025922 | Ga0207646_10073903 | Ga0207646_100739032 | 247 |
| 1015 | 3300025922 | Ga0207646_10641091 | Ga0207646_106410911 | 247 |
| 1016 | 3300025924 | Ga0207694_10017635 | Ga0207694_100176352 | 247 |
| 1017 | 3300025925 | Ga0207650_10062660 | Ga0207650_100626601 | 247 |
| 1018 | 3300025926 | Ga0207659_10008337 | Ga0207659_100083374 | 247 |
| 1019 | 3300025931 | Ga0207644_10000662 | Ga0207644_1000066218 | 247 |
| 1020 | 3300025931 | Ga0207644_10101300 | Ga0207644_101013002 | 247 |
| 1021 | 3300025933 | Ga0207706_10075564 | Ga0207706_100755643 | 247 |
| 1022 | 3300025934 | Ga0207686_10281531 | Ga0207686_102815312 | 247 |
| 1023 | 3300025935 | Ga0207709_10204687 | Ga0207709_102046871 | 247 |
| 1024 | 3300025938 | Ga0207704_10291416 | Ga0207704_102914162 | 247 |
| 1025 | 3300025939 | Ga0207665_10704104 | Ga0207665_107041041 | 247 |
| 1026 | 3300025940 | Ga0207691_10002630 | Ga0207691_1000263011 | 247 |
| 1027 | 3300025942 | Ga0207689_10122781 | Ga0207689_101227814 | 247 |
| 1028 | 3300025944 | Ga0207661_10040759 | Ga0207661_100407595 | 247 |
| 1029 | 3300025944 | Ga0207661_10051634 | Ga0207661_100516342 | 247 |
| 1030 | 3300025945 | Ga0207679_10000999 | Ga0207679_1000099911 | 247 |
| 1031 | 3300025945 | Ga0207679_10287696 | Ga0207679_102876962 | 247 |
| 1032 | 3300025949 | Ga0207667_10022102 | Ga0207667_100221023 | 247 |
| 1033 | 3300025949 | Ga0207667_10033353 | Ga0207667_100333534 | 247 |
| 1034 | 3300025949 | Ga0207667_10203396 | Ga0207667_102033962 | 247 |
| 1035 | 3300025960 | Ga0207651_10000539 | Ga0207651_1000053913 | 247 |
| 1036 | 3300025960 | Ga0207651_10028595 | Ga0207651_100285957 | 247 |
| 1037 | 3300025972 | Ga0207668_10020017 | Ga0207668_100200172 | 247 |
| 1038 | 3300025981 | Ga0207640_10002923 | Ga0207640_100029234 | 247 |
| 1039 | 3300025981 | Ga0207640_10098327 | Ga0207640_100983272 | 247 |
| 1040 | 3300025986 | Ga0207658_10067312 | Ga0207658_100673124 | 247 |
| 1041 | 3300025986 | Ga0207658_10067700 | Ga0207658_100677003 | 247 |
| 1042 | 3300025986 | Ga0207658_10813997 | Ga0207658_108139971 | 247 |
| 1043 | 3300026023 | Ga0207677_10006479 | Ga0207677_100064795 | 247 |
| 1044 | 3300026023 | Ga0207677_10050315 | Ga0207677_100503153 | 247 |
| 1045 | 3300026035 | Ga0207703_10001771 | Ga0207703_1000177110 | 247 |
| 1046 | 3300026035 | Ga0207703_10116025 | Ga0207703_101160253 | 247 |
| 1047 | 3300026035 | Ga0207703_10212189 | Ga0207703_102121891 | 247 |
| 1048 | 3300026067 | Ga0207678_10036030 | Ga0207678_100360303 | 247 |
| 1049 | 3300026067 | Ga0207678_10178085 | Ga0207678_101780852 | 247 |
| 1050 | 3300026075 | Ga0207708_10001813 | Ga0207708_100018139 | 247 |
| 1051 | 3300026075 | Ga0207708_10156445 | Ga0207708_101564451 | 247 |
| 1052 | 3300026078 | Ga0207702_10614122 | Ga0207702_106141221 | 247 |
| 1053 | 3300026088 | Ga0207641_10050841 | Ga0207641_100508413 | 247 |
| 1054 | 3300026088 | Ga0207641_10355003 | Ga0207641_103550032 | 247 |
| 1055 | 3300026089 | Ga0207648_10001802 | Ga0207648_100018028 | 247 |
| 1056 | 3300026089 | Ga0207648_10012847 | Ga0207648_100128477 | 247 |
| 1057 | 3300026089 | Ga0207648_10236908 | Ga0207648_102369082 | 247 |
| 1058 | 3300026095 | Ga0207676_10010216 | Ga0207676_100102164 | 247 |
| 1059 | 3300026095 | Ga0207676_10014329 | Ga0207676_100143294 | 247 |
| 1060 | 3300026095 | Ga0207676_10523919 | Ga0207676_105239191 | 247 |
| 1061 | 3300026116 | Ga0207674_10002489 | Ga0207674_1000248917 | 247 |
| 1062 | 3300026116 | Ga0207674_10002494 | Ga0207674_1000249422 | 247 |
| 1063 | 3300026116 | Ga0207674_10013097 | Ga0207674_100130978 | 247 |
| 1064 | 3300026116 | Ga0207674_10308643 | Ga0207674_103086432 | 247 |
| 1065 | 3300026118 | Ga0207675_100001457 | Ga0207675_10000145716 | 247 |
| 1066 | 3300026118 | Ga0207675_100261260 | Ga0207675_1002612602 | 247 |
| 1067 | 3300026118 | Ga0207675_100571763 | Ga0207675_1005717632 | 247 |
| 1068 | 3300026118 | Ga0207675_100635994 | Ga0207675_1006359941 | 247 |
| 1069 | 3300026118 | Ga0207675_100834745 | Ga0207675_1008347451 | 247 |
| 1070 | 3300026121 | Ga0207683_10006114 | Ga0207683_100061146 | 247 |
| 1071 | 3300026121 | Ga0207683_10030306 | Ga0207683_100303063 | 247 |
| 1072 | 3300026121 | Ga0207683_10103223 | Ga0207683_101032232 | 247 |
| 1073 | 3300026142 | Ga0207698_10174151 | Ga0207698_101741512 | 247 |
| 1074 | 3300026142 | Ga0207698_10450068 | Ga0207698_104500682 | 247 |
| 1075 | 3300027296 | Ga0209389_1000043 | Ga0209389_10000436 | 247 |
| 1076 | 3300027296 | Ga0209389_1000077 | Ga0209389_100007772 | 247 |
| 1077 | 3300027357 | Ga0209589_1000047 | Ga0209589_1000047105 | 247 |
| 1078 | 3300027360 | Ga0209969_1001449 | Ga0209969_10014492 | 247 |
| 1079 | 3300027361 | Ga0209489_100075 | Ga0209489_100075137 | 247 |
| 1080 | 3300027361 | Ga0209489_100251 | Ga0209489_10025172 | 247 |
| 1081 | 3300027363 | Ga0209700_100271 | Ga0209700_10027172 | 247 |
| 1082 | 3300027378 | Ga0209981_1002479 | Ga0209981_10024793 | 247 |
| 1083 | 3300027866 | Ga0209813_10000818 | Ga0209813_100008183 | 247 |
| 1084 | 3300027866 | Ga0209813_10002644 | Ga0209813_100026443 | 247 |
| 1085 | 3300027876 | Ga0209974_10004349 | Ga0209974_100043495 | 247 |
| 1086 | 3300027907 | Ga0207428_10002848 | Ga0207428_1000284817 | 247 |
| 1087 | 3300027907 | Ga0207428_10035406 | Ga0207428_100354065 | 247 |
| 1088 | 3300028379 | Ga0268266_10118526 | Ga0268266_101185262 | 247 |
| 1089 | 3300028379 | Ga0268266_10957672 | Ga0268266_109576721 | 247 |
| 1090 | 3300028380 | Ga0268265_10002314 | Ga0268265_1000231411 | 247 |
| 1091 | 3300028380 | Ga0268265_10177827 | Ga0268265_101778272 | 247 |
| 1092 | 3300028380 | Ga0268265_10416984 | Ga0268265_104169842 | 247 |
| 1093 | 3300028380 | Ga0268265_11031378 | Ga0268265_110313781 | 247 |
| 1094 | 3300028381 | Ga0268264_10000030 | Ga0268264_10000030230 | 247 |
| 1095 | 3300028381 | Ga0268264_10001973 | Ga0268264_100019737 | 247 |
| 1096 | 3300028381 | Ga0268264_10003102 | Ga0268264_1000310214 | 247 |
| 1097 | 3300028381 | Ga0268264_10409806 | Ga0268264_104098062 | 247 |
| 1098 | 3300030521 | Ga0307511_10039065 | Ga0307511_100390654 | 247 |
| 1099 | 3300031249 | Ga0265339_10009845 | Ga0265339_100098452 | 247 |
| 1100 | 3300031456 | Ga0307513_10000034 | Ga0307513_1000003454 | 247 |
| 1101 | 3300031456 | Ga0307513_10007609 | Ga0307513_100076096 | 247 |
| 1102 | 3300031507 | Ga0307509_10274920 | Ga0307509_102749202 | 247 |
| 1103 | 3300031548 | Ga0307408_100728188 | Ga0307408_1007281881 | 247 |
| 1104 | 3300031616 | Ga0307508_10003532 | Ga0307508_1000353212 | 247 |
| 1105 | 3300031616 | Ga0307508_10161807 | Ga0307508_101618071 | 247 |
| 1106 | 3300031616 | Ga0307508_10186206 | Ga0307508_101862062 | 247 |
| 1107 | 3300031711 | Ga0265314_10002700 | Ga0265314_1000270012 | 247 |
| 1108 | 3300031711 | Ga0265314_10046257 | Ga0265314_100462573 | 247 |
| 1109 | 3300031711 | Ga0265314_10139617 | Ga0265314_101396172 | 247 |
| 1110 | 3300031711 | Ga0265314_10236417 | Ga0265314_102364172 | 247 |
| 1111 | 3300031730 | Ga0307516_10018252 | Ga0307516_100182524 | 247 |
| 1112 | 3300031731 | Ga0307405_10377919 | Ga0307405_103779192 | 247 |
| 1113 | 3300031824 | Ga0307413_10682957 | Ga0307413_106829571 | 247 |
| 1114 | 3300031838 | Ga0307518_10200924 | Ga0307518_102009242 | 247 |
| 1115 | 3300031852 | Ga0307410_10709754 | Ga0307410_107097541 | 247 |
| 1116 | 3300032005 | Ga0307411_10162153 | Ga0307411_101621532 | 247 |
| 1117 | 3300033179 | Ga0307507_10026861 | Ga0307507_100268614 | 247 |
| 1118 | 3300033180 | Ga0307510_10017164 | Ga0307510_100171646 | 247 |
| 1119 | 3300034957 | Ga0373938_0004232 | Ga0373938_0004232_234_986 | 247 |
| 1120 | 3300035083 | Ga0373926_0038226 | Ga0373926_0038226_273_1025 | 247 |
| 1121 | 3300035113 | Ga0373936_0045218 | Ga0373936_0045218_858_1610 | 247 |
| 1122 | 3300035121 | Ga0373960_0002619 | Ga0373960_0002619_1758_2510 | 247 |
| 1123 | 3300035691 | Ga0373931_0000116 | Ga0373931_0000116_27720_28472 | 247 |
| 1124 | 3300035691 | Ga0373931_0111062 | Ga0373931_0111062_601_1353 | 247 |
| 1125 | 3300035692 | Ga0373935_0026781 | Ga0373935_0026781_2321_3073 | 247 |
| 1126 | 3300035692 | Ga0373935_0173688 | Ga0373935_0173688_578_1330 | 247 |
| 1127 | 3300035695 | Ga0373927_0038713 | Ga0373927_0038713_1984_2736 | 247 |
| 1128 | 3300035695 | Ga0373927_0046867 | Ga0373927_0046867_401_1153 | 247 |
| 1129 | 3300035695 | Ga0373927_0085133 | Ga0373927_0085133_1149_1901 | 247 |
| 1130 | 3300035695 | Ga0373927_0240362 | Ga0373927_0240362_68_820 | 247 |
| 1131 | 3300035725 | Ga0373947_0022472 | Ga0373947_0022472_2412_3164 | 247 |
| 1132 | 3300036401 | Ga0373937_0390306 | Ga0373937_0390306_372_1124 | 247 |
| 1133 | 3300037068 | Ga0373925_0016726 | Ga0373925_0016726_476_1228 | 247 |
| 1134 | 3300037068 | Ga0373925_0024885 | Ga0373925_0024885_1625_2377 | 247 |
| 1135 | 3300037068 | Ga0373925_0178949 | Ga0373925_0178949_153_905 | 247 |
| 1136 | 3300037068 | Ga0373925_0432399 | Ga0373925_0432399_169_921 | 247 |
| 1137 | 3300037418 | Ga0395900_0001310 | Ga0395900_0001310_665_1408 | 247 |
| 1138 | 3300037418 | Ga0395900_0334580 | Ga0395900_0334580_264_1079 | 247 |
| 1139 | 3300037418 | Ga0395900_0415545 | Ga0395900_0415545_131_883 | 247 |
| 1140 | 3300037466 | Ga0395898_0011039 | Ga0395898_0011039_434_1177 | 247 |
| 1141 | 3300037466 | Ga0395898_0086895 | Ga0395898_0086895_1543_2295 | 247 |
| 1142 | 3300037466 | Ga0395898_0089354 | Ga0395898_0089354_1338_2180 | 247 |
| 1143 | 3300037466 | Ga0395898_0245347 | Ga0395898_0245347_658_1413 | 247 |
| 1144 | 3300037471 | Ga0395905_0028793 | Ga0395905_0028793_3642_4394 | 247 |
| 1145 | 3300038443 | Ga0395901_0024836 | Ga0395901_0024836_4312_5055 | 247 |
| 1146 | 3300039437 | Ga0436365_0991677 | Ga0436365_0991677_47_934 | 247 |
| 1147 | 3300039437 | Ga0436365_1236739 | Ga0436365_1236739_27589_28341 | 247 |
| 1148 | 3300039437 | Ga0436365_1491363 | Ga0436365_1491363_1520_2272 | 247 |
| 1149 | 3300039438 | Ga0436360_0222734 | Ga0436360_0222734_284_1036 | 247 |
| 1150 | 3300039438 | Ga0436360_1227094 | Ga0436360_1227094_212_964 | 247 |
| 1151 | 3300039447 | Ga0436361_0975863 | Ga0436361_0975863_375_1127 | 247 |
| 1152 | 3300039447 | Ga0436361_1096819 | Ga0436361_1096819_404_1156 | 247 |
| 1153 | 3300039450 | Ga0436363_1119093 | Ga0436363_1119093_259_1011 | 247 |
| 1154 | 3300039453 | Ga0436362_0093970 | Ga0436362_0093970_212_964 | 247 |
| 1155 | 3300039453 | Ga0436362_0548217 | Ga0436362_0548217_1966_2718 | 247 |
| 1156 | 3300041452 | Ga0451793_0601538 | Ga0451793_0601538_803_1546 | 247 |
| 1157 | 3300041486 | Ga0451807_2436701 | Ga0451807_2436701_127_870 | 247 |
| 1158 | 3300041492 | Ga0451835_1188482 | Ga0451835_1188482_56_799 | 247 |
| 1159 | 3300041507 | Ga0451851_0511660 | Ga0451851_0511660_76_819 | 247 |
| 1160 | 3300044656 | Ga0466969_0071333 | Ga0466969_0071333_795_1538 | 247 |
| 1161 | 3300044656 | Ga0466969_0128632 | Ga0466969_0128632_389_1132 | 247 |
| 1162 | 3300044658 | Ga0466972_0000079 | Ga0466972_0000079_82293_83036 | 247 |
| 1163 | 3300044658 | Ga0466972_0004993 | Ga0466972_0004993_422_1165 | 247 |
| 1164 | 3300044658 | Ga0466972_0060127 | Ga0466972_0060127_78_821 | 247 |
| 1165 | 3300044684 | Ga0466966_0000191 | Ga0466966_0000191_16845_17588 | 247 |
| 1166 | 3300044693 | Ga0466961_0000005 | Ga0466961_0000005_56871_57614 | 247 |
| 1167 | 3300044694 | Ga0466963_0134668 | Ga0466963_0134668_180_923 | 247 |
| 1168 | 3300044694 | Ga0466963_0329166 | Ga0466963_0329166_76_837 | 247 |
| 1169 | 3300044706 | Ga0466964_0011528 | Ga0466964_0011528_144_887 | 247 |
| 1170 | 3300044765 | Ga0466970_0159152 | Ga0466970_0159152_417_1160 | 247 |
| 1171 | 3300044901 | Ga0466960_0022513 | Ga0466960_0022513_1801_2544 | 247 |
| 1172 | 3300045049 | Ga0466959_0000654 | Ga0466959_0000654_15549_16292 | 247 |
| 1173 | 3300045051 | Ga0451576_0491751 | Ga0451576_0491751_163_918 | 247 |
| 1174 | 3300045976 | Ga0466967_0056368 | Ga0466967_0056368_605_1348 | 247 |
| 1175 | 3300045976 | Ga0466967_0247653 | Ga0466967_0247653_635_1519 | 247 |
| 1176 | 3300045976 | Ga0466967_0398772 | Ga0466967_0398772_533_1276 | 247 |
| 1177 | 3300046454 | Ga0495592_0029039 | Ga0495592_0029039_707_1450 | 247 |
| 1178 | 3300046455 | Ga0495603_0045351 | Ga0495603_0045351_816_1568 | 247 |
| 1179 | 3300046457 | Ga0495590_0067357 | Ga0495590_0067357_106_849 | 247 |
| 1180 | 3300046462 | Ga0495651_0001292 | Ga0495651_0001292_18337_19080 | 247 |
| 1181 | 3300046475 | Ga0495639_0198840 | Ga0495639_0198840_46_798 | 247 |
| 1182 | 3300046477 | Ga0495664_0365399 | Ga0495664_0365399_20_772 | 247 |
| 1183 | 3300046511 | Ga0495608_0139730 | Ga0495608_0139730_790_1533 | 247 |
| 1184 | 3300046516 | Ga0495628_0018938 | Ga0495628_0018938_3875_4618 | 247 |
| 1185 | 3300046524 | Ga0495648_0028398 | Ga0495648_0028398_1989_2732 | 247 |
| 1186 | 3300046525 | Ga0495663_0100065 | Ga0495663_0100065_28_780 | 247 |
| 1187 | 3300046529 | Ga0495652_0006590 | Ga0495652_0006590_5068_5811 | 247 |
| 1188 | 3300046529 | Ga0495652_0230362 | Ga0495652_0230362_511_1263 | 247 |
| 1189 | 3300046529 | Ga0495652_0427058 | Ga0495652_0427058_52_795 | 247 |
| 1190 | 3300046538 | Ga0495609_0121254 | Ga0495609_0121254_105_848 | 247 |
| 1191 | 3300046539 | Ga0495621_0054227 | Ga0495621_0054227_392_1144 | 247 |
| 1192 | 3300046542 | Ga0495597_0078838 | Ga0495597_0078838_37_780 | 247 |
| 1193 | 3300046557 | Ga0495622_0007219 | Ga0495622_0007219_2510_3253 | 247 |
| 1194 | 3300046557 | Ga0495622_0009262 | Ga0495622_0009262_529_1272 | 247 |
| 1195 | 3300046557 | Ga0495622_0095691 | Ga0495622_0095691_55_807 | 247 |
| 1196 | 3300046616 | Ga0495668_0209470 | Ga0495668_0209470_180_923 | 247 |
| 1197 | 3300046642 | Ga0495634_0178489 | Ga0495634_0178489_471_1214 | 247 |
| 1198 | 3300046648 | Ga0495611_0026243 | Ga0495611_0026243_1180_1923 | 247 |
| 1199 | 3300046663 | Ga0495635_0002472 | Ga0495635_0002472_5824_6567 | 247 |
| 1200 | 3300046674 | Ga0495588_0004811 | Ga0495588_0004811_1198_1941 | 247 |
| 1201 | 3300046675 | Ga0495657_0004748 | Ga0495657_0004748_7881_8624 | 247 |
| 1202 | 3300046678 | Ga0495599_0081921 | Ga0495599_0081921_850_1593 | 247 |
| 1203 | 3300046679 | Ga0495623_0027704 | Ga0495623_0027704_1371_2114 | 247 |
| 1204 | 3300046681 | Ga0495647_0078863 | Ga0495647_0078863_320_1072 | 247 |
| 1205 | 3300046683 | Ga0495658_0097178 | Ga0495658_0097178_253_1005 | 247 |
| 1206 | 3300046689 | Ga0495613_0020813 | Ga0495613_0020813_2652_3395 | 247 |
| 1207 | 3300046689 | Ga0495613_0162640 | Ga0495613_0162640_732_1484 | 247 |
| 1208 | 3300046690 | Ga0495624_0007439 | Ga0495624_0007439_5802_6545 | 247 |
| 1209 | 3300046794 | Ga0495589_0075661 | Ga0495589_0075661_799_1542 | 247 |
| 1210 | 3300046809 | Ga0495600_0000887 | Ga0495600_0000887_14794_15537 | 247 |
| 1211 | 3300046809 | Ga0495600_0002308 | Ga0495600_0002308_4358_5101 | 247 |
| 1212 | 3300046809 | Ga0495600_0116846 | Ga0495600_0116846_830_1582 | 247 |
| 1213 | 3300047315 | Ga0495581_0007913 | Ga0495581_0007913_3804_4547 | 247 |
| 1214 | 3300047321 | Ga0495676_0031801 | Ga0495676_0031801_547_1290 | 247 |
| 1215 | 3300047321 | Ga0495676_0250756 | Ga0495676_0250756_390_1142 | 247 |
| 1216 | 3300047322 | Ga0495680_0004106 | Ga0495680_0004106_727_1470 | 247 |
| 1217 | 3300047444 | Ga0495675_0014844 | Ga0495675_0014844_1499_2242 | 247 |
| 1218 | 3300047444 | Ga0495675_0153474 | Ga0495675_0153474_57_809 | 247 |
| 1219 | 3300047471 | Ga0495684_0368462 | Ga0495684_0368462_96_848 | 247 |
| 1220 | 3300047471 | Ga0495684_0421971 | Ga0495684_0421971_62_805 | 247 |
| 1221 | 3300047472 | Ga0495686_0089415 | Ga0495686_0089415_162_914 | 247 |
| 1222 | 3300047673 | Ga0495593_0018091 | Ga0495593_0018091_1794_2537 | 247 |
| 1223 | 3300047673 | Ga0495593_0153959 | Ga0495593_0153959_157_900 | 247 |
| 1224 | 3300048088 | Ga0495602_0048917 | Ga0495602_0048917_2554_3297 | 247 |
| 1225 | 3300048088 | Ga0495602_0083357 | Ga0495602_0083357_1167_1919 | 247 |
| 1226 | 3300048903 | Ga0496100_0354358 | Ga0496100_0354358_59_811 | 247 |
| 1227 | 3300048903 | Ga0496100_0386626 | Ga0496100_0386626_88_831 | 247 |
| 1228 | 3300048904 | Ga0496101_0195605 | Ga0496101_0195605_481_1233 | 247 |
| 1229 | 3300048905 | Ga0496102_0004180 | Ga0496102_0004180_7600_8352 | 247 |
| 1230 | 3300048905 | Ga0496102_0037694 | Ga0496102_0037694_3403_4155 | 247 |
| 1231 | 3300048905 | Ga0496102_0298173 | Ga0496102_0298173_50_802 | 247 |
| 1232 | 3300048905 | Ga0496102_0611487 | Ga0496102_0611487_148_900 | 247 |
| 1233 | 3300048906 | Ga0496103_0010570 | Ga0496103_0010570_4662_5414 | 247 |
| 1234 | 3300048906 | Ga0496103_0020026 | Ga0496103_0020026_2281_3024 | 247 |
| 1235 | 3300048906 | Ga0496103_0079575 | Ga0496103_0079575_664_1416 | 247 |
| 1236 | 3300048907 | Ga0496104_0000887 | Ga0496104_0000887_1445_2197 | 247 |
| 1237 | 3300048907 | Ga0496104_0003143 | Ga0496104_0003143_3569_4321 | 247 |
| 1238 | 3300048907 | Ga0496104_0004370 | Ga0496104_0004370_5767_6510 | 247 |
| 1239 | 3300048907 | Ga0496104_0037883 | Ga0496104_0037883_311_1063 | 247 |
| 1240 | 3300048907 | Ga0496104_0249331 | Ga0496104_0249331_801_1544 | 247 |
| 1241 | 3300048908 | Ga0496105_0015706 | Ga0496105_0015706_3743_4495 | 247 |
| 1242 | 3300048908 | Ga0496105_0022134 | Ga0496105_0022134_168_920 | 247 |
| 1243 | 3300048908 | Ga0496105_0025293 | Ga0496105_0025293_1531_2274 | 247 |
| 1244 | 3300048909 | Ga0496106_0005519 | Ga0496106_0005519_2938_3690 | 247 |
| 1245 | 3300048909 | Ga0496106_0012569 | Ga0496106_0012569_187_939 | 247 |
| 1246 | 3300048909 | Ga0496106_0032551 | Ga0496106_0032551_1390_2133 | 247 |
| 1247 | 3300048909 | Ga0496106_0111916 | Ga0496106_0111916_350_1102 | 247 |
| 1248 | 3300048910 | Ga0496107_0053363 | Ga0496107_0053363_509_1252 | 247 |
| 1249 | 3300048910 | Ga0496107_0145016 | Ga0496107_0145016_812_1564 | 247 |
| 1250 | 3300048911 | Ga0496108_0001980 | Ga0496108_0001980_11764_12516 | 247 |
| 1251 | 3300048911 | Ga0496108_0003753 | Ga0496108_0003753_1644_2396 | 247 |
| 1252 | 3300048911 | Ga0496108_0009913 | Ga0496108_0009913_2499_3251 | 247 |
| 1253 | 3300048911 | Ga0496108_0041408 | Ga0496108_0041408_182_934 | 247 |
| 1254 | 3300048912 | Ga0496109_0043521 | Ga0496109_0043521_109_861 | 247 |
| 1255 | 3300048912 | Ga0496109_0072366 | Ga0496109_0072366_411_1154 | 247 |
| 1256 | 3300048912 | Ga0496109_0230160 | Ga0496109_0230160_792_1535 | 247 |
| 1257 | 3300048912 | Ga0496109_0368026 | Ga0496109_0368026_270_1022 | 247 |
| 1258 | 3300048913 | Ga0496110_0000895 | Ga0496110_0000895_9442_10194 | 247 |
| 1259 | 3300048913 | Ga0496110_0031997 | Ga0496110_0031997_1474_2226 | 247 |
| 1260 | 3300048913 | Ga0496110_0143275 | Ga0496110_0143275_992_1744 | 247 |
| 1261 | 3300048913 | Ga0496110_0550857 | Ga0496110_0550857_190_933 | 247 |
| 1262 | 3300048914 | Ga0496111_0011980 | Ga0496111_0011980_1162_1914 | 247 |
| 1263 | 3300048914 | Ga0496111_0029520 | Ga0496111_0029520_2263_3015 | 247 |
| 1264 | 3300048914 | Ga0496111_0064293 | Ga0496111_0064293_679_1431 | 247 |
| 1265 | 3300048914 | Ga0496111_0093348 | Ga0496111_0093348_1303_2055 | 247 |
| 1266 | 3300048915 | Ga0496112_0086125 | Ga0496112_0086125_169_921 | 247 |
| 1267 | 3300048915 | Ga0496112_0112237 | Ga0496112_0112237_1432_2184 | 247 |
| 1268 | 3300048916 | Ga0496113_0157676 | Ga0496113_0157676_817_1560 | 247 |
| 1269 | 3300048916 | Ga0496113_0248641 | Ga0496113_0248641_464_1216 | 247 |
| 1270 | 3300048917 | Ga0496114_0034538 | Ga0496114_0034538_897_1649 | 247 |
| 1271 | 3300048917 | Ga0496114_0200320 | Ga0496114_0200320_150_902 | 247 |
| 1272 | 3300048918 | Ga0496115_0096434 | Ga0496115_0096434_1221_1964 | 247 |
| 1273 | 3300048919 | Ga0496116_0022844 | Ga0496116_0022844_67_810 | 247 |
| 1274 | 3300048919 | Ga0496116_0083636 | Ga0496116_0083636_992_1744 | 247 |
| 1275 | 3300048921 | Ga0496118_0006235 | Ga0496118_0006235_5907_6659 | 247 |
| 1276 | 3300048921 | Ga0496118_0046707 | Ga0496118_0046707_1402_2145 | 247 |
| 1277 | 3300048921 | Ga0496118_0262934 | Ga0496118_0262934_45_788 | 247 |
| 1278 | 3300048922 | Ga0496119_0004854 | Ga0496119_0004854_5079_5831 | 247 |
| 1279 | 3300048922 | Ga0496119_0012751 | Ga0496119_0012751_4136_4879 | 247 |
| 1280 | 3300048923 | Ga0496120_0027812 | Ga0496120_0027812_1349_2092 | 247 |
| 1281 | 3300048924 | Ga0496121_0002635 | Ga0496121_0002635_4367_5119 | 247 |
| 1282 | 3300048924 | Ga0496121_0115874 | Ga0496121_0115874_1122_1865 | 247 |
| 1283 | 3300048924 | Ga0496121_0240280 | Ga0496121_0240280_270_1013 | 247 |
| 1284 | 3300048925 | Ga0496122_0058473 | Ga0496122_0058473_1875_2618 | 247 |
| 1285 | 3300048927 | Ga0496124_0004890 | Ga0496124_0004890_8642_9394 | 247 |
| 1286 | 3300048928 | Ga0496125_0017937 | Ga0496125_0017937_5041_5784 | 247 |
| 1287 | 3300048928 | Ga0496125_0197232 | Ga0496125_0197232_395_1147 | 247 |
| 1288 | 3300048929 | Ga0496126_0002122 | Ga0496126_0002122_11668_12420 | 247 |
| 1289 | 3300048929 | Ga0496126_0029792 | Ga0496126_0029792_1934_2677 | 247 |
| 1290 | 3300048929 | Ga0496126_0045231 | Ga0496126_0045231_1396_2139 | 247 |
| 1291 | 3300048929 | Ga0496126_0404681 | Ga0496126_0404681_347_1090 | 247 |
| 1292 | 3300049568 | Ga0501031_0002180 | Ga0501031_0002180_8206_9003 | 247 |
| 1293 | 3300049569 | Ga0501032_0000136 | Ga0501032_0000136_27984_28781 | 247 |
| 1294 | 3300049570 | Ga0501033_0000202 | Ga0501033_0000202_47970_48767 | 247 |
| 1295 | 3300049571 | Ga0501034_0000113 | Ga0501034_0000113_94920_95717 | 247 |
| 1296 | 3300049571 | Ga0501034_0029250 | Ga0501034_0029250_206_961 | 247 |
| 1297 | 3300049571 | Ga0501034_0102984 | Ga0501034_0102984_1405_2157 | 247 |
| 1298 | 3300049571 | Ga0501034_0253230 | Ga0501034_0253230_285_1037 | 247 |
| 1299 | 3300049572 | Ga0501036_0000059 | Ga0501036_0000059_63208_64005 | 247 |
| 1300 | 3300049572 | Ga0501036_0424980 | Ga0501036_0424980_242_994 | 247 |
| 1301 | 3300049573 | Ga0501037_0000214 | Ga0501037_0000214_11719_12516 | 247 |
| 1302 | 3300049574 | Ga0501038_0002810 | Ga0501038_0002810_691_1488 | 247 |
| 1303 | 3300049574 | Ga0501038_0115598 | Ga0501038_0115598_260_1012 | 247 |
| 1304 | 3300049575 | Ga0501039_0001981 | Ga0501039_0001981_4482_5279 | 247 |
| 1305 | 3300049575 | Ga0501039_0053131 | Ga0501039_0053131_729_1481 | 247 |
| 1306 | 3300049577 | Ga0501041_0039663 | Ga0501041_0039663_601_1353 | 247 |
| 1307 | 3300049577 | Ga0501041_0086153 | Ga0501041_0086153_768_1520 | 247 |
| 1308 | 3300049578 | Ga0501042_0055963 | Ga0501042_0055963_257_1054 | 247 |
| 1309 | 3300049579 | Ga0501043_0000017 | Ga0501043_0000017_1426_2223 | 247 |
| 1310 | 3300049579 | Ga0501043_0209553 | Ga0501043_0209553_726_1478 | 247 |
| 1311 | 3300049580 | Ga0501046_0000174 | Ga0501046_0000174_34965_35762 | 247 |
| 1312 | 3300049581 | Ga0501047_0000044 | Ga0501047_0000044_157537_158334 | 247 |
| 1313 | 3300049581 | Ga0501047_0195332 | Ga0501047_0195332_1054_1809 | 247 |
| 1314 | 3300049582 | Ga0501048_0000837 | Ga0501048_0000837_12517_13314 | 247 |
| 1315 | 3300049582 | Ga0501048_0036135 | Ga0501048_0036135_2511_3263 | 247 |
| 1316 | 3300049582 | Ga0501048_0079019 | Ga0501048_0079019_300_1052 | 247 |
| 1317 | 3300049583 | Ga0501067_0011413 | Ga0501067_0011413_2767_3564 | 247 |
| 1318 | 3300049584 | Ga0501068_0000089 | Ga0501068_0000089_36188_36985 | 247 |
| 1319 | 3300049585 | Ga0501069_0005200 | Ga0501069_0005200_4297_5094 | 247 |
| 1320 | 3300049585 | Ga0501069_0158532 | Ga0501069_0158532_246_998 | 247 |
| 1321 | 3300049586 | Ga0501070_0034519 | Ga0501070_0034519_2711_3508 | 247 |
| 1322 | 3300049586 | Ga0501070_0058949 | Ga0501070_0058949_145_897 | 247 |
| 1323 | 3300049586 | Ga0501070_0113759 | Ga0501070_0113759_355_1107 | 247 |
| 1324 | 3300049586 | Ga0501070_0113933 | Ga0501070_0113933_116_868 | 247 |
| 1325 | 3300049587 | Ga0501071_0018583 | Ga0501071_0018583_1723_2475 | 247 |
| 1326 | 3300049587 | Ga0501071_0046014 | Ga0501071_0046014_2348_3100 | 247 |
| 1327 | 3300049587 | Ga0501071_0127700 | Ga0501071_0127700_1094_1846 | 247 |
| 1328 | 3300049587 | Ga0501071_0187099 | Ga0501071_0187099_177_929 | 247 |
| 1329 | 3300049588 | Ga0501072_0003722 | Ga0501072_0003722_1296_2093 | 247 |
| 1330 | 3300049588 | Ga0501072_0005305 | Ga0501072_0005305_4828_5580 | 247 |
| 1331 | 3300049588 | Ga0501072_0212348 | Ga0501072_0212348_678_1430 | 247 |
| 1332 | 3300049588 | Ga0501072_0434669 | Ga0501072_0434669_33_785 | 247 |
| 1333 | 3300049589 | Ga0501073_0000069 | Ga0501073_0000069_19674_20471 | 247 |
| 1334 | 3300049590 | Ga0501074_0000346 | Ga0501074_0000346_1676_2473 | 247 |
| 1335 | 3300049590 | Ga0501074_0012367 | Ga0501074_0012367_1313_2119 | 247 |
| 1336 | 3300049590 | Ga0501074_0223605 | Ga0501074_0223605_47_799 | 247 |
| 1337 | 3300049591 | Ga0501075_0003173 | Ga0501075_0003173_5815_6567 | 247 |
| 1338 | 3300049591 | Ga0501075_0004743 | Ga0501075_0004743_7538_8290 | 247 |
| 1339 | 3300049591 | Ga0501075_0067175 | Ga0501075_0067175_945_1697 | 247 |
| 1340 | 3300049591 | Ga0501075_0082419 | Ga0501075_0082419_209_961 | 247 |
| 1341 | 3300049591 | Ga0501075_0090844 | Ga0501075_0090844_1184_1936 | 247 |
| 1342 | 3300049592 | Ga0501076_0004572 | Ga0501076_0004572_7183_7935 | 247 |
| 1343 | 3300049592 | Ga0501076_0022327 | Ga0501076_0022327_619_1371 | 247 |
| 1344 | 3300049592 | Ga0501076_0046875 | Ga0501076_0046875_2351_3103 | 247 |
| 1345 | 3300049592 | Ga0501076_0054576 | Ga0501076_0054576_1075_1827 | 247 |
| 1346 | 3300049592 | Ga0501076_0420969 | Ga0501076_0420969_256_1011 | 247 |
| 1347 | 3300049593 | Ga0501077_0007172 | Ga0501077_0007172_2947_3699 | 247 |
| 1348 | 3300049593 | Ga0501077_0048514 | Ga0501077_0048514_1234_1986 | 247 |
| 1349 | 3300049741 | Ga0501079_0011151 | Ga0501079_0011151_100_897 | 247 |
| 1350 | 3300049741 | Ga0501079_0060546 | Ga0501079_0060546_2035_2787 | 247 |
| 1351 | 3300049741 | Ga0501079_0137161 | Ga0501079_0137161_532_1284 | 247 |
| 1352 | 3300049742 | Ga0501080_0000613 | Ga0501080_0000613_15240_16037 | 247 |
| 1353 | 3300049742 | Ga0501080_0041399 | Ga0501080_0041399_2499_3251 | 247 |
| 1354 | 3300049742 | Ga0501080_0042217 | Ga0501080_0042217_1509_2261 | 247 |
| 1355 | 3300049742 | Ga0501080_0248884 | Ga0501080_0248884_421_1173 | 247 |
| 1356 | 3300049742 | Ga0501080_0262150 | Ga0501080_0262150_36_788 | 247 |
| 1357 | 3300049742 | Ga0501080_0276630 | Ga0501080_0276630_610_1362 | 247 |
| 1358 | 3300049743 | Ga0501081_0012368 | Ga0501081_0012368_1994_2746 | 247 |
| 1359 | 3300049743 | Ga0501081_0024760 | Ga0501081_0024760_1558_2310 | 247 |
| 1360 | 3300049743 | Ga0501081_0103516 | Ga0501081_0103516_108_860 | 247 |
| 1361 | 3300049744 | Ga0501083_0000838 | Ga0501083_0000838_9611_10408 | 247 |
| 1362 | 3300049744 | Ga0501083_0125880 | Ga0501083_0125880_414_1166 | 247 |
| 1363 | 3300049779 | Ga0501283_006120 | Ga0501283_006120_576_1331 | 247 |
| 1364 | 3300049822 | Ga0501035_0000393 | Ga0501035_0000393_13398_14195 | 247 |
| 1365 | 3300049823 | Ga0501044_0000108 | Ga0501044_0000108_90758_91555 | 247 |
| 1366 | 3300049823 | Ga0501044_0397655 | Ga0501044_0397655_522_1274 | 247 |
| 1367 | 3300049824 | Ga0501045_0003295 | Ga0501045_0003295_9456_10208 | 247 |
| 1368 | 3300049824 | Ga0501045_0007027 | Ga0501045_0007027_1316_2113 | 247 |
| 1369 | 3300049824 | Ga0501045_0052840 | Ga0501045_0052840_1593_2345 | 247 |
| 1370 | 3300049824 | Ga0501045_0088310 | Ga0501045_0088310_1368_2120 | 247 |
| 1371 | 3300050490 | nmdc:mga03n38_100614_c1 | nmdc:mga03n38_100614_c1_569_1324 | 247 |
| 1372 | 3300050490 | nmdc:mga03n38_222895_c1 | nmdc:mga03n38_222895_c1_231_974 | 247 |
| 1373 | 3300050490 | nmdc:mga03n38_303582_c1 | nmdc:mga03n38_303582_c1_79_831 | 247 |
| 1374 | 3300050490 | nmdc:mga03n38_90463_c1 | nmdc:mga03n38_90463_c1_329_1081 | 247 |
| 1375 | 3300050491 | nmdc:mga00v17_148995_c1 | nmdc:mga00v17_148995_c1_711_1469 | 247 |
| 1376 | 3300050491 | nmdc:mga00v17_30571_c1 | nmdc:mga00v17_30571_c1_718_1470 | 247 |
| 1377 | 3300050492 | nmdc:mga0yw44_28700_c1 | nmdc:mga0yw44_28700_c1_2148_2900 | 247 |
| 1378 | 3300050492 | nmdc:mga0yw44_389259_c1 | nmdc:mga0yw44_389259_c1_98_841 | 247 |
| 1379 | 3300050492 | nmdc:mga0yw44_393770_c1 | nmdc:mga0yw44_393770_c1_86_829 | 247 |
| 1380 | 3300050493 | nmdc:mga0k408_150863_c1 | nmdc:mga0k408_150863_c1_137_889 | 247 |
| 1381 | 3300050493 | nmdc:mga0k408_42447_c1 | nmdc:mga0k408_42447_c1_1688_2431 | 247 |
| 1382 | 3300050493 | nmdc:mga0k408_57199_c1 | nmdc:mga0k408_57199_c1_541_1296 | 247 |
| 1383 | 3300050494 | nmdc:mga06z11_102019_c1 | nmdc:mga06z11_102019_c1_48_791 | 247 |
| 1384 | 3300050494 | nmdc:mga06z11_126557_c1 | nmdc:mga06z11_126557_c1_183_935 | 247 |
| 1385 | 3300050494 | nmdc:mga06z11_16076_c1 | nmdc:mga06z11_16076_c1_1152_1904 | 247 |
| 1386 | 3300050494 | nmdc:mga06z11_22101_c1 | nmdc:mga06z11_22101_c1_1882_2634 | 247 |
| 1387 | 3300050494 | nmdc:mga06z11_2258_c1 | nmdc:mga06z11_2258_c1_1209_1961 | 247 |
| 1388 | 3300050495 | nmdc:mga04h51_1097_c1 | nmdc:mga04h51_1097_c1_181_933 | 247 |
| 1389 | 3300050496 | nmdc:mga07m45_155815_c1 | nmdc:mga07m45_155815_c1_262_1005 | 247 |
| 1390 | 3300050496 | nmdc:mga07m45_86069_c1 | nmdc:mga07m45_86069_c1_309_1052 | 247 |
| 1391 | 3300050507 | nmdc:mga05p37_120836_c1 | nmdc:mga05p37_120836_c1_1871_2623 | 247 |
| 1392 | 3300050507 | nmdc:mga05p37_148724_c1 | nmdc:mga05p37_148724_c1_1481_2233 | 247 |
| 1393 | 3300050507 | nmdc:mga05p37_171923_c1 | nmdc:mga05p37_171923_c1_1350_2102 | 247 |
| 1394 | 3300050507 | nmdc:mga05p37_237852_c1 | nmdc:mga05p37_237852_c1_724_1476 | 247 |
| 1395 | 3300050508 | nmdc:mga09592_26221_c1 | nmdc:mga09592_26221_c1_2649_3401 | 247 |
| 1396 | 3300050509 | nmdc:mga0qj67_13296_c1 | nmdc:mga0qj67_13296_c1_710_1465 | 247 |
| 1397 | 3300050509 | nmdc:mga0qj67_54969_c1 | nmdc:mga0qj67_54969_c1_1877_2629 | 247 |
| 1398 | 3300050509 | nmdc:mga0qj67_7712_c1 | nmdc:mga0qj67_7712_c1_5308_6060 | 247 |
| 1399 | 3300050510 | nmdc:mga06r32_14504_c2 | nmdc:mga06r32_14504_c2_143_898 | 247 |
| 1400 | 3300050510 | nmdc:mga06r32_251564_c1 | nmdc:mga06r32_251564_c1_648_1400 | 247 |
| 1401 | 3300050510 | nmdc:mga06r32_291163_c1 | nmdc:mga06r32_291163_c1_27_779 | 247 |
| 1402 | 3300050510 | nmdc:mga06r32_34274_c1 | nmdc:mga06r32_34274_c1_2934_3686 | 247 |
| 1403 | 3300050510 | nmdc:mga06r32_489969_c1 | nmdc:mga06r32_489969_c1_170_922 | 247 |
| 1404 | 3300050510 | nmdc:mga06r32_549401_c1 | nmdc:mga06r32_549401_c1_111_863 | 247 |
| 1405 | 3300050511 | nmdc:mga08y16_103236_c1 | nmdc:mga08y16_103236_c1_662_1414 | 247 |
| 1406 | 3300050511 | nmdc:mga08y16_143182_c1 | nmdc:mga08y16_143182_c1_1207_1962 | 247 |
| 1407 | 3300050511 | nmdc:mga08y16_224_c1 | nmdc:mga08y16_224_c1_15837_16589 | 247 |
| 1408 | 3300050511 | nmdc:mga08y16_26751_c1 | nmdc:mga08y16_26751_c1_4602_5354 | 247 |
| 1409 | 3300050512 | nmdc:mga0n895_105375_c1 | nmdc:mga0n895_105375_c1_422_1174 | 247 |
| 1410 | 3300050512 | nmdc:mga0n895_24213_c1 | nmdc:mga0n895_24213_c1_4597_5352 | 247 |
| 1411 | 3300050512 | nmdc:mga0n895_85508_c1 | nmdc:mga0n895_85508_c1_2131_2883 | 247 |
| 1412 | 3300050513 | nmdc:mga0rr50_70509_c1 | nmdc:mga0rr50_70509_c1_1154_1906 | 247 |
| 1413 | 3300050514 | nmdc:mga08x19_127824_c1 | nmdc:mga08x19_127824_c1_276_1028 | 247 |
| 1414 | 3300050514 | nmdc:mga08x19_4663_c1 | nmdc:mga08x19_4663_c1_1640_2392 | 247 |
| 1415 | 3300050515 | nmdc:mga0a205_183823_c1 | nmdc:mga0a205_183823_c1_1028_1780 | 247 |
| 1416 | 3300050516 | nmdc:mga0sz30_33559_c1 | nmdc:mga0sz30_33559_c1_611_1354 | 247 |
| 1417 | 3300050516 | nmdc:mga0sz30_5376_c1 | nmdc:mga0sz30_5376_c1_3863_4606 | 247 |
| 1418 | 3300053080 | Ga0500635_0014435 | Ga0500635_0014435_14_766 | 247 |
| 1419 | 3300053085 | Ga0495619_0161304 | Ga0495619_0161304_688_1440 | 247 |
| 1420 | 3300053085 | Ga0495619_0177792 | Ga0495619_0177792_596_1339 | 247 |
| 1421 | 3300053087 | Ga0500643_000373 | Ga0500643_000373_33161_33904 | 247 |
| 1422 | 3300053091 | Ga0500647_0019184 | Ga0500647_0019184_1806_2549 | 247 |
| 1423 | 3300053091 | Ga0500647_0128774 | Ga0500647_0128774_84_836 | 247 |
| 1424 | 3300053093 | Ga0500651_0008303 | Ga0500651_0008303_3146_3901 | 247 |
| 1425 | 3300053094 | Ga0500566_0000174 | Ga0500566_0000174_1485_2228 | 247 |
| 1426 | 3300053098 | Ga0500650_0027058 | Ga0500650_0027058_1783_2526 | 247 |
| 1427 | 3300053104 | Ga0500556_0076518 | Ga0500556_0076518_365_1108 | 247 |
| 1428 | 3300053109 | Ga0500569_037550 | Ga0500569_037550_553_1296 | 247 |
| 1429 | 3300053121 | Ga0500607_021746 | Ga0500607_021746_2447_3190 | 247 |
| 1430 | 3300053130 | Ga0500642_0000127 | Ga0500642_0000127_3624_4367 | 247 |
| 1431 | 3300053130 | Ga0500642_0007115 | Ga0500642_0007115_464_1207 | 247 |
| 1432 | 3300053134 | Ga0500658_0113169 | Ga0500658_0113169_58_810 | 247 |
| 1433 | 3300053139 | Ga0500568_0003938 | Ga0500568_0003938_3299_4042 | 247 |
| 1434 | 3300053140 | Ga0500573_0091335 | Ga0500573_0091335_338_1090 | 247 |
| 1435 | 3300053148 | Ga0500590_043953 | Ga0500590_043953_318_1073 | 247 |
| 1436 | 3300053148 | Ga0500590_098831 | Ga0500590_098831_265_1017 | 247 |
| 1437 | 3300053153 | Ga0500616_0028333 | Ga0500616_0028333_713_1456 | 247 |
| 1438 | 3300053154 | Ga0500619_000101 | Ga0500619_000101_3587_4342 | 247 |
| 1439 | 3300053177 | Ga0500636_0003003 | Ga0500636_0003003_1901_2644 | 247 |
| 1440 | 3300053177 | Ga0500636_0086701 | Ga0500636_0086701_982_1734 | 247 |
| 1441 | 3300053177 | Ga0500636_0264781 | Ga0500636_0264781_98_850 | 247 |
| 1442 | 3300053729 | Ga0500625_045973 | Ga0500625_045973_135_1031 | 247 |
| 1443 | 3300053731 | Ga0500609_002948 | Ga0500609_002948_487_1230 | 247 |
| 1444 | 3300053737 | Ga0500601_001110 | Ga0500601_001110_109_852 | 247 |
| 1445 | 3300054114 | Ga0501084_0002813 | Ga0501084_0002813_5010_5762 | 247 |
| 1446 | 3300054114 | Ga0501084_0033032 | Ga0501084_0033032_3518_4270 | 247 |
| 1447 | 3300054114 | Ga0501084_0044602 | Ga0501084_0044602_348_1145 | 247 |
| 1448 | 3300054114 | Ga0501084_0137678 | Ga0501084_0137678_787_1539 | 247 |
| 1449 | 3300054114 | Ga0501084_0188968 | Ga0501084_0188968_758_1510 | 247 |
| 1450 | 3300054114 | Ga0501084_0248698 | Ga0501084_0248698_10_762 | 247 |
| 1451 | 3300054114 | Ga0501084_0351688 | Ga0501084_0351688_458_1210 | 247 |
| 1452 | 3300054114 | Ga0501084_0413638 | Ga0501084_0413638_244_1002 | 247 |
| 1453 | 3300060353 | Ga0501082_0009986 | Ga0501082_0009986_2765_3517 | 247 |
| 1454 | 3300060353 | Ga0501082_0012212 | Ga0501082_0012212_5633_6430 | 247 |
| 1455 | 3300060353 | Ga0501082_0126553 | Ga0501082_0126553_91_843 | 247 |
| 1456 | 3300060353 | Ga0501082_0360815 | Ga0501082_0360815_342_1094 | 247 |
| 1457 | 3300061734 | Ga0530510_0040585 | Ga0530510_0040585_990_1742 | 247 |
| 1458 | 3300061734 | Ga0530510_0041312 | Ga0530510_0041312_1442_2194 | 247 |
| 1459 | 3300061734 | Ga0530510_0071132 | Ga0530510_0071132_907_1659 | 247 |
| 1460 | 3300061734 | Ga0530510_0241692 | Ga0530510_0241692_85_837 | 247 |
| 1461 | 3300061734 | Ga0530510_0506470 | Ga0530510_0506470_64_816 | 247 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3grp-assembly1.cif.gz_D | 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae | 0.9659 | 6 | 242 |
| 3grp-assembly1.cif.gz_C | 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae | 0.9583 | 5 | 242 |
| 5cdy-assembly1.cif.gz_B | the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution | 0.9433 | 6 | 241 |
| 3gaf-assembly1.cif.gz_A | 2.2a crystal structure of 7-alpha-hydroxysteroid dehydrogenase from brucella melitensis | 0.943 | 1 | 241 |
| 4wk6-assembly1.cif.gz_C | crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) (g141a) from vibrio cholerae in complex with nadph | 0.9426 | 3 | 242 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3grpC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9583 | 5 | 242 | 3.40.50.720 |
| af_P0AET8_1_255_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9382 | 2 | 247 | 3.40.50.720 |
| af_G5EGA6_1_260_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9366 | 6 | 245 | 3.40.50.720 |
| af_P9WGQ5_1_255_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.935 | 1 | 243 | 3.40.50.720 |
| 3rihC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9347 | 3 | 247 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0S6US13-F1-model_v4 | 7-alpha-hydroxysteroid dehydrogenase | 0.9918 | 1 | 247 |
|
| AF-A0A0S6US13-F1-model_v4 | 7-alpha-hydroxysteroid dehydrogenase | 0.9878 | 1 | 247 |
|
| AF-A0A3P4B666-F1-model_v4 | 3-oxoacyl-[acyl-carrier-protein] reductase FabG (EC 1.1.1.100) | 0.976 | 1 | 247 |
GO:0004316
|
| AF-A0A1Q7I980-F1-model_v4 | 3-oxoacyl-ACP reductase | 0.9759 | 1 | 172 |
GO:0016020
GO:0016491 |
| AF-A0A1L3F6G0-F1-model_v4 | 3-oxoacyl-ACP reductase | 0.9729 | 1 | 247 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar