F493991
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1441 | 420 | 2882 | 92 |
Family's Representative Sequence
| Representative Sequence | 3300049576|Ga0501040_0767818|Ga0501040_0767818_18_356 |
| Length | 112 |
| Sequence | VSAPAEPDIVETLGPKETVHMSVSVRIPTILRTYTGGESEVSAQGATLAEVLDDLESNYSGIKARILDEQGSIRRFVNVYVGNDDVRFLDSLDTKTPEGVQVSVIPAVAGGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 106 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 107 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 108 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 109 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 110 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 111 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 112 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 113 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 131 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 136 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 197 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 198 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 199 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 200 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 201 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 202 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 203 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 205 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 208 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 212 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 213 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 214 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 215 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 216 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 219 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 221 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 222 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 223 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 224 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 225 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 226 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 227 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 228 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 229 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 230 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 231 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 232 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 241 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 242 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 243 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 244 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 245 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 246 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 247 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 248 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 249 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 250 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 251 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 252 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 253 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 254 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 255 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 256 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 257 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 258 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 259 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 260 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 261 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 262 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 263 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 264 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 265 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 266 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 267 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 268 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 269 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 270 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 271 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 272 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 273 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 274 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 275 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 276 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 277 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 278 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 279 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 327 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 328 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 329 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 330 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 331 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 332 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 335 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 336 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 337 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 338 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 339 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 340 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 341 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 343 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 372 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 373 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 374 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 375 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 380 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 384 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 385 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 386 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 387 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 388 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 389 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 390 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 391 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 403 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 406 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 407 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 408 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 409 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 410 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 411 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 412 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 413 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 415 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 420 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.75 |
| Metatranscriptomes | 1.25 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.15 |
| Nodule | 0 |
| Rhizoplane | 8.26 |
| Rhizosphere | 83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501040_0767818 | 3300049576 | Bacteria | 697 |
| 2 | JGI24738J21930_10130572 | 3300002075 | Bacteria | 550 |
| 3 | JGI24738J21930_10132898 | 3300002075 | Bacteria | 546 |
| 4 | JGI24749J21850_1028970 | 3300002076 | Bacteria | 792 |
| 5 | JGI25406J46586_10095658 | 3300003203 | Bacteria | 890 |
| 6 | rootH1_10021847 | 3300003323 | Bacteria | 5080 |
| 7 | Ga0007429J51699_1061575 | 3300003579 | Bacteria | 578 |
| 8 | JGI25405J52794_10017062 | 3300003911 | Bacteria | 1439 |
| 9 | Ga0070658_10086969 | 3300005327 | Bacteria | 2572 |
| 10 | Ga0070676_10253832 | 3300005328 | Bacteria | 1175 |
| 11 | Ga0070676_11083428 | 3300005328 | Bacteria | 605 |
| 12 | Ga0070676_11532281 | 3300005328 | Bacteria | 514 |
| 13 | Ga0070683_100009719 | 3300005329 | Bacteria | 8236 |
| 14 | Ga0070683_100233458 | 3300005329 | Bacteria | 1749 |
| 15 | Ga0070683_100285940 | 3300005329 | Bacteria | 1568 |
| 16 | Ga0070683_100370449 | 3300005329 | Bacteria | 1364 |
| 17 | Ga0070683_100512918 | 3300005329 | Bacteria | 1146 |
| 18 | Ga0070683_100650643 | 3300005329 | Bacteria | 1009 |
| 19 | Ga0070683_100671788 | 3300005329 | Bacteria | 992 |
| 20 | Ga0070683_101406190 | 3300005329 | Bacteria | 670 |
| 21 | Ga0068869_100365160 | 3300005334 | Bacteria | 1180 |
| 22 | Ga0068869_100627468 | 3300005334 | Bacteria | 910 |
| 23 | Ga0070666_10524548 | 3300005335 | Bacteria | 860 |
| 24 | Ga0070680_100187462 | 3300005336 | Bacteria | 1743 |
| 25 | Ga0070682_100015312 | 3300005337 | Bacteria | 4441 |
| 26 | Ga0070682_100034835 | 3300005337 | Bacteria | 3069 |
| 27 | Ga0070682_100102526 | 3300005337 | Bacteria | 1891 |
| 28 | Ga0070682_101750246 | 3300005337 | Bacteria | 541 |
| 29 | Ga0070682_101983347 | 3300005337 | Bacteria | 512 |
| 30 | Ga0068868_100197708 | 3300005338 | Bacteria | 1674 |
| 31 | Ga0068868_101052334 | 3300005338 | Bacteria | 747 |
| 32 | Ga0068868_101506457 | 3300005338 | Bacteria | 630 |
| 33 | Ga0070660_100008562 | 3300005339 | Bacteria | 7163 |
| 34 | Ga0070660_100018998 | 3300005339 | Bacteria | 5031 |
| 35 | Ga0070660_100086786 | 3300005339 | Bacteria | 2462 |
| 36 | Ga0070660_101694516 | 3300005339 | Bacteria | 538 |
| 37 | Ga0070660_101874927 | 3300005339 | Bacteria | 511 |
| 38 | Ga0070660_101912647 | 3300005339 | Bacteria | 506 |
| 39 | Ga0070691_10052760 | 3300005341 | Bacteria | 1944 |
| 40 | Ga0070691_10244347 | 3300005341 | Bacteria | 960 |
| 41 | Ga0070691_10672253 | 3300005341 | Bacteria | 619 |
| 42 | Ga0070687_100053556 | 3300005343 | Bacteria | 2099 |
| 43 | Ga0070687_101078732 | 3300005343 | Bacteria | 586 |
| 44 | Ga0070687_101210565 | 3300005343 | Bacteria | 557 |
| 45 | Ga0070661_101525808 | 3300005344 | Bacteria | 564 |
| 46 | Ga0070692_10095330 | 3300005345 | Bacteria | 1623 |
| 47 | Ga0070692_10388353 | 3300005345 | Bacteria | 878 |
| 48 | Ga0070692_10489549 | 3300005345 | Bacteria | 795 |
| 49 | Ga0070692_10964769 | 3300005345 | Bacteria | 594 |
| 50 | Ga0070668_100112162 | 3300005347 | Bacteria | 2171 |
| 51 | Ga0070668_100188181 | 3300005347 | Bacteria | 1690 |
| 52 | Ga0070668_100358002 | 3300005347 | Bacteria | 1237 |
| 53 | Ga0070668_100568034 | 3300005347 | Bacteria | 989 |
| 54 | Ga0070668_101673572 | 3300005347 | Bacteria | 584 |
| 55 | Ga0070675_100098713 | 3300005354 | Bacteria | 2457 |
| 56 | Ga0070675_100343268 | 3300005354 | Bacteria | 1323 |
| 57 | Ga0070675_101514669 | 3300005354 | Bacteria | 619 |
| 58 | Ga0070671_100401955 | 3300005355 | Bacteria | 1172 |
| 59 | Ga0070674_100076977 | 3300005356 | Bacteria | 2373 |
| 60 | Ga0070674_100097774 | 3300005356 | Bacteria | 2133 |
| 61 | Ga0070674_100701608 | 3300005356 | Bacteria | 865 |
| 62 | Ga0070674_101302839 | 3300005356 | Bacteria | 648 |
| 63 | Ga0070674_101336798 | 3300005356 | Bacteria | 640 |
| 64 | Ga0070673_100831751 | 3300005364 | Bacteria | 854 |
| 65 | Ga0070673_102121210 | 3300005364 | Bacteria | 534 |
| 66 | Ga0070688_100096811 | 3300005365 | Bacteria | 1939 |
| 67 | Ga0070688_100387983 | 3300005365 | Bacteria | 1031 |
| 68 | Ga0070659_100016719 | 3300005366 | Bacteria | 5511 |
| 69 | Ga0070659_100032751 | 3300005366 | Bacteria | 4033 |
| 70 | Ga0070659_100195515 | 3300005366 | Bacteria | 1663 |
| 71 | Ga0070659_100342419 | 3300005366 | Bacteria | 1253 |
| 72 | Ga0070659_100478383 | 3300005366 | Bacteria | 1059 |
| 73 | Ga0070659_100485414 | 3300005366 | Bacteria | 1052 |
| 74 | Ga0070659_100867386 | 3300005366 | Bacteria | 787 |
| 75 | Ga0070667_100694735 | 3300005367 | Bacteria | 941 |
| 76 | Ga0070667_102109327 | 3300005367 | Bacteria | 531 |
| 77 | Ga0070714_100023518 | 3300005435 | Bacteria | 5065 |
| 78 | Ga0070701_10066850 | 3300005438 | Bacteria | 1911 |
| 79 | Ga0070701_10260346 | 3300005438 | Bacteria | 1051 |
| 80 | Ga0070701_10661069 | 3300005438 | Bacteria | 699 |
| 81 | Ga0070700_100035874 | 3300005441 | Bacteria | 3004 |
| 82 | Ga0070700_100194691 | 3300005441 | Bacteria | 1420 |
| 83 | Ga0070700_100242287 | 3300005441 | Bacteria | 1289 |
| 84 | Ga0070700_100924102 | 3300005441 | Bacteria | 712 |
| 85 | Ga0070700_101254718 | 3300005441 | Bacteria | 621 |
| 86 | Ga0070700_101697630 | 3300005441 | Bacteria | 542 |
| 87 | Ga0070708_100765853 | 3300005445 | Bacteria | 908 |
| 88 | Ga0070663_100299871 | 3300005455 | Bacteria | 1286 |
| 89 | Ga0070663_100813679 | 3300005455 | Bacteria | 802 |
| 90 | Ga0070678_100153525 | 3300005456 | Bacteria | 1857 |
| 91 | Ga0070678_100179670 | 3300005456 | Bacteria | 1731 |
| 92 | Ga0070678_100192177 | 3300005456 | Bacteria | 1679 |
| 93 | Ga0070678_100832039 | 3300005456 | Bacteria | 840 |
| 94 | Ga0070662_100242805 | 3300005457 | Bacteria | 1445 |
| 95 | Ga0070662_101204002 | 3300005457 | Bacteria | 651 |
| 96 | Ga0070681_10452716 | 3300005458 | Bacteria | 1196 |
| 97 | Ga0068867_100004521 | 3300005459 | Bacteria | 9776 |
| 98 | Ga0068867_100042397 | 3300005459 | Bacteria | 3329 |
| 99 | Ga0068867_100565142 | 3300005459 | Bacteria | 987 |
| 100 | Ga0068867_100693724 | 3300005459 | Bacteria | 898 |
| 101 | Ga0068867_101229218 | 3300005459 | Bacteria | 689 |
| 102 | Ga0070685_10244037 | 3300005466 | Bacteria | 1187 |
| 103 | Ga0070685_11294109 | 3300005466 | Bacteria | 557 |
| 104 | Ga0070685_11509660 | 3300005466 | Bacteria | 518 |
| 105 | Ga0070707_100110080 | 3300005468 | Bacteria | 2671 |
| 106 | Ga0070698_100001109 | 3300005471 | Bacteria | 29696 |
| 107 | Ga0070698_100669749 | 3300005471 | Bacteria | 979 |
| 108 | Ga0070699_100515279 | 3300005518 | Bacteria | 1087 |
| 109 | Ga0070679_100009296 | 3300005530 | Bacteria | 9290 |
| 110 | Ga0070679_100426360 | 3300005530 | Bacteria | 1272 |
| 111 | Ga0070679_101515074 | 3300005530 | Bacteria | 618 |
| 112 | Ga0070684_100009955 | 3300005535 | Bacteria | 7516 |
| 113 | Ga0070684_100177218 | 3300005535 | Bacteria | 1937 |
| 114 | Ga0070684_100202630 | 3300005535 | Bacteria | 1808 |
| 115 | Ga0070684_100320923 | 3300005535 | Bacteria | 1423 |
| 116 | Ga0070684_100356396 | 3300005535 | Bacteria | 1346 |
| 117 | Ga0070684_100423642 | 3300005535 | Bacteria | 1229 |
| 118 | Ga0070684_101588590 | 3300005535 | Bacteria | 617 |
| 119 | Ga0070684_102339418 | 3300005535 | Bacteria | 504 |
| 120 | Ga0068853_100276012 | 3300005539 | Bacteria | 1549 |
| 121 | Ga0068853_100529227 | 3300005539 | Bacteria | 1115 |
| 122 | Ga0068853_100864006 | 3300005539 | Bacteria | 868 |
| 123 | Ga0068853_101087352 | 3300005539 | Bacteria | 771 |
| 124 | Ga0068853_101467531 | 3300005539 | Bacteria | 660 |
| 125 | Ga0070672_100134831 | 3300005543 | Bacteria | 2033 |
| 126 | Ga0070672_100640587 | 3300005543 | Bacteria | 928 |
| 127 | Ga0070672_101826239 | 3300005543 | Bacteria | 547 |
| 128 | Ga0070686_100165300 | 3300005544 | Bacteria | 1561 |
| 129 | Ga0070696_101249112 | 3300005546 | Bacteria | 629 |
| 130 | Ga0070693_100203066 | 3300005547 | Bacteria | 1288 |
| 131 | Ga0070693_100319411 | 3300005547 | Bacteria | 1053 |
| 132 | Ga0070693_100330313 | 3300005547 | Bacteria | 1037 |
| 133 | Ga0070693_100948249 | 3300005547 | Bacteria | 648 |
| 134 | Ga0070693_101499802 | 3300005547 | Bacteria | 527 |
| 135 | Ga0070665_100004100 | 3300005548 | Bacteria | 15326 |
| 136 | Ga0070665_100262563 | 3300005548 | Bacteria | 1728 |
| 137 | Ga0070704_101491345 | 3300005549 | Bacteria | 622 |
| 138 | Ga0068855_100067295 | 3300005563 | Bacteria | 4174 |
| 139 | Ga0068855_100637333 | 3300005563 | Bacteria | 1146 |
| 140 | Ga0068855_100972915 | 3300005563 | Bacteria | 893 |
| 141 | Ga0070664_100048998 | 3300005564 | Bacteria | 3572 |
| 142 | Ga0070664_100387908 | 3300005564 | Bacteria | 1276 |
| 143 | Ga0070664_100716569 | 3300005564 | Bacteria | 933 |
| 144 | Ga0070664_102034625 | 3300005564 | Bacteria | 545 |
| 145 | Ga0068857_100004625 | 3300005577 | Bacteria | 11660 |
| 146 | Ga0068857_101209237 | 3300005577 | Bacteria | 732 |
| 147 | Ga0068854_100217223 | 3300005578 | Bacteria | 1511 |
| 148 | Ga0068854_100293169 | 3300005578 | Bacteria | 1313 |
| 149 | Ga0068854_101246697 | 3300005578 | Bacteria | 668 |
| 150 | Ga0068854_101337843 | 3300005578 | Bacteria | 646 |
| 151 | Ga0068854_101700591 | 3300005578 | Bacteria | 577 |
| 152 | Ga0068856_100433202 | 3300005614 | Bacteria | 1335 |
| 153 | Ga0068856_101078897 | 3300005614 | Bacteria | 821 |
| 154 | Ga0068856_101332623 | 3300005614 | Bacteria | 733 |
| 155 | Ga0068856_101950798 | 3300005614 | Bacteria | 598 |
| 156 | Ga0070702_100048120 | 3300005615 | Bacteria | 2425 |
| 157 | Ga0070702_100647182 | 3300005615 | Bacteria | 799 |
| 158 | Ga0070702_101249905 | 3300005615 | Bacteria | 601 |
| 159 | Ga0068852_100074976 | 3300005616 | Bacteria | 2982 |
| 160 | Ga0068852_100769180 | 3300005616 | Bacteria | 976 |
| 161 | Ga0068852_101730810 | 3300005616 | Bacteria | 648 |
| 162 | Ga0068852_102497043 | 3300005616 | Bacteria | 537 |
| 163 | Ga0068859_101245350 | 3300005617 | Bacteria | 820 |
| 164 | Ga0068859_102178260 | 3300005617 | Bacteria | 612 |
| 165 | Ga0068864_100193021 | 3300005618 | Bacteria | 1868 |
| 166 | Ga0068864_100204698 | 3300005618 | Bacteria | 1815 |
| 167 | Ga0068864_101372735 | 3300005618 | Bacteria | 708 |
| 168 | Ga0068866_10045752 | 3300005718 | Bacteria | 2197 |
| 169 | Ga0068866_10154966 | 3300005718 | Bacteria | 1331 |
| 170 | Ga0068866_10571426 | 3300005718 | Bacteria | 759 |
| 171 | Ga0068866_10610339 | 3300005718 | Bacteria | 738 |
| 172 | Ga0068861_100036116 | 3300005719 | Bacteria | 3665 |
| 173 | Ga0068861_100081817 | 3300005719 | Bacteria | 2529 |
| 174 | Ga0068861_100163603 | 3300005719 | Bacteria | 1838 |
| 175 | Ga0068861_100467399 | 3300005719 | Bacteria | 1133 |
| 176 | Ga0068861_101167191 | 3300005719 | Bacteria | 743 |
| 177 | Ga0068861_102571693 | 3300005719 | Bacteria | 513 |
| 178 | Ga0068870_10016336 | 3300005840 | Bacteria | 3544 |
| 179 | Ga0068870_10320545 | 3300005840 | Bacteria | 985 |
| 180 | Ga0068863_101179603 | 3300005841 | Bacteria | 771 |
| 181 | Ga0068858_100045587 | 3300005842 | Bacteria | 4064 |
| 182 | Ga0068858_100565027 | 3300005842 | Bacteria | 1102 |
| 183 | Ga0068858_101554333 | 3300005842 | Bacteria | 653 |
| 184 | Ga0068858_102121129 | 3300005842 | Bacteria | 556 |
| 185 | Ga0068860_100000237 | 3300005843 | Bacteria | 84631 |
| 186 | Ga0068860_100386785 | 3300005843 | Bacteria | 1382 |
| 187 | Ga0068862_100198936 | 3300005844 | Bacteria | 1806 |
| 188 | Ga0068862_100853033 | 3300005844 | Bacteria | 893 |
| 189 | Ga0068862_101655450 | 3300005844 | Bacteria | 648 |
| 190 | Ga0068862_102163729 | 3300005844 | Bacteria | 567 |
| 191 | Ga0068862_102564985 | 3300005844 | Bacteria | 521 |
| 192 | Ga0081455_10005211 | 3300005937 | Bacteria | 14299 |
| 193 | Ga0081455_10006193 | 3300005937 | Bacteria | 12899 |
| 194 | Ga0081455_10031416 | 3300005937 | Bacteria | 4806 |
| 195 | Ga0081538_10000428 | 3300005981 | Bacteria | 47270 |
| 196 | Ga0081539_10047241 | 3300005985 | Bacteria | 2460 |
| 197 | Ga0075365_10006292 | 3300006038 | Bacteria | 6517 |
| 198 | Ga0075365_10017380 | 3300006038 | Bacteria | 4399 |
| 199 | Ga0075365_10024864 | 3300006038 | Bacteria | 3785 |
| 200 | Ga0075365_10031622 | 3300006038 | Bacteria | 3396 |
| 201 | Ga0075365_10046184 | 3300006038 | Bacteria | 2859 |
| 202 | Ga0075365_10116200 | 3300006038 | Bacteria | 1842 |
| 203 | Ga0075365_10161190 | 3300006038 | Bacteria | 1563 |
| 204 | Ga0075365_10171543 | 3300006038 | Bacteria | 1514 |
| 205 | Ga0075365_10201112 | 3300006038 | Bacteria | 1395 |
| 206 | Ga0075365_10307301 | 3300006038 | Bacteria | 1116 |
| 207 | Ga0075365_10315598 | 3300006038 | Bacteria | 1100 |
| 208 | Ga0075365_10405045 | 3300006038 | Bacteria | 963 |
| 209 | Ga0075365_10440853 | 3300006038 | Bacteria | 920 |
| 210 | Ga0075365_10941560 | 3300006038 | Bacteria | 609 |
| 211 | Ga0075365_11005309 | 3300006038 | Bacteria | 588 |
| 212 | Ga0075365_11228441 | 3300006038 | Bacteria | 527 |
| 213 | Ga0075365_11292786 | 3300006038 | Bacteria | 512 |
| 214 | Ga0075368_10001919 | 3300006042 | Bacteria | 6687 |
| 215 | Ga0075368_10003530 | 3300006042 | Bacteria | 5235 |
| 216 | Ga0075368_10023996 | 3300006042 | Bacteria | 2333 |
| 217 | Ga0075363_100003768 | 3300006048 | Bacteria | 6531 |
| 218 | Ga0075363_100022968 | 3300006048 | Bacteria | 3157 |
| 219 | Ga0075363_100234505 | 3300006048 | Bacteria | 1054 |
| 220 | Ga0075363_100268834 | 3300006048 | Bacteria | 984 |
| 221 | Ga0075363_100315434 | 3300006048 | Bacteria | 909 |
| 222 | Ga0075363_100500199 | 3300006048 | Bacteria | 722 |
| 223 | Ga0075364_10025977 | 3300006051 | Bacteria | 3732 |
| 224 | Ga0075364_10081863 | 3300006051 | Bacteria | 2135 |
| 225 | Ga0075364_10099101 | 3300006051 | Bacteria | 1939 |
| 226 | Ga0075364_10148513 | 3300006051 | Bacteria | 1579 |
| 227 | Ga0075364_10192118 | 3300006051 | Bacteria | 1383 |
| 228 | Ga0075364_10241276 | 3300006051 | Bacteria | 1228 |
| 229 | Ga0075432_10002344 | 3300006058 | Bacteria | 6311 |
| 230 | Ga0075432_10006679 | 3300006058 | Bacteria | 3928 |
| 231 | Ga0075432_10146408 | 3300006058 | Bacteria | 904 |
| 232 | Ga0075432_10530377 | 3300006058 | Bacteria | 529 |
| 233 | Ga0075362_10014354 | 3300006177 | Bacteria | 3195 |
| 234 | Ga0075362_10083712 | 3300006177 | Bacteria | 1473 |
| 235 | Ga0075362_10349564 | 3300006177 | Bacteria | 740 |
| 236 | Ga0075367_10046982 | 3300006178 | Bacteria | 2538 |
| 237 | Ga0075367_10154403 | 3300006178 | Bacteria | 1426 |
| 238 | Ga0075367_10336740 | 3300006178 | Bacteria | 951 |
| 239 | Ga0075366_10592548 | 3300006195 | Bacteria | 687 |
| 240 | Ga0097621_100427321 | 3300006237 | Bacteria | 1190 |
| 241 | Ga0097621_100624168 | 3300006237 | Bacteria | 987 |
| 242 | Ga0097621_100625578 | 3300006237 | Bacteria | 986 |
| 243 | Ga0097621_101908630 | 3300006237 | Bacteria | 567 |
| 244 | Ga0075370_10032500 | 3300006353 | Bacteria | 2918 |
| 245 | Ga0075370_10037500 | 3300006353 | Bacteria | 2726 |
| 246 | Ga0075370_10053867 | 3300006353 | Bacteria | 2283 |
| 247 | Ga0075370_10646666 | 3300006353 | Bacteria | 642 |
| 248 | Ga0075370_10797714 | 3300006353 | Bacteria | 576 |
| 249 | Ga0068871_100589516 | 3300006358 | Bacteria | 1010 |
| 250 | Ga0068871_100737388 | 3300006358 | Bacteria | 905 |
| 251 | Ga0075428_100024363 | 3300006844 | Bacteria | 6697 |
| 252 | Ga0075428_100130269 | 3300006844 | Bacteria | 2736 |
| 253 | Ga0075428_100582980 | 3300006844 | Bacteria | 1195 |
| 254 | Ga0075428_100659286 | 3300006844 | Bacteria | 1116 |
| 255 | Ga0075428_101702835 | 3300006844 | Bacteria | 658 |
| 256 | Ga0075430_101699776 | 3300006846 | Bacteria | 518 |
| 257 | Ga0075431_100027797 | 3300006847 | Bacteria | 5805 |
| 258 | Ga0075433_10008034 | 3300006852 | Bacteria | 8402 |
| 259 | Ga0075433_10019906 | 3300006852 | Bacteria | 5602 |
| 260 | Ga0075434_100000790 | 3300006871 | Bacteria | 25014 |
| 261 | Ga0075434_100018722 | 3300006871 | Bacteria | 6692 |
| 262 | Ga0075429_100039533 | 3300006880 | Bacteria | 4105 |
| 263 | Ga0068865_100009130 | 3300006881 | Bacteria | 6138 |
| 264 | Ga0068865_100013158 | 3300006881 | Bacteria | 5222 |
| 265 | Ga0068865_100213986 | 3300006881 | Bacteria | 1503 |
| 266 | Ga0068865_100564032 | 3300006881 | Bacteria | 958 |
| 267 | Ga0068865_101241414 | 3300006881 | Bacteria | 661 |
| 268 | Ga0075436_100070655 | 3300006914 | Bacteria | 2414 |
| 269 | Ga0075436_100109664 | 3300006914 | Bacteria | 1926 |
| 270 | Ga0097620_101245337 | 3300006931 | Bacteria | 820 |
| 271 | Ga0097620_102177941 | 3300006931 | Bacteria | 612 |
| 272 | Ga0075435_100004534 | 3300007076 | Bacteria | 9553 |
| 273 | Ga0075435_100010687 | 3300007076 | Bacteria | 6719 |
| 274 | Ga0105240_11805877 | 3300009093 | Bacteria | 637 |
| 275 | Ga0111539_10001116 | 3300009094 | Bacteria | 35481 |
| 276 | Ga0111539_10115538 | 3300009094 | Bacteria | 3147 |
| 277 | Ga0111539_10555578 | 3300009094 | Bacteria | 1337 |
| 278 | Ga0111539_12178582 | 3300009094 | Bacteria | 643 |
| 279 | Ga0111539_13483269 | 3300009094 | Bacteria | 505 |
| 280 | Ga0105245_10000784 | 3300009098 | Bacteria | 28821 |
| 281 | Ga0105245_10013521 | 3300009098 | Bacteria | 7107 |
| 282 | Ga0105245_10217370 | 3300009098 | Bacteria | 1842 |
| 283 | Ga0105245_10234858 | 3300009098 | Bacteria | 1775 |
| 284 | Ga0105245_10454951 | 3300009098 | Bacteria | 1289 |
| 285 | Ga0105245_12073563 | 3300009098 | Bacteria | 622 |
| 286 | Ga0105247_10229412 | 3300009101 | Bacteria | 1260 |
| 287 | Ga0105247_10490636 | 3300009101 | Bacteria | 893 |
| 288 | Ga0114129_10009571 | 3300009147 | Bacteria | 13822 |
| 289 | Ga0114129_10651037 | 3300009147 | Bacteria | 1360 |
| 290 | Ga0105243_10009154 | 3300009148 | Bacteria | 7561 |
| 291 | Ga0105243_10029217 | 3300009148 | Bacteria | 4238 |
| 292 | Ga0105243_10082398 | 3300009148 | Bacteria | 2629 |
| 293 | Ga0105243_10108500 | 3300009148 | Bacteria | 2317 |
| 294 | Ga0105243_10516213 | 3300009148 | Bacteria | 1135 |
| 295 | Ga0105243_10547293 | 3300009148 | Bacteria | 1105 |
| 296 | Ga0105243_10599956 | 3300009148 | Bacteria | 1060 |
| 297 | Ga0105243_10625974 | 3300009148 | Bacteria | 1039 |
| 298 | Ga0105243_11284149 | 3300009148 | Bacteria | 748 |
| 299 | Ga0105243_11608031 | 3300009148 | Bacteria | 676 |
| 300 | Ga0105243_11917559 | 3300009148 | Bacteria | 626 |
| 301 | Ga0105241_10730309 | 3300009174 | Bacteria | 906 |
| 302 | Ga0105242_10058407 | 3300009176 | Bacteria | 3162 |
| 303 | Ga0105242_10203773 | 3300009176 | Bacteria | 1759 |
| 304 | Ga0105242_10223121 | 3300009176 | Bacteria | 1685 |
| 305 | Ga0105242_10324702 | 3300009176 | Bacteria | 1413 |
| 306 | Ga0105242_12120496 | 3300009176 | Bacteria | 606 |
| 307 | Ga0105248_10640200 | 3300009177 | Bacteria | 1200 |
| 308 | Ga0105248_10690995 | 3300009177 | Bacteria | 1151 |
| 309 | Ga0105248_10982496 | 3300009177 | Bacteria | 954 |
| 310 | Ga0105248_12520967 | 3300009177 | Bacteria | 586 |
| 311 | Ga0105237_10370582 | 3300009545 | Bacteria | 1437 |
| 312 | Ga0105237_10658500 | 3300009545 | Bacteria | 1054 |
| 313 | Ga0105237_11559717 | 3300009545 | Bacteria | 667 |
| 314 | Ga0105237_11631374 | 3300009545 | Bacteria | 652 |
| 315 | Ga0105238_10104155 | 3300009551 | Bacteria | 2818 |
| 316 | Ga0105238_10306736 | 3300009551 | Bacteria | 1572 |
| 317 | Ga0105238_10644430 | 3300009551 | Bacteria | 1069 |
| 318 | Ga0105238_12833672 | 3300009551 | Bacteria | 521 |
| 319 | Ga0105249_10135909 | 3300009553 | Bacteria | 2352 |
| 320 | Ga0105249_10223838 | 3300009553 | Bacteria | 1853 |
| 321 | Ga0105249_10361030 | 3300009553 | Bacteria | 1474 |
| 322 | Ga0105249_10621648 | 3300009553 | Bacteria | 1136 |
| 323 | Ga0105249_10789355 | 3300009553 | Bacteria | 1013 |
| 324 | Ga0105249_11104770 | 3300009553 | Bacteria | 863 |
| 325 | Ga0105249_11764053 | 3300009553 | Bacteria | 691 |
| 326 | Ga0105249_11794335 | 3300009553 | Bacteria | 686 |
| 327 | Ga0105249_13229679 | 3300009553 | Bacteria | 524 |
| 328 | Ga0105249_13569943 | 3300009553 | Bacteria | 501 |
| 329 | Ga0105239_10025063 | 3300010375 | Bacteria | 6571 |
| 330 | Ga0105239_10025631 | 3300010375 | Bacteria | 6492 |
| 331 | Ga0105239_10377368 | 3300010375 | Bacteria | 1603 |
| 332 | Ga0105239_10393451 | 3300010375 | Bacteria | 1568 |
| 333 | Ga0105239_10441979 | 3300010375 | Bacteria | 1475 |
| 334 | Ga0105239_11039996 | 3300010375 | Bacteria | 942 |
| 335 | Ga0105239_11239046 | 3300010375 | Bacteria | 860 |
| 336 | Ga0105239_11251885 | 3300010375 | Bacteria | 855 |
| 337 | Ga0105239_11664473 | 3300010375 | Bacteria | 738 |
| 338 | Ga0105239_11795826 | 3300010375 | Bacteria | 710 |
| 339 | Ga0105239_12345681 | 3300010375 | Bacteria | 621 |
| 340 | Ga0105239_13292876 | 3300010375 | Bacteria | 526 |
| 341 | Ga0105246_10004511 | 3300011119 | Bacteria | 8468 |
| 342 | Ga0105246_10197563 | 3300011119 | Bacteria | 1561 |
| 343 | Ga0105246_10207269 | 3300011119 | Bacteria | 1528 |
| 344 | Ga0105246_10320138 | 3300011119 | Bacteria | 1260 |
| 345 | Ga0105246_10797071 | 3300011119 | Bacteria | 838 |
| 346 | Ga0105246_11519439 | 3300011119 | Bacteria | 630 |
| 347 | Ga0105246_12304057 | 3300011119 | Bacteria | 526 |
| 348 | Ga0105246_12415712 | 3300011119 | Bacteria | 516 |
| 349 | Ga0157329_1004908 | 3300012491 | Bacteria | 885 |
| 350 | Ga0157341_1002850 | 3300012494 | Bacteria | 1171 |
| 351 | Ga0157319_1001748 | 3300012497 | Bacteria | 1166 |
| 352 | Ga0157345_1023030 | 3300012498 | Bacteria | 649 |
| 353 | Ga0157347_1059840 | 3300012502 | Bacteria | 543 |
| 354 | Ga0157313_1037034 | 3300012503 | Bacteria | 582 |
| 355 | Ga0157324_1031350 | 3300012506 | Bacteria | 604 |
| 356 | Ga0157315_1060990 | 3300012508 | Bacteria | 532 |
| 357 | Ga0157326_1003780 | 3300012513 | Bacteria | 1591 |
| 358 | Ga0157371_10087004 | 3300013102 | Bacteria | 2213 |
| 359 | Ga0157371_10160623 | 3300013102 | Bacteria | 1605 |
| 360 | Ga0157371_10293750 | 3300013102 | Bacteria | 1175 |
| 361 | Ga0157371_10354094 | 3300013102 | Bacteria | 1069 |
| 362 | Ga0157371_11185366 | 3300013102 | Bacteria | 588 |
| 363 | Ga0157370_10264443 | 3300013104 | Bacteria | 1589 |
| 364 | Ga0157370_11027938 | 3300013104 | Bacteria | 746 |
| 365 | Ga0157370_11236407 | 3300013104 | Bacteria | 673 |
| 366 | Ga0157370_11464431 | 3300013104 | Bacteria | 614 |
| 367 | Ga0157370_11672520 | 3300013104 | Bacteria | 571 |
| 368 | Ga0157369_10057264 | 3300013105 | Bacteria | 4205 |
| 369 | Ga0157369_10250867 | 3300013105 | Bacteria | 1847 |
| 370 | Ga0157369_10474237 | 3300013105 | Bacteria | 1295 |
| 371 | Ga0157369_11691093 | 3300013105 | Bacteria | 643 |
| 372 | Ga0157374_10463567 | 3300013296 | Bacteria | 1269 |
| 373 | Ga0157374_10998224 | 3300013296 | Bacteria | 856 |
| 374 | Ga0157374_11198190 | 3300013296 | Bacteria | 781 |
| 375 | Ga0157374_12866168 | 3300013296 | Bacteria | 510 |
| 376 | Ga0157378_10616971 | 3300013297 | Bacteria | 1097 |
| 377 | Ga0157378_11409136 | 3300013297 | Bacteria | 740 |
| 378 | Ga0157378_11590307 | 3300013297 | Bacteria | 699 |
| 379 | Ga0163162_10037964 | 3300013306 | Bacteria | 4808 |
| 380 | Ga0163162_10165665 | 3300013306 | Bacteria | 2334 |
| 381 | Ga0163162_10699096 | 3300013306 | Bacteria | 1136 |
| 382 | Ga0163162_10880048 | 3300013306 | Bacteria | 1010 |
| 383 | Ga0163162_10953710 | 3300013306 | Bacteria | 969 |
| 384 | Ga0163162_10991718 | 3300013306 | Bacteria | 949 |
| 385 | Ga0163162_12141496 | 3300013306 | Bacteria | 642 |
| 386 | Ga0157372_10006799 | 3300013307 | Bacteria | 12159 |
| 387 | Ga0157372_10196315 | 3300013307 | Bacteria | 2338 |
| 388 | Ga0157372_10340898 | 3300013307 | Bacteria | 1746 |
| 389 | Ga0157372_10387888 | 3300013307 | Bacteria | 1627 |
| 390 | Ga0157372_10439006 | 3300013307 | Bacteria | 1521 |
| 391 | Ga0157372_10605056 | 3300013307 | Bacteria | 1277 |
| 392 | Ga0157372_11561311 | 3300013307 | Bacteria | 760 |
| 393 | Ga0157372_11871357 | 3300013307 | Bacteria | 690 |
| 394 | Ga0157372_12767302 | 3300013307 | Bacteria | 563 |
| 395 | Ga0157375_10070197 | 3300013308 | Bacteria | 3512 |
| 396 | Ga0157375_10154789 | 3300013308 | Bacteria | 2431 |
| 397 | Ga0157375_10268601 | 3300013308 | Bacteria | 1867 |
| 398 | Ga0157375_10288095 | 3300013308 | Bacteria | 1805 |
| 399 | Ga0157375_10347642 | 3300013308 | Bacteria | 1649 |
| 400 | Ga0157375_10407439 | 3300013308 | Bacteria | 1526 |
| 401 | Ga0157375_10623105 | 3300013308 | Bacteria | 1237 |
| 402 | Ga0157375_10655259 | 3300013308 | Bacteria | 1206 |
| 403 | Ga0157375_10707989 | 3300013308 | Bacteria | 1160 |
| 404 | Ga0157375_10919724 | 3300013308 | Bacteria | 1018 |
| 405 | Ga0157375_10985650 | 3300013308 | Bacteria | 983 |
| 406 | Ga0163163_10207804 | 3300014325 | Bacteria | 2006 |
| 407 | Ga0163163_10371732 | 3300014325 | Bacteria | 1487 |
| 408 | Ga0163163_10965638 | 3300014325 | Bacteria | 915 |
| 409 | Ga0163163_11029407 | 3300014325 | Bacteria | 887 |
| 410 | Ga0163163_11734882 | 3300014325 | Bacteria | 685 |
| 411 | Ga0163163_11823228 | 3300014325 | Bacteria | 669 |
| 412 | Ga0163163_12662559 | 3300014325 | Bacteria | 557 |
| 413 | Ga0157380_10003865 | 3300014326 | Bacteria | 10322 |
| 414 | Ga0157380_10025349 | 3300014326 | Bacteria | 4497 |
| 415 | Ga0157380_10311376 | 3300014326 | Bacteria | 1455 |
| 416 | Ga0157380_10738734 | 3300014326 | Bacteria | 994 |
| 417 | Ga0182008_10070344 | 3300014497 | Bacteria | 1722 |
| 418 | Ga0182008_10142112 | 3300014497 | Bacteria | 1201 |
| 419 | Ga0182008_10334886 | 3300014497 | Bacteria | 799 |
| 420 | Ga0157377_10002420 | 3300014745 | Bacteria | 8237 |
| 421 | Ga0157377_10828088 | 3300014745 | Bacteria | 685 |
| 422 | Ga0157377_10897746 | 3300014745 | Bacteria | 662 |
| 423 | Ga0157377_11130082 | 3300014745 | Bacteria | 602 |
| 424 | Ga0157377_11149366 | 3300014745 | Bacteria | 598 |
| 425 | Ga0157379_10319028 | 3300014968 | Bacteria | 1419 |
| 426 | Ga0157376_10426080 | 3300014969 | Bacteria | 1289 |
| 427 | Ga0157376_10844694 | 3300014969 | Bacteria | 931 |
| 428 | Ga0157376_10964637 | 3300014969 | Bacteria | 874 |
| 429 | Ga0157376_11485512 | 3300014969 | Bacteria | 710 |
| 430 | Ga0163161_10255290 | 3300017792 | Bacteria | 1367 |
| 431 | Ga0163161_10272722 | 3300017792 | Bacteria | 1324 |
| 432 | Ga0163161_10844374 | 3300017792 | Bacteria | 772 |
| 433 | Ga0163161_10931748 | 3300017792 | Bacteria | 738 |
| 434 | Ga0163161_10990139 | 3300017792 | Bacteria | 717 |
| 435 | Ga0163161_11316386 | 3300017792 | Bacteria | 628 |
| 436 | Ga0163161_12003410 | 3300017792 | Bacteria | 515 |
| 437 | Ga0206356_11045432 | 3300020070 | Bacteria | 885 |
| 438 | Ga0206355_1474064 | 3300020076 | Bacteria | 576 |
| 439 | Ga0206351_10522411 | 3300020077 | Bacteria | 562 |
| 440 | Ga0206350_10017631 | 3300020080 | Bacteria | 542 |
| 441 | Ga0206354_11068423 | 3300020081 | Bacteria | 1071 |
| 442 | Ga0206353_10074550 | 3300020082 | Bacteria | 977 |
| 443 | Ga0206353_10216600 | 3300020082 | Bacteria | 743 |
| 444 | Ga0206353_11576002 | 3300020082 | Bacteria | 772 |
| 445 | Ga0213876_10133516 | 3300021384 | Bacteria | 1320 |
| 446 | Ga0224712_10232111 | 3300022467 | Bacteria | 847 |
| 447 | Ga0207697_10201355 | 3300025315 | Bacteria | 876 |
| 448 | Ga0207682_10228961 | 3300025893 | Bacteria | 861 |
| 449 | Ga0207642_10016931 | 3300025899 | Bacteria | 2760 |
| 450 | Ga0207642_10114690 | 3300025899 | Bacteria | 1378 |
| 451 | Ga0207642_10354691 | 3300025899 | Bacteria | 866 |
| 452 | Ga0207642_10582879 | 3300025899 | Bacteria | 694 |
| 453 | Ga0207642_10837576 | 3300025899 | Bacteria | 587 |
| 454 | Ga0207710_10137174 | 3300025900 | Bacteria | 1179 |
| 455 | Ga0207710_10191245 | 3300025900 | Bacteria | 1008 |
| 456 | Ga0207688_10023178 | 3300025901 | Bacteria | 3398 |
| 457 | Ga0207688_10025639 | 3300025901 | Bacteria | 3239 |
| 458 | Ga0207688_10129326 | 3300025901 | Bacteria | 1479 |
| 459 | Ga0207688_10232666 | 3300025901 | Bacteria | 1113 |
| 460 | Ga0207688_10451783 | 3300025901 | Bacteria | 801 |
| 461 | Ga0207688_10693185 | 3300025901 | Bacteria | 644 |
| 462 | Ga0207688_10937748 | 3300025901 | Bacteria | 548 |
| 463 | Ga0207688_11007464 | 3300025901 | Bacteria | 526 |
| 464 | Ga0207647_10011458 | 3300025904 | Bacteria | 6218 |
| 465 | Ga0207647_10191704 | 3300025904 | Bacteria | 1184 |
| 466 | Ga0207647_10232904 | 3300025904 | Bacteria | 1059 |
| 467 | Ga0207647_10265991 | 3300025904 | Bacteria | 981 |
| 468 | Ga0207647_10306855 | 3300025904 | Bacteria | 903 |
| 469 | Ga0207645_10516514 | 3300025907 | Bacteria | 809 |
| 470 | Ga0207643_10003490 | 3300025908 | Bacteria | 8454 |
| 471 | Ga0207643_10037488 | 3300025908 | Bacteria | 2720 |
| 472 | Ga0207643_10726892 | 3300025908 | Bacteria | 642 |
| 473 | Ga0207705_10012685 | 3300025909 | Bacteria | 6081 |
| 474 | Ga0207705_10942087 | 3300025909 | Bacteria | 668 |
| 475 | Ga0207707_10954079 | 3300025912 | Bacteria | 706 |
| 476 | Ga0207707_11267495 | 3300025912 | Bacteria | 594 |
| 477 | Ga0207671_10144000 | 3300025914 | Bacteria | 1838 |
| 478 | Ga0207671_10162853 | 3300025914 | Bacteria | 1728 |
| 479 | Ga0207671_10239136 | 3300025914 | Bacteria | 1426 |
| 480 | Ga0207660_11321538 | 3300025917 | Bacteria | 585 |
| 481 | Ga0207662_10055716 | 3300025918 | Bacteria | 2360 |
| 482 | Ga0207657_10004479 | 3300025919 | Bacteria | 14773 |
| 483 | Ga0207657_10027478 | 3300025919 | Bacteria | 5211 |
| 484 | Ga0207657_10050202 | 3300025919 | Bacteria | 3631 |
| 485 | Ga0207657_10873637 | 3300025919 | Bacteria | 693 |
| 486 | Ga0207657_11171562 | 3300025919 | Bacteria | 585 |
| 487 | Ga0207652_10437966 | 3300025921 | Bacteria | 1178 |
| 488 | Ga0207652_10533276 | 3300025921 | Bacteria | 1056 |
| 489 | Ga0207646_10054603 | 3300025922 | Bacteria | 3573 |
| 490 | Ga0207681_11427968 | 3300025923 | Bacteria | 581 |
| 491 | Ga0207694_10260070 | 3300025924 | Bacteria | 1422 |
| 492 | Ga0207694_10705232 | 3300025924 | Bacteria | 851 |
| 493 | Ga0207694_11729332 | 3300025924 | Bacteria | 526 |
| 494 | Ga0207659_10112748 | 3300025926 | Bacteria | 2070 |
| 495 | Ga0207659_10122010 | 3300025926 | Bacteria | 1998 |
| 496 | Ga0207687_10007750 | 3300025927 | Bacteria | 7045 |
| 497 | Ga0207687_10031535 | 3300025927 | Bacteria | 3583 |
| 498 | Ga0207687_10089049 | 3300025927 | Bacteria | 2246 |
| 499 | Ga0207687_10392237 | 3300025927 | Bacteria | 1140 |
| 500 | Ga0207664_10021185 | 3300025929 | Bacteria | 4829 |
| 501 | Ga0207644_10341144 | 3300025931 | Bacteria | 1215 |
| 502 | Ga0207644_10740850 | 3300025931 | Bacteria | 821 |
| 503 | Ga0207690_10038937 | 3300025932 | Bacteria | 3098 |
| 504 | Ga0207690_10104390 | 3300025932 | Bacteria | 2030 |
| 505 | Ga0207690_10171780 | 3300025932 | Bacteria | 1625 |
| 506 | Ga0207690_10177518 | 3300025932 | Bacteria | 1601 |
| 507 | Ga0207690_10349331 | 3300025932 | Bacteria | 1169 |
| 508 | Ga0207690_10486765 | 3300025932 | Bacteria | 996 |
| 509 | Ga0207690_11047723 | 3300025932 | Bacteria | 679 |
| 510 | Ga0207706_10025706 | 3300025933 | Bacteria | 5274 |
| 511 | Ga0207706_10138591 | 3300025933 | Bacteria | 2140 |
| 512 | Ga0207706_10148220 | 3300025933 | Bacteria | 2064 |
| 513 | Ga0207706_10331879 | 3300025933 | Bacteria | 1323 |
| 514 | Ga0207706_10867856 | 3300025933 | Bacteria | 763 |
| 515 | Ga0207686_10708021 | 3300025934 | Bacteria | 801 |
| 516 | Ga0207686_11492274 | 3300025934 | Bacteria | 557 |
| 517 | Ga0207709_10031220 | 3300025935 | Bacteria | 3109 |
| 518 | Ga0207709_10075093 | 3300025935 | Bacteria | 2159 |
| 519 | Ga0207709_10240490 | 3300025935 | Bacteria | 1317 |
| 520 | Ga0207709_10494880 | 3300025935 | Bacteria | 953 |
| 521 | Ga0207709_10946058 | 3300025935 | Bacteria | 702 |
| 522 | Ga0207709_11001324 | 3300025935 | Bacteria | 683 |
| 523 | Ga0207669_10082943 | 3300025937 | Bacteria | 2060 |
| 524 | Ga0207669_10083410 | 3300025937 | Bacteria | 2055 |
| 525 | Ga0207669_10302691 | 3300025937 | Bacteria | 1216 |
| 526 | Ga0207669_11563720 | 3300025937 | Bacteria | 563 |
| 527 | Ga0207669_11578060 | 3300025937 | Bacteria | 560 |
| 528 | Ga0207704_10007451 | 3300025938 | Bacteria | 5171 |
| 529 | Ga0207704_10074232 | 3300025938 | Bacteria | 2169 |
| 530 | Ga0207704_10212072 | 3300025938 | Bacteria | 1426 |
| 531 | Ga0207704_10506540 | 3300025938 | Bacteria | 974 |
| 532 | Ga0207691_10007736 | 3300025940 | Bacteria | 10345 |
| 533 | Ga0207691_10435869 | 3300025940 | Bacteria | 1116 |
| 534 | Ga0207691_10958650 | 3300025940 | Bacteria | 715 |
| 535 | Ga0207691_11343843 | 3300025940 | Bacteria | 589 |
| 536 | Ga0207711_10352633 | 3300025941 | Bacteria | 1362 |
| 537 | Ga0207711_10421491 | 3300025941 | Bacteria | 1241 |
| 538 | Ga0207711_10495792 | 3300025941 | Bacteria | 1138 |
| 539 | Ga0207689_10202976 | 3300025942 | Bacteria | 1637 |
| 540 | Ga0207689_10761677 | 3300025942 | Bacteria | 817 |
| 541 | Ga0207689_11643269 | 3300025942 | Bacteria | 534 |
| 542 | Ga0207661_10133972 | 3300025944 | Bacteria | 2126 |
| 543 | Ga0207661_10146461 | 3300025944 | Bacteria | 2038 |
| 544 | Ga0207661_10171341 | 3300025944 | Bacteria | 1890 |
| 545 | Ga0207661_10250278 | 3300025944 | Bacteria | 1575 |
| 546 | Ga0207661_10523615 | 3300025944 | Bacteria | 1085 |
| 547 | Ga0207661_10628778 | 3300025944 | Bacteria | 986 |
| 548 | Ga0207661_10813759 | 3300025944 | Bacteria | 860 |
| 549 | Ga0207661_10848868 | 3300025944 | Bacteria | 841 |
| 550 | Ga0207661_10886863 | 3300025944 | Bacteria | 821 |
| 551 | Ga0207661_11272465 | 3300025944 | Bacteria | 676 |
| 552 | Ga0207661_11477616 | 3300025944 | Bacteria | 623 |
| 553 | Ga0207679_10412219 | 3300025945 | Bacteria | 1191 |
| 554 | Ga0207679_10490537 | 3300025945 | Bacteria | 1095 |
| 555 | Ga0207679_10710591 | 3300025945 | Bacteria | 912 |
| 556 | Ga0207679_10981133 | 3300025945 | Bacteria | 774 |
| 557 | Ga0207679_11522531 | 3300025945 | Bacteria | 613 |
| 558 | Ga0207679_11700351 | 3300025945 | Bacteria | 577 |
| 559 | Ga0207679_12129599 | 3300025945 | Bacteria | 509 |
| 560 | Ga0207667_10661603 | 3300025949 | Bacteria | 1049 |
| 561 | Ga0207667_10890745 | 3300025949 | Bacteria | 882 |
| 562 | Ga0207651_11077563 | 3300025960 | Bacteria | 720 |
| 563 | Ga0207712_10099681 | 3300025961 | Bacteria | 2157 |
| 564 | Ga0207712_10163356 | 3300025961 | Bacteria | 1733 |
| 565 | Ga0207712_10287048 | 3300025961 | Bacteria | 1345 |
| 566 | Ga0207712_10360721 | 3300025961 | Bacteria | 1211 |
| 567 | Ga0207712_10816847 | 3300025961 | Bacteria | 820 |
| 568 | Ga0207668_10044265 | 3300025972 | Bacteria | 3027 |
| 569 | Ga0207668_10127223 | 3300025972 | Bacteria | 1940 |
| 570 | Ga0207668_11906966 | 3300025972 | Bacteria | 536 |
| 571 | Ga0207640_10241322 | 3300025981 | Bacteria | 1396 |
| 572 | Ga0207640_10278164 | 3300025981 | Bacteria | 1313 |
| 573 | Ga0207640_10431235 | 3300025981 | Bacteria | 1081 |
| 574 | Ga0207640_11136856 | 3300025981 | Bacteria | 692 |
| 575 | Ga0207640_11167579 | 3300025981 | Bacteria | 683 |
| 576 | Ga0207640_11229803 | 3300025981 | Bacteria | 667 |
| 577 | Ga0207658_10017447 | 3300025986 | Bacteria | 4946 |
| 578 | Ga0207658_10612554 | 3300025986 | Bacteria | 979 |
| 579 | Ga0207658_12154622 | 3300025986 | Bacteria | 506 |
| 580 | Ga0207677_10214840 | 3300026023 | Bacteria | 1538 |
| 581 | Ga0207677_10872935 | 3300026023 | Bacteria | 810 |
| 582 | Ga0207677_11375181 | 3300026023 | Bacteria | 650 |
| 583 | Ga0207703_10287576 | 3300026035 | Bacteria | 1495 |
| 584 | Ga0207703_11400234 | 3300026035 | Bacteria | 673 |
| 585 | Ga0207639_10723903 | 3300026041 | Bacteria | 924 |
| 586 | Ga0207639_11886409 | 3300026041 | Bacteria | 558 |
| 587 | Ga0207678_10271749 | 3300026067 | Bacteria | 1453 |
| 588 | Ga0207678_10359302 | 3300026067 | Bacteria | 1257 |
| 589 | Ga0207678_10424293 | 3300026067 | Bacteria | 1153 |
| 590 | Ga0207678_10436417 | 3300026067 | Bacteria | 1137 |
| 591 | Ga0207678_10981732 | 3300026067 | Bacteria | 747 |
| 592 | Ga0207678_11044549 | 3300026067 | Bacteria | 723 |
| 593 | Ga0207678_11668786 | 3300026067 | Bacteria | 560 |
| 594 | Ga0207708_10042577 | 3300026075 | Bacteria | 3460 |
| 595 | Ga0207708_10064834 | 3300026075 | Bacteria | 2792 |
| 596 | Ga0207708_10162751 | 3300026075 | Bacteria | 1763 |
| 597 | Ga0207708_10516949 | 3300026075 | Bacteria | 1003 |
| 598 | Ga0207708_11185591 | 3300026075 | Bacteria | 667 |
| 599 | Ga0207708_11206609 | 3300026075 | Bacteria | 662 |
| 600 | Ga0207708_11539972 | 3300026075 | Bacteria | 584 |
| 601 | Ga0207708_12018224 | 3300026075 | Bacteria | 505 |
| 602 | Ga0207702_10880280 | 3300026078 | Bacteria | 887 |
| 603 | Ga0207702_10913944 | 3300026078 | Bacteria | 870 |
| 604 | Ga0207702_11231244 | 3300026078 | Bacteria | 743 |
| 605 | Ga0207641_10440161 | 3300026088 | Bacteria | 1258 |
| 606 | Ga0207648_10001576 | 3300026089 | Bacteria | 25004 |
| 607 | Ga0207648_10052869 | 3300026089 | Bacteria | 3551 |
| 608 | Ga0207648_10767661 | 3300026089 | Bacteria | 896 |
| 609 | Ga0207648_10994035 | 3300026089 | Bacteria | 786 |
| 610 | Ga0207648_11158671 | 3300026089 | Bacteria | 726 |
| 611 | Ga0207676_10713395 | 3300026095 | Bacteria | 973 |
| 612 | Ga0207676_10905768 | 3300026095 | Bacteria | 865 |
| 613 | Ga0207676_10940089 | 3300026095 | Bacteria | 850 |
| 614 | Ga0207676_12322168 | 3300026095 | Bacteria | 534 |
| 615 | Ga0207674_10003282 | 3300026116 | Bacteria | 19892 |
| 616 | Ga0207674_10913390 | 3300026116 | Bacteria | 846 |
| 617 | Ga0207674_10983585 | 3300026116 | Bacteria | 813 |
| 618 | Ga0207674_11291720 | 3300026116 | Bacteria | 699 |
| 619 | Ga0207675_100019126 | 3300026118 | Bacteria | 6394 |
| 620 | Ga0207675_100027624 | 3300026118 | Bacteria | 5285 |
| 621 | Ga0207675_100072241 | 3300026118 | Bacteria | 3227 |
| 622 | Ga0207675_101002295 | 3300026118 | Bacteria | 854 |
| 623 | Ga0207675_101013152 | 3300026118 | Bacteria | 849 |
| 624 | Ga0207675_102017733 | 3300026118 | Bacteria | 594 |
| 625 | Ga0207683_10024133 | 3300026121 | Bacteria | 5233 |
| 626 | Ga0207683_10686162 | 3300026121 | Bacteria | 949 |
| 627 | Ga0207683_11943957 | 3300026121 | Bacteria | 537 |
| 628 | Ga0207698_10017237 | 3300026142 | Bacteria | 4895 |
| 629 | Ga0207698_10179653 | 3300026142 | Bacteria | 1873 |
| 630 | Ga0207698_11362345 | 3300026142 | Bacteria | 724 |
| 631 | Ga0207698_11863031 | 3300026142 | Bacteria | 616 |
| 632 | Ga0207698_11946301 | 3300026142 | Bacteria | 602 |
| 633 | Ga0207698_12005461 | 3300026142 | Bacteria | 593 |
| 634 | Ga0207698_12485903 | 3300026142 | Bacteria | 528 |
| 635 | Ga0209371_1059702 | 3300027312 | Bacteria | 704 |
| 636 | Ga0209813_10001855 | 3300027866 | Bacteria | 4767 |
| 637 | Ga0209813_10007379 | 3300027866 | Bacteria | 2737 |
| 638 | Ga0209813_10029205 | 3300027866 | Bacteria | 1613 |
| 639 | Ga0209974_10250496 | 3300027876 | Bacteria | 666 |
| 640 | Ga0207428_10001037 | 3300027907 | Bacteria | 30620 |
| 641 | Ga0207428_10002082 | 3300027907 | Bacteria | 20158 |
| 642 | Ga0207428_10059433 | 3300027907 | Bacteria | 3032 |
| 643 | Ga0268266_10019655 | 3300028379 | Bacteria | 5755 |
| 644 | Ga0268266_10132557 | 3300028379 | Bacteria | 2230 |
| 645 | Ga0268266_10343366 | 3300028379 | Bacteria | 1402 |
| 646 | Ga0268266_10785031 | 3300028379 | Bacteria | 920 |
| 647 | Ga0268266_10888330 | 3300028379 | Bacteria | 862 |
| 648 | Ga0268266_10941209 | 3300028379 | Bacteria | 836 |
| 649 | Ga0268266_10951369 | 3300028379 | Bacteria | 831 |
| 650 | Ga0268266_12264150 | 3300028379 | Bacteria | 515 |
| 651 | Ga0268265_10524707 | 3300028380 | Bacteria | 1120 |
| 652 | Ga0268265_10705282 | 3300028380 | Bacteria | 975 |
| 653 | Ga0268265_12502348 | 3300028380 | Bacteria | 522 |
| 654 | Ga0268264_10000195 | 3300028381 | Bacteria | 123899 |
| 655 | Ga0268264_10030690 | 3300028381 | Bacteria | 4406 |
| 656 | Ga0268264_12620586 | 3300028381 | Bacteria | 508 |
| 657 | Ga0307517_10659924 | 3300028786 | Bacteria | 508 |
| 658 | Ga0307515_10336916 | 3300028794 | Bacteria | 1163 |
| 659 | Ga0268256_1066836 | 3300030500 | Bacteria | 704 |
| 660 | Ga0316182_1145211 | 3300030745 | Bacteria | 747 |
| 661 | Ga0307513_10578670 | 3300031456 | Bacteria | 833 |
| 662 | Ga0307509_10009190 | 3300031507 | Bacteria | 12410 |
| 663 | Ga0307408_100003860 | 3300031548 | Bacteria | 10198 |
| 664 | Ga0307408_100049059 | 3300031548 | Bacteria | 3031 |
| 665 | Ga0307408_100089115 | 3300031548 | Bacteria | 2325 |
| 666 | Ga0307408_100133046 | 3300031548 | Bacteria | 1942 |
| 667 | Ga0307408_100980822 | 3300031548 | Bacteria | 778 |
| 668 | Ga0307408_101751100 | 3300031548 | Bacteria | 593 |
| 669 | Ga0307405_10001103 | 3300031731 | Bacteria | 11033 |
| 670 | Ga0307405_10006689 | 3300031731 | Bacteria | 5694 |
| 671 | Ga0307405_10055925 | 3300031731 | Bacteria | 2472 |
| 672 | Ga0307405_10397742 | 3300031731 | Bacteria | 1077 |
| 673 | Ga0307405_10824029 | 3300031731 | Bacteria | 779 |
| 674 | Ga0307413_10034163 | 3300031824 | Bacteria | 2903 |
| 675 | Ga0307413_10075719 | 3300031824 | Bacteria | 2137 |
| 676 | Ga0307413_10094384 | 3300031824 | Bacteria | 1958 |
| 677 | Ga0307413_10108459 | 3300031824 | Bacteria | 1853 |
| 678 | Ga0307413_11894619 | 3300031824 | Bacteria | 535 |
| 679 | Ga0307410_10000104 | 3300031852 | Bacteria | 29659 |
| 680 | Ga0307410_10027795 | 3300031852 | Bacteria | 3578 |
| 681 | Ga0307410_10098455 | 3300031852 | Bacteria | 2092 |
| 682 | Ga0307410_10300520 | 3300031852 | Bacteria | 1266 |
| 683 | Ga0307410_10365397 | 3300031852 | Bacteria | 1157 |
| 684 | Ga0307410_10443407 | 3300031852 | Bacteria | 1057 |
| 685 | Ga0307410_10624960 | 3300031852 | Bacteria | 901 |
| 686 | Ga0307410_11239514 | 3300031852 | Bacteria | 651 |
| 687 | Ga0307410_11421478 | 3300031852 | Bacteria | 609 |
| 688 | Ga0307410_11745830 | 3300031852 | Bacteria | 552 |
| 689 | Ga0307410_11844957 | 3300031852 | Bacteria | 538 |
| 690 | Ga0307406_10002432 | 3300031901 | Bacteria | 10128 |
| 691 | Ga0307406_10004038 | 3300031901 | Bacteria | 7981 |
| 692 | Ga0307406_10159312 | 3300031901 | Bacteria | 1620 |
| 693 | Ga0307406_10350080 | 3300031901 | Bacteria | 1154 |
| 694 | Ga0307406_10422472 | 3300031901 | Bacteria | 1062 |
| 695 | Ga0307406_10848067 | 3300031901 | Bacteria | 774 |
| 696 | Ga0307406_11624545 | 3300031901 | Bacteria | 571 |
| 697 | Ga0307407_10009633 | 3300031903 | Bacteria | 4509 |
| 698 | Ga0307407_10023658 | 3300031903 | Bacteria | 3208 |
| 699 | Ga0307407_10039378 | 3300031903 | Bacteria | 2628 |
| 700 | Ga0307407_10122575 | 3300031903 | Bacteria | 1650 |
| 701 | Ga0307407_10145777 | 3300031903 | Bacteria | 1533 |
| 702 | Ga0307407_10149766 | 3300031903 | Bacteria | 1515 |
| 703 | Ga0307407_10326575 | 3300031903 | Bacteria | 1078 |
| 704 | Ga0307407_10614433 | 3300031903 | Bacteria | 811 |
| 705 | Ga0307407_10683118 | 3300031903 | Bacteria | 772 |
| 706 | Ga0307407_10746354 | 3300031903 | Bacteria | 741 |
| 707 | Ga0307407_10876417 | 3300031903 | Bacteria | 687 |
| 708 | Ga0307407_11065760 | 3300031903 | Bacteria | 627 |
| 709 | Ga0307407_11401788 | 3300031903 | Bacteria | 550 |
| 710 | Ga0307412_10102729 | 3300031911 | Bacteria | 2025 |
| 711 | Ga0307412_10181827 | 3300031911 | Bacteria | 1582 |
| 712 | Ga0307412_10574554 | 3300031911 | Bacteria | 950 |
| 713 | Ga0307412_11639144 | 3300031911 | Bacteria | 588 |
| 714 | Ga0307412_12297496 | 3300031911 | Bacteria | 503 |
| 715 | Ga0307409_100000362 | 3300031995 | Bacteria | 18990 |
| 716 | Ga0307409_100013725 | 3300031995 | Bacteria | 5232 |
| 717 | Ga0307409_100048235 | 3300031995 | Bacteria | 3239 |
| 718 | Ga0307409_100086508 | 3300031995 | Bacteria | 2551 |
| 719 | Ga0307409_100107296 | 3300031995 | Bacteria | 2333 |
| 720 | Ga0307409_100267865 | 3300031995 | Bacteria | 1571 |
| 721 | Ga0307409_100291161 | 3300031995 | Bacteria | 1514 |
| 722 | Ga0307409_100305750 | 3300031995 | Bacteria | 1481 |
| 723 | Ga0307409_100418477 | 3300031995 | Bacteria | 1285 |
| 724 | Ga0307409_100536360 | 3300031995 | Bacteria | 1146 |
| 725 | Ga0307409_100566233 | 3300031995 | Bacteria | 1118 |
| 726 | Ga0307409_100599275 | 3300031995 | Bacteria | 1089 |
| 727 | Ga0307409_100634940 | 3300031995 | Bacteria | 1060 |
| 728 | Ga0307409_101004562 | 3300031995 | Bacteria | 852 |
| 729 | Ga0307409_101029679 | 3300031995 | Bacteria | 842 |
| 730 | Ga0307409_101293011 | 3300031995 | Bacteria | 754 |
| 731 | Ga0307409_102445044 | 3300031995 | Bacteria | 551 |
| 732 | Ga0307409_102950098 | 3300031995 | Bacteria | 502 |
| 733 | Ga0307416_100000240 | 3300032002 | Bacteria | 29208 |
| 734 | Ga0307416_100031648 | 3300032002 | Bacteria | 3985 |
| 735 | Ga0307416_100227355 | 3300032002 | Bacteria | 1795 |
| 736 | Ga0307416_100622512 | 3300032002 | Bacteria | 1161 |
| 737 | Ga0307416_100632438 | 3300032002 | Bacteria | 1153 |
| 738 | Ga0307416_100735733 | 3300032002 | Bacteria | 1078 |
| 739 | Ga0307416_100855586 | 3300032002 | Bacteria | 1007 |
| 740 | Ga0307416_101239266 | 3300032002 | Bacteria | 852 |
| 741 | Ga0307416_101771688 | 3300032002 | Bacteria | 722 |
| 742 | Ga0307416_101948383 | 3300032002 | Bacteria | 690 |
| 743 | Ga0307416_101985962 | 3300032002 | Bacteria | 684 |
| 744 | Ga0307416_102179285 | 3300032002 | Bacteria | 656 |
| 745 | Ga0307414_10037621 | 3300032004 | Bacteria | 3242 |
| 746 | Ga0307414_10156905 | 3300032004 | Bacteria | 1803 |
| 747 | Ga0307414_10251761 | 3300032004 | Bacteria | 1469 |
| 748 | Ga0307414_10455480 | 3300032004 | Bacteria | 1123 |
| 749 | Ga0307414_10482798 | 3300032004 | Bacteria | 1093 |
| 750 | Ga0307414_10512402 | 3300032004 | Bacteria | 1063 |
| 751 | Ga0307411_10051114 | 3300032005 | Bacteria | 2695 |
| 752 | Ga0307411_10177369 | 3300032005 | Bacteria | 1613 |
| 753 | Ga0307411_10199084 | 3300032005 | Bacteria | 1536 |
| 754 | Ga0307411_11556637 | 3300032005 | Bacteria | 609 |
| 755 | Ga0307411_11703303 | 3300032005 | Bacteria | 583 |
| 756 | Ga0307415_100002630 | 3300032126 | Bacteria | 8947 |
| 757 | Ga0307415_100005693 | 3300032126 | Bacteria | 6641 |
| 758 | Ga0307415_100016729 | 3300032126 | Bacteria | 4379 |
| 759 | Ga0307415_100017773 | 3300032126 | Bacteria | 4272 |
| 760 | Ga0307415_100043930 | 3300032126 | Bacteria | 2984 |
| 761 | Ga0307415_100093526 | 3300032126 | Bacteria | 2183 |
| 762 | Ga0307415_100148710 | 3300032126 | Bacteria | 1800 |
| 763 | Ga0307415_100214462 | 3300032126 | Bacteria | 1538 |
| 764 | Ga0307415_100313640 | 3300032126 | Bacteria | 1304 |
| 765 | Ga0307415_100706245 | 3300032126 | Bacteria | 910 |
| 766 | Ga0307415_101455195 | 3300032126 | Bacteria | 654 |
| 767 | Ga0307415_102083043 | 3300032126 | Bacteria | 554 |
| 768 | Ga0316583_10123617 | 3300032133 | Bacteria | 902 |
| 769 | Ga0373939_0446523 | 3300035114 | Bacteria | 544 |
| 770 | Ga0373942_0084645 | 3300035207 | Bacteria | 947 |
| 771 | Ga0373961_0137155 | 3300035241 | Bacteria | 824 |
| 772 | Ga0373961_0140389 | 3300035241 | Bacteria | 816 |
| 773 | Ga0373962_0176903 | 3300035242 | Bacteria | 712 |
| 774 | Ga0373931_0170473 | 3300035691 | Bacteria | 1282 |
| 775 | Ga0373931_0191330 | 3300035691 | Bacteria | 1218 |
| 776 | Ga0373931_0790490 | 3300035691 | Bacteria | 632 |
| 777 | Ga0373927_0980654 | 3300035695 | Bacteria | 558 |
| 778 | Ga0373927_1140813 | 3300035695 | Bacteria | 514 |
| 779 | Ga0395899_0250603 | 3300037312 | Bacteria | 1215 |
| 780 | Ga0395900_0058016 | 3300037418 | Bacteria | 3985 |
| 781 | Ga0395900_0462585 | 3300037418 | Bacteria | 1223 |
| 782 | Ga0395900_0615870 | 3300037418 | Bacteria | 1025 |
| 783 | Ga0395898_0096517 | 3300037466 | Bacteria | 2840 |
| 784 | Ga0395898_0242167 | 3300037466 | Bacteria | 1720 |
| 785 | Ga0395905_0400837 | 3300037471 | Bacteria | 1267 |
| 786 | Ga0395905_0825505 | 3300037471 | Bacteria | 830 |
| 787 | Ga0436364_0158595 | 3300037853 | Bacteria | 948 |
| 788 | Ga0395901_0105994 | 3300038443 | Bacteria | 2950 |
| 789 | Ga0395901_0635055 | 3300038443 | Bacteria | 1073 |
| 790 | Ga0395901_0867518 | 3300038443 | Bacteria | 887 |
| 791 | Ga0395901_1136481 | 3300038443 | Bacteria | 750 |
| 792 | Ga0395901_2081294 | 3300038443 | Bacteria | 513 |
| 793 | Ga0436365_1073144 | 3300039437 | Bacteria | 616 |
| 794 | Ga0436365_1902425 | 3300039437 | Bacteria | 1267 |
| 795 | Ga0436362_1172283 | 3300039453 | Bacteria | 547 |
| 796 | Ga0439438_175108 | 3300041405 | Bacteria | 510 |
| 797 | Ga0439439_0115796 | 3300041406 | Bacteria | 745 |
| 798 | Ga0439465_0085262 | 3300041413 | Bacteria | 1075 |
| 799 | Ga0451787_365079 | 3300041441 | Bacteria | 751 |
| 800 | Ga0451791_0511011 | 3300041451 | Bacteria | 552 |
| 801 | Ga0451791_1305444 | 3300041451 | Bacteria | 511 |
| 802 | Ga0451791_1611175 | 3300041451 | Bacteria | 1510 |
| 803 | Ga0451793_1110791 | 3300041452 | Bacteria | 583 |
| 804 | Ga0451795_0714571 | 3300041456 | Bacteria | 534 |
| 805 | Ga0451802_0295209 | 3300041460 | Bacteria | 718 |
| 806 | Ga0451802_0708292 | 3300041460 | Bacteria | 664 |
| 807 | Ga0451806_611162 | 3300041462 | Bacteria | 698 |
| 808 | Ga0451804_0216958 | 3300041463 | Bacteria | 506 |
| 809 | Ga0451804_0628311 | 3300041463 | Bacteria | 572 |
| 810 | Ga0451807_0228856 | 3300041486 | Bacteria | 689 |
| 811 | Ga0451807_0305274 | 3300041486 | Bacteria | 714 |
| 812 | Ga0451833_0680881 | 3300041491 | Bacteria | 583 |
| 813 | Ga0451833_0873441 | 3300041491 | Bacteria | 949 |
| 814 | Ga0451833_0977379 | 3300041491 | Bacteria | 511 |
| 815 | Ga0451833_1020092 | 3300041491 | Bacteria | 620 |
| 816 | Ga0451837_1623172 | 3300041494 | Bacteria | 557 |
| 817 | Ga0451839_1658216 | 3300041496 | Bacteria | 610 |
| 818 | Ga0451841_1334235 | 3300041498 | Bacteria | 536 |
| 819 | Ga0451849_1036478 | 3300041505 | Bacteria | 584 |
| 820 | Ga0451851_0539608 | 3300041507 | Bacteria | 593 |
| 821 | Ga0451853_0904534 | 3300041512 | Bacteria | 554 |
| 822 | Ga0451853_1786633 | 3300041512 | Bacteria | 529 |
| 823 | Ga0451853_3744708 | 3300041512 | Bacteria | 1026 |
| 824 | Ga0439431_0007629 | 3300041997 | Bacteria | 2416 |
| 825 | Ga0439431_0052178 | 3300041997 | Bacteria | 1062 |
| 826 | Ga0439431_0199582 | 3300041997 | Bacteria | 583 |
| 827 | Ga0439433_0156486 | 3300041999 | Bacteria | 589 |
| 828 | Ga0439442_020861 | 3300042002 | Bacteria | 1358 |
| 829 | Ga0439448_0021155 | 3300042005 | Bacteria | 2016 |
| 830 | Ga0439448_0062084 | 3300042005 | Bacteria | 1236 |
| 831 | Ga0439448_0282041 | 3300042005 | Bacteria | 589 |
| 832 | Ga0439432_058402 | 3300042006 | Bacteria | 1193 |
| 833 | Ga0439450_016080 | 3300042008 | Bacteria | 1542 |
| 834 | Ga0439450_093445 | 3300042008 | Bacteria | 757 |
| 835 | Ga0439462_0061846 | 3300042015 | Bacteria | 1014 |
| 836 | Ga0439463_000348 | 3300042016 | Bacteria | 12928 |
| 837 | Ga0439463_092384 | 3300042016 | Bacteria | 779 |
| 838 | Ga0439463_118824 | 3300042016 | Bacteria | 683 |
| 839 | Ga0450888_004963 | 3300042126 | Bacteria | 1405 |
| 840 | Ga0450907_016303 | 3300042146 | Bacteria | 1239 |
| 841 | Ga0439446_0038802 | 3300042156 | Bacteria | 1397 |
| 842 | Ga0439434_0017161 | 3300042435 | Bacteria | 2165 |
| 843 | Ga0439435_0011795 | 3300042436 | Bacteria | 2102 |
| 844 | Ga0439444_0010182 | 3300042437 | Bacteria | 1498 |
| 845 | Ga0439444_0021683 | 3300042437 | Bacteria | 1139 |
| 846 | Ga0439444_0094772 | 3300042437 | Bacteria | 670 |
| 847 | Ga0439464_0075031 | 3300042439 | Bacteria | 1004 |
| 848 | Ga0439460_0027857 | 3300042461 | Bacteria | 1590 |
| 849 | Ga0439460_0062596 | 3300042461 | Bacteria | 1138 |
| 850 | Ga0439440_0001208 | 3300042993 | Bacteria | 4643 |
| 851 | Ga0439440_0002278 | 3300042993 | Bacteria | 3604 |
| 852 | Ga0439440_0006577 | 3300042993 | Bacteria | 2345 |
| 853 | Ga0439440_0112705 | 3300042993 | Bacteria | 750 |
| 854 | Ga0466969_0006155 | 3300044656 | Bacteria | 6389 |
| 855 | Ga0466972_0018668 | 3300044658 | Bacteria | 3467 |
| 856 | Ga0466972_0192411 | 3300044658 | Bacteria | 956 |
| 857 | Ga0466965_0028706 | 3300044683 | Bacteria | 2704 |
| 858 | Ga0466965_0051778 | 3300044683 | Bacteria | 2037 |
| 859 | Ga0466965_0114997 | 3300044683 | Bacteria | 1385 |
| 860 | Ga0466965_0206835 | 3300044683 | Bacteria | 1042 |
| 861 | Ga0466965_0293639 | 3300044683 | Bacteria | 880 |
| 862 | Ga0466965_0895214 | 3300044683 | Bacteria | 517 |
| 863 | Ga0466966_0012013 | 3300044684 | Bacteria | 5739 |
| 864 | Ga0466966_0449487 | 3300044684 | Bacteria | 775 |
| 865 | Ga0466961_0018930 | 3300044693 | Bacteria | 4430 |
| 866 | Ga0466961_0057181 | 3300044693 | Bacteria | 2483 |
| 867 | Ga0466961_0110784 | 3300044693 | Bacteria | 1727 |
| 868 | Ga0466961_0815230 | 3300044693 | Bacteria | 557 |
| 869 | Ga0466961_0840479 | 3300044693 | Bacteria | 547 |
| 870 | Ga0466963_0086148 | 3300044694 | Bacteria | 2134 |
| 871 | Ga0466963_0123749 | 3300044694 | Bacteria | 1782 |
| 872 | Ga0466963_0138856 | 3300044694 | Bacteria | 1683 |
| 873 | Ga0466963_0145117 | 3300044694 | Bacteria | 1646 |
| 874 | Ga0466963_0679117 | 3300044694 | Bacteria | 727 |
| 875 | Ga0466963_0855076 | 3300044694 | Bacteria | 641 |
| 876 | Ga0466964_0016610 | 3300044706 | Bacteria | 2812 |
| 877 | Ga0466964_0029859 | 3300044706 | Bacteria | 2155 |
| 878 | Ga0466964_0033426 | 3300044706 | Bacteria | 2049 |
| 879 | Ga0466964_0351663 | 3300044706 | Bacteria | 757 |
| 880 | Ga0466964_0407436 | 3300044706 | Bacteria | 712 |
| 881 | Ga0466964_0810946 | 3300044706 | Bacteria | 530 |
| 882 | Ga0466971_0000730 | 3300044719 | Bacteria | 13160 |
| 883 | Ga0466971_0001409 | 3300044719 | Bacteria | 10103 |
| 884 | Ga0466971_0011981 | 3300044719 | Bacteria | 3799 |
| 885 | Ga0466971_0153252 | 3300044719 | Bacteria | 1077 |
| 886 | Ga0466971_0419921 | 3300044719 | Bacteria | 654 |
| 887 | Ga0466970_0006749 | 3300044765 | Bacteria | 5744 |
| 888 | Ga0466970_0161703 | 3300044765 | Bacteria | 1239 |
| 889 | Ga0466970_0183178 | 3300044765 | Bacteria | 1162 |
| 890 | Ga0466970_0284074 | 3300044765 | Bacteria | 931 |
| 891 | Ga0466970_0358850 | 3300044765 | Bacteria | 828 |
| 892 | Ga0466970_0526253 | 3300044765 | Bacteria | 682 |
| 893 | Ga0466957_0044095 | 3300044842 | Bacteria | 2702 |
| 894 | Ga0466957_0176632 | 3300044842 | Bacteria | 1393 |
| 895 | Ga0466957_0430288 | 3300044842 | Bacteria | 907 |
| 896 | Ga0466957_1122798 | 3300044842 | Bacteria | 567 |
| 897 | Ga0466960_0007519 | 3300044901 | Bacteria | 4430 |
| 898 | Ga0466960_0011527 | 3300044901 | Bacteria | 3702 |
| 899 | Ga0466960_0016613 | 3300044901 | Bacteria | 3196 |
| 900 | Ga0466960_0280963 | 3300044901 | Bacteria | 933 |
| 901 | Ga0466960_0341575 | 3300044901 | Bacteria | 852 |
| 902 | Ga0466960_0636665 | 3300044901 | Bacteria | 635 |
| 903 | Ga0466959_0000507 | 3300045049 | Bacteria | 22618 |
| 904 | Ga0466959_0456740 | 3300045049 | Bacteria | 866 |
| 905 | Ga0466959_0839745 | 3300045049 | Bacteria | 614 |
| 906 | Ga0451576_0789764 | 3300045051 | Bacteria | 997 |
| 907 | Ga0466958_0010466 | 3300045836 | Bacteria | 5196 |
| 908 | Ga0466958_0146855 | 3300045836 | Bacteria | 1486 |
| 909 | Ga0466958_0898824 | 3300045836 | Bacteria | 578 |
| 910 | Ga0466967_0005026 | 3300045976 | Bacteria | 9062 |
| 911 | Ga0466967_0029175 | 3300045976 | Bacteria | 4614 |
| 912 | Ga0466967_0045804 | 3300045976 | Bacteria | 3803 |
| 913 | Ga0466967_0067268 | 3300045976 | Bacteria | 3195 |
| 914 | Ga0466967_0081289 | 3300045976 | Bacteria | 2926 |
| 915 | Ga0466967_0231381 | 3300045976 | Bacteria | 1760 |
| 916 | Ga0466967_0252729 | 3300045976 | Bacteria | 1684 |
| 917 | Ga0466967_0363519 | 3300045976 | Bacteria | 1402 |
| 918 | Ga0466967_0584214 | 3300045976 | Bacteria | 1101 |
| 919 | Ga0466967_0615417 | 3300045976 | Bacteria | 1072 |
| 920 | Ga0466967_0939353 | 3300045976 | Bacteria | 860 |
| 921 | Ga0466967_0971458 | 3300045976 | Bacteria | 845 |
| 922 | Ga0466967_1117634 | 3300045976 | Bacteria | 785 |
| 923 | Ga0466967_1389603 | 3300045976 | Bacteria | 699 |
| 924 | Ga0466967_1479483 | 3300045976 | Bacteria | 676 |
| 925 | Ga0466967_1742535 | 3300045976 | Bacteria | 620 |
| 926 | Ga0495617_213429 | 3300046452 | Bacteria | 601 |
| 927 | Ga0495592_0149061 | 3300046454 | Bacteria | 1619 |
| 928 | Ga0495629_0216853 | 3300046459 | Bacteria | 1321 |
| 929 | Ga0495641_0156047 | 3300046461 | Bacteria | 1021 |
| 930 | Ga0495641_0431782 | 3300046461 | Bacteria | 599 |
| 931 | Ga0495651_0000079 | 3300046462 | Bacteria | 71581 |
| 932 | Ga0495653_0003879 | 3300046463 | Bacteria | 12086 |
| 933 | Ga0495653_0475047 | 3300046463 | Bacteria | 783 |
| 934 | Ga0495582_0184918 | 3300046473 | Bacteria | 1188 |
| 935 | Ga0495582_0237641 | 3300046473 | Bacteria | 1044 |
| 936 | Ga0495639_0737129 | 3300046475 | Bacteria | 510 |
| 937 | Ga0495662_0475655 | 3300046476 | Bacteria | 613 |
| 938 | Ga0495664_0058669 | 3300046477 | Bacteria | 2290 |
| 939 | Ga0495664_0314590 | 3300046477 | Bacteria | 944 |
| 940 | Ga0495607_0310115 | 3300046501 | Bacteria | 740 |
| 941 | Ga0495608_0305281 | 3300046511 | Bacteria | 985 |
| 942 | Ga0495608_0399435 | 3300046511 | Bacteria | 841 |
| 943 | Ga0495616_0158666 | 3300046513 | Bacteria | 1019 |
| 944 | Ga0495620_0183825 | 3300046515 | Bacteria | 807 |
| 945 | Ga0495620_0233352 | 3300046515 | Bacteria | 703 |
| 946 | Ga0495631_0077678 | 3300046518 | Bacteria | 1433 |
| 947 | Ga0495637_0219971 | 3300046520 | Bacteria | 692 |
| 948 | Ga0495663_0132797 | 3300046525 | Bacteria | 841 |
| 949 | Ga0495652_0003588 | 3300046529 | Bacteria | 15221 |
| 950 | Ga0495587_0109041 | 3300046536 | Bacteria | 1591 |
| 951 | Ga0495598_0111741 | 3300046537 | Bacteria | 917 |
| 952 | Ga0495598_0195773 | 3300046537 | Bacteria | 728 |
| 953 | Ga0495609_0250175 | 3300046538 | Bacteria | 730 |
| 954 | Ga0495609_0268829 | 3300046538 | Unclassified | 699 |
| 955 | Ga0495645_0059107 | 3300046543 | Bacteria | 2780 |
| 956 | Ga0495645_0542076 | 3300046543 | Bacteria | 722 |
| 957 | Ga0495667_0769789 | 3300046559 | Bacteria | 594 |
| 958 | Ga0495656_0043278 | 3300046615 | Bacteria | 1890 |
| 959 | Ga0495656_0244050 | 3300046615 | Bacteria | 905 |
| 960 | Ga0495668_0160408 | 3300046616 | Bacteria | 1232 |
| 961 | Ga0495634_0033758 | 3300046642 | Bacteria | 3514 |
| 962 | Ga0495611_0215002 | 3300046648 | Bacteria | 895 |
| 963 | Ga0495635_0002665 | 3300046663 | Bacteria | 12199 |
| 964 | Ga0495635_0182110 | 3300046663 | Bacteria | 1428 |
| 965 | Ga0495635_0293990 | 3300046663 | Bacteria | 1090 |
| 966 | Ga0495659_0396631 | 3300046664 | Bacteria | 595 |
| 967 | Ga0495661_0484120 | 3300046665 | Bacteria | 592 |
| 968 | Ga0495623_0228214 | 3300046679 | Bacteria | 1057 |
| 969 | Ga0495647_0155460 | 3300046681 | Bacteria | 983 |
| 970 | Ga0495658_0985627 | 3300046683 | Bacteria | 538 |
| 971 | Ga0495658_1001831 | 3300046683 | Bacteria | 533 |
| 972 | Ga0495658_1005295 | 3300046683 | Bacteria | 532 |
| 973 | Ga0495669_0616421 | 3300046684 | Bacteria | 528 |
| 974 | Ga0495669_0655641 | 3300046684 | Bacteria | 510 |
| 975 | Ga0495613_0331964 | 3300046689 | Bacteria | 1048 |
| 976 | Ga0495613_0733140 | 3300046689 | Bacteria | 649 |
| 977 | Ga0495624_0184178 | 3300046690 | Bacteria | 1272 |
| 978 | Ga0495670_0051441 | 3300046691 | Bacteria | 2062 |
| 979 | Ga0495670_0217389 | 3300046691 | Bacteria | 1015 |
| 980 | Ga0495671_0098607 | 3300046692 | Bacteria | 1429 |
| 981 | Ga0495649_0387298 | 3300046694 | Bacteria | 703 |
| 982 | Ga0495600_0008443 | 3300046809 | Bacteria | 6327 |
| 983 | Ga0495600_0171609 | 3300046809 | Bacteria | 1400 |
| 984 | Ga0495600_0876464 | 3300046809 | Bacteria | 531 |
| 985 | Ga0495581_0443904 | 3300047315 | Bacteria | 756 |
| 986 | Ga0495581_0619403 | 3300047315 | Bacteria | 626 |
| 987 | Ga0495676_0829248 | 3300047321 | Bacteria | 594 |
| 988 | Ga0495680_0291954 | 3300047322 | Bacteria | 1147 |
| 989 | Ga0495680_0898277 | 3300047322 | Bacteria | 572 |
| 990 | Ga0495680_1105983 | 3300047322 | Bacteria | 500 |
| 991 | Ga0495683_0122687 | 3300047323 | Bacteria | 1232 |
| 992 | Ga0495679_193175 | 3300047446 | Bacteria | 537 |
| 993 | Ga0496100_0017456 | 3300048903 | Bacteria | 4236 |
| 994 | Ga0496100_0226587 | 3300048903 | Bacteria | 1374 |
| 995 | Ga0496100_0565868 | 3300048903 | Bacteria | 880 |
| 996 | Ga0496100_1016902 | 3300048903 | Bacteria | 652 |
| 997 | Ga0496100_1249913 | 3300048903 | Bacteria | 586 |
| 998 | Ga0496101_0070926 | 3300048904 | Bacteria | 2553 |
| 999 | Ga0496101_0117874 | 3300048904 | Bacteria | 2005 |
| 1000 | Ga0496101_0138320 | 3300048904 | Bacteria | 1854 |
| 1001 | Ga0496101_0293802 | 3300048904 | Bacteria | 1272 |
| 1002 | Ga0496101_0577514 | 3300048904 | Bacteria | 889 |
| 1003 | Ga0496101_0678755 | 3300048904 | Bacteria | 814 |
| 1004 | Ga0496101_0970682 | 3300048904 | Bacteria | 668 |
| 1005 | Ga0496101_1526655 | 3300048904 | Bacteria | 520 |
| 1006 | Ga0496102_0009949 | 3300048905 | Bacteria | 8179 |
| 1007 | Ga0496102_0015093 | 3300048905 | Bacteria | 6725 |
| 1008 | Ga0496102_0123928 | 3300048905 | Bacteria | 2415 |
| 1009 | Ga0496102_0129045 | 3300048905 | Bacteria | 2365 |
| 1010 | Ga0496102_0236863 | 3300048905 | Bacteria | 1721 |
| 1011 | Ga0496102_0336690 | 3300048905 | Bacteria | 1421 |
| 1012 | Ga0496102_1007418 | 3300048905 | Bacteria | 753 |
| 1013 | Ga0496102_1237875 | 3300048905 | Bacteria | 666 |
| 1014 | Ga0496102_1408699 | 3300048905 | Bacteria | 616 |
| 1015 | Ga0496102_1687167 | 3300048905 | Bacteria | 551 |
| 1016 | Ga0496103_0077842 | 3300048906 | Bacteria | 2082 |
| 1017 | Ga0496103_0404688 | 3300048906 | Bacteria | 877 |
| 1018 | Ga0496103_0943341 | 3300048906 | Bacteria | 539 |
| 1019 | Ga0496104_0002251 | 3300048907 | Bacteria | 16644 |
| 1020 | Ga0496104_0839878 | 3300048907 | Bacteria | 824 |
| 1021 | Ga0496105_0001445 | 3300048908 | Bacteria | 16716 |
| 1022 | Ga0496105_0444091 | 3300048908 | Bacteria | 1025 |
| 1023 | Ga0496105_0712931 | 3300048908 | Bacteria | 769 |
| 1024 | Ga0496106_0145577 | 3300048909 | Bacteria | 1866 |
| 1025 | Ga0496106_0339949 | 3300048909 | Bacteria | 1205 |
| 1026 | Ga0496106_0668176 | 3300048909 | Bacteria | 829 |
| 1027 | Ga0496106_0956741 | 3300048909 | Bacteria | 675 |
| 1028 | Ga0496106_1490131 | 3300048909 | Bacteria | 521 |
| 1029 | Ga0496107_0040691 | 3300048910 | Bacteria | 3337 |
| 1030 | Ga0496107_0082877 | 3300048910 | Bacteria | 2338 |
| 1031 | Ga0496107_0362836 | 3300048910 | Bacteria | 1078 |
| 1032 | Ga0496107_0418638 | 3300048910 | Bacteria | 996 |
| 1033 | Ga0496107_0617340 | 3300048910 | Bacteria | 801 |
| 1034 | Ga0496107_0646932 | 3300048910 | Bacteria | 779 |
| 1035 | Ga0496107_0891784 | 3300048910 | Bacteria | 648 |
| 1036 | Ga0496108_0023155 | 3300048911 | Bacteria | 5108 |
| 1037 | Ga0496108_0032768 | 3300048911 | Bacteria | 4316 |
| 1038 | Ga0496108_0192586 | 3300048911 | Bacteria | 1767 |
| 1039 | Ga0496108_0471467 | 3300048911 | Bacteria | 1097 |
| 1040 | Ga0496108_0618741 | 3300048911 | Bacteria | 943 |
| 1041 | Ga0496108_0636239 | 3300048911 | Bacteria | 928 |
| 1042 | Ga0496108_0953899 | 3300048911 | Bacteria | 734 |
| 1043 | Ga0496108_1006250 | 3300048911 | Bacteria | 712 |
| 1044 | Ga0496108_1217472 | 3300048911 | Bacteria | 636 |
| 1045 | Ga0496109_0011825 | 3300048912 | Bacteria | 7514 |
| 1046 | Ga0496109_0018556 | 3300048912 | Bacteria | 6111 |
| 1047 | Ga0496109_0066214 | 3300048912 | Bacteria | 3307 |
| 1048 | Ga0496109_0073561 | 3300048912 | Bacteria | 3140 |
| 1049 | Ga0496109_0092134 | 3300048912 | Bacteria | 2803 |
| 1050 | Ga0496109_0435065 | 3300048912 | Bacteria | 1239 |
| 1051 | Ga0496109_0458040 | 3300048912 | Bacteria | 1204 |
| 1052 | Ga0496109_0469310 | 3300048912 | Bacteria | 1188 |
| 1053 | Ga0496109_0630366 | 3300048912 | Bacteria | 1009 |
| 1054 | Ga0496109_1249266 | 3300048912 | Bacteria | 679 |
| 1055 | Ga0496110_0009095 | 3300048913 | Bacteria | 8017 |
| 1056 | Ga0496110_0062693 | 3300048913 | Bacteria | 3284 |
| 1057 | Ga0496110_0111825 | 3300048913 | Bacteria | 2455 |
| 1058 | Ga0496110_0138170 | 3300048913 | Bacteria | 2203 |
| 1059 | Ga0496110_1125418 | 3300048913 | Bacteria | 693 |
| 1060 | Ga0496110_1276520 | 3300048913 | Bacteria | 643 |
| 1061 | Ga0496110_1338079 | 3300048913 | Bacteria | 626 |
| 1062 | Ga0496110_1371737 | 3300048913 | Bacteria | 616 |
| 1063 | Ga0496111_0002908 | 3300048914 | Bacteria | 10465 |
| 1064 | Ga0496111_0081282 | 3300048914 | Bacteria | 2365 |
| 1065 | Ga0496111_0171692 | 3300048914 | Bacteria | 1611 |
| 1066 | Ga0496111_0188171 | 3300048914 | Bacteria | 1535 |
| 1067 | Ga0496111_0357272 | 3300048914 | Bacteria | 1081 |
| 1068 | Ga0496111_0430765 | 3300048914 | Bacteria | 974 |
| 1069 | Ga0496111_0512930 | 3300048914 | Bacteria | 882 |
| 1070 | Ga0496111_0786568 | 3300048914 | Bacteria | 689 |
| 1071 | Ga0496111_0790208 | 3300048914 | Bacteria | 687 |
| 1072 | Ga0496111_0877483 | 3300048914 | Bacteria | 647 |
| 1073 | Ga0496111_1174909 | 3300048914 | Bacteria | 545 |
| 1074 | Ga0496112_0209718 | 3300048915 | Bacteria | 1906 |
| 1075 | Ga0496112_0500081 | 3300048915 | Bacteria | 1151 |
| 1076 | Ga0496112_0663507 | 3300048915 | Bacteria | 972 |
| 1077 | Ga0496112_1184511 | 3300048915 | Bacteria | 681 |
| 1078 | Ga0496113_0082131 | 3300048916 | Bacteria | 2471 |
| 1079 | Ga0496113_0477004 | 3300048916 | Bacteria | 1002 |
| 1080 | Ga0496113_0578509 | 3300048916 | Bacteria | 900 |
| 1081 | Ga0496114_0045834 | 3300048917 | Bacteria | 3633 |
| 1082 | Ga0496114_0053634 | 3300048917 | Bacteria | 3361 |
| 1083 | Ga0496114_0057334 | 3300048917 | Bacteria | 3251 |
| 1084 | Ga0496114_0161756 | 3300048917 | Bacteria | 1947 |
| 1085 | Ga0496114_0241626 | 3300048917 | Bacteria | 1588 |
| 1086 | Ga0496114_0328466 | 3300048917 | Bacteria | 1352 |
| 1087 | Ga0496114_0403540 | 3300048917 | Bacteria | 1210 |
| 1088 | Ga0496114_0467899 | 3300048917 | Bacteria | 1116 |
| 1089 | Ga0496114_0505345 | 3300048917 | Bacteria | 1069 |
| 1090 | Ga0496114_0549470 | 3300048917 | Bacteria | 1020 |
| 1091 | Ga0496114_0665936 | 3300048917 | Bacteria | 915 |
| 1092 | Ga0496114_0841424 | 3300048917 | Bacteria | 797 |
| 1093 | Ga0496114_0985004 | 3300048917 | Bacteria | 726 |
| 1094 | Ga0496114_1080707 | 3300048917 | Bacteria | 687 |
| 1095 | Ga0496114_1355387 | 3300048917 | Bacteria | 598 |
| 1096 | Ga0496114_1746814 | 3300048917 | Bacteria | 510 |
| 1097 | Ga0496115_0001053 | 3300048918 | Bacteria | 20003 |
| 1098 | Ga0496115_0294981 | 3300048918 | Bacteria | 1329 |
| 1099 | Ga0496124_0207881 | 3300048927 | Bacteria | 1483 |
| 1100 | Ga0496124_0916845 | 3300048927 | Bacteria | 530 |
| 1101 | Ga0501307_034436 | 3300049162 | Bacteria | 715 |
| 1102 | Ga0501291_036161 | 3300049514 | Bacteria | 852 |
| 1103 | Ga0501311_027348 | 3300049527 | Bacteria | 809 |
| 1104 | Ga0501311_107219 | 3300049527 | Bacteria | 500 |
| 1105 | Ga0501323_055930 | 3300049539 | Bacteria | 607 |
| 1106 | Ga0501324_027046 | 3300049540 | Bacteria | 611 |
| 1107 | Ga0501031_0002572 | 3300049568 | Bacteria | 11555 |
| 1108 | Ga0501031_0055271 | 3300049568 | Bacteria | 2587 |
| 1109 | Ga0501031_0102489 | 3300049568 | Bacteria | 1867 |
| 1110 | Ga0501031_0114560 | 3300049568 | Bacteria | 1761 |
| 1111 | Ga0501031_0232391 | 3300049568 | Bacteria | 1200 |
| 1112 | Ga0501031_0458521 | 3300049568 | Bacteria | 823 |
| 1113 | Ga0501031_0583582 | 3300049568 | Bacteria | 719 |
| 1114 | Ga0501031_0822940 | 3300049568 | Bacteria | 595 |
| 1115 | Ga0501031_0876639 | 3300049568 | Bacteria | 575 |
| 1116 | Ga0501032_0001212 | 3300049569 | Bacteria | 20635 |
| 1117 | Ga0501032_0414597 | 3300049569 | Bacteria | 864 |
| 1118 | Ga0501032_0565001 | 3300049569 | Bacteria | 725 |
| 1119 | Ga0501032_0594548 | 3300049569 | Bacteria | 704 |
| 1120 | Ga0501032_0646648 | 3300049569 | Bacteria | 672 |
| 1121 | Ga0501033_0008061 | 3300049570 | Bacteria | 8158 |
| 1122 | Ga0501033_0131599 | 3300049570 | Bacteria | 1812 |
| 1123 | Ga0501033_0214508 | 3300049570 | Bacteria | 1372 |
| 1124 | Ga0501033_0570038 | 3300049570 | Bacteria | 779 |
| 1125 | Ga0501033_0871309 | 3300049570 | Bacteria | 606 |
| 1126 | Ga0501034_0006278 | 3300049571 | Bacteria | 12789 |
| 1127 | Ga0501034_0158844 | 3300049571 | Bacteria | 2233 |
| 1128 | Ga0501036_0008586 | 3300049572 | Bacteria | 8379 |
| 1129 | Ga0501036_0012956 | 3300049572 | Bacteria | 6923 |
| 1130 | Ga0501036_0019876 | 3300049572 | Bacteria | 5639 |
| 1131 | Ga0501036_0071186 | 3300049572 | Bacteria | 2940 |
| 1132 | Ga0501036_0196008 | 3300049572 | Bacteria | 1699 |
| 1133 | Ga0501036_0317640 | 3300049572 | Bacteria | 1302 |
| 1134 | Ga0501036_0370101 | 3300049572 | Bacteria | 1196 |
| 1135 | Ga0501036_0557629 | 3300049572 | Bacteria | 952 |
| 1136 | Ga0501036_0773226 | 3300049572 | Bacteria | 792 |
| 1137 | Ga0501036_1635440 | 3300049572 | Bacteria | 520 |
| 1138 | Ga0501037_0000836 | 3300049573 | Bacteria | 23004 |
| 1139 | Ga0501037_0028438 | 3300049573 | Bacteria | 4129 |
| 1140 | Ga0501037_0104942 | 3300049573 | Bacteria | 2037 |
| 1141 | Ga0501037_0174556 | 3300049573 | Bacteria | 1526 |
| 1142 | Ga0501037_0247666 | 3300049573 | Bacteria | 1248 |
| 1143 | Ga0501037_0342779 | 3300049573 | Bacteria | 1032 |
| 1144 | Ga0501037_0368765 | 3300049573 | Bacteria | 988 |
| 1145 | Ga0501037_0646738 | 3300049573 | Bacteria | 707 |
| 1146 | Ga0501037_0669714 | 3300049573 | Bacteria | 692 |
| 1147 | Ga0501038_0012780 | 3300049574 | Bacteria | 7668 |
| 1148 | Ga0501038_0099125 | 3300049574 | Bacteria | 2429 |
| 1149 | Ga0501038_0462595 | 3300049574 | Bacteria | 974 |
| 1150 | Ga0501038_1045226 | 3300049574 | Bacteria | 598 |
| 1151 | Ga0501039_0006931 | 3300049575 | Bacteria | 8625 |
| 1152 | Ga0501039_0007687 | 3300049575 | Bacteria | 8228 |
| 1153 | Ga0501039_0017109 | 3300049575 | Bacteria | 5560 |
| 1154 | Ga0501039_0218394 | 3300049575 | Bacteria | 1499 |
| 1155 | Ga0501039_0406298 | 3300049575 | Bacteria | 1069 |
| 1156 | Ga0501039_0443677 | 3300049575 | Bacteria | 1019 |
| 1157 | Ga0501039_0445896 | 3300049575 | Bacteria | 1016 |
| 1158 | Ga0501039_0789178 | 3300049575 | Bacteria | 741 |
| 1159 | Ga0501039_0918402 | 3300049575 | Bacteria | 681 |
| 1160 | Ga0501039_1212115 | 3300049575 | Bacteria | 583 |
| 1161 | Ga0501039_1592677 | 3300049575 | Bacteria | 501 |
| 1162 | Ga0501040_0007931 | 3300049576 | Bacteria | 6886 |
| 1163 | Ga0501040_0016197 | 3300049576 | Bacteria | 4929 |
| 1164 | Ga0501040_0090901 | 3300049576 | Bacteria | 2122 |
| 1165 | Ga0501040_0422601 | 3300049576 | Bacteria | 958 |
| 1166 | Ga0501040_0779337 | 3300049576 | Bacteria | 692 |
| 1167 | Ga0501040_0826673 | 3300049576 | Bacteria | 670 |
| 1168 | Ga0501040_1143943 | 3300049576 | Bacteria | 565 |
| 1169 | Ga0501041_0001518 | 3300049577 | Bacteria | 12874 |
| 1170 | Ga0501041_0015469 | 3300049577 | Bacteria | 4530 |
| 1171 | Ga0501041_0115663 | 3300049577 | Bacteria | 1665 |
| 1172 | Ga0501041_0126443 | 3300049577 | Bacteria | 1591 |
| 1173 | Ga0501041_0187938 | 3300049577 | Bacteria | 1294 |
| 1174 | Ga0501041_0222281 | 3300049577 | Bacteria | 1185 |
| 1175 | Ga0501041_0616911 | 3300049577 | Bacteria | 693 |
| 1176 | Ga0501041_0760679 | 3300049577 | Bacteria | 621 |
| 1177 | Ga0501042_0015097 | 3300049578 | Bacteria | 5281 |
| 1178 | Ga0501042_0038752 | 3300049578 | Bacteria | 3384 |
| 1179 | Ga0501042_0103321 | 3300049578 | Bacteria | 2050 |
| 1180 | Ga0501042_0503196 | 3300049578 | Bacteria | 880 |
| 1181 | Ga0501042_1315790 | 3300049578 | Bacteria | 527 |
| 1182 | Ga0501043_0005580 | 3300049579 | Bacteria | 10135 |
| 1183 | Ga0501043_0040260 | 3300049579 | Bacteria | 3673 |
| 1184 | Ga0501043_1006288 | 3300049579 | Bacteria | 593 |
| 1185 | Ga0501046_0015697 | 3300049580 | Bacteria | 6357 |
| 1186 | Ga0501046_0035677 | 3300049580 | Bacteria | 4007 |
| 1187 | Ga0501046_0746690 | 3300049580 | Bacteria | 688 |
| 1188 | Ga0501046_0958577 | 3300049580 | Bacteria | 595 |
| 1189 | Ga0501046_1072862 | 3300049580 | Bacteria | 557 |
| 1190 | Ga0501047_0000072 | 3300049581 | Bacteria | 126542 |
| 1191 | Ga0501047_0001607 | 3300049581 | Bacteria | 22028 |
| 1192 | Ga0501047_0367951 | 3300049581 | Bacteria | 1273 |
| 1193 | Ga0501048_0015295 | 3300049582 | Bacteria | 5666 |
| 1194 | Ga0501048_0092611 | 3300049582 | Bacteria | 2131 |
| 1195 | Ga0501048_0184517 | 3300049582 | Bacteria | 1479 |
| 1196 | Ga0501048_0191308 | 3300049582 | Bacteria | 1450 |
| 1197 | Ga0501048_0474050 | 3300049582 | Bacteria | 897 |
| 1198 | Ga0501048_1076913 | 3300049582 | Bacteria | 578 |
| 1199 | Ga0501067_0002181 | 3300049583 | Bacteria | 10797 |
| 1200 | Ga0501067_0004018 | 3300049583 | Bacteria | 8115 |
| 1201 | Ga0501067_0013763 | 3300049583 | Bacteria | 4479 |
| 1202 | Ga0501067_0058965 | 3300049583 | Bacteria | 2125 |
| 1203 | Ga0501067_0185940 | 3300049583 | Bacteria | 1157 |
| 1204 | Ga0501067_0199998 | 3300049583 | Bacteria | 1113 |
| 1205 | Ga0501067_0208202 | 3300049583 | Bacteria | 1089 |
| 1206 | Ga0501067_0245086 | 3300049583 | Bacteria | 997 |
| 1207 | Ga0501067_0341939 | 3300049583 | Bacteria | 834 |
| 1208 | Ga0501067_0418626 | 3300049583 | Bacteria | 747 |
| 1209 | Ga0501068_0003236 | 3300049584 | Bacteria | 8730 |
| 1210 | Ga0501068_0018233 | 3300049584 | Bacteria | 4066 |
| 1211 | Ga0501068_0047246 | 3300049584 | Bacteria | 2596 |
| 1212 | Ga0501068_0051891 | 3300049584 | Bacteria | 2482 |
| 1213 | Ga0501068_0082305 | 3300049584 | Bacteria | 1977 |
| 1214 | Ga0501068_0418334 | 3300049584 | Bacteria | 865 |
| 1215 | Ga0501068_0496504 | 3300049584 | Bacteria | 791 |
| 1216 | Ga0501069_0003896 | 3300049585 | Bacteria | 7693 |
| 1217 | Ga0501069_0069416 | 3300049585 | Bacteria | 1973 |
| 1218 | Ga0501069_0075648 | 3300049585 | Bacteria | 1892 |
| 1219 | Ga0501069_0105900 | 3300049585 | Bacteria | 1598 |
| 1220 | Ga0501069_0108318 | 3300049585 | Bacteria | 1581 |
| 1221 | Ga0501069_0126822 | 3300049585 | Bacteria | 1460 |
| 1222 | Ga0501069_0225420 | 3300049585 | Bacteria | 1090 |
| 1223 | Ga0501069_0232788 | 3300049585 | Bacteria | 1073 |
| 1224 | Ga0501069_0291900 | 3300049585 | Bacteria | 955 |
| 1225 | Ga0501069_0641964 | 3300049585 | Bacteria | 638 |
| 1226 | Ga0501069_0805429 | 3300049585 | Unclassified | 569 |
| 1227 | Ga0501069_0807536 | 3300049585 | Bacteria | 569 |
| 1228 | Ga0501070_0001680 | 3300049586 | Bacteria | 19600 |
| 1229 | Ga0501070_0002630 | 3300049586 | Bacteria | 15679 |
| 1230 | Ga0501070_0008861 | 3300049586 | Bacteria | 8503 |
| 1231 | Ga0501070_0022760 | 3300049586 | Bacteria | 5245 |
| 1232 | Ga0501070_0180153 | 3300049586 | Bacteria | 1739 |
| 1233 | Ga0501070_0381976 | 3300049586 | Bacteria | 1141 |
| 1234 | Ga0501070_0439120 | 3300049586 | Bacteria | 1053 |
| 1235 | Ga0501070_0539223 | 3300049586 | Bacteria | 935 |
| 1236 | Ga0501070_0580035 | 3300049586 | Bacteria | 895 |
| 1237 | Ga0501070_0747712 | 3300049586 | Bacteria | 771 |
| 1238 | Ga0501071_0000108 | 3300049587 | Bacteria | 32155 |
| 1239 | Ga0501071_0001602 | 3300049587 | Bacteria | 13270 |
| 1240 | Ga0501071_0081711 | 3300049587 | Bacteria | 2365 |
| 1241 | Ga0501071_0110608 | 3300049587 | Bacteria | 2030 |
| 1242 | Ga0501071_0150375 | 3300049587 | Bacteria | 1737 |
| 1243 | Ga0501071_0272135 | 3300049587 | Bacteria | 1281 |
| 1244 | Ga0501071_0554806 | 3300049587 | Bacteria | 882 |
| 1245 | Ga0501071_0801199 | 3300049587 | Bacteria | 726 |
| 1246 | Ga0501071_1041602 | 3300049587 | Bacteria | 632 |
| 1247 | Ga0501071_1098280 | 3300049587 | Bacteria | 615 |
| 1248 | Ga0501071_1473934 | 3300049587 | Bacteria | 525 |
| 1249 | Ga0501072_0001898 | 3300049588 | Bacteria | 15570 |
| 1250 | Ga0501072_0042055 | 3300049588 | Bacteria | 3589 |
| 1251 | Ga0501072_0065449 | 3300049588 | Bacteria | 2866 |
| 1252 | Ga0501072_0084578 | 3300049588 | Bacteria | 2515 |
| 1253 | Ga0501072_0790243 | 3300049588 | Bacteria | 744 |
| 1254 | Ga0501072_1380020 | 3300049588 | Bacteria | 545 |
| 1255 | Ga0501073_0004339 | 3300049589 | Bacteria | 10649 |
| 1256 | Ga0501073_0008201 | 3300049589 | Bacteria | 7747 |
| 1257 | Ga0501073_0009415 | 3300049589 | Bacteria | 7213 |
| 1258 | Ga0501073_0170287 | 3300049589 | Bacteria | 1507 |
| 1259 | Ga0501073_1160285 | 3300049589 | Bacteria | 530 |
| 1260 | Ga0501074_0000517 | 3300049590 | Bacteria | 23715 |
| 1261 | Ga0501074_0014007 | 3300049590 | Bacteria | 5829 |
| 1262 | Ga0501074_0033398 | 3300049590 | Bacteria | 3728 |
| 1263 | Ga0501074_0102899 | 3300049590 | Bacteria | 2044 |
| 1264 | Ga0501074_0286234 | 3300049590 | Bacteria | 1171 |
| 1265 | Ga0501074_0388369 | 3300049590 | Bacteria | 990 |
| 1266 | Ga0501074_0647778 | 3300049590 | Bacteria | 746 |
| 1267 | Ga0501075_0090711 | 3300049591 | Bacteria | 2319 |
| 1268 | Ga0501075_0274446 | 3300049591 | Bacteria | 1285 |
| 1269 | Ga0501075_0566983 | 3300049591 | Bacteria | 866 |
| 1270 | Ga0501075_0668492 | 3300049591 | Bacteria | 792 |
| 1271 | Ga0501075_0862178 | 3300049591 | Bacteria | 689 |
| 1272 | Ga0501075_0902399 | 3300049591 | Bacteria | 672 |
| 1273 | Ga0501076_0003333 | 3300049592 | Bacteria | 11268 |
| 1274 | Ga0501076_0051564 | 3300049592 | Bacteria | 3257 |
| 1275 | Ga0501076_0078789 | 3300049592 | Bacteria | 2644 |
| 1276 | Ga0501076_0517229 | 3300049592 | Bacteria | 984 |
| 1277 | Ga0501076_0679460 | 3300049592 | Bacteria | 850 |
| 1278 | Ga0501076_1005584 | 3300049592 | Bacteria | 687 |
| 1279 | Ga0501077_0003084 | 3300049593 | Bacteria | 10018 |
| 1280 | Ga0501077_0012750 | 3300049593 | Bacteria | 5265 |
| 1281 | Ga0501077_0023052 | 3300049593 | Bacteria | 3948 |
| 1282 | Ga0501077_0071766 | 3300049593 | Bacteria | 2195 |
| 1283 | Ga0501077_0199282 | 3300049593 | Bacteria | 1272 |
| 1284 | Ga0501202_026952 | 3300049652 | Bacteria | 1179 |
| 1285 | Ga0501202_082951 | 3300049652 | Bacteria | 756 |
| 1286 | Ga0501206_049981 | 3300049653 | Bacteria | 664 |
| 1287 | Ga0501217_033097 | 3300049661 | Bacteria | 1283 |
| 1288 | Ga0501243_017725 | 3300049675 | Bacteria | 1156 |
| 1289 | Ga0501079_0007167 | 3300049741 | Bacteria | 8417 |
| 1290 | Ga0501079_0012242 | 3300049741 | Bacteria | 6549 |
| 1291 | Ga0501079_0049083 | 3300049741 | Bacteria | 3257 |
| 1292 | Ga0501079_0208952 | 3300049741 | Bacteria | 1525 |
| 1293 | Ga0501079_0688790 | 3300049741 | Bacteria | 804 |
| 1294 | Ga0501079_0743481 | 3300049741 | Bacteria | 772 |
| 1295 | Ga0501079_1277114 | 3300049741 | Bacteria | 578 |
| 1296 | Ga0501079_1283680 | 3300049741 | Bacteria | 576 |
| 1297 | Ga0501080_0000361 | 3300049742 | Bacteria | 35108 |
| 1298 | Ga0501080_0004573 | 3300049742 | Bacteria | 12334 |
| 1299 | Ga0501080_0087116 | 3300049742 | Bacteria | 2901 |
| 1300 | Ga0501080_0121371 | 3300049742 | Bacteria | 2421 |
| 1301 | Ga0501080_0644486 | 3300049742 | Bacteria | 938 |
| 1302 | Ga0501081_0010183 | 3300049743 | Bacteria | 6135 |
| 1303 | Ga0501081_0318181 | 3300049743 | Bacteria | 1143 |
| 1304 | Ga0501083_0005579 | 3300049744 | Bacteria | 8909 |
| 1305 | Ga0501083_0246691 | 3300049744 | Bacteria | 1162 |
| 1306 | Ga0501083_0918029 | 3300049744 | Bacteria | 570 |
| 1307 | Ga0501083_0977183 | 3300049744 | Unclassified | 551 |
| 1308 | Ga0501271_013784 | 3300049768 | Bacteria | 889 |
| 1309 | Ga0501035_0005086 | 3300049822 | Bacteria | 12462 |
| 1310 | Ga0501035_0554317 | 3300049822 | Bacteria | 941 |
| 1311 | Ga0501035_0999873 | 3300049822 | Bacteria | 658 |
| 1312 | Ga0501044_0005927 | 3300049823 | Bacteria | 13541 |
| 1313 | Ga0501044_0158949 | 3300049823 | Bacteria | 2238 |
| 1314 | Ga0501044_0432368 | 3300049823 | Bacteria | 1225 |
| 1315 | Ga0501044_0564339 | 3300049823 | Bacteria | 1034 |
| 1316 | Ga0501044_0817724 | 3300049823 | Bacteria | 810 |
| 1317 | Ga0501044_1198377 | 3300049823 | Bacteria | 627 |
| 1318 | Ga0501044_1364078 | 3300049823 | Bacteria | 575 |
| 1319 | Ga0501044_1471594 | 3300049823 | Bacteria | 546 |
| 1320 | Ga0501045_0014996 | 3300049824 | Bacteria | 5499 |
| 1321 | Ga0501045_0146406 | 3300049824 | Bacteria | 1757 |
| 1322 | Ga0501045_0170785 | 3300049824 | Bacteria | 1619 |
| 1323 | Ga0501045_0367052 | 3300049824 | Bacteria | 1071 |
| 1324 | Ga0501045_0938898 | 3300049824 | Bacteria | 635 |
| 1325 | Ga0501045_1026408 | 3300049824 | Bacteria | 604 |
| 1326 | Ga0501045_1244408 | 3300049824 | Bacteria | 542 |
| 1327 | Ga0501212_069666 | 3300049851 | Bacteria | 621 |
| 1328 | nmdc:mga03683_121919_c1 | 3300050489 | Bacteria | 1160 |
| 1329 | nmdc:mga03683_91187_c1 | 3300050489 | Bacteria | 835 |
| 1330 | nmdc:mga03n38_23326_c1 | 3300050490 | Bacteria | 2516 |
| 1331 | nmdc:mga03n38_27426_c1 | 3300050490 | Bacteria | 2363 |
| 1332 | nmdc:mga03n38_301779_c1 | 3300050490 | Bacteria | 860 |
| 1333 | nmdc:mga03n38_470672_c1 | 3300050490 | Bacteria | 701 |
| 1334 | nmdc:mga03n38_624460_c1 | 3300050490 | Bacteria | 616 |
| 1335 | nmdc:mga00v17_126040_c1 | 3300050491 | Bacteria | 1634 |
| 1336 | nmdc:mga00v17_131259_c1 | 3300050491 | Bacteria | 1601 |
| 1337 | nmdc:mga00v17_153617_c1 | 3300050491 | Bacteria | 1479 |
| 1338 | nmdc:mga00v17_195991_c1 | 3300050491 | Bacteria | 1305 |
| 1339 | nmdc:mga00v17_26578_c1 | 3300050491 | Bacteria | 3375 |
| 1340 | nmdc:mga00v17_26998_c1 | 3300050491 | Bacteria | 3349 |
| 1341 | nmdc:mga00v17_282229_c1 | 3300050491 | Bacteria | 1078 |
| 1342 | nmdc:mga00v17_89688_c1 | 3300050491 | Bacteria | 1929 |
| 1343 | nmdc:mga00v17_915528_c1 | 3300050491 | Bacteria | 555 |
| 1344 | nmdc:mga0yw44_1064139_c1 | 3300050492 | Bacteria | 547 |
| 1345 | nmdc:mga0yw44_107708_c1 | 3300050492 | Bacteria | 1783 |
| 1346 | nmdc:mga0yw44_115859_c1 | 3300050492 | Bacteria | 1722 |
| 1347 | nmdc:mga0yw44_142047_c1 | 3300050492 | Bacteria | 1561 |
| 1348 | nmdc:mga0yw44_189355_c1 | 3300050492 | Bacteria | 1357 |
| 1349 | nmdc:mga0yw44_196086_c1 | 3300050492 | Bacteria | 1333 |
| 1350 | nmdc:mga0yw44_23011_c1 | 3300050492 | Bacteria | 3505 |
| 1351 | nmdc:mga0yw44_276036_c1 | 3300050492 | Bacteria | 1123 |
| 1352 | nmdc:mga0yw44_39590_c1 | 3300050492 | Bacteria | 2796 |
| 1353 | nmdc:mga0yw44_427423_c1 | 3300050492 | Bacteria | 897 |
| 1354 | nmdc:mga0yw44_429_c1 | 3300050492 | Bacteria | 14756 |
| 1355 | nmdc:mga0yw44_51107_c1 | 3300050492 | Bacteria | 2502 |
| 1356 | nmdc:mga0yw44_519998_c1 | 3300050492 | Bacteria | 808 |
| 1357 | nmdc:mga0yw44_553324_c1 | 3300050492 | Bacteria | 781 |
| 1358 | nmdc:mga0yw44_57912_c1 | 3300050492 | Bacteria | 2365 |
| 1359 | nmdc:mga0yw44_69910_c1 | 3300050492 | Bacteria | 2175 |
| 1360 | nmdc:mga06z11_16557_c1 | 3300050494 | Bacteria | 3324 |
| 1361 | nmdc:mga06z11_285866_c1 | 3300050494 | Bacteria | 978 |
| 1362 | nmdc:mga06z11_482484_c1 | 3300050494 | Bacteria | 750 |
| 1363 | nmdc:mga06z11_700670_c1 | 3300050494 | Bacteria | 617 |
| 1364 | nmdc:mga04h51_447460_c1 | 3300050495 | Bacteria | 546 |
| 1365 | nmdc:mga04h51_495640_c1 | 3300050495 | Bacteria | 521 |
| 1366 | nmdc:mga04h51_5000_c1 | 3300050495 | Bacteria | 3347 |
| 1367 | nmdc:mga04h51_9575_c1 | 3300050495 | Bacteria | 2634 |
| 1368 | nmdc:mga07m45_122922_c1 | 3300050496 | Bacteria | 1500 |
| 1369 | nmdc:mga07m45_55078_c1 | 3300050496 | Bacteria | 2248 |
| 1370 | nmdc:mga07m45_866533_c1 | 3300050496 | Bacteria | 517 |
| 1371 | nmdc:mga05p37_406788_c1 | 3300050507 | Bacteria | 1587 |
| 1372 | nmdc:mga05p37_986830_c1 | 3300050507 | Bacteria | 897 |
| 1373 | nmdc:mga09592_630062_c1 | 3300050508 | Bacteria | 917 |
| 1374 | nmdc:mga09592_873617_c1 | 3300050508 | Bacteria | 757 |
| 1375 | nmdc:mga0qj67_251663_c1 | 3300050509 | Bacteria | 1433 |
| 1376 | nmdc:mga0qj67_562005_c1 | 3300050509 | Bacteria | 914 |
| 1377 | nmdc:mga06r32_14124_c1 | 3300050510 | Bacteria | 7242 |
| 1378 | nmdc:mga08y16_1156544_c1 | 3300050511 | Bacteria | 746 |
| 1379 | nmdc:mga08y16_13951_c1 | 3300050511 | Bacteria | 8458 |
| 1380 | nmdc:mga08y16_1685327_c1 | 3300050511 | Bacteria | 590 |
| 1381 | nmdc:mga08y16_545864_c2 | 3300050511 | Bacteria | 646 |
| 1382 | nmdc:mga08y16_63660_c1 | 3300050511 | Bacteria | 3852 |
| 1383 | nmdc:mga0n895_1057137_c1 | 3300050512 | Bacteria | 791 |
| 1384 | nmdc:mga0n895_535_c1 | 3300050512 | Bacteria | 25937 |
| 1385 | nmdc:mga0rr50_184510_c1 | 3300050513 | Bacteria | 1707 |
| 1386 | nmdc:mga0rr50_231255_c1 | 3300050513 | Bacteria | 1530 |
| 1387 | nmdc:mga08x19_1032_c1 | 3300050514 | Bacteria | 17387 |
| 1388 | nmdc:mga0a205_7445_c1 | 3300050515 | Bacteria | 9914 |
| 1389 | Ga0495601_0264047 | 3300053077 | Bacteria | 1123 |
| 1390 | Ga0495601_0844181 | 3300053077 | Bacteria | 580 |
| 1391 | Ga0495612_0003302 | 3300053078 | Bacteria | 6687 |
| 1392 | Ga0500635_0308542 | 3300053080 | Bacteria | 625 |
| 1393 | Ga0495595_0230920 | 3300053084 | Bacteria | 924 |
| 1394 | Ga0495595_0302999 | 3300053084 | Bacteria | 804 |
| 1395 | Ga0495619_0092261 | 3300053085 | Bacteria | 2051 |
| 1396 | Ga0495619_0182301 | 3300053085 | Bacteria | 1453 |
| 1397 | Ga0495619_0689573 | 3300053085 | Bacteria | 695 |
| 1398 | Ga0500644_0000489 | 3300053088 | Bacteria | 17298 |
| 1399 | Ga0500644_0037984 | 3300053088 | Bacteria | 1578 |
| 1400 | Ga0500644_0260939 | 3300053088 | Bacteria | 733 |
| 1401 | Ga0500554_147461 | 3300053102 | Bacteria | 795 |
| 1402 | Ga0500593_000592 | 3300053117 | Bacteria | 13905 |
| 1403 | Ga0500628_148609 | 3300053129 | Bacteria | 654 |
| 1404 | Ga0500559_0551658 | 3300053136 | Bacteria | 526 |
| 1405 | Ga0500568_0107630 | 3300053139 | Bacteria | 1043 |
| 1406 | Ga0500573_0030403 | 3300053140 | Bacteria | 3116 |
| 1407 | Ga0500573_0107734 | 3300053140 | Bacteria | 1562 |
| 1408 | Ga0500573_0311348 | 3300053140 | Bacteria | 782 |
| 1409 | Ga0500620_083656 | 3300053155 | Bacteria | 1107 |
| 1410 | Ga0501084_0004130 | 3300054114 | Bacteria | 11829 |
| 1411 | Ga0501084_0028629 | 3300054114 | Bacteria | 4658 |
| 1412 | Ga0501084_0059413 | 3300054114 | Bacteria | 3200 |
| 1413 | Ga0501084_0148023 | 3300054114 | Bacteria | 1978 |
| 1414 | Ga0501084_0465464 | 3300054114 | Bacteria | 1069 |
| 1415 | Ga0501084_1423975 | 3300054114 | Bacteria | 580 |
| 1416 | Ga0590077_062731 | 3300059426 | Bacteria | 844 |
| 1417 | Ga0587091_171231 | 3300059511 | Bacteria | 565 |
| 1418 | Ga0587128_147832 | 3300059630 | Bacteria | 533 |
| 1419 | Ga0587107_133361 | 3300059652 | Bacteria | 524 |
| 1420 | Ga0501082_0008254 | 3300060353 | Bacteria | 8980 |
| 1421 | Ga0501082_0059879 | 3300060353 | Bacteria | 3281 |
| 1422 | Ga0501082_0062182 | 3300060353 | Bacteria | 3213 |
| 1423 | Ga0501082_0127882 | 3300060353 | Bacteria | 2204 |
| 1424 | Ga0501082_0141089 | 3300060353 | Bacteria | 2091 |
| 1425 | Ga0501082_0620617 | 3300060353 | Bacteria | 946 |
| 1426 | Ga0501082_1174118 | 3300060353 | Bacteria | 671 |
| 1427 | Ga0501082_1877407 | 3300060353 | Bacteria | 522 |
| 1428 | Ga0466962_0003215 | 3300061719 | Bacteria | 7762 |
| 1429 | Ga0466962_0009228 | 3300061719 | Bacteria | 4726 |
| 1430 | Ga0466962_0049410 | 3300061719 | Bacteria | 2010 |
| 1431 | Ga0466962_0058613 | 3300061719 | Bacteria | 1838 |
| 1432 | Ga0530510_0069190 | 3300061734 | Bacteria | 2561 |
| 1433 | Ga0530510_0085801 | 3300061734 | Bacteria | 2294 |
| 1434 | Ga0530510_0146581 | 3300061734 | Bacteria | 1741 |
| 1435 | Ga0530510_0149633 | 3300061734 | Bacteria | 1723 |
| 1436 | Ga0530510_0259482 | 3300061734 | Bacteria | 1296 |
| 1437 | Ga0530510_0313246 | 3300061734 | Bacteria | 1176 |
| 1438 | Ga0530510_0644395 | 3300061734 | Bacteria | 807 |
| 1439 | Ga0530510_0687048 | 3300061734 | Bacteria | 780 |
| 1440 | Ga0530510_0929809 | 3300061734 | Bacteria | 665 |
| 1441 | Ga0530510_1336131 | 3300061734 | Bacteria | 550 |
| 1442 | Ga0501040_0767818 | |||
| 1443 | JGI24738J21930_10130572 | |||
| 1444 | JGI24738J21930_10132898 | |||
| 1445 | JGI24749J21850_1028970 | |||
| 1446 | JGI25406J46586_10095658 | |||
| 1447 | rootH1_10021847 | |||
| 1448 | Ga0007429J51699_1061575 | |||
| 1449 | JGI25405J52794_10017062 | |||
| 1450 | Ga0070658_10086969 | |||
| 1451 | Ga0070676_10253832 | |||
| 1452 | Ga0070676_11083428 | |||
| 1453 | Ga0070676_11532281 | |||
| 1454 | Ga0070683_100009719 | |||
| 1455 | Ga0070683_100233458 | |||
| 1456 | Ga0070683_100285940 | |||
| 1457 | Ga0070683_100370449 | |||
| 1458 | Ga0070683_100512918 | |||
| 1459 | Ga0070683_100650643 | |||
| 1460 | Ga0070683_100671788 | |||
| 1461 | Ga0070683_101406190 | |||
| 1462 | Ga0068869_100365160 | |||
| 1463 | Ga0068869_100627468 | |||
| 1464 | Ga0070666_10524548 | |||
| 1465 | Ga0070680_100187462 | |||
| 1466 | Ga0070682_100015312 | |||
| 1467 | Ga0070682_100034835 | |||
| 1468 | Ga0070682_100102526 | |||
| 1469 | Ga0070682_101750246 | |||
| 1470 | Ga0070682_101983347 | |||
| 1471 | Ga0068868_100197708 | |||
| 1472 | Ga0068868_101052334 | |||
| 1473 | Ga0068868_101506457 | |||
| 1474 | Ga0070660_100008562 | |||
| 1475 | Ga0070660_100018998 | |||
| 1476 | Ga0070660_100086786 | |||
| 1477 | Ga0070660_101694516 | |||
| 1478 | Ga0070660_101874927 | |||
| 1479 | Ga0070660_101912647 | |||
| 1480 | Ga0070691_10052760 | |||
| 1481 | Ga0070691_10244347 | |||
| 1482 | Ga0070691_10672253 | |||
| 1483 | Ga0070687_100053556 | |||
| 1484 | Ga0070687_101078732 | |||
| 1485 | Ga0070687_101210565 | |||
| 1486 | Ga0070661_101525808 | |||
| 1487 | Ga0070692_10095330 | |||
| 1488 | Ga0070692_10388353 | |||
| 1489 | Ga0070692_10489549 | |||
| 1490 | Ga0070692_10964769 | |||
| 1491 | Ga0070668_100112162 | |||
| 1492 | Ga0070668_100188181 | |||
| 1493 | Ga0070668_100358002 | |||
| 1494 | Ga0070668_100568034 | |||
| 1495 | Ga0070668_101673572 | |||
| 1496 | Ga0070675_100098713 | |||
| 1497 | Ga0070675_100343268 | |||
| 1498 | Ga0070675_101514669 | |||
| 1499 | Ga0070671_100401955 | |||
| 1500 | Ga0070674_100076977 | |||
| 1501 | Ga0070674_100097774 | |||
| 1502 | Ga0070674_100701608 | |||
| 1503 | Ga0070674_101302839 | |||
| 1504 | Ga0070674_101336798 | |||
| 1505 | Ga0070673_100831751 | |||
| 1506 | Ga0070673_102121210 | |||
| 1507 | Ga0070688_100096811 | |||
| 1508 | Ga0070688_100387983 | |||
| 1509 | Ga0070659_100016719 | |||
| 1510 | Ga0070659_100032751 | |||
| 1511 | Ga0070659_100195515 | |||
| 1512 | Ga0070659_100342419 | |||
| 1513 | Ga0070659_100478383 | |||
| 1514 | Ga0070659_100485414 | |||
| 1515 | Ga0070659_100867386 | |||
| 1516 | Ga0070667_100694735 | |||
| 1517 | Ga0070667_102109327 | |||
| 1518 | Ga0070714_100023518 | |||
| 1519 | Ga0070701_10066850 | |||
| 1520 | Ga0070701_10260346 | |||
| 1521 | Ga0070701_10661069 | |||
| 1522 | Ga0070700_100035874 | |||
| 1523 | Ga0070700_100194691 | |||
| 1524 | Ga0070700_100242287 | |||
| 1525 | Ga0070700_100924102 | |||
| 1526 | Ga0070700_101254718 | |||
| 1527 | Ga0070700_101697630 | |||
| 1528 | Ga0070708_100765853 | |||
| 1529 | Ga0070663_100299871 | |||
| 1530 | Ga0070663_100813679 | |||
| 1531 | Ga0070678_100153525 | |||
| 1532 | Ga0070678_100179670 | |||
| 1533 | Ga0070678_100192177 | |||
| 1534 | Ga0070678_100832039 | |||
| 1535 | Ga0070662_100242805 | |||
| 1536 | Ga0070662_101204002 | |||
| 1537 | Ga0070681_10452716 | |||
| 1538 | Ga0068867_100004521 | |||
| 1539 | Ga0068867_100042397 | |||
| 1540 | Ga0068867_100565142 | |||
| 1541 | Ga0068867_100693724 | |||
| 1542 | Ga0068867_101229218 | |||
| 1543 | Ga0070685_10244037 | |||
| 1544 | Ga0070685_11294109 | |||
| 1545 | Ga0070685_11509660 | |||
| 1546 | Ga0070707_100110080 | |||
| 1547 | Ga0070698_100001109 | |||
| 1548 | Ga0070698_100669749 | |||
| 1549 | Ga0070699_100515279 | |||
| 1550 | Ga0070679_100009296 | |||
| 1551 | Ga0070679_100426360 | |||
| 1552 | Ga0070679_101515074 | |||
| 1553 | Ga0070684_100009955 | |||
| 1554 | Ga0070684_100177218 | |||
| 1555 | Ga0070684_100202630 | |||
| 1556 | Ga0070684_100320923 | |||
| 1557 | Ga0070684_100356396 | |||
| 1558 | Ga0070684_100423642 | |||
| 1559 | Ga0070684_101588590 | |||
| 1560 | Ga0070684_102339418 | |||
| 1561 | Ga0068853_100276012 | |||
| 1562 | Ga0068853_100529227 | |||
| 1563 | Ga0068853_100864006 | |||
| 1564 | Ga0068853_101087352 | |||
| 1565 | Ga0068853_101467531 | |||
| 1566 | Ga0070672_100134831 | |||
| 1567 | Ga0070672_100640587 | |||
| 1568 | Ga0070672_101826239 | |||
| 1569 | Ga0070686_100165300 | |||
| 1570 | Ga0070696_101249112 | |||
| 1571 | Ga0070693_100203066 | |||
| 1572 | Ga0070693_100319411 | |||
| 1573 | Ga0070693_100330313 | |||
| 1574 | Ga0070693_100948249 | |||
| 1575 | Ga0070693_101499802 | |||
| 1576 | Ga0070665_100004100 | |||
| 1577 | Ga0070665_100262563 | |||
| 1578 | Ga0070704_101491345 | |||
| 1579 | Ga0068855_100067295 | |||
| 1580 | Ga0068855_100637333 | |||
| 1581 | Ga0068855_100972915 | |||
| 1582 | Ga0070664_100048998 | |||
| 1583 | Ga0070664_100387908 | |||
| 1584 | Ga0070664_100716569 | |||
| 1585 | Ga0070664_102034625 | |||
| 1586 | Ga0068857_100004625 | |||
| 1587 | Ga0068857_101209237 | |||
| 1588 | Ga0068854_100217223 | |||
| 1589 | Ga0068854_100293169 | |||
| 1590 | Ga0068854_101246697 | |||
| 1591 | Ga0068854_101337843 | |||
| 1592 | Ga0068854_101700591 | |||
| 1593 | Ga0068856_100433202 | |||
| 1594 | Ga0068856_101078897 | |||
| 1595 | Ga0068856_101332623 | |||
| 1596 | Ga0068856_101950798 | |||
| 1597 | Ga0070702_100048120 | |||
| 1598 | Ga0070702_100647182 | |||
| 1599 | Ga0070702_101249905 | |||
| 1600 | Ga0068852_100074976 | |||
| 1601 | Ga0068852_100769180 | |||
| 1602 | Ga0068852_101730810 | |||
| 1603 | Ga0068852_102497043 | |||
| 1604 | Ga0068859_101245350 | |||
| 1605 | Ga0068859_102178260 | |||
| 1606 | Ga0068864_100193021 | |||
| 1607 | Ga0068864_100204698 | |||
| 1608 | Ga0068864_101372735 | |||
| 1609 | Ga0068866_10045752 | |||
| 1610 | Ga0068866_10154966 | |||
| 1611 | Ga0068866_10571426 | |||
| 1612 | Ga0068866_10610339 | |||
| 1613 | Ga0068861_100036116 | |||
| 1614 | Ga0068861_100081817 | |||
| 1615 | Ga0068861_100163603 | |||
| 1616 | Ga0068861_100467399 | |||
| 1617 | Ga0068861_101167191 | |||
| 1618 | Ga0068861_102571693 | |||
| 1619 | Ga0068870_10016336 | |||
| 1620 | Ga0068870_10320545 | |||
| 1621 | Ga0068863_101179603 | |||
| 1622 | Ga0068858_100045587 | |||
| 1623 | Ga0068858_100565027 | |||
| 1624 | Ga0068858_101554333 | |||
| 1625 | Ga0068858_102121129 | |||
| 1626 | Ga0068860_100000237 | |||
| 1627 | Ga0068860_100386785 | |||
| 1628 | Ga0068862_100198936 | |||
| 1629 | Ga0068862_100853033 | |||
| 1630 | Ga0068862_101655450 | |||
| 1631 | Ga0068862_102163729 | |||
| 1632 | Ga0068862_102564985 | |||
| 1633 | Ga0081455_10005211 | |||
| 1634 | Ga0081455_10006193 | |||
| 1635 | Ga0081455_10031416 | |||
| 1636 | Ga0081538_10000428 | |||
| 1637 | Ga0081539_10047241 | |||
| 1638 | Ga0075365_10006292 | |||
| 1639 | Ga0075365_10017380 | |||
| 1640 | Ga0075365_10024864 | |||
| 1641 | Ga0075365_10031622 | |||
| 1642 | Ga0075365_10046184 | |||
| 1643 | Ga0075365_10116200 | |||
| 1644 | Ga0075365_10161190 | |||
| 1645 | Ga0075365_10171543 | |||
| 1646 | Ga0075365_10201112 | |||
| 1647 | Ga0075365_10307301 | |||
| 1648 | Ga0075365_10315598 | |||
| 1649 | Ga0075365_10405045 | |||
| 1650 | Ga0075365_10440853 | |||
| 1651 | Ga0075365_10941560 | |||
| 1652 | Ga0075365_11005309 | |||
| 1653 | Ga0075365_11228441 | |||
| 1654 | Ga0075365_11292786 | |||
| 1655 | Ga0075368_10001919 | |||
| 1656 | Ga0075368_10003530 | |||
| 1657 | Ga0075368_10023996 | |||
| 1658 | Ga0075363_100003768 | |||
| 1659 | Ga0075363_100022968 | |||
| 1660 | Ga0075363_100234505 | |||
| 1661 | Ga0075363_100268834 | |||
| 1662 | Ga0075363_100315434 | |||
| 1663 | Ga0075363_100500199 | |||
| 1664 | Ga0075364_10025977 | |||
| 1665 | Ga0075364_10081863 | |||
| 1666 | Ga0075364_10099101 | |||
| 1667 | Ga0075364_10148513 | |||
| 1668 | Ga0075364_10192118 | |||
| 1669 | Ga0075364_10241276 | |||
| 1670 | Ga0075432_10002344 | |||
| 1671 | Ga0075432_10006679 | |||
| 1672 | Ga0075432_10146408 | |||
| 1673 | Ga0075432_10530377 | |||
| 1674 | Ga0075362_10014354 | |||
| 1675 | Ga0075362_10083712 | |||
| 1676 | Ga0075362_10349564 | |||
| 1677 | Ga0075367_10046982 | |||
| 1678 | Ga0075367_10154403 | |||
| 1679 | Ga0075367_10336740 | |||
| 1680 | Ga0075366_10592548 | |||
| 1681 | Ga0097621_100427321 | |||
| 1682 | Ga0097621_100624168 | |||
| 1683 | Ga0097621_100625578 | |||
| 1684 | Ga0097621_101908630 | |||
| 1685 | Ga0075370_10032500 | |||
| 1686 | Ga0075370_10037500 | |||
| 1687 | Ga0075370_10053867 | |||
| 1688 | Ga0075370_10646666 | |||
| 1689 | Ga0075370_10797714 | |||
| 1690 | Ga0068871_100589516 | |||
| 1691 | Ga0068871_100737388 | |||
| 1692 | Ga0075428_100024363 | |||
| 1693 | Ga0075428_100130269 | |||
| 1694 | Ga0075428_100582980 | |||
| 1695 | Ga0075428_100659286 | |||
| 1696 | Ga0075428_101702835 | |||
| 1697 | Ga0075430_101699776 | |||
| 1698 | Ga0075431_100027797 | |||
| 1699 | Ga0075433_10008034 | |||
| 1700 | Ga0075433_10019906 | |||
| 1701 | Ga0075434_100000790 | |||
| 1702 | Ga0075434_100018722 | |||
| 1703 | Ga0075429_100039533 | |||
| 1704 | Ga0068865_100009130 | |||
| 1705 | Ga0068865_100013158 | |||
| 1706 | Ga0068865_100213986 | |||
| 1707 | Ga0068865_100564032 | |||
| 1708 | Ga0068865_101241414 | |||
| 1709 | Ga0075436_100070655 | |||
| 1710 | Ga0075436_100109664 | |||
| 1711 | Ga0097620_101245337 | |||
| 1712 | Ga0097620_102177941 | |||
| 1713 | Ga0075435_100004534 | |||
| 1714 | Ga0075435_100010687 | |||
| 1715 | Ga0105240_11805877 | |||
| 1716 | Ga0111539_10001116 | |||
| 1717 | Ga0111539_10115538 | |||
| 1718 | Ga0111539_10555578 | |||
| 1719 | Ga0111539_12178582 | |||
| 1720 | Ga0111539_13483269 | |||
| 1721 | Ga0105245_10000784 | |||
| 1722 | Ga0105245_10013521 | |||
| 1723 | Ga0105245_10217370 | |||
| 1724 | Ga0105245_10234858 | |||
| 1725 | Ga0105245_10454951 | |||
| 1726 | Ga0105245_12073563 | |||
| 1727 | Ga0105247_10229412 | |||
| 1728 | Ga0105247_10490636 | |||
| 1729 | Ga0114129_10009571 | |||
| 1730 | Ga0114129_10651037 | |||
| 1731 | Ga0105243_10009154 | |||
| 1732 | Ga0105243_10029217 | |||
| 1733 | Ga0105243_10082398 | |||
| 1734 | Ga0105243_10108500 | |||
| 1735 | Ga0105243_10516213 | |||
| 1736 | Ga0105243_10547293 | |||
| 1737 | Ga0105243_10599956 | |||
| 1738 | Ga0105243_10625974 | |||
| 1739 | Ga0105243_11284149 | |||
| 1740 | Ga0105243_11608031 | |||
| 1741 | Ga0105243_11917559 | |||
| 1742 | Ga0105241_10730309 | |||
| 1743 | Ga0105242_10058407 | |||
| 1744 | Ga0105242_10203773 | |||
| 1745 | Ga0105242_10223121 | |||
| 1746 | Ga0105242_10324702 | |||
| 1747 | Ga0105242_12120496 | |||
| 1748 | Ga0105248_10640200 | |||
| 1749 | Ga0105248_10690995 | |||
| 1750 | Ga0105248_10982496 | |||
| 1751 | Ga0105248_12520967 | |||
| 1752 | Ga0105237_10370582 | |||
| 1753 | Ga0105237_10658500 | |||
| 1754 | Ga0105237_11559717 | |||
| 1755 | Ga0105237_11631374 | |||
| 1756 | Ga0105238_10104155 | |||
| 1757 | Ga0105238_10306736 | |||
| 1758 | Ga0105238_10644430 | |||
| 1759 | Ga0105238_12833672 | |||
| 1760 | Ga0105249_10135909 | |||
| 1761 | Ga0105249_10223838 | |||
| 1762 | Ga0105249_10361030 | |||
| 1763 | Ga0105249_10621648 | |||
| 1764 | Ga0105249_10789355 | |||
| 1765 | Ga0105249_11104770 | |||
| 1766 | Ga0105249_11764053 | |||
| 1767 | Ga0105249_11794335 | |||
| 1768 | Ga0105249_13229679 | |||
| 1769 | Ga0105249_13569943 | |||
| 1770 | Ga0105239_10025063 | |||
| 1771 | Ga0105239_10025631 | |||
| 1772 | Ga0105239_10377368 | |||
| 1773 | Ga0105239_10393451 | |||
| 1774 | Ga0105239_10441979 | |||
| 1775 | Ga0105239_11039996 | |||
| 1776 | Ga0105239_11239046 | |||
| 1777 | Ga0105239_11251885 | |||
| 1778 | Ga0105239_11664473 | |||
| 1779 | Ga0105239_11795826 | |||
| 1780 | Ga0105239_12345681 | |||
| 1781 | Ga0105239_13292876 | |||
| 1782 | Ga0105246_10004511 | |||
| 1783 | Ga0105246_10197563 | |||
| 1784 | Ga0105246_10207269 | |||
| 1785 | Ga0105246_10320138 | |||
| 1786 | Ga0105246_10797071 | |||
| 1787 | Ga0105246_11519439 | |||
| 1788 | Ga0105246_12304057 | |||
| 1789 | Ga0105246_12415712 | |||
| 1790 | Ga0157329_1004908 | |||
| 1791 | Ga0157341_1002850 | |||
| 1792 | Ga0157319_1001748 | |||
| 1793 | Ga0157345_1023030 | |||
| 1794 | Ga0157347_1059840 | |||
| 1795 | Ga0157313_1037034 | |||
| 1796 | Ga0157324_1031350 | |||
| 1797 | Ga0157315_1060990 | |||
| 1798 | Ga0157326_1003780 | |||
| 1799 | Ga0157371_10087004 | |||
| 1800 | Ga0157371_10160623 | |||
| 1801 | Ga0157371_10293750 | |||
| 1802 | Ga0157371_10354094 | |||
| 1803 | Ga0157371_11185366 | |||
| 1804 | Ga0157370_10264443 | |||
| 1805 | Ga0157370_11027938 | |||
| 1806 | Ga0157370_11236407 | |||
| 1807 | Ga0157370_11464431 | |||
| 1808 | Ga0157370_11672520 | |||
| 1809 | Ga0157369_10057264 | |||
| 1810 | Ga0157369_10250867 | |||
| 1811 | Ga0157369_10474237 | |||
| 1812 | Ga0157369_11691093 | |||
| 1813 | Ga0157374_10463567 | |||
| 1814 | Ga0157374_10998224 | |||
| 1815 | Ga0157374_11198190 | |||
| 1816 | Ga0157374_12866168 | |||
| 1817 | Ga0157378_10616971 | |||
| 1818 | Ga0157378_11409136 | |||
| 1819 | Ga0157378_11590307 | |||
| 1820 | Ga0163162_10037964 | |||
| 1821 | Ga0163162_10165665 | |||
| 1822 | Ga0163162_10699096 | |||
| 1823 | Ga0163162_10880048 | |||
| 1824 | Ga0163162_10953710 | |||
| 1825 | Ga0163162_10991718 | |||
| 1826 | Ga0163162_12141496 | |||
| 1827 | Ga0157372_10006799 | |||
| 1828 | Ga0157372_10196315 | |||
| 1829 | Ga0157372_10340898 | |||
| 1830 | Ga0157372_10387888 | |||
| 1831 | Ga0157372_10439006 | |||
| 1832 | Ga0157372_10605056 | |||
| 1833 | Ga0157372_11561311 | |||
| 1834 | Ga0157372_11871357 | |||
| 1835 | Ga0157372_12767302 | |||
| 1836 | Ga0157375_10070197 | |||
| 1837 | Ga0157375_10154789 | |||
| 1838 | Ga0157375_10268601 | |||
| 1839 | Ga0157375_10288095 | |||
| 1840 | Ga0157375_10347642 | |||
| 1841 | Ga0157375_10407439 | |||
| 1842 | Ga0157375_10623105 | |||
| 1843 | Ga0157375_10655259 | |||
| 1844 | Ga0157375_10707989 | |||
| 1845 | Ga0157375_10919724 | |||
| 1846 | Ga0157375_10985650 | |||
| 1847 | Ga0163163_10207804 | |||
| 1848 | Ga0163163_10371732 | |||
| 1849 | Ga0163163_10965638 | |||
| 1850 | Ga0163163_11029407 | |||
| 1851 | Ga0163163_11734882 | |||
| 1852 | Ga0163163_11823228 | |||
| 1853 | Ga0163163_12662559 | |||
| 1854 | Ga0157380_10003865 | |||
| 1855 | Ga0157380_10025349 | |||
| 1856 | Ga0157380_10311376 | |||
| 1857 | Ga0157380_10738734 | |||
| 1858 | Ga0182008_10070344 | |||
| 1859 | Ga0182008_10142112 | |||
| 1860 | Ga0182008_10334886 | |||
| 1861 | Ga0157377_10002420 | |||
| 1862 | Ga0157377_10828088 | |||
| 1863 | Ga0157377_10897746 | |||
| 1864 | Ga0157377_11130082 | |||
| 1865 | Ga0157377_11149366 | |||
| 1866 | Ga0157379_10319028 | |||
| 1867 | Ga0157376_10426080 | |||
| 1868 | Ga0157376_10844694 | |||
| 1869 | Ga0157376_10964637 | |||
| 1870 | Ga0157376_11485512 | |||
| 1871 | Ga0163161_10255290 | |||
| 1872 | Ga0163161_10272722 | |||
| 1873 | Ga0163161_10844374 | |||
| 1874 | Ga0163161_10931748 | |||
| 1875 | Ga0163161_10990139 | |||
| 1876 | Ga0163161_11316386 | |||
| 1877 | Ga0163161_12003410 | |||
| 1878 | Ga0206356_11045432 | |||
| 1879 | Ga0206355_1474064 | |||
| 1880 | Ga0206351_10522411 | |||
| 1881 | Ga0206350_10017631 | |||
| 1882 | Ga0206354_11068423 | |||
| 1883 | Ga0206353_10074550 | |||
| 1884 | Ga0206353_10216600 | |||
| 1885 | Ga0206353_11576002 | |||
| 1886 | Ga0213876_10133516 | |||
| 1887 | Ga0224712_10232111 | |||
| 1888 | Ga0207697_10201355 | |||
| 1889 | Ga0207682_10228961 | |||
| 1890 | Ga0207642_10016931 | |||
| 1891 | Ga0207642_10114690 | |||
| 1892 | Ga0207642_10354691 | |||
| 1893 | Ga0207642_10582879 | |||
| 1894 | Ga0207642_10837576 | |||
| 1895 | Ga0207710_10137174 | |||
| 1896 | Ga0207710_10191245 | |||
| 1897 | Ga0207688_10023178 | |||
| 1898 | Ga0207688_10025639 | |||
| 1899 | Ga0207688_10129326 | |||
| 1900 | Ga0207688_10232666 | |||
| 1901 | Ga0207688_10451783 | |||
| 1902 | Ga0207688_10693185 | |||
| 1903 | Ga0207688_10937748 | |||
| 1904 | Ga0207688_11007464 | |||
| 1905 | Ga0207647_10011458 | |||
| 1906 | Ga0207647_10191704 | |||
| 1907 | Ga0207647_10232904 | |||
| 1908 | Ga0207647_10265991 | |||
| 1909 | Ga0207647_10306855 | |||
| 1910 | Ga0207645_10516514 | |||
| 1911 | Ga0207643_10003490 | |||
| 1912 | Ga0207643_10037488 | |||
| 1913 | Ga0207643_10726892 | |||
| 1914 | Ga0207705_10012685 | |||
| 1915 | Ga0207705_10942087 | |||
| 1916 | Ga0207707_10954079 | |||
| 1917 | Ga0207707_11267495 | |||
| 1918 | Ga0207671_10144000 | |||
| 1919 | Ga0207671_10162853 | |||
| 1920 | Ga0207671_10239136 | |||
| 1921 | Ga0207660_11321538 | |||
| 1922 | Ga0207662_10055716 | |||
| 1923 | Ga0207657_10004479 | |||
| 1924 | Ga0207657_10027478 | |||
| 1925 | Ga0207657_10050202 | |||
| 1926 | Ga0207657_10873637 | |||
| 1927 | Ga0207657_11171562 | |||
| 1928 | Ga0207652_10437966 | |||
| 1929 | Ga0207652_10533276 | |||
| 1930 | Ga0207646_10054603 | |||
| 1931 | Ga0207681_11427968 | |||
| 1932 | Ga0207694_10260070 | |||
| 1933 | Ga0207694_10705232 | |||
| 1934 | Ga0207694_11729332 | |||
| 1935 | Ga0207659_10112748 | |||
| 1936 | Ga0207659_10122010 | |||
| 1937 | Ga0207687_10007750 | |||
| 1938 | Ga0207687_10031535 | |||
| 1939 | Ga0207687_10089049 | |||
| 1940 | Ga0207687_10392237 | |||
| 1941 | Ga0207664_10021185 | |||
| 1942 | Ga0207644_10341144 | |||
| 1943 | Ga0207644_10740850 | |||
| 1944 | Ga0207690_10038937 | |||
| 1945 | Ga0207690_10104390 | |||
| 1946 | Ga0207690_10171780 | |||
| 1947 | Ga0207690_10177518 | |||
| 1948 | Ga0207690_10349331 | |||
| 1949 | Ga0207690_10486765 | |||
| 1950 | Ga0207690_11047723 | |||
| 1951 | Ga0207706_10025706 | |||
| 1952 | Ga0207706_10138591 | |||
| 1953 | Ga0207706_10148220 | |||
| 1954 | Ga0207706_10331879 | |||
| 1955 | Ga0207706_10867856 | |||
| 1956 | Ga0207686_10708021 | |||
| 1957 | Ga0207686_11492274 | |||
| 1958 | Ga0207709_10031220 | |||
| 1959 | Ga0207709_10075093 | |||
| 1960 | Ga0207709_10240490 | |||
| 1961 | Ga0207709_10494880 | |||
| 1962 | Ga0207709_10946058 | |||
| 1963 | Ga0207709_11001324 | |||
| 1964 | Ga0207669_10082943 | |||
| 1965 | Ga0207669_10083410 | |||
| 1966 | Ga0207669_10302691 | |||
| 1967 | Ga0207669_11563720 | |||
| 1968 | Ga0207669_11578060 | |||
| 1969 | Ga0207704_10007451 | |||
| 1970 | Ga0207704_10074232 | |||
| 1971 | Ga0207704_10212072 | |||
| 1972 | Ga0207704_10506540 | |||
| 1973 | Ga0207691_10007736 | |||
| 1974 | Ga0207691_10435869 | |||
| 1975 | Ga0207691_10958650 | |||
| 1976 | Ga0207691_11343843 | |||
| 1977 | Ga0207711_10352633 | |||
| 1978 | Ga0207711_10421491 | |||
| 1979 | Ga0207711_10495792 | |||
| 1980 | Ga0207689_10202976 | |||
| 1981 | Ga0207689_10761677 | |||
| 1982 | Ga0207689_11643269 | |||
| 1983 | Ga0207661_10133972 | |||
| 1984 | Ga0207661_10146461 | |||
| 1985 | Ga0207661_10171341 | |||
| 1986 | Ga0207661_10250278 | |||
| 1987 | Ga0207661_10523615 | |||
| 1988 | Ga0207661_10628778 | |||
| 1989 | Ga0207661_10813759 | |||
| 1990 | Ga0207661_10848868 | |||
| 1991 | Ga0207661_10886863 | |||
| 1992 | Ga0207661_11272465 | |||
| 1993 | Ga0207661_11477616 | |||
| 1994 | Ga0207679_10412219 | |||
| 1995 | Ga0207679_10490537 | |||
| 1996 | Ga0207679_10710591 | |||
| 1997 | Ga0207679_10981133 | |||
| 1998 | Ga0207679_11522531 | |||
| 1999 | Ga0207679_11700351 | |||
| 2000 | Ga0207679_12129599 | |||
| 2001 | Ga0207667_10661603 | |||
| 2002 | Ga0207667_10890745 | |||
| 2003 | Ga0207651_11077563 | |||
| 2004 | Ga0207712_10099681 | |||
| 2005 | Ga0207712_10163356 | |||
| 2006 | Ga0207712_10287048 | |||
| 2007 | Ga0207712_10360721 | |||
| 2008 | Ga0207712_10816847 | |||
| 2009 | Ga0207668_10044265 | |||
| 2010 | Ga0207668_10127223 | |||
| 2011 | Ga0207668_11906966 | |||
| 2012 | Ga0207640_10241322 | |||
| 2013 | Ga0207640_10278164 | |||
| 2014 | Ga0207640_10431235 | |||
| 2015 | Ga0207640_11136856 | |||
| 2016 | Ga0207640_11167579 | |||
| 2017 | Ga0207640_11229803 | |||
| 2018 | Ga0207658_10017447 | |||
| 2019 | Ga0207658_10612554 | |||
| 2020 | Ga0207658_12154622 | |||
| 2021 | Ga0207677_10214840 | |||
| 2022 | Ga0207677_10872935 | |||
| 2023 | Ga0207677_11375181 | |||
| 2024 | Ga0207703_10287576 | |||
| 2025 | Ga0207703_11400234 | |||
| 2026 | Ga0207639_10723903 | |||
| 2027 | Ga0207639_11886409 | |||
| 2028 | Ga0207678_10271749 | |||
| 2029 | Ga0207678_10359302 | |||
| 2030 | Ga0207678_10424293 | |||
| 2031 | Ga0207678_10436417 | |||
| 2032 | Ga0207678_10981732 | |||
| 2033 | Ga0207678_11044549 | |||
| 2034 | Ga0207678_11668786 | |||
| 2035 | Ga0207708_10042577 | |||
| 2036 | Ga0207708_10064834 | |||
| 2037 | Ga0207708_10162751 | |||
| 2038 | Ga0207708_10516949 | |||
| 2039 | Ga0207708_11185591 | |||
| 2040 | Ga0207708_11206609 | |||
| 2041 | Ga0207708_11539972 | |||
| 2042 | Ga0207708_12018224 | |||
| 2043 | Ga0207702_10880280 | |||
| 2044 | Ga0207702_10913944 | |||
| 2045 | Ga0207702_11231244 | |||
| 2046 | Ga0207641_10440161 | |||
| 2047 | Ga0207648_10001576 | |||
| 2048 | Ga0207648_10052869 | |||
| 2049 | Ga0207648_10767661 | |||
| 2050 | Ga0207648_10994035 | |||
| 2051 | Ga0207648_11158671 | |||
| 2052 | Ga0207676_10713395 | |||
| 2053 | Ga0207676_10905768 | |||
| 2054 | Ga0207676_10940089 | |||
| 2055 | Ga0207676_12322168 | |||
| 2056 | Ga0207674_10003282 | |||
| 2057 | Ga0207674_10913390 | |||
| 2058 | Ga0207674_10983585 | |||
| 2059 | Ga0207674_11291720 | |||
| 2060 | Ga0207675_100019126 | |||
| 2061 | Ga0207675_100027624 | |||
| 2062 | Ga0207675_100072241 | |||
| 2063 | Ga0207675_101002295 | |||
| 2064 | Ga0207675_101013152 | |||
| 2065 | Ga0207675_102017733 | |||
| 2066 | Ga0207683_10024133 | |||
| 2067 | Ga0207683_10686162 | |||
| 2068 | Ga0207683_11943957 | |||
| 2069 | Ga0207698_10017237 | |||
| 2070 | Ga0207698_10179653 | |||
| 2071 | Ga0207698_11362345 | |||
| 2072 | Ga0207698_11863031 | |||
| 2073 | Ga0207698_11946301 | |||
| 2074 | Ga0207698_12005461 | |||
| 2075 | Ga0207698_12485903 | |||
| 2076 | Ga0209371_1059702 | |||
| 2077 | Ga0209813_10001855 | |||
| 2078 | Ga0209813_10007379 | |||
| 2079 | Ga0209813_10029205 | |||
| 2080 | Ga0209974_10250496 | |||
| 2081 | Ga0207428_10001037 | |||
| 2082 | Ga0207428_10002082 | |||
| 2083 | Ga0207428_10059433 | |||
| 2084 | Ga0268266_10019655 | |||
| 2085 | Ga0268266_10132557 | |||
| 2086 | Ga0268266_10343366 | |||
| 2087 | Ga0268266_10785031 | |||
| 2088 | Ga0268266_10888330 | |||
| 2089 | Ga0268266_10941209 | |||
| 2090 | Ga0268266_10951369 | |||
| 2091 | Ga0268266_12264150 | |||
| 2092 | Ga0268265_10524707 | |||
| 2093 | Ga0268265_10705282 | |||
| 2094 | Ga0268265_12502348 | |||
| 2095 | Ga0268264_10000195 | |||
| 2096 | Ga0268264_10030690 | |||
| 2097 | Ga0268264_12620586 | |||
| 2098 | Ga0307517_10659924 | |||
| 2099 | Ga0307515_10336916 | |||
| 2100 | Ga0268256_1066836 | |||
| 2101 | Ga0316182_1145211 | |||
| 2102 | Ga0307513_10578670 | |||
| 2103 | Ga0307509_10009190 | |||
| 2104 | Ga0307408_100003860 | |||
| 2105 | Ga0307408_100049059 | |||
| 2106 | Ga0307408_100089115 | |||
| 2107 | Ga0307408_100133046 | |||
| 2108 | Ga0307408_100980822 | |||
| 2109 | Ga0307408_101751100 | |||
| 2110 | Ga0307405_10001103 | |||
| 2111 | Ga0307405_10006689 | |||
| 2112 | Ga0307405_10055925 | |||
| 2113 | Ga0307405_10397742 | |||
| 2114 | Ga0307405_10824029 | |||
| 2115 | Ga0307413_10034163 | |||
| 2116 | Ga0307413_10075719 | |||
| 2117 | Ga0307413_10094384 | |||
| 2118 | Ga0307413_10108459 | |||
| 2119 | Ga0307413_11894619 | |||
| 2120 | Ga0307410_10000104 | |||
| 2121 | Ga0307410_10027795 | |||
| 2122 | Ga0307410_10098455 | |||
| 2123 | Ga0307410_10300520 | |||
| 2124 | Ga0307410_10365397 | |||
| 2125 | Ga0307410_10443407 | |||
| 2126 | Ga0307410_10624960 | |||
| 2127 | Ga0307410_11239514 | |||
| 2128 | Ga0307410_11421478 | |||
| 2129 | Ga0307410_11745830 | |||
| 2130 | Ga0307410_11844957 | |||
| 2131 | Ga0307406_10002432 | |||
| 2132 | Ga0307406_10004038 | |||
| 2133 | Ga0307406_10159312 | |||
| 2134 | Ga0307406_10350080 | |||
| 2135 | Ga0307406_10422472 | |||
| 2136 | Ga0307406_10848067 | |||
| 2137 | Ga0307406_11624545 | |||
| 2138 | Ga0307407_10009633 | |||
| 2139 | Ga0307407_10023658 | |||
| 2140 | Ga0307407_10039378 | |||
| 2141 | Ga0307407_10122575 | |||
| 2142 | Ga0307407_10145777 | |||
| 2143 | Ga0307407_10149766 | |||
| 2144 | Ga0307407_10326575 | |||
| 2145 | Ga0307407_10614433 | |||
| 2146 | Ga0307407_10683118 | |||
| 2147 | Ga0307407_10746354 | |||
| 2148 | Ga0307407_10876417 | |||
| 2149 | Ga0307407_11065760 | |||
| 2150 | Ga0307407_11401788 | |||
| 2151 | Ga0307412_10102729 | |||
| 2152 | Ga0307412_10181827 | |||
| 2153 | Ga0307412_10574554 | |||
| 2154 | Ga0307412_11639144 | |||
| 2155 | Ga0307412_12297496 | |||
| 2156 | Ga0307409_100000362 | |||
| 2157 | Ga0307409_100013725 | |||
| 2158 | Ga0307409_100048235 | |||
| 2159 | Ga0307409_100086508 | |||
| 2160 | Ga0307409_100107296 | |||
| 2161 | Ga0307409_100267865 | |||
| 2162 | Ga0307409_100291161 | |||
| 2163 | Ga0307409_100305750 | |||
| 2164 | Ga0307409_100418477 | |||
| 2165 | Ga0307409_100536360 | |||
| 2166 | Ga0307409_100566233 | |||
| 2167 | Ga0307409_100599275 | |||
| 2168 | Ga0307409_100634940 | |||
| 2169 | Ga0307409_101004562 | |||
| 2170 | Ga0307409_101029679 | |||
| 2171 | Ga0307409_101293011 | |||
| 2172 | Ga0307409_102445044 | |||
| 2173 | Ga0307409_102950098 | |||
| 2174 | Ga0307416_100000240 | |||
| 2175 | Ga0307416_100031648 | |||
| 2176 | Ga0307416_100227355 | |||
| 2177 | Ga0307416_100622512 | |||
| 2178 | Ga0307416_100632438 | |||
| 2179 | Ga0307416_100735733 | |||
| 2180 | Ga0307416_100855586 | |||
| 2181 | Ga0307416_101239266 | |||
| 2182 | Ga0307416_101771688 | |||
| 2183 | Ga0307416_101948383 | |||
| 2184 | Ga0307416_101985962 | |||
| 2185 | Ga0307416_102179285 | |||
| 2186 | Ga0307414_10037621 | |||
| 2187 | Ga0307414_10156905 | |||
| 2188 | Ga0307414_10251761 | |||
| 2189 | Ga0307414_10455480 | |||
| 2190 | Ga0307414_10482798 | |||
| 2191 | Ga0307414_10512402 | |||
| 2192 | Ga0307411_10051114 | |||
| 2193 | Ga0307411_10177369 | |||
| 2194 | Ga0307411_10199084 | |||
| 2195 | Ga0307411_11556637 | |||
| 2196 | Ga0307411_11703303 | |||
| 2197 | Ga0307415_100002630 | |||
| 2198 | Ga0307415_100005693 | |||
| 2199 | Ga0307415_100016729 | |||
| 2200 | Ga0307415_100017773 | |||
| 2201 | Ga0307415_100043930 | |||
| 2202 | Ga0307415_100093526 | |||
| 2203 | Ga0307415_100148710 | |||
| 2204 | Ga0307415_100214462 | |||
| 2205 | Ga0307415_100313640 | |||
| 2206 | Ga0307415_100706245 | |||
| 2207 | Ga0307415_101455195 | |||
| 2208 | Ga0307415_102083043 | |||
| 2209 | Ga0316583_10123617 | |||
| 2210 | Ga0373939_0446523 | |||
| 2211 | Ga0373942_0084645 | |||
| 2212 | Ga0373961_0137155 | |||
| 2213 | Ga0373961_0140389 | |||
| 2214 | Ga0373962_0176903 | |||
| 2215 | Ga0373931_0170473 | |||
| 2216 | Ga0373931_0191330 | |||
| 2217 | Ga0373931_0790490 | |||
| 2218 | Ga0373927_0980654 | |||
| 2219 | Ga0373927_1140813 | |||
| 2220 | Ga0395899_0250603 | |||
| 2221 | Ga0395900_0058016 | |||
| 2222 | Ga0395900_0462585 | |||
| 2223 | Ga0395900_0615870 | |||
| 2224 | Ga0395898_0096517 | |||
| 2225 | Ga0395898_0242167 | |||
| 2226 | Ga0395905_0400837 | |||
| 2227 | Ga0395905_0825505 | |||
| 2228 | Ga0436364_0158595 | |||
| 2229 | Ga0395901_0105994 | |||
| 2230 | Ga0395901_0635055 | |||
| 2231 | Ga0395901_0867518 | |||
| 2232 | Ga0395901_1136481 | |||
| 2233 | Ga0395901_2081294 | |||
| 2234 | Ga0436365_1073144 | |||
| 2235 | Ga0436365_1902425 | |||
| 2236 | Ga0436362_1172283 | |||
| 2237 | Ga0439438_175108 | |||
| 2238 | Ga0439439_0115796 | |||
| 2239 | Ga0439465_0085262 | |||
| 2240 | Ga0451787_365079 | |||
| 2241 | Ga0451791_0511011 | |||
| 2242 | Ga0451791_1305444 | |||
| 2243 | Ga0451791_1611175 | |||
| 2244 | Ga0451793_1110791 | |||
| 2245 | Ga0451795_0714571 | |||
| 2246 | Ga0451802_0295209 | |||
| 2247 | Ga0451802_0708292 | |||
| 2248 | Ga0451806_611162 | |||
| 2249 | Ga0451804_0216958 | |||
| 2250 | Ga0451804_0628311 | |||
| 2251 | Ga0451807_0228856 | |||
| 2252 | Ga0451807_0305274 | |||
| 2253 | Ga0451833_0680881 | |||
| 2254 | Ga0451833_0873441 | |||
| 2255 | Ga0451833_0977379 | |||
| 2256 | Ga0451833_1020092 | |||
| 2257 | Ga0451837_1623172 | |||
| 2258 | Ga0451839_1658216 | |||
| 2259 | Ga0451841_1334235 | |||
| 2260 | Ga0451849_1036478 | |||
| 2261 | Ga0451851_0539608 | |||
| 2262 | Ga0451853_0904534 | |||
| 2263 | Ga0451853_1786633 | |||
| 2264 | Ga0451853_3744708 | |||
| 2265 | Ga0439431_0007629 | |||
| 2266 | Ga0439431_0052178 | |||
| 2267 | Ga0439431_0199582 | |||
| 2268 | Ga0439433_0156486 | |||
| 2269 | Ga0439442_020861 | |||
| 2270 | Ga0439448_0021155 | |||
| 2271 | Ga0439448_0062084 | |||
| 2272 | Ga0439448_0282041 | |||
| 2273 | Ga0439432_058402 | |||
| 2274 | Ga0439450_016080 | |||
| 2275 | Ga0439450_093445 | |||
| 2276 | Ga0439462_0061846 | |||
| 2277 | Ga0439463_000348 | |||
| 2278 | Ga0439463_092384 | |||
| 2279 | Ga0439463_118824 | |||
| 2280 | Ga0450888_004963 | |||
| 2281 | Ga0450907_016303 | |||
| 2282 | Ga0439446_0038802 | |||
| 2283 | Ga0439434_0017161 | |||
| 2284 | Ga0439435_0011795 | |||
| 2285 | Ga0439444_0010182 | |||
| 2286 | Ga0439444_0021683 | |||
| 2287 | Ga0439444_0094772 | |||
| 2288 | Ga0439464_0075031 | |||
| 2289 | Ga0439460_0027857 | |||
| 2290 | Ga0439460_0062596 | |||
| 2291 | Ga0439440_0001208 | |||
| 2292 | Ga0439440_0002278 | |||
| 2293 | Ga0439440_0006577 | |||
| 2294 | Ga0439440_0112705 | |||
| 2295 | Ga0466969_0006155 | |||
| 2296 | Ga0466972_0018668 | |||
| 2297 | Ga0466972_0192411 | |||
| 2298 | Ga0466965_0028706 | |||
| 2299 | Ga0466965_0051778 | |||
| 2300 | Ga0466965_0114997 | |||
| 2301 | Ga0466965_0206835 | |||
| 2302 | Ga0466965_0293639 | |||
| 2303 | Ga0466965_0895214 | |||
| 2304 | Ga0466966_0012013 | |||
| 2305 | Ga0466966_0449487 | |||
| 2306 | Ga0466961_0018930 | |||
| 2307 | Ga0466961_0057181 | |||
| 2308 | Ga0466961_0110784 | |||
| 2309 | Ga0466961_0815230 | |||
| 2310 | Ga0466961_0840479 | |||
| 2311 | Ga0466963_0086148 | |||
| 2312 | Ga0466963_0123749 | |||
| 2313 | Ga0466963_0138856 | |||
| 2314 | Ga0466963_0145117 | |||
| 2315 | Ga0466963_0679117 | |||
| 2316 | Ga0466963_0855076 | |||
| 2317 | Ga0466964_0016610 | |||
| 2318 | Ga0466964_0029859 | |||
| 2319 | Ga0466964_0033426 | |||
| 2320 | Ga0466964_0351663 | |||
| 2321 | Ga0466964_0407436 | |||
| 2322 | Ga0466964_0810946 | |||
| 2323 | Ga0466971_0000730 | |||
| 2324 | Ga0466971_0001409 | |||
| 2325 | Ga0466971_0011981 | |||
| 2326 | Ga0466971_0153252 | |||
| 2327 | Ga0466971_0419921 | |||
| 2328 | Ga0466970_0006749 | |||
| 2329 | Ga0466970_0161703 | |||
| 2330 | Ga0466970_0183178 | |||
| 2331 | Ga0466970_0284074 | |||
| 2332 | Ga0466970_0358850 | |||
| 2333 | Ga0466970_0526253 | |||
| 2334 | Ga0466957_0044095 | |||
| 2335 | Ga0466957_0176632 | |||
| 2336 | Ga0466957_0430288 | |||
| 2337 | Ga0466957_1122798 | |||
| 2338 | Ga0466960_0007519 | |||
| 2339 | Ga0466960_0011527 | |||
| 2340 | Ga0466960_0016613 | |||
| 2341 | Ga0466960_0280963 | |||
| 2342 | Ga0466960_0341575 | |||
| 2343 | Ga0466960_0636665 | |||
| 2344 | Ga0466959_0000507 | |||
| 2345 | Ga0466959_0456740 | |||
| 2346 | Ga0466959_0839745 | |||
| 2347 | Ga0451576_0789764 | |||
| 2348 | Ga0466958_0010466 | |||
| 2349 | Ga0466958_0146855 | |||
| 2350 | Ga0466958_0898824 | |||
| 2351 | Ga0466967_0005026 | |||
| 2352 | Ga0466967_0029175 | |||
| 2353 | Ga0466967_0045804 | |||
| 2354 | Ga0466967_0067268 | |||
| 2355 | Ga0466967_0081289 | |||
| 2356 | Ga0466967_0231381 | |||
| 2357 | Ga0466967_0252729 | |||
| 2358 | Ga0466967_0363519 | |||
| 2359 | Ga0466967_0584214 | |||
| 2360 | Ga0466967_0615417 | |||
| 2361 | Ga0466967_0939353 | |||
| 2362 | Ga0466967_0971458 | |||
| 2363 | Ga0466967_1117634 | |||
| 2364 | Ga0466967_1389603 | |||
| 2365 | Ga0466967_1479483 | |||
| 2366 | Ga0466967_1742535 | |||
| 2367 | Ga0495617_213429 | |||
| 2368 | Ga0495592_0149061 | |||
| 2369 | Ga0495629_0216853 | |||
| 2370 | Ga0495641_0156047 | |||
| 2371 | Ga0495641_0431782 | |||
| 2372 | Ga0495651_0000079 | |||
| 2373 | Ga0495653_0003879 | |||
| 2374 | Ga0495653_0475047 | |||
| 2375 | Ga0495582_0184918 | |||
| 2376 | Ga0495582_0237641 | |||
| 2377 | Ga0495639_0737129 | |||
| 2378 | Ga0495662_0475655 | |||
| 2379 | Ga0495664_0058669 | |||
| 2380 | Ga0495664_0314590 | |||
| 2381 | Ga0495607_0310115 | |||
| 2382 | Ga0495608_0305281 | |||
| 2383 | Ga0495608_0399435 | |||
| 2384 | Ga0495616_0158666 | |||
| 2385 | Ga0495620_0183825 | |||
| 2386 | Ga0495620_0233352 | |||
| 2387 | Ga0495631_0077678 | |||
| 2388 | Ga0495637_0219971 | |||
| 2389 | Ga0495663_0132797 | |||
| 2390 | Ga0495652_0003588 | |||
| 2391 | Ga0495587_0109041 | |||
| 2392 | Ga0495598_0111741 | |||
| 2393 | Ga0495598_0195773 | |||
| 2394 | Ga0495609_0250175 | |||
| 2395 | Ga0495609_0268829 | |||
| 2396 | Ga0495645_0059107 | |||
| 2397 | Ga0495645_0542076 | |||
| 2398 | Ga0495667_0769789 | |||
| 2399 | Ga0495656_0043278 | |||
| 2400 | Ga0495656_0244050 | |||
| 2401 | Ga0495668_0160408 | |||
| 2402 | Ga0495634_0033758 | |||
| 2403 | Ga0495611_0215002 | |||
| 2404 | Ga0495635_0002665 | |||
| 2405 | Ga0495635_0182110 | |||
| 2406 | Ga0495635_0293990 | |||
| 2407 | Ga0495659_0396631 | |||
| 2408 | Ga0495661_0484120 | |||
| 2409 | Ga0495623_0228214 | |||
| 2410 | Ga0495647_0155460 | |||
| 2411 | Ga0495658_0985627 | |||
| 2412 | Ga0495658_1001831 | |||
| 2413 | Ga0495658_1005295 | |||
| 2414 | Ga0495669_0616421 | |||
| 2415 | Ga0495669_0655641 | |||
| 2416 | Ga0495613_0331964 | |||
| 2417 | Ga0495613_0733140 | |||
| 2418 | Ga0495624_0184178 | |||
| 2419 | Ga0495670_0051441 | |||
| 2420 | Ga0495670_0217389 | |||
| 2421 | Ga0495671_0098607 | |||
| 2422 | Ga0495649_0387298 | |||
| 2423 | Ga0495600_0008443 | |||
| 2424 | Ga0495600_0171609 | |||
| 2425 | Ga0495600_0876464 | |||
| 2426 | Ga0495581_0443904 | |||
| 2427 | Ga0495581_0619403 | |||
| 2428 | Ga0495676_0829248 | |||
| 2429 | Ga0495680_0291954 | |||
| 2430 | Ga0495680_0898277 | |||
| 2431 | Ga0495680_1105983 | |||
| 2432 | Ga0495683_0122687 | |||
| 2433 | Ga0495679_193175 | |||
| 2434 | Ga0496100_0017456 | |||
| 2435 | Ga0496100_0226587 | |||
| 2436 | Ga0496100_0565868 | |||
| 2437 | Ga0496100_1016902 | |||
| 2438 | Ga0496100_1249913 | |||
| 2439 | Ga0496101_0070926 | |||
| 2440 | Ga0496101_0117874 | |||
| 2441 | Ga0496101_0138320 | |||
| 2442 | Ga0496101_0293802 | |||
| 2443 | Ga0496101_0577514 | |||
| 2444 | Ga0496101_0678755 | |||
| 2445 | Ga0496101_0970682 | |||
| 2446 | Ga0496101_1526655 | |||
| 2447 | Ga0496102_0009949 | |||
| 2448 | Ga0496102_0015093 | |||
| 2449 | Ga0496102_0123928 | |||
| 2450 | Ga0496102_0129045 | |||
| 2451 | Ga0496102_0236863 | |||
| 2452 | Ga0496102_0336690 | |||
| 2453 | Ga0496102_1007418 | |||
| 2454 | Ga0496102_1237875 | |||
| 2455 | Ga0496102_1408699 | |||
| 2456 | Ga0496102_1687167 | |||
| 2457 | Ga0496103_0077842 | |||
| 2458 | Ga0496103_0404688 | |||
| 2459 | Ga0496103_0943341 | |||
| 2460 | Ga0496104_0002251 | |||
| 2461 | Ga0496104_0839878 | |||
| 2462 | Ga0496105_0001445 | |||
| 2463 | Ga0496105_0444091 | |||
| 2464 | Ga0496105_0712931 | |||
| 2465 | Ga0496106_0145577 | |||
| 2466 | Ga0496106_0339949 | |||
| 2467 | Ga0496106_0668176 | |||
| 2468 | Ga0496106_0956741 | |||
| 2469 | Ga0496106_1490131 | |||
| 2470 | Ga0496107_0040691 | |||
| 2471 | Ga0496107_0082877 | |||
| 2472 | Ga0496107_0362836 | |||
| 2473 | Ga0496107_0418638 | |||
| 2474 | Ga0496107_0617340 | |||
| 2475 | Ga0496107_0646932 | |||
| 2476 | Ga0496107_0891784 | |||
| 2477 | Ga0496108_0023155 | |||
| 2478 | Ga0496108_0032768 | |||
| 2479 | Ga0496108_0192586 | |||
| 2480 | Ga0496108_0471467 | |||
| 2481 | Ga0496108_0618741 | |||
| 2482 | Ga0496108_0636239 | |||
| 2483 | Ga0496108_0953899 | |||
| 2484 | Ga0496108_1006250 | |||
| 2485 | Ga0496108_1217472 | |||
| 2486 | Ga0496109_0011825 | |||
| 2487 | Ga0496109_0018556 | |||
| 2488 | Ga0496109_0066214 | |||
| 2489 | Ga0496109_0073561 | |||
| 2490 | Ga0496109_0092134 | |||
| 2491 | Ga0496109_0435065 | |||
| 2492 | Ga0496109_0458040 | |||
| 2493 | Ga0496109_0469310 | |||
| 2494 | Ga0496109_0630366 | |||
| 2495 | Ga0496109_1249266 | |||
| 2496 | Ga0496110_0009095 | |||
| 2497 | Ga0496110_0062693 | |||
| 2498 | Ga0496110_0111825 | |||
| 2499 | Ga0496110_0138170 | |||
| 2500 | Ga0496110_1125418 | |||
| 2501 | Ga0496110_1276520 | |||
| 2502 | Ga0496110_1338079 | |||
| 2503 | Ga0496110_1371737 | |||
| 2504 | Ga0496111_0002908 | |||
| 2505 | Ga0496111_0081282 | |||
| 2506 | Ga0496111_0171692 | |||
| 2507 | Ga0496111_0188171 | |||
| 2508 | Ga0496111_0357272 | |||
| 2509 | Ga0496111_0430765 | |||
| 2510 | Ga0496111_0512930 | |||
| 2511 | Ga0496111_0786568 | |||
| 2512 | Ga0496111_0790208 | |||
| 2513 | Ga0496111_0877483 | |||
| 2514 | Ga0496111_1174909 | |||
| 2515 | Ga0496112_0209718 | |||
| 2516 | Ga0496112_0500081 | |||
| 2517 | Ga0496112_0663507 | |||
| 2518 | Ga0496112_1184511 | |||
| 2519 | Ga0496113_0082131 | |||
| 2520 | Ga0496113_0477004 | |||
| 2521 | Ga0496113_0578509 | |||
| 2522 | Ga0496114_0045834 | |||
| 2523 | Ga0496114_0053634 | |||
| 2524 | Ga0496114_0057334 | |||
| 2525 | Ga0496114_0161756 | |||
| 2526 | Ga0496114_0241626 | |||
| 2527 | Ga0496114_0328466 | |||
| 2528 | Ga0496114_0403540 | |||
| 2529 | Ga0496114_0467899 | |||
| 2530 | Ga0496114_0505345 | |||
| 2531 | Ga0496114_0549470 | |||
| 2532 | Ga0496114_0665936 | |||
| 2533 | Ga0496114_0841424 | |||
| 2534 | Ga0496114_0985004 | |||
| 2535 | Ga0496114_1080707 | |||
| 2536 | Ga0496114_1355387 | |||
| 2537 | Ga0496114_1746814 | |||
| 2538 | Ga0496115_0001053 | |||
| 2539 | Ga0496115_0294981 | |||
| 2540 | Ga0496124_0207881 | |||
| 2541 | Ga0496124_0916845 | |||
| 2542 | Ga0501307_034436 | |||
| 2543 | Ga0501291_036161 | |||
| 2544 | Ga0501311_027348 | |||
| 2545 | Ga0501311_107219 | |||
| 2546 | Ga0501323_055930 | |||
| 2547 | Ga0501324_027046 | |||
| 2548 | Ga0501031_0002572 | |||
| 2549 | Ga0501031_0055271 | |||
| 2550 | Ga0501031_0102489 | |||
| 2551 | Ga0501031_0114560 | |||
| 2552 | Ga0501031_0232391 | |||
| 2553 | Ga0501031_0458521 | |||
| 2554 | Ga0501031_0583582 | |||
| 2555 | Ga0501031_0822940 | |||
| 2556 | Ga0501031_0876639 | |||
| 2557 | Ga0501032_0001212 | |||
| 2558 | Ga0501032_0414597 | |||
| 2559 | Ga0501032_0565001 | |||
| 2560 | Ga0501032_0594548 | |||
| 2561 | Ga0501032_0646648 | |||
| 2562 | Ga0501033_0008061 | |||
| 2563 | Ga0501033_0131599 | |||
| 2564 | Ga0501033_0214508 | |||
| 2565 | Ga0501033_0570038 | |||
| 2566 | Ga0501033_0871309 | |||
| 2567 | Ga0501034_0006278 | |||
| 2568 | Ga0501034_0158844 | |||
| 2569 | Ga0501036_0008586 | |||
| 2570 | Ga0501036_0012956 | |||
| 2571 | Ga0501036_0019876 | |||
| 2572 | Ga0501036_0071186 | |||
| 2573 | Ga0501036_0196008 | |||
| 2574 | Ga0501036_0317640 | |||
| 2575 | Ga0501036_0370101 | |||
| 2576 | Ga0501036_0557629 | |||
| 2577 | Ga0501036_0773226 | |||
| 2578 | Ga0501036_1635440 | |||
| 2579 | Ga0501037_0000836 | |||
| 2580 | Ga0501037_0028438 | |||
| 2581 | Ga0501037_0104942 | |||
| 2582 | Ga0501037_0174556 | |||
| 2583 | Ga0501037_0247666 | |||
| 2584 | Ga0501037_0342779 | |||
| 2585 | Ga0501037_0368765 | |||
| 2586 | Ga0501037_0646738 | |||
| 2587 | Ga0501037_0669714 | |||
| 2588 | Ga0501038_0012780 | |||
| 2589 | Ga0501038_0099125 | |||
| 2590 | Ga0501038_0462595 | |||
| 2591 | Ga0501038_1045226 | |||
| 2592 | Ga0501039_0006931 | |||
| 2593 | Ga0501039_0007687 | |||
| 2594 | Ga0501039_0017109 | |||
| 2595 | Ga0501039_0218394 | |||
| 2596 | Ga0501039_0406298 | |||
| 2597 | Ga0501039_0443677 | |||
| 2598 | Ga0501039_0445896 | |||
| 2599 | Ga0501039_0789178 | |||
| 2600 | Ga0501039_0918402 | |||
| 2601 | Ga0501039_1212115 | |||
| 2602 | Ga0501039_1592677 | |||
| 2603 | Ga0501040_0007931 | |||
| 2604 | Ga0501040_0016197 | |||
| 2605 | Ga0501040_0090901 | |||
| 2606 | Ga0501040_0422601 | |||
| 2607 | Ga0501040_0779337 | |||
| 2608 | Ga0501040_0826673 | |||
| 2609 | Ga0501040_1143943 | |||
| 2610 | Ga0501041_0001518 | |||
| 2611 | Ga0501041_0015469 | |||
| 2612 | Ga0501041_0115663 | |||
| 2613 | Ga0501041_0126443 | |||
| 2614 | Ga0501041_0187938 | |||
| 2615 | Ga0501041_0222281 | |||
| 2616 | Ga0501041_0616911 | |||
| 2617 | Ga0501041_0760679 | |||
| 2618 | Ga0501042_0015097 | |||
| 2619 | Ga0501042_0038752 | |||
| 2620 | Ga0501042_0103321 | |||
| 2621 | Ga0501042_0503196 | |||
| 2622 | Ga0501042_1315790 | |||
| 2623 | Ga0501043_0005580 | |||
| 2624 | Ga0501043_0040260 | |||
| 2625 | Ga0501043_1006288 | |||
| 2626 | Ga0501046_0015697 | |||
| 2627 | Ga0501046_0035677 | |||
| 2628 | Ga0501046_0746690 | |||
| 2629 | Ga0501046_0958577 | |||
| 2630 | Ga0501046_1072862 | |||
| 2631 | Ga0501047_0000072 | |||
| 2632 | Ga0501047_0001607 | |||
| 2633 | Ga0501047_0367951 | |||
| 2634 | Ga0501048_0015295 | |||
| 2635 | Ga0501048_0092611 | |||
| 2636 | Ga0501048_0184517 | |||
| 2637 | Ga0501048_0191308 | |||
| 2638 | Ga0501048_0474050 | |||
| 2639 | Ga0501048_1076913 | |||
| 2640 | Ga0501067_0002181 | |||
| 2641 | Ga0501067_0004018 | |||
| 2642 | Ga0501067_0013763 | |||
| 2643 | Ga0501067_0058965 | |||
| 2644 | Ga0501067_0185940 | |||
| 2645 | Ga0501067_0199998 | |||
| 2646 | Ga0501067_0208202 | |||
| 2647 | Ga0501067_0245086 | |||
| 2648 | Ga0501067_0341939 | |||
| 2649 | Ga0501067_0418626 | |||
| 2650 | Ga0501068_0003236 | |||
| 2651 | Ga0501068_0018233 | |||
| 2652 | Ga0501068_0047246 | |||
| 2653 | Ga0501068_0051891 | |||
| 2654 | Ga0501068_0082305 | |||
| 2655 | Ga0501068_0418334 | |||
| 2656 | Ga0501068_0496504 | |||
| 2657 | Ga0501069_0003896 | |||
| 2658 | Ga0501069_0069416 | |||
| 2659 | Ga0501069_0075648 | |||
| 2660 | Ga0501069_0105900 | |||
| 2661 | Ga0501069_0108318 | |||
| 2662 | Ga0501069_0126822 | |||
| 2663 | Ga0501069_0225420 | |||
| 2664 | Ga0501069_0232788 | |||
| 2665 | Ga0501069_0291900 | |||
| 2666 | Ga0501069_0641964 | |||
| 2667 | Ga0501069_0805429 | |||
| 2668 | Ga0501069_0807536 | |||
| 2669 | Ga0501070_0001680 | |||
| 2670 | Ga0501070_0002630 | |||
| 2671 | Ga0501070_0008861 | |||
| 2672 | Ga0501070_0022760 | |||
| 2673 | Ga0501070_0180153 | |||
| 2674 | Ga0501070_0381976 | |||
| 2675 | Ga0501070_0439120 | |||
| 2676 | Ga0501070_0539223 | |||
| 2677 | Ga0501070_0580035 | |||
| 2678 | Ga0501070_0747712 | |||
| 2679 | Ga0501071_0000108 | |||
| 2680 | Ga0501071_0001602 | |||
| 2681 | Ga0501071_0081711 | |||
| 2682 | Ga0501071_0110608 | |||
| 2683 | Ga0501071_0150375 | |||
| 2684 | Ga0501071_0272135 | |||
| 2685 | Ga0501071_0554806 | |||
| 2686 | Ga0501071_0801199 | |||
| 2687 | Ga0501071_1041602 | |||
| 2688 | Ga0501071_1098280 | |||
| 2689 | Ga0501071_1473934 | |||
| 2690 | Ga0501072_0001898 | |||
| 2691 | Ga0501072_0042055 | |||
| 2692 | Ga0501072_0065449 | |||
| 2693 | Ga0501072_0084578 | |||
| 2694 | Ga0501072_0790243 | |||
| 2695 | Ga0501072_1380020 | |||
| 2696 | Ga0501073_0004339 | |||
| 2697 | Ga0501073_0008201 | |||
| 2698 | Ga0501073_0009415 | |||
| 2699 | Ga0501073_0170287 | |||
| 2700 | Ga0501073_1160285 | |||
| 2701 | Ga0501074_0000517 | |||
| 2702 | Ga0501074_0014007 | |||
| 2703 | Ga0501074_0033398 | |||
| 2704 | Ga0501074_0102899 | |||
| 2705 | Ga0501074_0286234 | |||
| 2706 | Ga0501074_0388369 | |||
| 2707 | Ga0501074_0647778 | |||
| 2708 | Ga0501075_0090711 | |||
| 2709 | Ga0501075_0274446 | |||
| 2710 | Ga0501075_0566983 | |||
| 2711 | Ga0501075_0668492 | |||
| 2712 | Ga0501075_0862178 | |||
| 2713 | Ga0501075_0902399 | |||
| 2714 | Ga0501076_0003333 | |||
| 2715 | Ga0501076_0051564 | |||
| 2716 | Ga0501076_0078789 | |||
| 2717 | Ga0501076_0517229 | |||
| 2718 | Ga0501076_0679460 | |||
| 2719 | Ga0501076_1005584 | |||
| 2720 | Ga0501077_0003084 | |||
| 2721 | Ga0501077_0012750 | |||
| 2722 | Ga0501077_0023052 | |||
| 2723 | Ga0501077_0071766 | |||
| 2724 | Ga0501077_0199282 | |||
| 2725 | Ga0501202_026952 | |||
| 2726 | Ga0501202_082951 | |||
| 2727 | Ga0501206_049981 | |||
| 2728 | Ga0501217_033097 | |||
| 2729 | Ga0501243_017725 | |||
| 2730 | Ga0501079_0007167 | |||
| 2731 | Ga0501079_0012242 | |||
| 2732 | Ga0501079_0049083 | |||
| 2733 | Ga0501079_0208952 | |||
| 2734 | Ga0501079_0688790 | |||
| 2735 | Ga0501079_0743481 | |||
| 2736 | Ga0501079_1277114 | |||
| 2737 | Ga0501079_1283680 | |||
| 2738 | Ga0501080_0000361 | |||
| 2739 | Ga0501080_0004573 | |||
| 2740 | Ga0501080_0087116 | |||
| 2741 | Ga0501080_0121371 | |||
| 2742 | Ga0501080_0644486 | |||
| 2743 | Ga0501081_0010183 | |||
| 2744 | Ga0501081_0318181 | |||
| 2745 | Ga0501083_0005579 | |||
| 2746 | Ga0501083_0246691 | |||
| 2747 | Ga0501083_0918029 | |||
| 2748 | Ga0501083_0977183 | |||
| 2749 | Ga0501271_013784 | |||
| 2750 | Ga0501035_0005086 | |||
| 2751 | Ga0501035_0554317 | |||
| 2752 | Ga0501035_0999873 | |||
| 2753 | Ga0501044_0005927 | |||
| 2754 | Ga0501044_0158949 | |||
| 2755 | Ga0501044_0432368 | |||
| 2756 | Ga0501044_0564339 | |||
| 2757 | Ga0501044_0817724 | |||
| 2758 | Ga0501044_1198377 | |||
| 2759 | Ga0501044_1364078 | |||
| 2760 | Ga0501044_1471594 | |||
| 2761 | Ga0501045_0014996 | |||
| 2762 | Ga0501045_0146406 | |||
| 2763 | Ga0501045_0170785 | |||
| 2764 | Ga0501045_0367052 | |||
| 2765 | Ga0501045_0938898 | |||
| 2766 | Ga0501045_1026408 | |||
| 2767 | Ga0501045_1244408 | |||
| 2768 | Ga0501212_069666 | |||
| 2769 | nmdc:mga03683_121919_c1 | |||
| 2770 | nmdc:mga03683_91187_c1 | |||
| 2771 | nmdc:mga03n38_23326_c1 | |||
| 2772 | nmdc:mga03n38_27426_c1 | |||
| 2773 | nmdc:mga03n38_301779_c1 | |||
| 2774 | nmdc:mga03n38_470672_c1 | |||
| 2775 | nmdc:mga03n38_624460_c1 | |||
| 2776 | nmdc:mga00v17_126040_c1 | |||
| 2777 | nmdc:mga00v17_131259_c1 | |||
| 2778 | nmdc:mga00v17_153617_c1 | |||
| 2779 | nmdc:mga00v17_195991_c1 | |||
| 2780 | nmdc:mga00v17_26578_c1 | |||
| 2781 | nmdc:mga00v17_26998_c1 | |||
| 2782 | nmdc:mga00v17_282229_c1 | |||
| 2783 | nmdc:mga00v17_89688_c1 | |||
| 2784 | nmdc:mga00v17_915528_c1 | |||
| 2785 | nmdc:mga0yw44_1064139_c1 | |||
| 2786 | nmdc:mga0yw44_107708_c1 | |||
| 2787 | nmdc:mga0yw44_115859_c1 | |||
| 2788 | nmdc:mga0yw44_142047_c1 | |||
| 2789 | nmdc:mga0yw44_189355_c1 | |||
| 2790 | nmdc:mga0yw44_196086_c1 | |||
| 2791 | nmdc:mga0yw44_23011_c1 | |||
| 2792 | nmdc:mga0yw44_276036_c1 | |||
| 2793 | nmdc:mga0yw44_39590_c1 | |||
| 2794 | nmdc:mga0yw44_427423_c1 | |||
| 2795 | nmdc:mga0yw44_429_c1 | |||
| 2796 | nmdc:mga0yw44_51107_c1 | |||
| 2797 | nmdc:mga0yw44_519998_c1 | |||
| 2798 | nmdc:mga0yw44_553324_c1 | |||
| 2799 | nmdc:mga0yw44_57912_c1 | |||
| 2800 | nmdc:mga0yw44_69910_c1 | |||
| 2801 | nmdc:mga06z11_16557_c1 | |||
| 2802 | nmdc:mga06z11_285866_c1 | |||
| 2803 | nmdc:mga06z11_482484_c1 | |||
| 2804 | nmdc:mga06z11_700670_c1 | |||
| 2805 | nmdc:mga04h51_447460_c1 | |||
| 2806 | nmdc:mga04h51_495640_c1 | |||
| 2807 | nmdc:mga04h51_5000_c1 | |||
| 2808 | nmdc:mga04h51_9575_c1 | |||
| 2809 | nmdc:mga07m45_122922_c1 | |||
| 2810 | nmdc:mga07m45_55078_c1 | |||
| 2811 | nmdc:mga07m45_866533_c1 | |||
| 2812 | nmdc:mga05p37_406788_c1 | |||
| 2813 | nmdc:mga05p37_986830_c1 | |||
| 2814 | nmdc:mga09592_630062_c1 | |||
| 2815 | nmdc:mga09592_873617_c1 | |||
| 2816 | nmdc:mga0qj67_251663_c1 | |||
| 2817 | nmdc:mga0qj67_562005_c1 | |||
| 2818 | nmdc:mga06r32_14124_c1 | |||
| 2819 | nmdc:mga08y16_1156544_c1 | |||
| 2820 | nmdc:mga08y16_13951_c1 | |||
| 2821 | nmdc:mga08y16_1685327_c1 | |||
| 2822 | nmdc:mga08y16_545864_c2 | |||
| 2823 | nmdc:mga08y16_63660_c1 | |||
| 2824 | nmdc:mga0n895_1057137_c1 | |||
| 2825 | nmdc:mga0n895_535_c1 | |||
| 2826 | nmdc:mga0rr50_184510_c1 | |||
| 2827 | nmdc:mga0rr50_231255_c1 | |||
| 2828 | nmdc:mga08x19_1032_c1 | |||
| 2829 | nmdc:mga0a205_7445_c1 | |||
| 2830 | Ga0495601_0264047 | |||
| 2831 | Ga0495601_0844181 | |||
| 2832 | Ga0495612_0003302 | |||
| 2833 | Ga0500635_0308542 | |||
| 2834 | Ga0495595_0230920 | |||
| 2835 | Ga0495595_0302999 | |||
| 2836 | Ga0495619_0092261 | |||
| 2837 | Ga0495619_0182301 | |||
| 2838 | Ga0495619_0689573 | |||
| 2839 | Ga0500644_0000489 | |||
| 2840 | Ga0500644_0037984 | |||
| 2841 | Ga0500644_0260939 | |||
| 2842 | Ga0500554_147461 | |||
| 2843 | Ga0500593_000592 | |||
| 2844 | Ga0500628_148609 | |||
| 2845 | Ga0500559_0551658 | |||
| 2846 | Ga0500568_0107630 | |||
| 2847 | Ga0500573_0030403 | |||
| 2848 | Ga0500573_0107734 | |||
| 2849 | Ga0500573_0311348 | |||
| 2850 | Ga0500620_083656 | |||
| 2851 | Ga0501084_0004130 | |||
| 2852 | Ga0501084_0028629 | |||
| 2853 | Ga0501084_0059413 | |||
| 2854 | Ga0501084_0148023 | |||
| 2855 | Ga0501084_0465464 | |||
| 2856 | Ga0501084_1423975 | |||
| 2857 | Ga0590077_062731 | |||
| 2858 | Ga0587091_171231 | |||
| 2859 | Ga0587128_147832 | |||
| 2860 | Ga0587107_133361 | |||
| 2861 | Ga0501082_0008254 | |||
| 2862 | Ga0501082_0059879 | |||
| 2863 | Ga0501082_0062182 | |||
| 2864 | Ga0501082_0127882 | |||
| 2865 | Ga0501082_0141089 | |||
| 2866 | Ga0501082_0620617 | |||
| 2867 | Ga0501082_1174118 | |||
| 2868 | Ga0501082_1877407 | |||
| 2869 | Ga0466962_0003215 | |||
| 2870 | Ga0466962_0009228 | |||
| 2871 | Ga0466962_0049410 | |||
| 2872 | Ga0466962_0058613 | |||
| 2873 | Ga0530510_0069190 | |||
| 2874 | Ga0530510_0085801 | |||
| 2875 | Ga0530510_0146581 | |||
| 2876 | Ga0530510_0149633 | |||
| 2877 | Ga0530510_0259482 | |||
| 2878 | Ga0530510_0313246 | |||
| 2879 | Ga0530510_0644395 | |||
| 2880 | Ga0530510_0687048 | |||
| 2881 | Ga0530510_0929809 | |||
| 2882 | Ga0530510_1336131 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dwm-assembly2.cif.gz_B | crystal structure of mycobacterium tuberculosis cyso, an antigen | 0.9812 | 3 | 88 |
| 4n6e-assembly1.cif.gz_B-2 | crystal structure of amycolatopsis orientalis bexx/cyso complex | 0.9502 | 3 | 91 |
| 3dwm-assembly2.cif.gz_B | crystal structure of mycobacterium tuberculosis cyso, an antigen | 0.9382 | 3 | 88 |
| 4n6e-assembly1.cif.gz_B-2 | crystal structure of amycolatopsis orientalis bexx/cyso complex | 0.9296 | 3 | 91 |
| 1v8c-assembly1.cif.gz_A | crystal structure of moad related protein from thermus thermophilus hb8 | 0.9026 | 4 | 88 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4n6eB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9502 | 3 | 91 | 3.10.20.30 |
| 4n6eB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9296 | 3 | 91 | 3.10.20.30 |
| 1v8cB01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8729 | 4 | 86 | 3.10.20.30 |
| 1v8cB01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8448 | 4 | 86 | 3.10.20.30 |
| 4hroA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8374 | 2 | 88 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B3IN31-F1-model_v4 | MoaD/ThiS family protein | 1.003 | 1 | 88 |
|
| AF-A0A4V2XVV1-F1-model_v4 | MoaD/ThiS family protein | 1 | 1 | 78 |
|
| AF-A0A6B3IN31-F1-model_v4 | MoaD/ThiS family protein | 0.9916 | 1 | 88 |
|
| AF-X8F476-F1-model_v4 | deleted | 0.9895 | 1 | 91 |
|
| AF-A0A1Q7QFQ2-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9886 | 1 | 90 |
|