F493991

General Info

Members Datasets Scaffolds Average Seq Length
1441 420 2882 92

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0767818|Ga0501040_0767818_18_356
Length 112
Sequence VSAPAEPDIVETLGPKETVHMSVSVRIPTILRTYTGGESEVSAQGATLAEVLDDLESNYSGIKARILDEQGSIRRFVNVYVGNDDVRFLDSLDTKTPEGVQVSVIPAVAGGS

Samples

Sample ID Description Type Environment
1 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
106 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
107 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
108 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
109 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
110 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
111 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
112 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
113 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
131 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
136 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
191 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
197 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
198 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
199 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
200 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
201 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
214 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
215 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
216 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
217 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
218 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
228 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
229 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
230 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
231 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
232 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
233 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
234 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
235 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
236 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
237 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
238 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
239 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
240 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
241 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
242 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
243 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
244 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
245 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
246 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
247 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
248 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
249 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
250 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
251 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
252 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
253 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
254 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
255 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
256 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
257 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
258 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
259 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
260 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
261 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
262 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
263 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
264 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
265 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
266 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
267 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
268 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
269 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
270 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
271 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
272 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
273 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
274 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
275 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
276 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
277 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
278 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
279 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
280 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
281 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
282 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
283 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
284 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
285 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
286 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
287 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
288 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
289 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
290 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
291 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
292 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
293 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
294 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
295 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
296 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
297 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
298 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
299 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
300 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
301 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
302 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
303 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
304 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
305 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
306 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
307 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
308 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
309 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
310 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
311 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
312 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
313 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
314 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
315 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
316 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
317 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
318 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
319 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
320 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
321 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
322 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
323 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
324 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
325 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
326 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
327 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
328 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
329 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
330 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
331 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
332 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
333 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
334 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
335 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
336 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
337 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
338 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
339 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
340 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
341 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
343 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
361 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
362 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
363 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
364 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
365 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
366 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
367 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
368 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
369 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
370 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
371 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
372 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
373 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
374 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
375 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
376 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
377 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
378 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
379 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
380 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
384 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
385 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
386 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
387 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
388 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
389 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
390 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
391 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
392 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
393 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
394 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
395 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
396 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
397 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
398 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
399 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
400 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
401 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
402 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
403 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
404 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
405 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
406 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
407 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
408 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
409 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
410 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
411 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
412 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
413 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
414 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
415 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
419 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
420 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 1.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.15
Nodule 0
Rhizoplane 8.26
Rhizosphere 83
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501040_0767818 3300049576 Bacteria 697
2 JGI24738J21930_10130572 3300002075 Bacteria 550
3 JGI24738J21930_10132898 3300002075 Bacteria 546
4 JGI24749J21850_1028970 3300002076 Bacteria 792
5 JGI25406J46586_10095658 3300003203 Bacteria 890
6 rootH1_10021847 3300003323 Bacteria 5080
7 Ga0007429J51699_1061575 3300003579 Bacteria 578
8 JGI25405J52794_10017062 3300003911 Bacteria 1439
9 Ga0070658_10086969 3300005327 Bacteria 2572
10 Ga0070676_10253832 3300005328 Bacteria 1175
11 Ga0070676_11083428 3300005328 Bacteria 605
12 Ga0070676_11532281 3300005328 Bacteria 514
13 Ga0070683_100009719 3300005329 Bacteria 8236
14 Ga0070683_100233458 3300005329 Bacteria 1749
15 Ga0070683_100285940 3300005329 Bacteria 1568
16 Ga0070683_100370449 3300005329 Bacteria 1364
17 Ga0070683_100512918 3300005329 Bacteria 1146
18 Ga0070683_100650643 3300005329 Bacteria 1009
19 Ga0070683_100671788 3300005329 Bacteria 992
20 Ga0070683_101406190 3300005329 Bacteria 670
21 Ga0068869_100365160 3300005334 Bacteria 1180
22 Ga0068869_100627468 3300005334 Bacteria 910
23 Ga0070666_10524548 3300005335 Bacteria 860
24 Ga0070680_100187462 3300005336 Bacteria 1743
25 Ga0070682_100015312 3300005337 Bacteria 4441
26 Ga0070682_100034835 3300005337 Bacteria 3069
27 Ga0070682_100102526 3300005337 Bacteria 1891
28 Ga0070682_101750246 3300005337 Bacteria 541
29 Ga0070682_101983347 3300005337 Bacteria 512
30 Ga0068868_100197708 3300005338 Bacteria 1674
31 Ga0068868_101052334 3300005338 Bacteria 747
32 Ga0068868_101506457 3300005338 Bacteria 630
33 Ga0070660_100008562 3300005339 Bacteria 7163
34 Ga0070660_100018998 3300005339 Bacteria 5031
35 Ga0070660_100086786 3300005339 Bacteria 2462
36 Ga0070660_101694516 3300005339 Bacteria 538
37 Ga0070660_101874927 3300005339 Bacteria 511
38 Ga0070660_101912647 3300005339 Bacteria 506
39 Ga0070691_10052760 3300005341 Bacteria 1944
40 Ga0070691_10244347 3300005341 Bacteria 960
41 Ga0070691_10672253 3300005341 Bacteria 619
42 Ga0070687_100053556 3300005343 Bacteria 2099
43 Ga0070687_101078732 3300005343 Bacteria 586
44 Ga0070687_101210565 3300005343 Bacteria 557
45 Ga0070661_101525808 3300005344 Bacteria 564
46 Ga0070692_10095330 3300005345 Bacteria 1623
47 Ga0070692_10388353 3300005345 Bacteria 878
48 Ga0070692_10489549 3300005345 Bacteria 795
49 Ga0070692_10964769 3300005345 Bacteria 594
50 Ga0070668_100112162 3300005347 Bacteria 2171
51 Ga0070668_100188181 3300005347 Bacteria 1690
52 Ga0070668_100358002 3300005347 Bacteria 1237
53 Ga0070668_100568034 3300005347 Bacteria 989
54 Ga0070668_101673572 3300005347 Bacteria 584
55 Ga0070675_100098713 3300005354 Bacteria 2457
56 Ga0070675_100343268 3300005354 Bacteria 1323
57 Ga0070675_101514669 3300005354 Bacteria 619
58 Ga0070671_100401955 3300005355 Bacteria 1172
59 Ga0070674_100076977 3300005356 Bacteria 2373
60 Ga0070674_100097774 3300005356 Bacteria 2133
61 Ga0070674_100701608 3300005356 Bacteria 865
62 Ga0070674_101302839 3300005356 Bacteria 648
63 Ga0070674_101336798 3300005356 Bacteria 640
64 Ga0070673_100831751 3300005364 Bacteria 854
65 Ga0070673_102121210 3300005364 Bacteria 534
66 Ga0070688_100096811 3300005365 Bacteria 1939
67 Ga0070688_100387983 3300005365 Bacteria 1031
68 Ga0070659_100016719 3300005366 Bacteria 5511
69 Ga0070659_100032751 3300005366 Bacteria 4033
70 Ga0070659_100195515 3300005366 Bacteria 1663
71 Ga0070659_100342419 3300005366 Bacteria 1253
72 Ga0070659_100478383 3300005366 Bacteria 1059
73 Ga0070659_100485414 3300005366 Bacteria 1052
74 Ga0070659_100867386 3300005366 Bacteria 787
75 Ga0070667_100694735 3300005367 Bacteria 941
76 Ga0070667_102109327 3300005367 Bacteria 531
77 Ga0070714_100023518 3300005435 Bacteria 5065
78 Ga0070701_10066850 3300005438 Bacteria 1911
79 Ga0070701_10260346 3300005438 Bacteria 1051
80 Ga0070701_10661069 3300005438 Bacteria 699
81 Ga0070700_100035874 3300005441 Bacteria 3004
82 Ga0070700_100194691 3300005441 Bacteria 1420
83 Ga0070700_100242287 3300005441 Bacteria 1289
84 Ga0070700_100924102 3300005441 Bacteria 712
85 Ga0070700_101254718 3300005441 Bacteria 621
86 Ga0070700_101697630 3300005441 Bacteria 542
87 Ga0070708_100765853 3300005445 Bacteria 908
88 Ga0070663_100299871 3300005455 Bacteria 1286
89 Ga0070663_100813679 3300005455 Bacteria 802
90 Ga0070678_100153525 3300005456 Bacteria 1857
91 Ga0070678_100179670 3300005456 Bacteria 1731
92 Ga0070678_100192177 3300005456 Bacteria 1679
93 Ga0070678_100832039 3300005456 Bacteria 840
94 Ga0070662_100242805 3300005457 Bacteria 1445
95 Ga0070662_101204002 3300005457 Bacteria 651
96 Ga0070681_10452716 3300005458 Bacteria 1196
97 Ga0068867_100004521 3300005459 Bacteria 9776
98 Ga0068867_100042397 3300005459 Bacteria 3329
99 Ga0068867_100565142 3300005459 Bacteria 987
100 Ga0068867_100693724 3300005459 Bacteria 898
101 Ga0068867_101229218 3300005459 Bacteria 689
102 Ga0070685_10244037 3300005466 Bacteria 1187
103 Ga0070685_11294109 3300005466 Bacteria 557
104 Ga0070685_11509660 3300005466 Bacteria 518
105 Ga0070707_100110080 3300005468 Bacteria 2671
106 Ga0070698_100001109 3300005471 Bacteria 29696
107 Ga0070698_100669749 3300005471 Bacteria 979
108 Ga0070699_100515279 3300005518 Bacteria 1087
109 Ga0070679_100009296 3300005530 Bacteria 9290
110 Ga0070679_100426360 3300005530 Bacteria 1272
111 Ga0070679_101515074 3300005530 Bacteria 618
112 Ga0070684_100009955 3300005535 Bacteria 7516
113 Ga0070684_100177218 3300005535 Bacteria 1937
114 Ga0070684_100202630 3300005535 Bacteria 1808
115 Ga0070684_100320923 3300005535 Bacteria 1423
116 Ga0070684_100356396 3300005535 Bacteria 1346
117 Ga0070684_100423642 3300005535 Bacteria 1229
118 Ga0070684_101588590 3300005535 Bacteria 617
119 Ga0070684_102339418 3300005535 Bacteria 504
120 Ga0068853_100276012 3300005539 Bacteria 1549
121 Ga0068853_100529227 3300005539 Bacteria 1115
122 Ga0068853_100864006 3300005539 Bacteria 868
123 Ga0068853_101087352 3300005539 Bacteria 771
124 Ga0068853_101467531 3300005539 Bacteria 660
125 Ga0070672_100134831 3300005543 Bacteria 2033
126 Ga0070672_100640587 3300005543 Bacteria 928
127 Ga0070672_101826239 3300005543 Bacteria 547
128 Ga0070686_100165300 3300005544 Bacteria 1561
129 Ga0070696_101249112 3300005546 Bacteria 629
130 Ga0070693_100203066 3300005547 Bacteria 1288
131 Ga0070693_100319411 3300005547 Bacteria 1053
132 Ga0070693_100330313 3300005547 Bacteria 1037
133 Ga0070693_100948249 3300005547 Bacteria 648
134 Ga0070693_101499802 3300005547 Bacteria 527
135 Ga0070665_100004100 3300005548 Bacteria 15326
136 Ga0070665_100262563 3300005548 Bacteria 1728
137 Ga0070704_101491345 3300005549 Bacteria 622
138 Ga0068855_100067295 3300005563 Bacteria 4174
139 Ga0068855_100637333 3300005563 Bacteria 1146
140 Ga0068855_100972915 3300005563 Bacteria 893
141 Ga0070664_100048998 3300005564 Bacteria 3572
142 Ga0070664_100387908 3300005564 Bacteria 1276
143 Ga0070664_100716569 3300005564 Bacteria 933
144 Ga0070664_102034625 3300005564 Bacteria 545
145 Ga0068857_100004625 3300005577 Bacteria 11660
146 Ga0068857_101209237 3300005577 Bacteria 732
147 Ga0068854_100217223 3300005578 Bacteria 1511
148 Ga0068854_100293169 3300005578 Bacteria 1313
149 Ga0068854_101246697 3300005578 Bacteria 668
150 Ga0068854_101337843 3300005578 Bacteria 646
151 Ga0068854_101700591 3300005578 Bacteria 577
152 Ga0068856_100433202 3300005614 Bacteria 1335
153 Ga0068856_101078897 3300005614 Bacteria 821
154 Ga0068856_101332623 3300005614 Bacteria 733
155 Ga0068856_101950798 3300005614 Bacteria 598
156 Ga0070702_100048120 3300005615 Bacteria 2425
157 Ga0070702_100647182 3300005615 Bacteria 799
158 Ga0070702_101249905 3300005615 Bacteria 601
159 Ga0068852_100074976 3300005616 Bacteria 2982
160 Ga0068852_100769180 3300005616 Bacteria 976
161 Ga0068852_101730810 3300005616 Bacteria 648
162 Ga0068852_102497043 3300005616 Bacteria 537
163 Ga0068859_101245350 3300005617 Bacteria 820
164 Ga0068859_102178260 3300005617 Bacteria 612
165 Ga0068864_100193021 3300005618 Bacteria 1868
166 Ga0068864_100204698 3300005618 Bacteria 1815
167 Ga0068864_101372735 3300005618 Bacteria 708
168 Ga0068866_10045752 3300005718 Bacteria 2197
169 Ga0068866_10154966 3300005718 Bacteria 1331
170 Ga0068866_10571426 3300005718 Bacteria 759
171 Ga0068866_10610339 3300005718 Bacteria 738
172 Ga0068861_100036116 3300005719 Bacteria 3665
173 Ga0068861_100081817 3300005719 Bacteria 2529
174 Ga0068861_100163603 3300005719 Bacteria 1838
175 Ga0068861_100467399 3300005719 Bacteria 1133
176 Ga0068861_101167191 3300005719 Bacteria 743
177 Ga0068861_102571693 3300005719 Bacteria 513
178 Ga0068870_10016336 3300005840 Bacteria 3544
179 Ga0068870_10320545 3300005840 Bacteria 985
180 Ga0068863_101179603 3300005841 Bacteria 771
181 Ga0068858_100045587 3300005842 Bacteria 4064
182 Ga0068858_100565027 3300005842 Bacteria 1102
183 Ga0068858_101554333 3300005842 Bacteria 653
184 Ga0068858_102121129 3300005842 Bacteria 556
185 Ga0068860_100000237 3300005843 Bacteria 84631
186 Ga0068860_100386785 3300005843 Bacteria 1382
187 Ga0068862_100198936 3300005844 Bacteria 1806
188 Ga0068862_100853033 3300005844 Bacteria 893
189 Ga0068862_101655450 3300005844 Bacteria 648
190 Ga0068862_102163729 3300005844 Bacteria 567
191 Ga0068862_102564985 3300005844 Bacteria 521
192 Ga0081455_10005211 3300005937 Bacteria 14299
193 Ga0081455_10006193 3300005937 Bacteria 12899
194 Ga0081455_10031416 3300005937 Bacteria 4806
195 Ga0081538_10000428 3300005981 Bacteria 47270
196 Ga0081539_10047241 3300005985 Bacteria 2460
197 Ga0075365_10006292 3300006038 Bacteria 6517
198 Ga0075365_10017380 3300006038 Bacteria 4399
199 Ga0075365_10024864 3300006038 Bacteria 3785
200 Ga0075365_10031622 3300006038 Bacteria 3396
201 Ga0075365_10046184 3300006038 Bacteria 2859
202 Ga0075365_10116200 3300006038 Bacteria 1842
203 Ga0075365_10161190 3300006038 Bacteria 1563
204 Ga0075365_10171543 3300006038 Bacteria 1514
205 Ga0075365_10201112 3300006038 Bacteria 1395
206 Ga0075365_10307301 3300006038 Bacteria 1116
207 Ga0075365_10315598 3300006038 Bacteria 1100
208 Ga0075365_10405045 3300006038 Bacteria 963
209 Ga0075365_10440853 3300006038 Bacteria 920
210 Ga0075365_10941560 3300006038 Bacteria 609
211 Ga0075365_11005309 3300006038 Bacteria 588
212 Ga0075365_11228441 3300006038 Bacteria 527
213 Ga0075365_11292786 3300006038 Bacteria 512
214 Ga0075368_10001919 3300006042 Bacteria 6687
215 Ga0075368_10003530 3300006042 Bacteria 5235
216 Ga0075368_10023996 3300006042 Bacteria 2333
217 Ga0075363_100003768 3300006048 Bacteria 6531
218 Ga0075363_100022968 3300006048 Bacteria 3157
219 Ga0075363_100234505 3300006048 Bacteria 1054
220 Ga0075363_100268834 3300006048 Bacteria 984
221 Ga0075363_100315434 3300006048 Bacteria 909
222 Ga0075363_100500199 3300006048 Bacteria 722
223 Ga0075364_10025977 3300006051 Bacteria 3732
224 Ga0075364_10081863 3300006051 Bacteria 2135
225 Ga0075364_10099101 3300006051 Bacteria 1939
226 Ga0075364_10148513 3300006051 Bacteria 1579
227 Ga0075364_10192118 3300006051 Bacteria 1383
228 Ga0075364_10241276 3300006051 Bacteria 1228
229 Ga0075432_10002344 3300006058 Bacteria 6311
230 Ga0075432_10006679 3300006058 Bacteria 3928
231 Ga0075432_10146408 3300006058 Bacteria 904
232 Ga0075432_10530377 3300006058 Bacteria 529
233 Ga0075362_10014354 3300006177 Bacteria 3195
234 Ga0075362_10083712 3300006177 Bacteria 1473
235 Ga0075362_10349564 3300006177 Bacteria 740
236 Ga0075367_10046982 3300006178 Bacteria 2538
237 Ga0075367_10154403 3300006178 Bacteria 1426
238 Ga0075367_10336740 3300006178 Bacteria 951
239 Ga0075366_10592548 3300006195 Bacteria 687
240 Ga0097621_100427321 3300006237 Bacteria 1190
241 Ga0097621_100624168 3300006237 Bacteria 987
242 Ga0097621_100625578 3300006237 Bacteria 986
243 Ga0097621_101908630 3300006237 Bacteria 567
244 Ga0075370_10032500 3300006353 Bacteria 2918
245 Ga0075370_10037500 3300006353 Bacteria 2726
246 Ga0075370_10053867 3300006353 Bacteria 2283
247 Ga0075370_10646666 3300006353 Bacteria 642
248 Ga0075370_10797714 3300006353 Bacteria 576
249 Ga0068871_100589516 3300006358 Bacteria 1010
250 Ga0068871_100737388 3300006358 Bacteria 905
251 Ga0075428_100024363 3300006844 Bacteria 6697
252 Ga0075428_100130269 3300006844 Bacteria 2736
253 Ga0075428_100582980 3300006844 Bacteria 1195
254 Ga0075428_100659286 3300006844 Bacteria 1116
255 Ga0075428_101702835 3300006844 Bacteria 658
256 Ga0075430_101699776 3300006846 Bacteria 518
257 Ga0075431_100027797 3300006847 Bacteria 5805
258 Ga0075433_10008034 3300006852 Bacteria 8402
259 Ga0075433_10019906 3300006852 Bacteria 5602
260 Ga0075434_100000790 3300006871 Bacteria 25014
261 Ga0075434_100018722 3300006871 Bacteria 6692
262 Ga0075429_100039533 3300006880 Bacteria 4105
263 Ga0068865_100009130 3300006881 Bacteria 6138
264 Ga0068865_100013158 3300006881 Bacteria 5222
265 Ga0068865_100213986 3300006881 Bacteria 1503
266 Ga0068865_100564032 3300006881 Bacteria 958
267 Ga0068865_101241414 3300006881 Bacteria 661
268 Ga0075436_100070655 3300006914 Bacteria 2414
269 Ga0075436_100109664 3300006914 Bacteria 1926
270 Ga0097620_101245337 3300006931 Bacteria 820
271 Ga0097620_102177941 3300006931 Bacteria 612
272 Ga0075435_100004534 3300007076 Bacteria 9553
273 Ga0075435_100010687 3300007076 Bacteria 6719
274 Ga0105240_11805877 3300009093 Bacteria 637
275 Ga0111539_10001116 3300009094 Bacteria 35481
276 Ga0111539_10115538 3300009094 Bacteria 3147
277 Ga0111539_10555578 3300009094 Bacteria 1337
278 Ga0111539_12178582 3300009094 Bacteria 643
279 Ga0111539_13483269 3300009094 Bacteria 505
280 Ga0105245_10000784 3300009098 Bacteria 28821
281 Ga0105245_10013521 3300009098 Bacteria 7107
282 Ga0105245_10217370 3300009098 Bacteria 1842
283 Ga0105245_10234858 3300009098 Bacteria 1775
284 Ga0105245_10454951 3300009098 Bacteria 1289
285 Ga0105245_12073563 3300009098 Bacteria 622
286 Ga0105247_10229412 3300009101 Bacteria 1260
287 Ga0105247_10490636 3300009101 Bacteria 893
288 Ga0114129_10009571 3300009147 Bacteria 13822
289 Ga0114129_10651037 3300009147 Bacteria 1360
290 Ga0105243_10009154 3300009148 Bacteria 7561
291 Ga0105243_10029217 3300009148 Bacteria 4238
292 Ga0105243_10082398 3300009148 Bacteria 2629
293 Ga0105243_10108500 3300009148 Bacteria 2317
294 Ga0105243_10516213 3300009148 Bacteria 1135
295 Ga0105243_10547293 3300009148 Bacteria 1105
296 Ga0105243_10599956 3300009148 Bacteria 1060
297 Ga0105243_10625974 3300009148 Bacteria 1039
298 Ga0105243_11284149 3300009148 Bacteria 748
299 Ga0105243_11608031 3300009148 Bacteria 676
300 Ga0105243_11917559 3300009148 Bacteria 626
301 Ga0105241_10730309 3300009174 Bacteria 906
302 Ga0105242_10058407 3300009176 Bacteria 3162
303 Ga0105242_10203773 3300009176 Bacteria 1759
304 Ga0105242_10223121 3300009176 Bacteria 1685
305 Ga0105242_10324702 3300009176 Bacteria 1413
306 Ga0105242_12120496 3300009176 Bacteria 606
307 Ga0105248_10640200 3300009177 Bacteria 1200
308 Ga0105248_10690995 3300009177 Bacteria 1151
309 Ga0105248_10982496 3300009177 Bacteria 954
310 Ga0105248_12520967 3300009177 Bacteria 586
311 Ga0105237_10370582 3300009545 Bacteria 1437
312 Ga0105237_10658500 3300009545 Bacteria 1054
313 Ga0105237_11559717 3300009545 Bacteria 667
314 Ga0105237_11631374 3300009545 Bacteria 652
315 Ga0105238_10104155 3300009551 Bacteria 2818
316 Ga0105238_10306736 3300009551 Bacteria 1572
317 Ga0105238_10644430 3300009551 Bacteria 1069
318 Ga0105238_12833672 3300009551 Bacteria 521
319 Ga0105249_10135909 3300009553 Bacteria 2352
320 Ga0105249_10223838 3300009553 Bacteria 1853
321 Ga0105249_10361030 3300009553 Bacteria 1474
322 Ga0105249_10621648 3300009553 Bacteria 1136
323 Ga0105249_10789355 3300009553 Bacteria 1013
324 Ga0105249_11104770 3300009553 Bacteria 863
325 Ga0105249_11764053 3300009553 Bacteria 691
326 Ga0105249_11794335 3300009553 Bacteria 686
327 Ga0105249_13229679 3300009553 Bacteria 524
328 Ga0105249_13569943 3300009553 Bacteria 501
329 Ga0105239_10025063 3300010375 Bacteria 6571
330 Ga0105239_10025631 3300010375 Bacteria 6492
331 Ga0105239_10377368 3300010375 Bacteria 1603
332 Ga0105239_10393451 3300010375 Bacteria 1568
333 Ga0105239_10441979 3300010375 Bacteria 1475
334 Ga0105239_11039996 3300010375 Bacteria 942
335 Ga0105239_11239046 3300010375 Bacteria 860
336 Ga0105239_11251885 3300010375 Bacteria 855
337 Ga0105239_11664473 3300010375 Bacteria 738
338 Ga0105239_11795826 3300010375 Bacteria 710
339 Ga0105239_12345681 3300010375 Bacteria 621
340 Ga0105239_13292876 3300010375 Bacteria 526
341 Ga0105246_10004511 3300011119 Bacteria 8468
342 Ga0105246_10197563 3300011119 Bacteria 1561
343 Ga0105246_10207269 3300011119 Bacteria 1528
344 Ga0105246_10320138 3300011119 Bacteria 1260
345 Ga0105246_10797071 3300011119 Bacteria 838
346 Ga0105246_11519439 3300011119 Bacteria 630
347 Ga0105246_12304057 3300011119 Bacteria 526
348 Ga0105246_12415712 3300011119 Bacteria 516
349 Ga0157329_1004908 3300012491 Bacteria 885
350 Ga0157341_1002850 3300012494 Bacteria 1171
351 Ga0157319_1001748 3300012497 Bacteria 1166
352 Ga0157345_1023030 3300012498 Bacteria 649
353 Ga0157347_1059840 3300012502 Bacteria 543
354 Ga0157313_1037034 3300012503 Bacteria 582
355 Ga0157324_1031350 3300012506 Bacteria 604
356 Ga0157315_1060990 3300012508 Bacteria 532
357 Ga0157326_1003780 3300012513 Bacteria 1591
358 Ga0157371_10087004 3300013102 Bacteria 2213
359 Ga0157371_10160623 3300013102 Bacteria 1605
360 Ga0157371_10293750 3300013102 Bacteria 1175
361 Ga0157371_10354094 3300013102 Bacteria 1069
362 Ga0157371_11185366 3300013102 Bacteria 588
363 Ga0157370_10264443 3300013104 Bacteria 1589
364 Ga0157370_11027938 3300013104 Bacteria 746
365 Ga0157370_11236407 3300013104 Bacteria 673
366 Ga0157370_11464431 3300013104 Bacteria 614
367 Ga0157370_11672520 3300013104 Bacteria 571
368 Ga0157369_10057264 3300013105 Bacteria 4205
369 Ga0157369_10250867 3300013105 Bacteria 1847
370 Ga0157369_10474237 3300013105 Bacteria 1295
371 Ga0157369_11691093 3300013105 Bacteria 643
372 Ga0157374_10463567 3300013296 Bacteria 1269
373 Ga0157374_10998224 3300013296 Bacteria 856
374 Ga0157374_11198190 3300013296 Bacteria 781
375 Ga0157374_12866168 3300013296 Bacteria 510
376 Ga0157378_10616971 3300013297 Bacteria 1097
377 Ga0157378_11409136 3300013297 Bacteria 740
378 Ga0157378_11590307 3300013297 Bacteria 699
379 Ga0163162_10037964 3300013306 Bacteria 4808
380 Ga0163162_10165665 3300013306 Bacteria 2334
381 Ga0163162_10699096 3300013306 Bacteria 1136
382 Ga0163162_10880048 3300013306 Bacteria 1010
383 Ga0163162_10953710 3300013306 Bacteria 969
384 Ga0163162_10991718 3300013306 Bacteria 949
385 Ga0163162_12141496 3300013306 Bacteria 642
386 Ga0157372_10006799 3300013307 Bacteria 12159
387 Ga0157372_10196315 3300013307 Bacteria 2338
388 Ga0157372_10340898 3300013307 Bacteria 1746
389 Ga0157372_10387888 3300013307 Bacteria 1627
390 Ga0157372_10439006 3300013307 Bacteria 1521
391 Ga0157372_10605056 3300013307 Bacteria 1277
392 Ga0157372_11561311 3300013307 Bacteria 760
393 Ga0157372_11871357 3300013307 Bacteria 690
394 Ga0157372_12767302 3300013307 Bacteria 563
395 Ga0157375_10070197 3300013308 Bacteria 3512
396 Ga0157375_10154789 3300013308 Bacteria 2431
397 Ga0157375_10268601 3300013308 Bacteria 1867
398 Ga0157375_10288095 3300013308 Bacteria 1805
399 Ga0157375_10347642 3300013308 Bacteria 1649
400 Ga0157375_10407439 3300013308 Bacteria 1526
401 Ga0157375_10623105 3300013308 Bacteria 1237
402 Ga0157375_10655259 3300013308 Bacteria 1206
403 Ga0157375_10707989 3300013308 Bacteria 1160
404 Ga0157375_10919724 3300013308 Bacteria 1018
405 Ga0157375_10985650 3300013308 Bacteria 983
406 Ga0163163_10207804 3300014325 Bacteria 2006
407 Ga0163163_10371732 3300014325 Bacteria 1487
408 Ga0163163_10965638 3300014325 Bacteria 915
409 Ga0163163_11029407 3300014325 Bacteria 887
410 Ga0163163_11734882 3300014325 Bacteria 685
411 Ga0163163_11823228 3300014325 Bacteria 669
412 Ga0163163_12662559 3300014325 Bacteria 557
413 Ga0157380_10003865 3300014326 Bacteria 10322
414 Ga0157380_10025349 3300014326 Bacteria 4497
415 Ga0157380_10311376 3300014326 Bacteria 1455
416 Ga0157380_10738734 3300014326 Bacteria 994
417 Ga0182008_10070344 3300014497 Bacteria 1722
418 Ga0182008_10142112 3300014497 Bacteria 1201
419 Ga0182008_10334886 3300014497 Bacteria 799
420 Ga0157377_10002420 3300014745 Bacteria 8237
421 Ga0157377_10828088 3300014745 Bacteria 685
422 Ga0157377_10897746 3300014745 Bacteria 662
423 Ga0157377_11130082 3300014745 Bacteria 602
424 Ga0157377_11149366 3300014745 Bacteria 598
425 Ga0157379_10319028 3300014968 Bacteria 1419
426 Ga0157376_10426080 3300014969 Bacteria 1289
427 Ga0157376_10844694 3300014969 Bacteria 931
428 Ga0157376_10964637 3300014969 Bacteria 874
429 Ga0157376_11485512 3300014969 Bacteria 710
430 Ga0163161_10255290 3300017792 Bacteria 1367
431 Ga0163161_10272722 3300017792 Bacteria 1324
432 Ga0163161_10844374 3300017792 Bacteria 772
433 Ga0163161_10931748 3300017792 Bacteria 738
434 Ga0163161_10990139 3300017792 Bacteria 717
435 Ga0163161_11316386 3300017792 Bacteria 628
436 Ga0163161_12003410 3300017792 Bacteria 515
437 Ga0206356_11045432 3300020070 Bacteria 885
438 Ga0206355_1474064 3300020076 Bacteria 576
439 Ga0206351_10522411 3300020077 Bacteria 562
440 Ga0206350_10017631 3300020080 Bacteria 542
441 Ga0206354_11068423 3300020081 Bacteria 1071
442 Ga0206353_10074550 3300020082 Bacteria 977
443 Ga0206353_10216600 3300020082 Bacteria 743
444 Ga0206353_11576002 3300020082 Bacteria 772
445 Ga0213876_10133516 3300021384 Bacteria 1320
446 Ga0224712_10232111 3300022467 Bacteria 847
447 Ga0207697_10201355 3300025315 Bacteria 876
448 Ga0207682_10228961 3300025893 Bacteria 861
449 Ga0207642_10016931 3300025899 Bacteria 2760
450 Ga0207642_10114690 3300025899 Bacteria 1378
451 Ga0207642_10354691 3300025899 Bacteria 866
452 Ga0207642_10582879 3300025899 Bacteria 694
453 Ga0207642_10837576 3300025899 Bacteria 587
454 Ga0207710_10137174 3300025900 Bacteria 1179
455 Ga0207710_10191245 3300025900 Bacteria 1008
456 Ga0207688_10023178 3300025901 Bacteria 3398
457 Ga0207688_10025639 3300025901 Bacteria 3239
458 Ga0207688_10129326 3300025901 Bacteria 1479
459 Ga0207688_10232666 3300025901 Bacteria 1113
460 Ga0207688_10451783 3300025901 Bacteria 801
461 Ga0207688_10693185 3300025901 Bacteria 644
462 Ga0207688_10937748 3300025901 Bacteria 548
463 Ga0207688_11007464 3300025901 Bacteria 526
464 Ga0207647_10011458 3300025904 Bacteria 6218
465 Ga0207647_10191704 3300025904 Bacteria 1184
466 Ga0207647_10232904 3300025904 Bacteria 1059
467 Ga0207647_10265991 3300025904 Bacteria 981
468 Ga0207647_10306855 3300025904 Bacteria 903
469 Ga0207645_10516514 3300025907 Bacteria 809
470 Ga0207643_10003490 3300025908 Bacteria 8454
471 Ga0207643_10037488 3300025908 Bacteria 2720
472 Ga0207643_10726892 3300025908 Bacteria 642
473 Ga0207705_10012685 3300025909 Bacteria 6081
474 Ga0207705_10942087 3300025909 Bacteria 668
475 Ga0207707_10954079 3300025912 Bacteria 706
476 Ga0207707_11267495 3300025912 Bacteria 594
477 Ga0207671_10144000 3300025914 Bacteria 1838
478 Ga0207671_10162853 3300025914 Bacteria 1728
479 Ga0207671_10239136 3300025914 Bacteria 1426
480 Ga0207660_11321538 3300025917 Bacteria 585
481 Ga0207662_10055716 3300025918 Bacteria 2360
482 Ga0207657_10004479 3300025919 Bacteria 14773
483 Ga0207657_10027478 3300025919 Bacteria 5211
484 Ga0207657_10050202 3300025919 Bacteria 3631
485 Ga0207657_10873637 3300025919 Bacteria 693
486 Ga0207657_11171562 3300025919 Bacteria 585
487 Ga0207652_10437966 3300025921 Bacteria 1178
488 Ga0207652_10533276 3300025921 Bacteria 1056
489 Ga0207646_10054603 3300025922 Bacteria 3573
490 Ga0207681_11427968 3300025923 Bacteria 581
491 Ga0207694_10260070 3300025924 Bacteria 1422
492 Ga0207694_10705232 3300025924 Bacteria 851
493 Ga0207694_11729332 3300025924 Bacteria 526
494 Ga0207659_10112748 3300025926 Bacteria 2070
495 Ga0207659_10122010 3300025926 Bacteria 1998
496 Ga0207687_10007750 3300025927 Bacteria 7045
497 Ga0207687_10031535 3300025927 Bacteria 3583
498 Ga0207687_10089049 3300025927 Bacteria 2246
499 Ga0207687_10392237 3300025927 Bacteria 1140
500 Ga0207664_10021185 3300025929 Bacteria 4829
501 Ga0207644_10341144 3300025931 Bacteria 1215
502 Ga0207644_10740850 3300025931 Bacteria 821
503 Ga0207690_10038937 3300025932 Bacteria 3098
504 Ga0207690_10104390 3300025932 Bacteria 2030
505 Ga0207690_10171780 3300025932 Bacteria 1625
506 Ga0207690_10177518 3300025932 Bacteria 1601
507 Ga0207690_10349331 3300025932 Bacteria 1169
508 Ga0207690_10486765 3300025932 Bacteria 996
509 Ga0207690_11047723 3300025932 Bacteria 679
510 Ga0207706_10025706 3300025933 Bacteria 5274
511 Ga0207706_10138591 3300025933 Bacteria 2140
512 Ga0207706_10148220 3300025933 Bacteria 2064
513 Ga0207706_10331879 3300025933 Bacteria 1323
514 Ga0207706_10867856 3300025933 Bacteria 763
515 Ga0207686_10708021 3300025934 Bacteria 801
516 Ga0207686_11492274 3300025934 Bacteria 557
517 Ga0207709_10031220 3300025935 Bacteria 3109
518 Ga0207709_10075093 3300025935 Bacteria 2159
519 Ga0207709_10240490 3300025935 Bacteria 1317
520 Ga0207709_10494880 3300025935 Bacteria 953
521 Ga0207709_10946058 3300025935 Bacteria 702
522 Ga0207709_11001324 3300025935 Bacteria 683
523 Ga0207669_10082943 3300025937 Bacteria 2060
524 Ga0207669_10083410 3300025937 Bacteria 2055
525 Ga0207669_10302691 3300025937 Bacteria 1216
526 Ga0207669_11563720 3300025937 Bacteria 563
527 Ga0207669_11578060 3300025937 Bacteria 560
528 Ga0207704_10007451 3300025938 Bacteria 5171
529 Ga0207704_10074232 3300025938 Bacteria 2169
530 Ga0207704_10212072 3300025938 Bacteria 1426
531 Ga0207704_10506540 3300025938 Bacteria 974
532 Ga0207691_10007736 3300025940 Bacteria 10345
533 Ga0207691_10435869 3300025940 Bacteria 1116
534 Ga0207691_10958650 3300025940 Bacteria 715
535 Ga0207691_11343843 3300025940 Bacteria 589
536 Ga0207711_10352633 3300025941 Bacteria 1362
537 Ga0207711_10421491 3300025941 Bacteria 1241
538 Ga0207711_10495792 3300025941 Bacteria 1138
539 Ga0207689_10202976 3300025942 Bacteria 1637
540 Ga0207689_10761677 3300025942 Bacteria 817
541 Ga0207689_11643269 3300025942 Bacteria 534
542 Ga0207661_10133972 3300025944 Bacteria 2126
543 Ga0207661_10146461 3300025944 Bacteria 2038
544 Ga0207661_10171341 3300025944 Bacteria 1890
545 Ga0207661_10250278 3300025944 Bacteria 1575
546 Ga0207661_10523615 3300025944 Bacteria 1085
547 Ga0207661_10628778 3300025944 Bacteria 986
548 Ga0207661_10813759 3300025944 Bacteria 860
549 Ga0207661_10848868 3300025944 Bacteria 841
550 Ga0207661_10886863 3300025944 Bacteria 821
551 Ga0207661_11272465 3300025944 Bacteria 676
552 Ga0207661_11477616 3300025944 Bacteria 623
553 Ga0207679_10412219 3300025945 Bacteria 1191
554 Ga0207679_10490537 3300025945 Bacteria 1095
555 Ga0207679_10710591 3300025945 Bacteria 912
556 Ga0207679_10981133 3300025945 Bacteria 774
557 Ga0207679_11522531 3300025945 Bacteria 613
558 Ga0207679_11700351 3300025945 Bacteria 577
559 Ga0207679_12129599 3300025945 Bacteria 509
560 Ga0207667_10661603 3300025949 Bacteria 1049
561 Ga0207667_10890745 3300025949 Bacteria 882
562 Ga0207651_11077563 3300025960 Bacteria 720
563 Ga0207712_10099681 3300025961 Bacteria 2157
564 Ga0207712_10163356 3300025961 Bacteria 1733
565 Ga0207712_10287048 3300025961 Bacteria 1345
566 Ga0207712_10360721 3300025961 Bacteria 1211
567 Ga0207712_10816847 3300025961 Bacteria 820
568 Ga0207668_10044265 3300025972 Bacteria 3027
569 Ga0207668_10127223 3300025972 Bacteria 1940
570 Ga0207668_11906966 3300025972 Bacteria 536
571 Ga0207640_10241322 3300025981 Bacteria 1396
572 Ga0207640_10278164 3300025981 Bacteria 1313
573 Ga0207640_10431235 3300025981 Bacteria 1081
574 Ga0207640_11136856 3300025981 Bacteria 692
575 Ga0207640_11167579 3300025981 Bacteria 683
576 Ga0207640_11229803 3300025981 Bacteria 667
577 Ga0207658_10017447 3300025986 Bacteria 4946
578 Ga0207658_10612554 3300025986 Bacteria 979
579 Ga0207658_12154622 3300025986 Bacteria 506
580 Ga0207677_10214840 3300026023 Bacteria 1538
581 Ga0207677_10872935 3300026023 Bacteria 810
582 Ga0207677_11375181 3300026023 Bacteria 650
583 Ga0207703_10287576 3300026035 Bacteria 1495
584 Ga0207703_11400234 3300026035 Bacteria 673
585 Ga0207639_10723903 3300026041 Bacteria 924
586 Ga0207639_11886409 3300026041 Bacteria 558
587 Ga0207678_10271749 3300026067 Bacteria 1453
588 Ga0207678_10359302 3300026067 Bacteria 1257
589 Ga0207678_10424293 3300026067 Bacteria 1153
590 Ga0207678_10436417 3300026067 Bacteria 1137
591 Ga0207678_10981732 3300026067 Bacteria 747
592 Ga0207678_11044549 3300026067 Bacteria 723
593 Ga0207678_11668786 3300026067 Bacteria 560
594 Ga0207708_10042577 3300026075 Bacteria 3460
595 Ga0207708_10064834 3300026075 Bacteria 2792
596 Ga0207708_10162751 3300026075 Bacteria 1763
597 Ga0207708_10516949 3300026075 Bacteria 1003
598 Ga0207708_11185591 3300026075 Bacteria 667
599 Ga0207708_11206609 3300026075 Bacteria 662
600 Ga0207708_11539972 3300026075 Bacteria 584
601 Ga0207708_12018224 3300026075 Bacteria 505
602 Ga0207702_10880280 3300026078 Bacteria 887
603 Ga0207702_10913944 3300026078 Bacteria 870
604 Ga0207702_11231244 3300026078 Bacteria 743
605 Ga0207641_10440161 3300026088 Bacteria 1258
606 Ga0207648_10001576 3300026089 Bacteria 25004
607 Ga0207648_10052869 3300026089 Bacteria 3551
608 Ga0207648_10767661 3300026089 Bacteria 896
609 Ga0207648_10994035 3300026089 Bacteria 786
610 Ga0207648_11158671 3300026089 Bacteria 726
611 Ga0207676_10713395 3300026095 Bacteria 973
612 Ga0207676_10905768 3300026095 Bacteria 865
613 Ga0207676_10940089 3300026095 Bacteria 850
614 Ga0207676_12322168 3300026095 Bacteria 534
615 Ga0207674_10003282 3300026116 Bacteria 19892
616 Ga0207674_10913390 3300026116 Bacteria 846
617 Ga0207674_10983585 3300026116 Bacteria 813
618 Ga0207674_11291720 3300026116 Bacteria 699
619 Ga0207675_100019126 3300026118 Bacteria 6394
620 Ga0207675_100027624 3300026118 Bacteria 5285
621 Ga0207675_100072241 3300026118 Bacteria 3227
622 Ga0207675_101002295 3300026118 Bacteria 854
623 Ga0207675_101013152 3300026118 Bacteria 849
624 Ga0207675_102017733 3300026118 Bacteria 594
625 Ga0207683_10024133 3300026121 Bacteria 5233
626 Ga0207683_10686162 3300026121 Bacteria 949
627 Ga0207683_11943957 3300026121 Bacteria 537
628 Ga0207698_10017237 3300026142 Bacteria 4895
629 Ga0207698_10179653 3300026142 Bacteria 1873
630 Ga0207698_11362345 3300026142 Bacteria 724
631 Ga0207698_11863031 3300026142 Bacteria 616
632 Ga0207698_11946301 3300026142 Bacteria 602
633 Ga0207698_12005461 3300026142 Bacteria 593
634 Ga0207698_12485903 3300026142 Bacteria 528
635 Ga0209371_1059702 3300027312 Bacteria 704
636 Ga0209813_10001855 3300027866 Bacteria 4767
637 Ga0209813_10007379 3300027866 Bacteria 2737
638 Ga0209813_10029205 3300027866 Bacteria 1613
639 Ga0209974_10250496 3300027876 Bacteria 666
640 Ga0207428_10001037 3300027907 Bacteria 30620
641 Ga0207428_10002082 3300027907 Bacteria 20158
642 Ga0207428_10059433 3300027907 Bacteria 3032
643 Ga0268266_10019655 3300028379 Bacteria 5755
644 Ga0268266_10132557 3300028379 Bacteria 2230
645 Ga0268266_10343366 3300028379 Bacteria 1402
646 Ga0268266_10785031 3300028379 Bacteria 920
647 Ga0268266_10888330 3300028379 Bacteria 862
648 Ga0268266_10941209 3300028379 Bacteria 836
649 Ga0268266_10951369 3300028379 Bacteria 831
650 Ga0268266_12264150 3300028379 Bacteria 515
651 Ga0268265_10524707 3300028380 Bacteria 1120
652 Ga0268265_10705282 3300028380 Bacteria 975
653 Ga0268265_12502348 3300028380 Bacteria 522
654 Ga0268264_10000195 3300028381 Bacteria 123899
655 Ga0268264_10030690 3300028381 Bacteria 4406
656 Ga0268264_12620586 3300028381 Bacteria 508
657 Ga0307517_10659924 3300028786 Bacteria 508
658 Ga0307515_10336916 3300028794 Bacteria 1163
659 Ga0268256_1066836 3300030500 Bacteria 704
660 Ga0316182_1145211 3300030745 Bacteria 747
661 Ga0307513_10578670 3300031456 Bacteria 833
662 Ga0307509_10009190 3300031507 Bacteria 12410
663 Ga0307408_100003860 3300031548 Bacteria 10198
664 Ga0307408_100049059 3300031548 Bacteria 3031
665 Ga0307408_100089115 3300031548 Bacteria 2325
666 Ga0307408_100133046 3300031548 Bacteria 1942
667 Ga0307408_100980822 3300031548 Bacteria 778
668 Ga0307408_101751100 3300031548 Bacteria 593
669 Ga0307405_10001103 3300031731 Bacteria 11033
670 Ga0307405_10006689 3300031731 Bacteria 5694
671 Ga0307405_10055925 3300031731 Bacteria 2472
672 Ga0307405_10397742 3300031731 Bacteria 1077
673 Ga0307405_10824029 3300031731 Bacteria 779
674 Ga0307413_10034163 3300031824 Bacteria 2903
675 Ga0307413_10075719 3300031824 Bacteria 2137
676 Ga0307413_10094384 3300031824 Bacteria 1958
677 Ga0307413_10108459 3300031824 Bacteria 1853
678 Ga0307413_11894619 3300031824 Bacteria 535
679 Ga0307410_10000104 3300031852 Bacteria 29659
680 Ga0307410_10027795 3300031852 Bacteria 3578
681 Ga0307410_10098455 3300031852 Bacteria 2092
682 Ga0307410_10300520 3300031852 Bacteria 1266
683 Ga0307410_10365397 3300031852 Bacteria 1157
684 Ga0307410_10443407 3300031852 Bacteria 1057
685 Ga0307410_10624960 3300031852 Bacteria 901
686 Ga0307410_11239514 3300031852 Bacteria 651
687 Ga0307410_11421478 3300031852 Bacteria 609
688 Ga0307410_11745830 3300031852 Bacteria 552
689 Ga0307410_11844957 3300031852 Bacteria 538
690 Ga0307406_10002432 3300031901 Bacteria 10128
691 Ga0307406_10004038 3300031901 Bacteria 7981
692 Ga0307406_10159312 3300031901 Bacteria 1620
693 Ga0307406_10350080 3300031901 Bacteria 1154
694 Ga0307406_10422472 3300031901 Bacteria 1062
695 Ga0307406_10848067 3300031901 Bacteria 774
696 Ga0307406_11624545 3300031901 Bacteria 571
697 Ga0307407_10009633 3300031903 Bacteria 4509
698 Ga0307407_10023658 3300031903 Bacteria 3208
699 Ga0307407_10039378 3300031903 Bacteria 2628
700 Ga0307407_10122575 3300031903 Bacteria 1650
701 Ga0307407_10145777 3300031903 Bacteria 1533
702 Ga0307407_10149766 3300031903 Bacteria 1515
703 Ga0307407_10326575 3300031903 Bacteria 1078
704 Ga0307407_10614433 3300031903 Bacteria 811
705 Ga0307407_10683118 3300031903 Bacteria 772
706 Ga0307407_10746354 3300031903 Bacteria 741
707 Ga0307407_10876417 3300031903 Bacteria 687
708 Ga0307407_11065760 3300031903 Bacteria 627
709 Ga0307407_11401788 3300031903 Bacteria 550
710 Ga0307412_10102729 3300031911 Bacteria 2025
711 Ga0307412_10181827 3300031911 Bacteria 1582
712 Ga0307412_10574554 3300031911 Bacteria 950
713 Ga0307412_11639144 3300031911 Bacteria 588
714 Ga0307412_12297496 3300031911 Bacteria 503
715 Ga0307409_100000362 3300031995 Bacteria 18990
716 Ga0307409_100013725 3300031995 Bacteria 5232
717 Ga0307409_100048235 3300031995 Bacteria 3239
718 Ga0307409_100086508 3300031995 Bacteria 2551
719 Ga0307409_100107296 3300031995 Bacteria 2333
720 Ga0307409_100267865 3300031995 Bacteria 1571
721 Ga0307409_100291161 3300031995 Bacteria 1514
722 Ga0307409_100305750 3300031995 Bacteria 1481
723 Ga0307409_100418477 3300031995 Bacteria 1285
724 Ga0307409_100536360 3300031995 Bacteria 1146
725 Ga0307409_100566233 3300031995 Bacteria 1118
726 Ga0307409_100599275 3300031995 Bacteria 1089
727 Ga0307409_100634940 3300031995 Bacteria 1060
728 Ga0307409_101004562 3300031995 Bacteria 852
729 Ga0307409_101029679 3300031995 Bacteria 842
730 Ga0307409_101293011 3300031995 Bacteria 754
731 Ga0307409_102445044 3300031995 Bacteria 551
732 Ga0307409_102950098 3300031995 Bacteria 502
733 Ga0307416_100000240 3300032002 Bacteria 29208
734 Ga0307416_100031648 3300032002 Bacteria 3985
735 Ga0307416_100227355 3300032002 Bacteria 1795
736 Ga0307416_100622512 3300032002 Bacteria 1161
737 Ga0307416_100632438 3300032002 Bacteria 1153
738 Ga0307416_100735733 3300032002 Bacteria 1078
739 Ga0307416_100855586 3300032002 Bacteria 1007
740 Ga0307416_101239266 3300032002 Bacteria 852
741 Ga0307416_101771688 3300032002 Bacteria 722
742 Ga0307416_101948383 3300032002 Bacteria 690
743 Ga0307416_101985962 3300032002 Bacteria 684
744 Ga0307416_102179285 3300032002 Bacteria 656
745 Ga0307414_10037621 3300032004 Bacteria 3242
746 Ga0307414_10156905 3300032004 Bacteria 1803
747 Ga0307414_10251761 3300032004 Bacteria 1469
748 Ga0307414_10455480 3300032004 Bacteria 1123
749 Ga0307414_10482798 3300032004 Bacteria 1093
750 Ga0307414_10512402 3300032004 Bacteria 1063
751 Ga0307411_10051114 3300032005 Bacteria 2695
752 Ga0307411_10177369 3300032005 Bacteria 1613
753 Ga0307411_10199084 3300032005 Bacteria 1536
754 Ga0307411_11556637 3300032005 Bacteria 609
755 Ga0307411_11703303 3300032005 Bacteria 583
756 Ga0307415_100002630 3300032126 Bacteria 8947
757 Ga0307415_100005693 3300032126 Bacteria 6641
758 Ga0307415_100016729 3300032126 Bacteria 4379
759 Ga0307415_100017773 3300032126 Bacteria 4272
760 Ga0307415_100043930 3300032126 Bacteria 2984
761 Ga0307415_100093526 3300032126 Bacteria 2183
762 Ga0307415_100148710 3300032126 Bacteria 1800
763 Ga0307415_100214462 3300032126 Bacteria 1538
764 Ga0307415_100313640 3300032126 Bacteria 1304
765 Ga0307415_100706245 3300032126 Bacteria 910
766 Ga0307415_101455195 3300032126 Bacteria 654
767 Ga0307415_102083043 3300032126 Bacteria 554
768 Ga0316583_10123617 3300032133 Bacteria 902
769 Ga0373939_0446523 3300035114 Bacteria 544
770 Ga0373942_0084645 3300035207 Bacteria 947
771 Ga0373961_0137155 3300035241 Bacteria 824
772 Ga0373961_0140389 3300035241 Bacteria 816
773 Ga0373962_0176903 3300035242 Bacteria 712
774 Ga0373931_0170473 3300035691 Bacteria 1282
775 Ga0373931_0191330 3300035691 Bacteria 1218
776 Ga0373931_0790490 3300035691 Bacteria 632
777 Ga0373927_0980654 3300035695 Bacteria 558
778 Ga0373927_1140813 3300035695 Bacteria 514
779 Ga0395899_0250603 3300037312 Bacteria 1215
780 Ga0395900_0058016 3300037418 Bacteria 3985
781 Ga0395900_0462585 3300037418 Bacteria 1223
782 Ga0395900_0615870 3300037418 Bacteria 1025
783 Ga0395898_0096517 3300037466 Bacteria 2840
784 Ga0395898_0242167 3300037466 Bacteria 1720
785 Ga0395905_0400837 3300037471 Bacteria 1267
786 Ga0395905_0825505 3300037471 Bacteria 830
787 Ga0436364_0158595 3300037853 Bacteria 948
788 Ga0395901_0105994 3300038443 Bacteria 2950
789 Ga0395901_0635055 3300038443 Bacteria 1073
790 Ga0395901_0867518 3300038443 Bacteria 887
791 Ga0395901_1136481 3300038443 Bacteria 750
792 Ga0395901_2081294 3300038443 Bacteria 513
793 Ga0436365_1073144 3300039437 Bacteria 616
794 Ga0436365_1902425 3300039437 Bacteria 1267
795 Ga0436362_1172283 3300039453 Bacteria 547
796 Ga0439438_175108 3300041405 Bacteria 510
797 Ga0439439_0115796 3300041406 Bacteria 745
798 Ga0439465_0085262 3300041413 Bacteria 1075
799 Ga0451787_365079 3300041441 Bacteria 751
800 Ga0451791_0511011 3300041451 Bacteria 552
801 Ga0451791_1305444 3300041451 Bacteria 511
802 Ga0451791_1611175 3300041451 Bacteria 1510
803 Ga0451793_1110791 3300041452 Bacteria 583
804 Ga0451795_0714571 3300041456 Bacteria 534
805 Ga0451802_0295209 3300041460 Bacteria 718
806 Ga0451802_0708292 3300041460 Bacteria 664
807 Ga0451806_611162 3300041462 Bacteria 698
808 Ga0451804_0216958 3300041463 Bacteria 506
809 Ga0451804_0628311 3300041463 Bacteria 572
810 Ga0451807_0228856 3300041486 Bacteria 689
811 Ga0451807_0305274 3300041486 Bacteria 714
812 Ga0451833_0680881 3300041491 Bacteria 583
813 Ga0451833_0873441 3300041491 Bacteria 949
814 Ga0451833_0977379 3300041491 Bacteria 511
815 Ga0451833_1020092 3300041491 Bacteria 620
816 Ga0451837_1623172 3300041494 Bacteria 557
817 Ga0451839_1658216 3300041496 Bacteria 610
818 Ga0451841_1334235 3300041498 Bacteria 536
819 Ga0451849_1036478 3300041505 Bacteria 584
820 Ga0451851_0539608 3300041507 Bacteria 593
821 Ga0451853_0904534 3300041512 Bacteria 554
822 Ga0451853_1786633 3300041512 Bacteria 529
823 Ga0451853_3744708 3300041512 Bacteria 1026
824 Ga0439431_0007629 3300041997 Bacteria 2416
825 Ga0439431_0052178 3300041997 Bacteria 1062
826 Ga0439431_0199582 3300041997 Bacteria 583
827 Ga0439433_0156486 3300041999 Bacteria 589
828 Ga0439442_020861 3300042002 Bacteria 1358
829 Ga0439448_0021155 3300042005 Bacteria 2016
830 Ga0439448_0062084 3300042005 Bacteria 1236
831 Ga0439448_0282041 3300042005 Bacteria 589
832 Ga0439432_058402 3300042006 Bacteria 1193
833 Ga0439450_016080 3300042008 Bacteria 1542
834 Ga0439450_093445 3300042008 Bacteria 757
835 Ga0439462_0061846 3300042015 Bacteria 1014
836 Ga0439463_000348 3300042016 Bacteria 12928
837 Ga0439463_092384 3300042016 Bacteria 779
838 Ga0439463_118824 3300042016 Bacteria 683
839 Ga0450888_004963 3300042126 Bacteria 1405
840 Ga0450907_016303 3300042146 Bacteria 1239
841 Ga0439446_0038802 3300042156 Bacteria 1397
842 Ga0439434_0017161 3300042435 Bacteria 2165
843 Ga0439435_0011795 3300042436 Bacteria 2102
844 Ga0439444_0010182 3300042437 Bacteria 1498
845 Ga0439444_0021683 3300042437 Bacteria 1139
846 Ga0439444_0094772 3300042437 Bacteria 670
847 Ga0439464_0075031 3300042439 Bacteria 1004
848 Ga0439460_0027857 3300042461 Bacteria 1590
849 Ga0439460_0062596 3300042461 Bacteria 1138
850 Ga0439440_0001208 3300042993 Bacteria 4643
851 Ga0439440_0002278 3300042993 Bacteria 3604
852 Ga0439440_0006577 3300042993 Bacteria 2345
853 Ga0439440_0112705 3300042993 Bacteria 750
854 Ga0466969_0006155 3300044656 Bacteria 6389
855 Ga0466972_0018668 3300044658 Bacteria 3467
856 Ga0466972_0192411 3300044658 Bacteria 956
857 Ga0466965_0028706 3300044683 Bacteria 2704
858 Ga0466965_0051778 3300044683 Bacteria 2037
859 Ga0466965_0114997 3300044683 Bacteria 1385
860 Ga0466965_0206835 3300044683 Bacteria 1042
861 Ga0466965_0293639 3300044683 Bacteria 880
862 Ga0466965_0895214 3300044683 Bacteria 517
863 Ga0466966_0012013 3300044684 Bacteria 5739
864 Ga0466966_0449487 3300044684 Bacteria 775
865 Ga0466961_0018930 3300044693 Bacteria 4430
866 Ga0466961_0057181 3300044693 Bacteria 2483
867 Ga0466961_0110784 3300044693 Bacteria 1727
868 Ga0466961_0815230 3300044693 Bacteria 557
869 Ga0466961_0840479 3300044693 Bacteria 547
870 Ga0466963_0086148 3300044694 Bacteria 2134
871 Ga0466963_0123749 3300044694 Bacteria 1782
872 Ga0466963_0138856 3300044694 Bacteria 1683
873 Ga0466963_0145117 3300044694 Bacteria 1646
874 Ga0466963_0679117 3300044694 Bacteria 727
875 Ga0466963_0855076 3300044694 Bacteria 641
876 Ga0466964_0016610 3300044706 Bacteria 2812
877 Ga0466964_0029859 3300044706 Bacteria 2155
878 Ga0466964_0033426 3300044706 Bacteria 2049
879 Ga0466964_0351663 3300044706 Bacteria 757
880 Ga0466964_0407436 3300044706 Bacteria 712
881 Ga0466964_0810946 3300044706 Bacteria 530
882 Ga0466971_0000730 3300044719 Bacteria 13160
883 Ga0466971_0001409 3300044719 Bacteria 10103
884 Ga0466971_0011981 3300044719 Bacteria 3799
885 Ga0466971_0153252 3300044719 Bacteria 1077
886 Ga0466971_0419921 3300044719 Bacteria 654
887 Ga0466970_0006749 3300044765 Bacteria 5744
888 Ga0466970_0161703 3300044765 Bacteria 1239
889 Ga0466970_0183178 3300044765 Bacteria 1162
890 Ga0466970_0284074 3300044765 Bacteria 931
891 Ga0466970_0358850 3300044765 Bacteria 828
892 Ga0466970_0526253 3300044765 Bacteria 682
893 Ga0466957_0044095 3300044842 Bacteria 2702
894 Ga0466957_0176632 3300044842 Bacteria 1393
895 Ga0466957_0430288 3300044842 Bacteria 907
896 Ga0466957_1122798 3300044842 Bacteria 567
897 Ga0466960_0007519 3300044901 Bacteria 4430
898 Ga0466960_0011527 3300044901 Bacteria 3702
899 Ga0466960_0016613 3300044901 Bacteria 3196
900 Ga0466960_0280963 3300044901 Bacteria 933
901 Ga0466960_0341575 3300044901 Bacteria 852
902 Ga0466960_0636665 3300044901 Bacteria 635
903 Ga0466959_0000507 3300045049 Bacteria 22618
904 Ga0466959_0456740 3300045049 Bacteria 866
905 Ga0466959_0839745 3300045049 Bacteria 614
906 Ga0451576_0789764 3300045051 Bacteria 997
907 Ga0466958_0010466 3300045836 Bacteria 5196
908 Ga0466958_0146855 3300045836 Bacteria 1486
909 Ga0466958_0898824 3300045836 Bacteria 578
910 Ga0466967_0005026 3300045976 Bacteria 9062
911 Ga0466967_0029175 3300045976 Bacteria 4614
912 Ga0466967_0045804 3300045976 Bacteria 3803
913 Ga0466967_0067268 3300045976 Bacteria 3195
914 Ga0466967_0081289 3300045976 Bacteria 2926
915 Ga0466967_0231381 3300045976 Bacteria 1760
916 Ga0466967_0252729 3300045976 Bacteria 1684
917 Ga0466967_0363519 3300045976 Bacteria 1402
918 Ga0466967_0584214 3300045976 Bacteria 1101
919 Ga0466967_0615417 3300045976 Bacteria 1072
920 Ga0466967_0939353 3300045976 Bacteria 860
921 Ga0466967_0971458 3300045976 Bacteria 845
922 Ga0466967_1117634 3300045976 Bacteria 785
923 Ga0466967_1389603 3300045976 Bacteria 699
924 Ga0466967_1479483 3300045976 Bacteria 676
925 Ga0466967_1742535 3300045976 Bacteria 620
926 Ga0495617_213429 3300046452 Bacteria 601
927 Ga0495592_0149061 3300046454 Bacteria 1619
928 Ga0495629_0216853 3300046459 Bacteria 1321
929 Ga0495641_0156047 3300046461 Bacteria 1021
930 Ga0495641_0431782 3300046461 Bacteria 599
931 Ga0495651_0000079 3300046462 Bacteria 71581
932 Ga0495653_0003879 3300046463 Bacteria 12086
933 Ga0495653_0475047 3300046463 Bacteria 783
934 Ga0495582_0184918 3300046473 Bacteria 1188
935 Ga0495582_0237641 3300046473 Bacteria 1044
936 Ga0495639_0737129 3300046475 Bacteria 510
937 Ga0495662_0475655 3300046476 Bacteria 613
938 Ga0495664_0058669 3300046477 Bacteria 2290
939 Ga0495664_0314590 3300046477 Bacteria 944
940 Ga0495607_0310115 3300046501 Bacteria 740
941 Ga0495608_0305281 3300046511 Bacteria 985
942 Ga0495608_0399435 3300046511 Bacteria 841
943 Ga0495616_0158666 3300046513 Bacteria 1019
944 Ga0495620_0183825 3300046515 Bacteria 807
945 Ga0495620_0233352 3300046515 Bacteria 703
946 Ga0495631_0077678 3300046518 Bacteria 1433
947 Ga0495637_0219971 3300046520 Bacteria 692
948 Ga0495663_0132797 3300046525 Bacteria 841
949 Ga0495652_0003588 3300046529 Bacteria 15221
950 Ga0495587_0109041 3300046536 Bacteria 1591
951 Ga0495598_0111741 3300046537 Bacteria 917
952 Ga0495598_0195773 3300046537 Bacteria 728
953 Ga0495609_0250175 3300046538 Bacteria 730
954 Ga0495609_0268829 3300046538 Unclassified 699
955 Ga0495645_0059107 3300046543 Bacteria 2780
956 Ga0495645_0542076 3300046543 Bacteria 722
957 Ga0495667_0769789 3300046559 Bacteria 594
958 Ga0495656_0043278 3300046615 Bacteria 1890
959 Ga0495656_0244050 3300046615 Bacteria 905
960 Ga0495668_0160408 3300046616 Bacteria 1232
961 Ga0495634_0033758 3300046642 Bacteria 3514
962 Ga0495611_0215002 3300046648 Bacteria 895
963 Ga0495635_0002665 3300046663 Bacteria 12199
964 Ga0495635_0182110 3300046663 Bacteria 1428
965 Ga0495635_0293990 3300046663 Bacteria 1090
966 Ga0495659_0396631 3300046664 Bacteria 595
967 Ga0495661_0484120 3300046665 Bacteria 592
968 Ga0495623_0228214 3300046679 Bacteria 1057
969 Ga0495647_0155460 3300046681 Bacteria 983
970 Ga0495658_0985627 3300046683 Bacteria 538
971 Ga0495658_1001831 3300046683 Bacteria 533
972 Ga0495658_1005295 3300046683 Bacteria 532
973 Ga0495669_0616421 3300046684 Bacteria 528
974 Ga0495669_0655641 3300046684 Bacteria 510
975 Ga0495613_0331964 3300046689 Bacteria 1048
976 Ga0495613_0733140 3300046689 Bacteria 649
977 Ga0495624_0184178 3300046690 Bacteria 1272
978 Ga0495670_0051441 3300046691 Bacteria 2062
979 Ga0495670_0217389 3300046691 Bacteria 1015
980 Ga0495671_0098607 3300046692 Bacteria 1429
981 Ga0495649_0387298 3300046694 Bacteria 703
982 Ga0495600_0008443 3300046809 Bacteria 6327
983 Ga0495600_0171609 3300046809 Bacteria 1400
984 Ga0495600_0876464 3300046809 Bacteria 531
985 Ga0495581_0443904 3300047315 Bacteria 756
986 Ga0495581_0619403 3300047315 Bacteria 626
987 Ga0495676_0829248 3300047321 Bacteria 594
988 Ga0495680_0291954 3300047322 Bacteria 1147
989 Ga0495680_0898277 3300047322 Bacteria 572
990 Ga0495680_1105983 3300047322 Bacteria 500
991 Ga0495683_0122687 3300047323 Bacteria 1232
992 Ga0495679_193175 3300047446 Bacteria 537
993 Ga0496100_0017456 3300048903 Bacteria 4236
994 Ga0496100_0226587 3300048903 Bacteria 1374
995 Ga0496100_0565868 3300048903 Bacteria 880
996 Ga0496100_1016902 3300048903 Bacteria 652
997 Ga0496100_1249913 3300048903 Bacteria 586
998 Ga0496101_0070926 3300048904 Bacteria 2553
999 Ga0496101_0117874 3300048904 Bacteria 2005
1000 Ga0496101_0138320 3300048904 Bacteria 1854
1001 Ga0496101_0293802 3300048904 Bacteria 1272
1002 Ga0496101_0577514 3300048904 Bacteria 889
1003 Ga0496101_0678755 3300048904 Bacteria 814
1004 Ga0496101_0970682 3300048904 Bacteria 668
1005 Ga0496101_1526655 3300048904 Bacteria 520
1006 Ga0496102_0009949 3300048905 Bacteria 8179
1007 Ga0496102_0015093 3300048905 Bacteria 6725
1008 Ga0496102_0123928 3300048905 Bacteria 2415
1009 Ga0496102_0129045 3300048905 Bacteria 2365
1010 Ga0496102_0236863 3300048905 Bacteria 1721
1011 Ga0496102_0336690 3300048905 Bacteria 1421
1012 Ga0496102_1007418 3300048905 Bacteria 753
1013 Ga0496102_1237875 3300048905 Bacteria 666
1014 Ga0496102_1408699 3300048905 Bacteria 616
1015 Ga0496102_1687167 3300048905 Bacteria 551
1016 Ga0496103_0077842 3300048906 Bacteria 2082
1017 Ga0496103_0404688 3300048906 Bacteria 877
1018 Ga0496103_0943341 3300048906 Bacteria 539
1019 Ga0496104_0002251 3300048907 Bacteria 16644
1020 Ga0496104_0839878 3300048907 Bacteria 824
1021 Ga0496105_0001445 3300048908 Bacteria 16716
1022 Ga0496105_0444091 3300048908 Bacteria 1025
1023 Ga0496105_0712931 3300048908 Bacteria 769
1024 Ga0496106_0145577 3300048909 Bacteria 1866
1025 Ga0496106_0339949 3300048909 Bacteria 1205
1026 Ga0496106_0668176 3300048909 Bacteria 829
1027 Ga0496106_0956741 3300048909 Bacteria 675
1028 Ga0496106_1490131 3300048909 Bacteria 521
1029 Ga0496107_0040691 3300048910 Bacteria 3337
1030 Ga0496107_0082877 3300048910 Bacteria 2338
1031 Ga0496107_0362836 3300048910 Bacteria 1078
1032 Ga0496107_0418638 3300048910 Bacteria 996
1033 Ga0496107_0617340 3300048910 Bacteria 801
1034 Ga0496107_0646932 3300048910 Bacteria 779
1035 Ga0496107_0891784 3300048910 Bacteria 648
1036 Ga0496108_0023155 3300048911 Bacteria 5108
1037 Ga0496108_0032768 3300048911 Bacteria 4316
1038 Ga0496108_0192586 3300048911 Bacteria 1767
1039 Ga0496108_0471467 3300048911 Bacteria 1097
1040 Ga0496108_0618741 3300048911 Bacteria 943
1041 Ga0496108_0636239 3300048911 Bacteria 928
1042 Ga0496108_0953899 3300048911 Bacteria 734
1043 Ga0496108_1006250 3300048911 Bacteria 712
1044 Ga0496108_1217472 3300048911 Bacteria 636
1045 Ga0496109_0011825 3300048912 Bacteria 7514
1046 Ga0496109_0018556 3300048912 Bacteria 6111
1047 Ga0496109_0066214 3300048912 Bacteria 3307
1048 Ga0496109_0073561 3300048912 Bacteria 3140
1049 Ga0496109_0092134 3300048912 Bacteria 2803
1050 Ga0496109_0435065 3300048912 Bacteria 1239
1051 Ga0496109_0458040 3300048912 Bacteria 1204
1052 Ga0496109_0469310 3300048912 Bacteria 1188
1053 Ga0496109_0630366 3300048912 Bacteria 1009
1054 Ga0496109_1249266 3300048912 Bacteria 679
1055 Ga0496110_0009095 3300048913 Bacteria 8017
1056 Ga0496110_0062693 3300048913 Bacteria 3284
1057 Ga0496110_0111825 3300048913 Bacteria 2455
1058 Ga0496110_0138170 3300048913 Bacteria 2203
1059 Ga0496110_1125418 3300048913 Bacteria 693
1060 Ga0496110_1276520 3300048913 Bacteria 643
1061 Ga0496110_1338079 3300048913 Bacteria 626
1062 Ga0496110_1371737 3300048913 Bacteria 616
1063 Ga0496111_0002908 3300048914 Bacteria 10465
1064 Ga0496111_0081282 3300048914 Bacteria 2365
1065 Ga0496111_0171692 3300048914 Bacteria 1611
1066 Ga0496111_0188171 3300048914 Bacteria 1535
1067 Ga0496111_0357272 3300048914 Bacteria 1081
1068 Ga0496111_0430765 3300048914 Bacteria 974
1069 Ga0496111_0512930 3300048914 Bacteria 882
1070 Ga0496111_0786568 3300048914 Bacteria 689
1071 Ga0496111_0790208 3300048914 Bacteria 687
1072 Ga0496111_0877483 3300048914 Bacteria 647
1073 Ga0496111_1174909 3300048914 Bacteria 545
1074 Ga0496112_0209718 3300048915 Bacteria 1906
1075 Ga0496112_0500081 3300048915 Bacteria 1151
1076 Ga0496112_0663507 3300048915 Bacteria 972
1077 Ga0496112_1184511 3300048915 Bacteria 681
1078 Ga0496113_0082131 3300048916 Bacteria 2471
1079 Ga0496113_0477004 3300048916 Bacteria 1002
1080 Ga0496113_0578509 3300048916 Bacteria 900
1081 Ga0496114_0045834 3300048917 Bacteria 3633
1082 Ga0496114_0053634 3300048917 Bacteria 3361
1083 Ga0496114_0057334 3300048917 Bacteria 3251
1084 Ga0496114_0161756 3300048917 Bacteria 1947
1085 Ga0496114_0241626 3300048917 Bacteria 1588
1086 Ga0496114_0328466 3300048917 Bacteria 1352
1087 Ga0496114_0403540 3300048917 Bacteria 1210
1088 Ga0496114_0467899 3300048917 Bacteria 1116
1089 Ga0496114_0505345 3300048917 Bacteria 1069
1090 Ga0496114_0549470 3300048917 Bacteria 1020
1091 Ga0496114_0665936 3300048917 Bacteria 915
1092 Ga0496114_0841424 3300048917 Bacteria 797
1093 Ga0496114_0985004 3300048917 Bacteria 726
1094 Ga0496114_1080707 3300048917 Bacteria 687
1095 Ga0496114_1355387 3300048917 Bacteria 598
1096 Ga0496114_1746814 3300048917 Bacteria 510
1097 Ga0496115_0001053 3300048918 Bacteria 20003
1098 Ga0496115_0294981 3300048918 Bacteria 1329
1099 Ga0496124_0207881 3300048927 Bacteria 1483
1100 Ga0496124_0916845 3300048927 Bacteria 530
1101 Ga0501307_034436 3300049162 Bacteria 715
1102 Ga0501291_036161 3300049514 Bacteria 852
1103 Ga0501311_027348 3300049527 Bacteria 809
1104 Ga0501311_107219 3300049527 Bacteria 500
1105 Ga0501323_055930 3300049539 Bacteria 607
1106 Ga0501324_027046 3300049540 Bacteria 611
1107 Ga0501031_0002572 3300049568 Bacteria 11555
1108 Ga0501031_0055271 3300049568 Bacteria 2587
1109 Ga0501031_0102489 3300049568 Bacteria 1867
1110 Ga0501031_0114560 3300049568 Bacteria 1761
1111 Ga0501031_0232391 3300049568 Bacteria 1200
1112 Ga0501031_0458521 3300049568 Bacteria 823
1113 Ga0501031_0583582 3300049568 Bacteria 719
1114 Ga0501031_0822940 3300049568 Bacteria 595
1115 Ga0501031_0876639 3300049568 Bacteria 575
1116 Ga0501032_0001212 3300049569 Bacteria 20635
1117 Ga0501032_0414597 3300049569 Bacteria 864
1118 Ga0501032_0565001 3300049569 Bacteria 725
1119 Ga0501032_0594548 3300049569 Bacteria 704
1120 Ga0501032_0646648 3300049569 Bacteria 672
1121 Ga0501033_0008061 3300049570 Bacteria 8158
1122 Ga0501033_0131599 3300049570 Bacteria 1812
1123 Ga0501033_0214508 3300049570 Bacteria 1372
1124 Ga0501033_0570038 3300049570 Bacteria 779
1125 Ga0501033_0871309 3300049570 Bacteria 606
1126 Ga0501034_0006278 3300049571 Bacteria 12789
1127 Ga0501034_0158844 3300049571 Bacteria 2233
1128 Ga0501036_0008586 3300049572 Bacteria 8379
1129 Ga0501036_0012956 3300049572 Bacteria 6923
1130 Ga0501036_0019876 3300049572 Bacteria 5639
1131 Ga0501036_0071186 3300049572 Bacteria 2940
1132 Ga0501036_0196008 3300049572 Bacteria 1699
1133 Ga0501036_0317640 3300049572 Bacteria 1302
1134 Ga0501036_0370101 3300049572 Bacteria 1196
1135 Ga0501036_0557629 3300049572 Bacteria 952
1136 Ga0501036_0773226 3300049572 Bacteria 792
1137 Ga0501036_1635440 3300049572 Bacteria 520
1138 Ga0501037_0000836 3300049573 Bacteria 23004
1139 Ga0501037_0028438 3300049573 Bacteria 4129
1140 Ga0501037_0104942 3300049573 Bacteria 2037
1141 Ga0501037_0174556 3300049573 Bacteria 1526
1142 Ga0501037_0247666 3300049573 Bacteria 1248
1143 Ga0501037_0342779 3300049573 Bacteria 1032
1144 Ga0501037_0368765 3300049573 Bacteria 988
1145 Ga0501037_0646738 3300049573 Bacteria 707
1146 Ga0501037_0669714 3300049573 Bacteria 692
1147 Ga0501038_0012780 3300049574 Bacteria 7668
1148 Ga0501038_0099125 3300049574 Bacteria 2429
1149 Ga0501038_0462595 3300049574 Bacteria 974
1150 Ga0501038_1045226 3300049574 Bacteria 598
1151 Ga0501039_0006931 3300049575 Bacteria 8625
1152 Ga0501039_0007687 3300049575 Bacteria 8228
1153 Ga0501039_0017109 3300049575 Bacteria 5560
1154 Ga0501039_0218394 3300049575 Bacteria 1499
1155 Ga0501039_0406298 3300049575 Bacteria 1069
1156 Ga0501039_0443677 3300049575 Bacteria 1019
1157 Ga0501039_0445896 3300049575 Bacteria 1016
1158 Ga0501039_0789178 3300049575 Bacteria 741
1159 Ga0501039_0918402 3300049575 Bacteria 681
1160 Ga0501039_1212115 3300049575 Bacteria 583
1161 Ga0501039_1592677 3300049575 Bacteria 501
1162 Ga0501040_0007931 3300049576 Bacteria 6886
1163 Ga0501040_0016197 3300049576 Bacteria 4929
1164 Ga0501040_0090901 3300049576 Bacteria 2122
1165 Ga0501040_0422601 3300049576 Bacteria 958
1166 Ga0501040_0779337 3300049576 Bacteria 692
1167 Ga0501040_0826673 3300049576 Bacteria 670
1168 Ga0501040_1143943 3300049576 Bacteria 565
1169 Ga0501041_0001518 3300049577 Bacteria 12874
1170 Ga0501041_0015469 3300049577 Bacteria 4530
1171 Ga0501041_0115663 3300049577 Bacteria 1665
1172 Ga0501041_0126443 3300049577 Bacteria 1591
1173 Ga0501041_0187938 3300049577 Bacteria 1294
1174 Ga0501041_0222281 3300049577 Bacteria 1185
1175 Ga0501041_0616911 3300049577 Bacteria 693
1176 Ga0501041_0760679 3300049577 Bacteria 621
1177 Ga0501042_0015097 3300049578 Bacteria 5281
1178 Ga0501042_0038752 3300049578 Bacteria 3384
1179 Ga0501042_0103321 3300049578 Bacteria 2050
1180 Ga0501042_0503196 3300049578 Bacteria 880
1181 Ga0501042_1315790 3300049578 Bacteria 527
1182 Ga0501043_0005580 3300049579 Bacteria 10135
1183 Ga0501043_0040260 3300049579 Bacteria 3673
1184 Ga0501043_1006288 3300049579 Bacteria 593
1185 Ga0501046_0015697 3300049580 Bacteria 6357
1186 Ga0501046_0035677 3300049580 Bacteria 4007
1187 Ga0501046_0746690 3300049580 Bacteria 688
1188 Ga0501046_0958577 3300049580 Bacteria 595
1189 Ga0501046_1072862 3300049580 Bacteria 557
1190 Ga0501047_0000072 3300049581 Bacteria 126542
1191 Ga0501047_0001607 3300049581 Bacteria 22028
1192 Ga0501047_0367951 3300049581 Bacteria 1273
1193 Ga0501048_0015295 3300049582 Bacteria 5666
1194 Ga0501048_0092611 3300049582 Bacteria 2131
1195 Ga0501048_0184517 3300049582 Bacteria 1479
1196 Ga0501048_0191308 3300049582 Bacteria 1450
1197 Ga0501048_0474050 3300049582 Bacteria 897
1198 Ga0501048_1076913 3300049582 Bacteria 578
1199 Ga0501067_0002181 3300049583 Bacteria 10797
1200 Ga0501067_0004018 3300049583 Bacteria 8115
1201 Ga0501067_0013763 3300049583 Bacteria 4479
1202 Ga0501067_0058965 3300049583 Bacteria 2125
1203 Ga0501067_0185940 3300049583 Bacteria 1157
1204 Ga0501067_0199998 3300049583 Bacteria 1113
1205 Ga0501067_0208202 3300049583 Bacteria 1089
1206 Ga0501067_0245086 3300049583 Bacteria 997
1207 Ga0501067_0341939 3300049583 Bacteria 834
1208 Ga0501067_0418626 3300049583 Bacteria 747
1209 Ga0501068_0003236 3300049584 Bacteria 8730
1210 Ga0501068_0018233 3300049584 Bacteria 4066
1211 Ga0501068_0047246 3300049584 Bacteria 2596
1212 Ga0501068_0051891 3300049584 Bacteria 2482
1213 Ga0501068_0082305 3300049584 Bacteria 1977
1214 Ga0501068_0418334 3300049584 Bacteria 865
1215 Ga0501068_0496504 3300049584 Bacteria 791
1216 Ga0501069_0003896 3300049585 Bacteria 7693
1217 Ga0501069_0069416 3300049585 Bacteria 1973
1218 Ga0501069_0075648 3300049585 Bacteria 1892
1219 Ga0501069_0105900 3300049585 Bacteria 1598
1220 Ga0501069_0108318 3300049585 Bacteria 1581
1221 Ga0501069_0126822 3300049585 Bacteria 1460
1222 Ga0501069_0225420 3300049585 Bacteria 1090
1223 Ga0501069_0232788 3300049585 Bacteria 1073
1224 Ga0501069_0291900 3300049585 Bacteria 955
1225 Ga0501069_0641964 3300049585 Bacteria 638
1226 Ga0501069_0805429 3300049585 Unclassified 569
1227 Ga0501069_0807536 3300049585 Bacteria 569
1228 Ga0501070_0001680 3300049586 Bacteria 19600
1229 Ga0501070_0002630 3300049586 Bacteria 15679
1230 Ga0501070_0008861 3300049586 Bacteria 8503
1231 Ga0501070_0022760 3300049586 Bacteria 5245
1232 Ga0501070_0180153 3300049586 Bacteria 1739
1233 Ga0501070_0381976 3300049586 Bacteria 1141
1234 Ga0501070_0439120 3300049586 Bacteria 1053
1235 Ga0501070_0539223 3300049586 Bacteria 935
1236 Ga0501070_0580035 3300049586 Bacteria 895
1237 Ga0501070_0747712 3300049586 Bacteria 771
1238 Ga0501071_0000108 3300049587 Bacteria 32155
1239 Ga0501071_0001602 3300049587 Bacteria 13270
1240 Ga0501071_0081711 3300049587 Bacteria 2365
1241 Ga0501071_0110608 3300049587 Bacteria 2030
1242 Ga0501071_0150375 3300049587 Bacteria 1737
1243 Ga0501071_0272135 3300049587 Bacteria 1281
1244 Ga0501071_0554806 3300049587 Bacteria 882
1245 Ga0501071_0801199 3300049587 Bacteria 726
1246 Ga0501071_1041602 3300049587 Bacteria 632
1247 Ga0501071_1098280 3300049587 Bacteria 615
1248 Ga0501071_1473934 3300049587 Bacteria 525
1249 Ga0501072_0001898 3300049588 Bacteria 15570
1250 Ga0501072_0042055 3300049588 Bacteria 3589
1251 Ga0501072_0065449 3300049588 Bacteria 2866
1252 Ga0501072_0084578 3300049588 Bacteria 2515
1253 Ga0501072_0790243 3300049588 Bacteria 744
1254 Ga0501072_1380020 3300049588 Bacteria 545
1255 Ga0501073_0004339 3300049589 Bacteria 10649
1256 Ga0501073_0008201 3300049589 Bacteria 7747
1257 Ga0501073_0009415 3300049589 Bacteria 7213
1258 Ga0501073_0170287 3300049589 Bacteria 1507
1259 Ga0501073_1160285 3300049589 Bacteria 530
1260 Ga0501074_0000517 3300049590 Bacteria 23715
1261 Ga0501074_0014007 3300049590 Bacteria 5829
1262 Ga0501074_0033398 3300049590 Bacteria 3728
1263 Ga0501074_0102899 3300049590 Bacteria 2044
1264 Ga0501074_0286234 3300049590 Bacteria 1171
1265 Ga0501074_0388369 3300049590 Bacteria 990
1266 Ga0501074_0647778 3300049590 Bacteria 746
1267 Ga0501075_0090711 3300049591 Bacteria 2319
1268 Ga0501075_0274446 3300049591 Bacteria 1285
1269 Ga0501075_0566983 3300049591 Bacteria 866
1270 Ga0501075_0668492 3300049591 Bacteria 792
1271 Ga0501075_0862178 3300049591 Bacteria 689
1272 Ga0501075_0902399 3300049591 Bacteria 672
1273 Ga0501076_0003333 3300049592 Bacteria 11268
1274 Ga0501076_0051564 3300049592 Bacteria 3257
1275 Ga0501076_0078789 3300049592 Bacteria 2644
1276 Ga0501076_0517229 3300049592 Bacteria 984
1277 Ga0501076_0679460 3300049592 Bacteria 850
1278 Ga0501076_1005584 3300049592 Bacteria 687
1279 Ga0501077_0003084 3300049593 Bacteria 10018
1280 Ga0501077_0012750 3300049593 Bacteria 5265
1281 Ga0501077_0023052 3300049593 Bacteria 3948
1282 Ga0501077_0071766 3300049593 Bacteria 2195
1283 Ga0501077_0199282 3300049593 Bacteria 1272
1284 Ga0501202_026952 3300049652 Bacteria 1179
1285 Ga0501202_082951 3300049652 Bacteria 756
1286 Ga0501206_049981 3300049653 Bacteria 664
1287 Ga0501217_033097 3300049661 Bacteria 1283
1288 Ga0501243_017725 3300049675 Bacteria 1156
1289 Ga0501079_0007167 3300049741 Bacteria 8417
1290 Ga0501079_0012242 3300049741 Bacteria 6549
1291 Ga0501079_0049083 3300049741 Bacteria 3257
1292 Ga0501079_0208952 3300049741 Bacteria 1525
1293 Ga0501079_0688790 3300049741 Bacteria 804
1294 Ga0501079_0743481 3300049741 Bacteria 772
1295 Ga0501079_1277114 3300049741 Bacteria 578
1296 Ga0501079_1283680 3300049741 Bacteria 576
1297 Ga0501080_0000361 3300049742 Bacteria 35108
1298 Ga0501080_0004573 3300049742 Bacteria 12334
1299 Ga0501080_0087116 3300049742 Bacteria 2901
1300 Ga0501080_0121371 3300049742 Bacteria 2421
1301 Ga0501080_0644486 3300049742 Bacteria 938
1302 Ga0501081_0010183 3300049743 Bacteria 6135
1303 Ga0501081_0318181 3300049743 Bacteria 1143
1304 Ga0501083_0005579 3300049744 Bacteria 8909
1305 Ga0501083_0246691 3300049744 Bacteria 1162
1306 Ga0501083_0918029 3300049744 Bacteria 570
1307 Ga0501083_0977183 3300049744 Unclassified 551
1308 Ga0501271_013784 3300049768 Bacteria 889
1309 Ga0501035_0005086 3300049822 Bacteria 12462
1310 Ga0501035_0554317 3300049822 Bacteria 941
1311 Ga0501035_0999873 3300049822 Bacteria 658
1312 Ga0501044_0005927 3300049823 Bacteria 13541
1313 Ga0501044_0158949 3300049823 Bacteria 2238
1314 Ga0501044_0432368 3300049823 Bacteria 1225
1315 Ga0501044_0564339 3300049823 Bacteria 1034
1316 Ga0501044_0817724 3300049823 Bacteria 810
1317 Ga0501044_1198377 3300049823 Bacteria 627
1318 Ga0501044_1364078 3300049823 Bacteria 575
1319 Ga0501044_1471594 3300049823 Bacteria 546
1320 Ga0501045_0014996 3300049824 Bacteria 5499
1321 Ga0501045_0146406 3300049824 Bacteria 1757
1322 Ga0501045_0170785 3300049824 Bacteria 1619
1323 Ga0501045_0367052 3300049824 Bacteria 1071
1324 Ga0501045_0938898 3300049824 Bacteria 635
1325 Ga0501045_1026408 3300049824 Bacteria 604
1326 Ga0501045_1244408 3300049824 Bacteria 542
1327 Ga0501212_069666 3300049851 Bacteria 621
1328 nmdc:mga03683_121919_c1 3300050489 Bacteria 1160
1329 nmdc:mga03683_91187_c1 3300050489 Bacteria 835
1330 nmdc:mga03n38_23326_c1 3300050490 Bacteria 2516
1331 nmdc:mga03n38_27426_c1 3300050490 Bacteria 2363
1332 nmdc:mga03n38_301779_c1 3300050490 Bacteria 860
1333 nmdc:mga03n38_470672_c1 3300050490 Bacteria 701
1334 nmdc:mga03n38_624460_c1 3300050490 Bacteria 616
1335 nmdc:mga00v17_126040_c1 3300050491 Bacteria 1634
1336 nmdc:mga00v17_131259_c1 3300050491 Bacteria 1601
1337 nmdc:mga00v17_153617_c1 3300050491 Bacteria 1479
1338 nmdc:mga00v17_195991_c1 3300050491 Bacteria 1305
1339 nmdc:mga00v17_26578_c1 3300050491 Bacteria 3375
1340 nmdc:mga00v17_26998_c1 3300050491 Bacteria 3349
1341 nmdc:mga00v17_282229_c1 3300050491 Bacteria 1078
1342 nmdc:mga00v17_89688_c1 3300050491 Bacteria 1929
1343 nmdc:mga00v17_915528_c1 3300050491 Bacteria 555
1344 nmdc:mga0yw44_1064139_c1 3300050492 Bacteria 547
1345 nmdc:mga0yw44_107708_c1 3300050492 Bacteria 1783
1346 nmdc:mga0yw44_115859_c1 3300050492 Bacteria 1722
1347 nmdc:mga0yw44_142047_c1 3300050492 Bacteria 1561
1348 nmdc:mga0yw44_189355_c1 3300050492 Bacteria 1357
1349 nmdc:mga0yw44_196086_c1 3300050492 Bacteria 1333
1350 nmdc:mga0yw44_23011_c1 3300050492 Bacteria 3505
1351 nmdc:mga0yw44_276036_c1 3300050492 Bacteria 1123
1352 nmdc:mga0yw44_39590_c1 3300050492 Bacteria 2796
1353 nmdc:mga0yw44_427423_c1 3300050492 Bacteria 897
1354 nmdc:mga0yw44_429_c1 3300050492 Bacteria 14756
1355 nmdc:mga0yw44_51107_c1 3300050492 Bacteria 2502
1356 nmdc:mga0yw44_519998_c1 3300050492 Bacteria 808
1357 nmdc:mga0yw44_553324_c1 3300050492 Bacteria 781
1358 nmdc:mga0yw44_57912_c1 3300050492 Bacteria 2365
1359 nmdc:mga0yw44_69910_c1 3300050492 Bacteria 2175
1360 nmdc:mga06z11_16557_c1 3300050494 Bacteria 3324
1361 nmdc:mga06z11_285866_c1 3300050494 Bacteria 978
1362 nmdc:mga06z11_482484_c1 3300050494 Bacteria 750
1363 nmdc:mga06z11_700670_c1 3300050494 Bacteria 617
1364 nmdc:mga04h51_447460_c1 3300050495 Bacteria 546
1365 nmdc:mga04h51_495640_c1 3300050495 Bacteria 521
1366 nmdc:mga04h51_5000_c1 3300050495 Bacteria 3347
1367 nmdc:mga04h51_9575_c1 3300050495 Bacteria 2634
1368 nmdc:mga07m45_122922_c1 3300050496 Bacteria 1500
1369 nmdc:mga07m45_55078_c1 3300050496 Bacteria 2248
1370 nmdc:mga07m45_866533_c1 3300050496 Bacteria 517
1371 nmdc:mga05p37_406788_c1 3300050507 Bacteria 1587
1372 nmdc:mga05p37_986830_c1 3300050507 Bacteria 897
1373 nmdc:mga09592_630062_c1 3300050508 Bacteria 917
1374 nmdc:mga09592_873617_c1 3300050508 Bacteria 757
1375 nmdc:mga0qj67_251663_c1 3300050509 Bacteria 1433
1376 nmdc:mga0qj67_562005_c1 3300050509 Bacteria 914
1377 nmdc:mga06r32_14124_c1 3300050510 Bacteria 7242
1378 nmdc:mga08y16_1156544_c1 3300050511 Bacteria 746
1379 nmdc:mga08y16_13951_c1 3300050511 Bacteria 8458
1380 nmdc:mga08y16_1685327_c1 3300050511 Bacteria 590
1381 nmdc:mga08y16_545864_c2 3300050511 Bacteria 646
1382 nmdc:mga08y16_63660_c1 3300050511 Bacteria 3852
1383 nmdc:mga0n895_1057137_c1 3300050512 Bacteria 791
1384 nmdc:mga0n895_535_c1 3300050512 Bacteria 25937
1385 nmdc:mga0rr50_184510_c1 3300050513 Bacteria 1707
1386 nmdc:mga0rr50_231255_c1 3300050513 Bacteria 1530
1387 nmdc:mga08x19_1032_c1 3300050514 Bacteria 17387
1388 nmdc:mga0a205_7445_c1 3300050515 Bacteria 9914
1389 Ga0495601_0264047 3300053077 Bacteria 1123
1390 Ga0495601_0844181 3300053077 Bacteria 580
1391 Ga0495612_0003302 3300053078 Bacteria 6687
1392 Ga0500635_0308542 3300053080 Bacteria 625
1393 Ga0495595_0230920 3300053084 Bacteria 924
1394 Ga0495595_0302999 3300053084 Bacteria 804
1395 Ga0495619_0092261 3300053085 Bacteria 2051
1396 Ga0495619_0182301 3300053085 Bacteria 1453
1397 Ga0495619_0689573 3300053085 Bacteria 695
1398 Ga0500644_0000489 3300053088 Bacteria 17298
1399 Ga0500644_0037984 3300053088 Bacteria 1578
1400 Ga0500644_0260939 3300053088 Bacteria 733
1401 Ga0500554_147461 3300053102 Bacteria 795
1402 Ga0500593_000592 3300053117 Bacteria 13905
1403 Ga0500628_148609 3300053129 Bacteria 654
1404 Ga0500559_0551658 3300053136 Bacteria 526
1405 Ga0500568_0107630 3300053139 Bacteria 1043
1406 Ga0500573_0030403 3300053140 Bacteria 3116
1407 Ga0500573_0107734 3300053140 Bacteria 1562
1408 Ga0500573_0311348 3300053140 Bacteria 782
1409 Ga0500620_083656 3300053155 Bacteria 1107
1410 Ga0501084_0004130 3300054114 Bacteria 11829
1411 Ga0501084_0028629 3300054114 Bacteria 4658
1412 Ga0501084_0059413 3300054114 Bacteria 3200
1413 Ga0501084_0148023 3300054114 Bacteria 1978
1414 Ga0501084_0465464 3300054114 Bacteria 1069
1415 Ga0501084_1423975 3300054114 Bacteria 580
1416 Ga0590077_062731 3300059426 Bacteria 844
1417 Ga0587091_171231 3300059511 Bacteria 565
1418 Ga0587128_147832 3300059630 Bacteria 533
1419 Ga0587107_133361 3300059652 Bacteria 524
1420 Ga0501082_0008254 3300060353 Bacteria 8980
1421 Ga0501082_0059879 3300060353 Bacteria 3281
1422 Ga0501082_0062182 3300060353 Bacteria 3213
1423 Ga0501082_0127882 3300060353 Bacteria 2204
1424 Ga0501082_0141089 3300060353 Bacteria 2091
1425 Ga0501082_0620617 3300060353 Bacteria 946
1426 Ga0501082_1174118 3300060353 Bacteria 671
1427 Ga0501082_1877407 3300060353 Bacteria 522
1428 Ga0466962_0003215 3300061719 Bacteria 7762
1429 Ga0466962_0009228 3300061719 Bacteria 4726
1430 Ga0466962_0049410 3300061719 Bacteria 2010
1431 Ga0466962_0058613 3300061719 Bacteria 1838
1432 Ga0530510_0069190 3300061734 Bacteria 2561
1433 Ga0530510_0085801 3300061734 Bacteria 2294
1434 Ga0530510_0146581 3300061734 Bacteria 1741
1435 Ga0530510_0149633 3300061734 Bacteria 1723
1436 Ga0530510_0259482 3300061734 Bacteria 1296
1437 Ga0530510_0313246 3300061734 Bacteria 1176
1438 Ga0530510_0644395 3300061734 Bacteria 807
1439 Ga0530510_0687048 3300061734 Bacteria 780
1440 Ga0530510_0929809 3300061734 Bacteria 665
1441 Ga0530510_1336131 3300061734 Bacteria 550
1442 Ga0501040_0767818
1443 JGI24738J21930_10130572
1444 JGI24738J21930_10132898
1445 JGI24749J21850_1028970
1446 JGI25406J46586_10095658
1447 rootH1_10021847
1448 Ga0007429J51699_1061575
1449 JGI25405J52794_10017062
1450 Ga0070658_10086969
1451 Ga0070676_10253832
1452 Ga0070676_11083428
1453 Ga0070676_11532281
1454 Ga0070683_100009719
1455 Ga0070683_100233458
1456 Ga0070683_100285940
1457 Ga0070683_100370449
1458 Ga0070683_100512918
1459 Ga0070683_100650643
1460 Ga0070683_100671788
1461 Ga0070683_101406190
1462 Ga0068869_100365160
1463 Ga0068869_100627468
1464 Ga0070666_10524548
1465 Ga0070680_100187462
1466 Ga0070682_100015312
1467 Ga0070682_100034835
1468 Ga0070682_100102526
1469 Ga0070682_101750246
1470 Ga0070682_101983347
1471 Ga0068868_100197708
1472 Ga0068868_101052334
1473 Ga0068868_101506457
1474 Ga0070660_100008562
1475 Ga0070660_100018998
1476 Ga0070660_100086786
1477 Ga0070660_101694516
1478 Ga0070660_101874927
1479 Ga0070660_101912647
1480 Ga0070691_10052760
1481 Ga0070691_10244347
1482 Ga0070691_10672253
1483 Ga0070687_100053556
1484 Ga0070687_101078732
1485 Ga0070687_101210565
1486 Ga0070661_101525808
1487 Ga0070692_10095330
1488 Ga0070692_10388353
1489 Ga0070692_10489549
1490 Ga0070692_10964769
1491 Ga0070668_100112162
1492 Ga0070668_100188181
1493 Ga0070668_100358002
1494 Ga0070668_100568034
1495 Ga0070668_101673572
1496 Ga0070675_100098713
1497 Ga0070675_100343268
1498 Ga0070675_101514669
1499 Ga0070671_100401955
1500 Ga0070674_100076977
1501 Ga0070674_100097774
1502 Ga0070674_100701608
1503 Ga0070674_101302839
1504 Ga0070674_101336798
1505 Ga0070673_100831751
1506 Ga0070673_102121210
1507 Ga0070688_100096811
1508 Ga0070688_100387983
1509 Ga0070659_100016719
1510 Ga0070659_100032751
1511 Ga0070659_100195515
1512 Ga0070659_100342419
1513 Ga0070659_100478383
1514 Ga0070659_100485414
1515 Ga0070659_100867386
1516 Ga0070667_100694735
1517 Ga0070667_102109327
1518 Ga0070714_100023518
1519 Ga0070701_10066850
1520 Ga0070701_10260346
1521 Ga0070701_10661069
1522 Ga0070700_100035874
1523 Ga0070700_100194691
1524 Ga0070700_100242287
1525 Ga0070700_100924102
1526 Ga0070700_101254718
1527 Ga0070700_101697630
1528 Ga0070708_100765853
1529 Ga0070663_100299871
1530 Ga0070663_100813679
1531 Ga0070678_100153525
1532 Ga0070678_100179670
1533 Ga0070678_100192177
1534 Ga0070678_100832039
1535 Ga0070662_100242805
1536 Ga0070662_101204002
1537 Ga0070681_10452716
1538 Ga0068867_100004521
1539 Ga0068867_100042397
1540 Ga0068867_100565142
1541 Ga0068867_100693724
1542 Ga0068867_101229218
1543 Ga0070685_10244037
1544 Ga0070685_11294109
1545 Ga0070685_11509660
1546 Ga0070707_100110080
1547 Ga0070698_100001109
1548 Ga0070698_100669749
1549 Ga0070699_100515279
1550 Ga0070679_100009296
1551 Ga0070679_100426360
1552 Ga0070679_101515074
1553 Ga0070684_100009955
1554 Ga0070684_100177218
1555 Ga0070684_100202630
1556 Ga0070684_100320923
1557 Ga0070684_100356396
1558 Ga0070684_100423642
1559 Ga0070684_101588590
1560 Ga0070684_102339418
1561 Ga0068853_100276012
1562 Ga0068853_100529227
1563 Ga0068853_100864006
1564 Ga0068853_101087352
1565 Ga0068853_101467531
1566 Ga0070672_100134831
1567 Ga0070672_100640587
1568 Ga0070672_101826239
1569 Ga0070686_100165300
1570 Ga0070696_101249112
1571 Ga0070693_100203066
1572 Ga0070693_100319411
1573 Ga0070693_100330313
1574 Ga0070693_100948249
1575 Ga0070693_101499802
1576 Ga0070665_100004100
1577 Ga0070665_100262563
1578 Ga0070704_101491345
1579 Ga0068855_100067295
1580 Ga0068855_100637333
1581 Ga0068855_100972915
1582 Ga0070664_100048998
1583 Ga0070664_100387908
1584 Ga0070664_100716569
1585 Ga0070664_102034625
1586 Ga0068857_100004625
1587 Ga0068857_101209237
1588 Ga0068854_100217223
1589 Ga0068854_100293169
1590 Ga0068854_101246697
1591 Ga0068854_101337843
1592 Ga0068854_101700591
1593 Ga0068856_100433202
1594 Ga0068856_101078897
1595 Ga0068856_101332623
1596 Ga0068856_101950798
1597 Ga0070702_100048120
1598 Ga0070702_100647182
1599 Ga0070702_101249905
1600 Ga0068852_100074976
1601 Ga0068852_100769180
1602 Ga0068852_101730810
1603 Ga0068852_102497043
1604 Ga0068859_101245350
1605 Ga0068859_102178260
1606 Ga0068864_100193021
1607 Ga0068864_100204698
1608 Ga0068864_101372735
1609 Ga0068866_10045752
1610 Ga0068866_10154966
1611 Ga0068866_10571426
1612 Ga0068866_10610339
1613 Ga0068861_100036116
1614 Ga0068861_100081817
1615 Ga0068861_100163603
1616 Ga0068861_100467399
1617 Ga0068861_101167191
1618 Ga0068861_102571693
1619 Ga0068870_10016336
1620 Ga0068870_10320545
1621 Ga0068863_101179603
1622 Ga0068858_100045587
1623 Ga0068858_100565027
1624 Ga0068858_101554333
1625 Ga0068858_102121129
1626 Ga0068860_100000237
1627 Ga0068860_100386785
1628 Ga0068862_100198936
1629 Ga0068862_100853033
1630 Ga0068862_101655450
1631 Ga0068862_102163729
1632 Ga0068862_102564985
1633 Ga0081455_10005211
1634 Ga0081455_10006193
1635 Ga0081455_10031416
1636 Ga0081538_10000428
1637 Ga0081539_10047241
1638 Ga0075365_10006292
1639 Ga0075365_10017380
1640 Ga0075365_10024864
1641 Ga0075365_10031622
1642 Ga0075365_10046184
1643 Ga0075365_10116200
1644 Ga0075365_10161190
1645 Ga0075365_10171543
1646 Ga0075365_10201112
1647 Ga0075365_10307301
1648 Ga0075365_10315598
1649 Ga0075365_10405045
1650 Ga0075365_10440853
1651 Ga0075365_10941560
1652 Ga0075365_11005309
1653 Ga0075365_11228441
1654 Ga0075365_11292786
1655 Ga0075368_10001919
1656 Ga0075368_10003530
1657 Ga0075368_10023996
1658 Ga0075363_100003768
1659 Ga0075363_100022968
1660 Ga0075363_100234505
1661 Ga0075363_100268834
1662 Ga0075363_100315434
1663 Ga0075363_100500199
1664 Ga0075364_10025977
1665 Ga0075364_10081863
1666 Ga0075364_10099101
1667 Ga0075364_10148513
1668 Ga0075364_10192118
1669 Ga0075364_10241276
1670 Ga0075432_10002344
1671 Ga0075432_10006679
1672 Ga0075432_10146408
1673 Ga0075432_10530377
1674 Ga0075362_10014354
1675 Ga0075362_10083712
1676 Ga0075362_10349564
1677 Ga0075367_10046982
1678 Ga0075367_10154403
1679 Ga0075367_10336740
1680 Ga0075366_10592548
1681 Ga0097621_100427321
1682 Ga0097621_100624168
1683 Ga0097621_100625578
1684 Ga0097621_101908630
1685 Ga0075370_10032500
1686 Ga0075370_10037500
1687 Ga0075370_10053867
1688 Ga0075370_10646666
1689 Ga0075370_10797714
1690 Ga0068871_100589516
1691 Ga0068871_100737388
1692 Ga0075428_100024363
1693 Ga0075428_100130269
1694 Ga0075428_100582980
1695 Ga0075428_100659286
1696 Ga0075428_101702835
1697 Ga0075430_101699776
1698 Ga0075431_100027797
1699 Ga0075433_10008034
1700 Ga0075433_10019906
1701 Ga0075434_100000790
1702 Ga0075434_100018722
1703 Ga0075429_100039533
1704 Ga0068865_100009130
1705 Ga0068865_100013158
1706 Ga0068865_100213986
1707 Ga0068865_100564032
1708 Ga0068865_101241414
1709 Ga0075436_100070655
1710 Ga0075436_100109664
1711 Ga0097620_101245337
1712 Ga0097620_102177941
1713 Ga0075435_100004534
1714 Ga0075435_100010687
1715 Ga0105240_11805877
1716 Ga0111539_10001116
1717 Ga0111539_10115538
1718 Ga0111539_10555578
1719 Ga0111539_12178582
1720 Ga0111539_13483269
1721 Ga0105245_10000784
1722 Ga0105245_10013521
1723 Ga0105245_10217370
1724 Ga0105245_10234858
1725 Ga0105245_10454951
1726 Ga0105245_12073563
1727 Ga0105247_10229412
1728 Ga0105247_10490636
1729 Ga0114129_10009571
1730 Ga0114129_10651037
1731 Ga0105243_10009154
1732 Ga0105243_10029217
1733 Ga0105243_10082398
1734 Ga0105243_10108500
1735 Ga0105243_10516213
1736 Ga0105243_10547293
1737 Ga0105243_10599956
1738 Ga0105243_10625974
1739 Ga0105243_11284149
1740 Ga0105243_11608031
1741 Ga0105243_11917559
1742 Ga0105241_10730309
1743 Ga0105242_10058407
1744 Ga0105242_10203773
1745 Ga0105242_10223121
1746 Ga0105242_10324702
1747 Ga0105242_12120496
1748 Ga0105248_10640200
1749 Ga0105248_10690995
1750 Ga0105248_10982496
1751 Ga0105248_12520967
1752 Ga0105237_10370582
1753 Ga0105237_10658500
1754 Ga0105237_11559717
1755 Ga0105237_11631374
1756 Ga0105238_10104155
1757 Ga0105238_10306736
1758 Ga0105238_10644430
1759 Ga0105238_12833672
1760 Ga0105249_10135909
1761 Ga0105249_10223838
1762 Ga0105249_10361030
1763 Ga0105249_10621648
1764 Ga0105249_10789355
1765 Ga0105249_11104770
1766 Ga0105249_11764053
1767 Ga0105249_11794335
1768 Ga0105249_13229679
1769 Ga0105249_13569943
1770 Ga0105239_10025063
1771 Ga0105239_10025631
1772 Ga0105239_10377368
1773 Ga0105239_10393451
1774 Ga0105239_10441979
1775 Ga0105239_11039996
1776 Ga0105239_11239046
1777 Ga0105239_11251885
1778 Ga0105239_11664473
1779 Ga0105239_11795826
1780 Ga0105239_12345681
1781 Ga0105239_13292876
1782 Ga0105246_10004511
1783 Ga0105246_10197563
1784 Ga0105246_10207269
1785 Ga0105246_10320138
1786 Ga0105246_10797071
1787 Ga0105246_11519439
1788 Ga0105246_12304057
1789 Ga0105246_12415712
1790 Ga0157329_1004908
1791 Ga0157341_1002850
1792 Ga0157319_1001748
1793 Ga0157345_1023030
1794 Ga0157347_1059840
1795 Ga0157313_1037034
1796 Ga0157324_1031350
1797 Ga0157315_1060990
1798 Ga0157326_1003780
1799 Ga0157371_10087004
1800 Ga0157371_10160623
1801 Ga0157371_10293750
1802 Ga0157371_10354094
1803 Ga0157371_11185366
1804 Ga0157370_10264443
1805 Ga0157370_11027938
1806 Ga0157370_11236407
1807 Ga0157370_11464431
1808 Ga0157370_11672520
1809 Ga0157369_10057264
1810 Ga0157369_10250867
1811 Ga0157369_10474237
1812 Ga0157369_11691093
1813 Ga0157374_10463567
1814 Ga0157374_10998224
1815 Ga0157374_11198190
1816 Ga0157374_12866168
1817 Ga0157378_10616971
1818 Ga0157378_11409136
1819 Ga0157378_11590307
1820 Ga0163162_10037964
1821 Ga0163162_10165665
1822 Ga0163162_10699096
1823 Ga0163162_10880048
1824 Ga0163162_10953710
1825 Ga0163162_10991718
1826 Ga0163162_12141496
1827 Ga0157372_10006799
1828 Ga0157372_10196315
1829 Ga0157372_10340898
1830 Ga0157372_10387888
1831 Ga0157372_10439006
1832 Ga0157372_10605056
1833 Ga0157372_11561311
1834 Ga0157372_11871357
1835 Ga0157372_12767302
1836 Ga0157375_10070197
1837 Ga0157375_10154789
1838 Ga0157375_10268601
1839 Ga0157375_10288095
1840 Ga0157375_10347642
1841 Ga0157375_10407439
1842 Ga0157375_10623105
1843 Ga0157375_10655259
1844 Ga0157375_10707989
1845 Ga0157375_10919724
1846 Ga0157375_10985650
1847 Ga0163163_10207804
1848 Ga0163163_10371732
1849 Ga0163163_10965638
1850 Ga0163163_11029407
1851 Ga0163163_11734882
1852 Ga0163163_11823228
1853 Ga0163163_12662559
1854 Ga0157380_10003865
1855 Ga0157380_10025349
1856 Ga0157380_10311376
1857 Ga0157380_10738734
1858 Ga0182008_10070344
1859 Ga0182008_10142112
1860 Ga0182008_10334886
1861 Ga0157377_10002420
1862 Ga0157377_10828088
1863 Ga0157377_10897746
1864 Ga0157377_11130082
1865 Ga0157377_11149366
1866 Ga0157379_10319028
1867 Ga0157376_10426080
1868 Ga0157376_10844694
1869 Ga0157376_10964637
1870 Ga0157376_11485512
1871 Ga0163161_10255290
1872 Ga0163161_10272722
1873 Ga0163161_10844374
1874 Ga0163161_10931748
1875 Ga0163161_10990139
1876 Ga0163161_11316386
1877 Ga0163161_12003410
1878 Ga0206356_11045432
1879 Ga0206355_1474064
1880 Ga0206351_10522411
1881 Ga0206350_10017631
1882 Ga0206354_11068423
1883 Ga0206353_10074550
1884 Ga0206353_10216600
1885 Ga0206353_11576002
1886 Ga0213876_10133516
1887 Ga0224712_10232111
1888 Ga0207697_10201355
1889 Ga0207682_10228961
1890 Ga0207642_10016931
1891 Ga0207642_10114690
1892 Ga0207642_10354691
1893 Ga0207642_10582879
1894 Ga0207642_10837576
1895 Ga0207710_10137174
1896 Ga0207710_10191245
1897 Ga0207688_10023178
1898 Ga0207688_10025639
1899 Ga0207688_10129326
1900 Ga0207688_10232666
1901 Ga0207688_10451783
1902 Ga0207688_10693185
1903 Ga0207688_10937748
1904 Ga0207688_11007464
1905 Ga0207647_10011458
1906 Ga0207647_10191704
1907 Ga0207647_10232904
1908 Ga0207647_10265991
1909 Ga0207647_10306855
1910 Ga0207645_10516514
1911 Ga0207643_10003490
1912 Ga0207643_10037488
1913 Ga0207643_10726892
1914 Ga0207705_10012685
1915 Ga0207705_10942087
1916 Ga0207707_10954079
1917 Ga0207707_11267495
1918 Ga0207671_10144000
1919 Ga0207671_10162853
1920 Ga0207671_10239136
1921 Ga0207660_11321538
1922 Ga0207662_10055716
1923 Ga0207657_10004479
1924 Ga0207657_10027478
1925 Ga0207657_10050202
1926 Ga0207657_10873637
1927 Ga0207657_11171562
1928 Ga0207652_10437966
1929 Ga0207652_10533276
1930 Ga0207646_10054603
1931 Ga0207681_11427968
1932 Ga0207694_10260070
1933 Ga0207694_10705232
1934 Ga0207694_11729332
1935 Ga0207659_10112748
1936 Ga0207659_10122010
1937 Ga0207687_10007750
1938 Ga0207687_10031535
1939 Ga0207687_10089049
1940 Ga0207687_10392237
1941 Ga0207664_10021185
1942 Ga0207644_10341144
1943 Ga0207644_10740850
1944 Ga0207690_10038937
1945 Ga0207690_10104390
1946 Ga0207690_10171780
1947 Ga0207690_10177518
1948 Ga0207690_10349331
1949 Ga0207690_10486765
1950 Ga0207690_11047723
1951 Ga0207706_10025706
1952 Ga0207706_10138591
1953 Ga0207706_10148220
1954 Ga0207706_10331879
1955 Ga0207706_10867856
1956 Ga0207686_10708021
1957 Ga0207686_11492274
1958 Ga0207709_10031220
1959 Ga0207709_10075093
1960 Ga0207709_10240490
1961 Ga0207709_10494880
1962 Ga0207709_10946058
1963 Ga0207709_11001324
1964 Ga0207669_10082943
1965 Ga0207669_10083410
1966 Ga0207669_10302691
1967 Ga0207669_11563720
1968 Ga0207669_11578060
1969 Ga0207704_10007451
1970 Ga0207704_10074232
1971 Ga0207704_10212072
1972 Ga0207704_10506540
1973 Ga0207691_10007736
1974 Ga0207691_10435869
1975 Ga0207691_10958650
1976 Ga0207691_11343843
1977 Ga0207711_10352633
1978 Ga0207711_10421491
1979 Ga0207711_10495792
1980 Ga0207689_10202976
1981 Ga0207689_10761677
1982 Ga0207689_11643269
1983 Ga0207661_10133972
1984 Ga0207661_10146461
1985 Ga0207661_10171341
1986 Ga0207661_10250278
1987 Ga0207661_10523615
1988 Ga0207661_10628778
1989 Ga0207661_10813759
1990 Ga0207661_10848868
1991 Ga0207661_10886863
1992 Ga0207661_11272465
1993 Ga0207661_11477616
1994 Ga0207679_10412219
1995 Ga0207679_10490537
1996 Ga0207679_10710591
1997 Ga0207679_10981133
1998 Ga0207679_11522531
1999 Ga0207679_11700351
2000 Ga0207679_12129599
2001 Ga0207667_10661603
2002 Ga0207667_10890745
2003 Ga0207651_11077563
2004 Ga0207712_10099681
2005 Ga0207712_10163356
2006 Ga0207712_10287048
2007 Ga0207712_10360721
2008 Ga0207712_10816847
2009 Ga0207668_10044265
2010 Ga0207668_10127223
2011 Ga0207668_11906966
2012 Ga0207640_10241322
2013 Ga0207640_10278164
2014 Ga0207640_10431235
2015 Ga0207640_11136856
2016 Ga0207640_11167579
2017 Ga0207640_11229803
2018 Ga0207658_10017447
2019 Ga0207658_10612554
2020 Ga0207658_12154622
2021 Ga0207677_10214840
2022 Ga0207677_10872935
2023 Ga0207677_11375181
2024 Ga0207703_10287576
2025 Ga0207703_11400234
2026 Ga0207639_10723903
2027 Ga0207639_11886409
2028 Ga0207678_10271749
2029 Ga0207678_10359302
2030 Ga0207678_10424293
2031 Ga0207678_10436417
2032 Ga0207678_10981732
2033 Ga0207678_11044549
2034 Ga0207678_11668786
2035 Ga0207708_10042577
2036 Ga0207708_10064834
2037 Ga0207708_10162751
2038 Ga0207708_10516949
2039 Ga0207708_11185591
2040 Ga0207708_11206609
2041 Ga0207708_11539972
2042 Ga0207708_12018224
2043 Ga0207702_10880280
2044 Ga0207702_10913944
2045 Ga0207702_11231244
2046 Ga0207641_10440161
2047 Ga0207648_10001576
2048 Ga0207648_10052869
2049 Ga0207648_10767661
2050 Ga0207648_10994035
2051 Ga0207648_11158671
2052 Ga0207676_10713395
2053 Ga0207676_10905768
2054 Ga0207676_10940089
2055 Ga0207676_12322168
2056 Ga0207674_10003282
2057 Ga0207674_10913390
2058 Ga0207674_10983585
2059 Ga0207674_11291720
2060 Ga0207675_100019126
2061 Ga0207675_100027624
2062 Ga0207675_100072241
2063 Ga0207675_101002295
2064 Ga0207675_101013152
2065 Ga0207675_102017733
2066 Ga0207683_10024133
2067 Ga0207683_10686162
2068 Ga0207683_11943957
2069 Ga0207698_10017237
2070 Ga0207698_10179653
2071 Ga0207698_11362345
2072 Ga0207698_11863031
2073 Ga0207698_11946301
2074 Ga0207698_12005461
2075 Ga0207698_12485903
2076 Ga0209371_1059702
2077 Ga0209813_10001855
2078 Ga0209813_10007379
2079 Ga0209813_10029205
2080 Ga0209974_10250496
2081 Ga0207428_10001037
2082 Ga0207428_10002082
2083 Ga0207428_10059433
2084 Ga0268266_10019655
2085 Ga0268266_10132557
2086 Ga0268266_10343366
2087 Ga0268266_10785031
2088 Ga0268266_10888330
2089 Ga0268266_10941209
2090 Ga0268266_10951369
2091 Ga0268266_12264150
2092 Ga0268265_10524707
2093 Ga0268265_10705282
2094 Ga0268265_12502348
2095 Ga0268264_10000195
2096 Ga0268264_10030690
2097 Ga0268264_12620586
2098 Ga0307517_10659924
2099 Ga0307515_10336916
2100 Ga0268256_1066836
2101 Ga0316182_1145211
2102 Ga0307513_10578670
2103 Ga0307509_10009190
2104 Ga0307408_100003860
2105 Ga0307408_100049059
2106 Ga0307408_100089115
2107 Ga0307408_100133046
2108 Ga0307408_100980822
2109 Ga0307408_101751100
2110 Ga0307405_10001103
2111 Ga0307405_10006689
2112 Ga0307405_10055925
2113 Ga0307405_10397742
2114 Ga0307405_10824029
2115 Ga0307413_10034163
2116 Ga0307413_10075719
2117 Ga0307413_10094384
2118 Ga0307413_10108459
2119 Ga0307413_11894619
2120 Ga0307410_10000104
2121 Ga0307410_10027795
2122 Ga0307410_10098455
2123 Ga0307410_10300520
2124 Ga0307410_10365397
2125 Ga0307410_10443407
2126 Ga0307410_10624960
2127 Ga0307410_11239514
2128 Ga0307410_11421478
2129 Ga0307410_11745830
2130 Ga0307410_11844957
2131 Ga0307406_10002432
2132 Ga0307406_10004038
2133 Ga0307406_10159312
2134 Ga0307406_10350080
2135 Ga0307406_10422472
2136 Ga0307406_10848067
2137 Ga0307406_11624545
2138 Ga0307407_10009633
2139 Ga0307407_10023658
2140 Ga0307407_10039378
2141 Ga0307407_10122575
2142 Ga0307407_10145777
2143 Ga0307407_10149766
2144 Ga0307407_10326575
2145 Ga0307407_10614433
2146 Ga0307407_10683118
2147 Ga0307407_10746354
2148 Ga0307407_10876417
2149 Ga0307407_11065760
2150 Ga0307407_11401788
2151 Ga0307412_10102729
2152 Ga0307412_10181827
2153 Ga0307412_10574554
2154 Ga0307412_11639144
2155 Ga0307412_12297496
2156 Ga0307409_100000362
2157 Ga0307409_100013725
2158 Ga0307409_100048235
2159 Ga0307409_100086508
2160 Ga0307409_100107296
2161 Ga0307409_100267865
2162 Ga0307409_100291161
2163 Ga0307409_100305750
2164 Ga0307409_100418477
2165 Ga0307409_100536360
2166 Ga0307409_100566233
2167 Ga0307409_100599275
2168 Ga0307409_100634940
2169 Ga0307409_101004562
2170 Ga0307409_101029679
2171 Ga0307409_101293011
2172 Ga0307409_102445044
2173 Ga0307409_102950098
2174 Ga0307416_100000240
2175 Ga0307416_100031648
2176 Ga0307416_100227355
2177 Ga0307416_100622512
2178 Ga0307416_100632438
2179 Ga0307416_100735733
2180 Ga0307416_100855586
2181 Ga0307416_101239266
2182 Ga0307416_101771688
2183 Ga0307416_101948383
2184 Ga0307416_101985962
2185 Ga0307416_102179285
2186 Ga0307414_10037621
2187 Ga0307414_10156905
2188 Ga0307414_10251761
2189 Ga0307414_10455480
2190 Ga0307414_10482798
2191 Ga0307414_10512402
2192 Ga0307411_10051114
2193 Ga0307411_10177369
2194 Ga0307411_10199084
2195 Ga0307411_11556637
2196 Ga0307411_11703303
2197 Ga0307415_100002630
2198 Ga0307415_100005693
2199 Ga0307415_100016729
2200 Ga0307415_100017773
2201 Ga0307415_100043930
2202 Ga0307415_100093526
2203 Ga0307415_100148710
2204 Ga0307415_100214462
2205 Ga0307415_100313640
2206 Ga0307415_100706245
2207 Ga0307415_101455195
2208 Ga0307415_102083043
2209 Ga0316583_10123617
2210 Ga0373939_0446523
2211 Ga0373942_0084645
2212 Ga0373961_0137155
2213 Ga0373961_0140389
2214 Ga0373962_0176903
2215 Ga0373931_0170473
2216 Ga0373931_0191330
2217 Ga0373931_0790490
2218 Ga0373927_0980654
2219 Ga0373927_1140813
2220 Ga0395899_0250603
2221 Ga0395900_0058016
2222 Ga0395900_0462585
2223 Ga0395900_0615870
2224 Ga0395898_0096517
2225 Ga0395898_0242167
2226 Ga0395905_0400837
2227 Ga0395905_0825505
2228 Ga0436364_0158595
2229 Ga0395901_0105994
2230 Ga0395901_0635055
2231 Ga0395901_0867518
2232 Ga0395901_1136481
2233 Ga0395901_2081294
2234 Ga0436365_1073144
2235 Ga0436365_1902425
2236 Ga0436362_1172283
2237 Ga0439438_175108
2238 Ga0439439_0115796
2239 Ga0439465_0085262
2240 Ga0451787_365079
2241 Ga0451791_0511011
2242 Ga0451791_1305444
2243 Ga0451791_1611175
2244 Ga0451793_1110791
2245 Ga0451795_0714571
2246 Ga0451802_0295209
2247 Ga0451802_0708292
2248 Ga0451806_611162
2249 Ga0451804_0216958
2250 Ga0451804_0628311
2251 Ga0451807_0228856
2252 Ga0451807_0305274
2253 Ga0451833_0680881
2254 Ga0451833_0873441
2255 Ga0451833_0977379
2256 Ga0451833_1020092
2257 Ga0451837_1623172
2258 Ga0451839_1658216
2259 Ga0451841_1334235
2260 Ga0451849_1036478
2261 Ga0451851_0539608
2262 Ga0451853_0904534
2263 Ga0451853_1786633
2264 Ga0451853_3744708
2265 Ga0439431_0007629
2266 Ga0439431_0052178
2267 Ga0439431_0199582
2268 Ga0439433_0156486
2269 Ga0439442_020861
2270 Ga0439448_0021155
2271 Ga0439448_0062084
2272 Ga0439448_0282041
2273 Ga0439432_058402
2274 Ga0439450_016080
2275 Ga0439450_093445
2276 Ga0439462_0061846
2277 Ga0439463_000348
2278 Ga0439463_092384
2279 Ga0439463_118824
2280 Ga0450888_004963
2281 Ga0450907_016303
2282 Ga0439446_0038802
2283 Ga0439434_0017161
2284 Ga0439435_0011795
2285 Ga0439444_0010182
2286 Ga0439444_0021683
2287 Ga0439444_0094772
2288 Ga0439464_0075031
2289 Ga0439460_0027857
2290 Ga0439460_0062596
2291 Ga0439440_0001208
2292 Ga0439440_0002278
2293 Ga0439440_0006577
2294 Ga0439440_0112705
2295 Ga0466969_0006155
2296 Ga0466972_0018668
2297 Ga0466972_0192411
2298 Ga0466965_0028706
2299 Ga0466965_0051778
2300 Ga0466965_0114997
2301 Ga0466965_0206835
2302 Ga0466965_0293639
2303 Ga0466965_0895214
2304 Ga0466966_0012013
2305 Ga0466966_0449487
2306 Ga0466961_0018930
2307 Ga0466961_0057181
2308 Ga0466961_0110784
2309 Ga0466961_0815230
2310 Ga0466961_0840479
2311 Ga0466963_0086148
2312 Ga0466963_0123749
2313 Ga0466963_0138856
2314 Ga0466963_0145117
2315 Ga0466963_0679117
2316 Ga0466963_0855076
2317 Ga0466964_0016610
2318 Ga0466964_0029859
2319 Ga0466964_0033426
2320 Ga0466964_0351663
2321 Ga0466964_0407436
2322 Ga0466964_0810946
2323 Ga0466971_0000730
2324 Ga0466971_0001409
2325 Ga0466971_0011981
2326 Ga0466971_0153252
2327 Ga0466971_0419921
2328 Ga0466970_0006749
2329 Ga0466970_0161703
2330 Ga0466970_0183178
2331 Ga0466970_0284074
2332 Ga0466970_0358850
2333 Ga0466970_0526253
2334 Ga0466957_0044095
2335 Ga0466957_0176632
2336 Ga0466957_0430288
2337 Ga0466957_1122798
2338 Ga0466960_0007519
2339 Ga0466960_0011527
2340 Ga0466960_0016613
2341 Ga0466960_0280963
2342 Ga0466960_0341575
2343 Ga0466960_0636665
2344 Ga0466959_0000507
2345 Ga0466959_0456740
2346 Ga0466959_0839745
2347 Ga0451576_0789764
2348 Ga0466958_0010466
2349 Ga0466958_0146855
2350 Ga0466958_0898824
2351 Ga0466967_0005026
2352 Ga0466967_0029175
2353 Ga0466967_0045804
2354 Ga0466967_0067268
2355 Ga0466967_0081289
2356 Ga0466967_0231381
2357 Ga0466967_0252729
2358 Ga0466967_0363519
2359 Ga0466967_0584214
2360 Ga0466967_0615417
2361 Ga0466967_0939353
2362 Ga0466967_0971458
2363 Ga0466967_1117634
2364 Ga0466967_1389603
2365 Ga0466967_1479483
2366 Ga0466967_1742535
2367 Ga0495617_213429
2368 Ga0495592_0149061
2369 Ga0495629_0216853
2370 Ga0495641_0156047
2371 Ga0495641_0431782
2372 Ga0495651_0000079
2373 Ga0495653_0003879
2374 Ga0495653_0475047
2375 Ga0495582_0184918
2376 Ga0495582_0237641
2377 Ga0495639_0737129
2378 Ga0495662_0475655
2379 Ga0495664_0058669
2380 Ga0495664_0314590
2381 Ga0495607_0310115
2382 Ga0495608_0305281
2383 Ga0495608_0399435
2384 Ga0495616_0158666
2385 Ga0495620_0183825
2386 Ga0495620_0233352
2387 Ga0495631_0077678
2388 Ga0495637_0219971
2389 Ga0495663_0132797
2390 Ga0495652_0003588
2391 Ga0495587_0109041
2392 Ga0495598_0111741
2393 Ga0495598_0195773
2394 Ga0495609_0250175
2395 Ga0495609_0268829
2396 Ga0495645_0059107
2397 Ga0495645_0542076
2398 Ga0495667_0769789
2399 Ga0495656_0043278
2400 Ga0495656_0244050
2401 Ga0495668_0160408
2402 Ga0495634_0033758
2403 Ga0495611_0215002
2404 Ga0495635_0002665
2405 Ga0495635_0182110
2406 Ga0495635_0293990
2407 Ga0495659_0396631
2408 Ga0495661_0484120
2409 Ga0495623_0228214
2410 Ga0495647_0155460
2411 Ga0495658_0985627
2412 Ga0495658_1001831
2413 Ga0495658_1005295
2414 Ga0495669_0616421
2415 Ga0495669_0655641
2416 Ga0495613_0331964
2417 Ga0495613_0733140
2418 Ga0495624_0184178
2419 Ga0495670_0051441
2420 Ga0495670_0217389
2421 Ga0495671_0098607
2422 Ga0495649_0387298
2423 Ga0495600_0008443
2424 Ga0495600_0171609
2425 Ga0495600_0876464
2426 Ga0495581_0443904
2427 Ga0495581_0619403
2428 Ga0495676_0829248
2429 Ga0495680_0291954
2430 Ga0495680_0898277
2431 Ga0495680_1105983
2432 Ga0495683_0122687
2433 Ga0495679_193175
2434 Ga0496100_0017456
2435 Ga0496100_0226587
2436 Ga0496100_0565868
2437 Ga0496100_1016902
2438 Ga0496100_1249913
2439 Ga0496101_0070926
2440 Ga0496101_0117874
2441 Ga0496101_0138320
2442 Ga0496101_0293802
2443 Ga0496101_0577514
2444 Ga0496101_0678755
2445 Ga0496101_0970682
2446 Ga0496101_1526655
2447 Ga0496102_0009949
2448 Ga0496102_0015093
2449 Ga0496102_0123928
2450 Ga0496102_0129045
2451 Ga0496102_0236863
2452 Ga0496102_0336690
2453 Ga0496102_1007418
2454 Ga0496102_1237875
2455 Ga0496102_1408699
2456 Ga0496102_1687167
2457 Ga0496103_0077842
2458 Ga0496103_0404688
2459 Ga0496103_0943341
2460 Ga0496104_0002251
2461 Ga0496104_0839878
2462 Ga0496105_0001445
2463 Ga0496105_0444091
2464 Ga0496105_0712931
2465 Ga0496106_0145577
2466 Ga0496106_0339949
2467 Ga0496106_0668176
2468 Ga0496106_0956741
2469 Ga0496106_1490131
2470 Ga0496107_0040691
2471 Ga0496107_0082877
2472 Ga0496107_0362836
2473 Ga0496107_0418638
2474 Ga0496107_0617340
2475 Ga0496107_0646932
2476 Ga0496107_0891784
2477 Ga0496108_0023155
2478 Ga0496108_0032768
2479 Ga0496108_0192586
2480 Ga0496108_0471467
2481 Ga0496108_0618741
2482 Ga0496108_0636239
2483 Ga0496108_0953899
2484 Ga0496108_1006250
2485 Ga0496108_1217472
2486 Ga0496109_0011825
2487 Ga0496109_0018556
2488 Ga0496109_0066214
2489 Ga0496109_0073561
2490 Ga0496109_0092134
2491 Ga0496109_0435065
2492 Ga0496109_0458040
2493 Ga0496109_0469310
2494 Ga0496109_0630366
2495 Ga0496109_1249266
2496 Ga0496110_0009095
2497 Ga0496110_0062693
2498 Ga0496110_0111825
2499 Ga0496110_0138170
2500 Ga0496110_1125418
2501 Ga0496110_1276520
2502 Ga0496110_1338079
2503 Ga0496110_1371737
2504 Ga0496111_0002908
2505 Ga0496111_0081282
2506 Ga0496111_0171692
2507 Ga0496111_0188171
2508 Ga0496111_0357272
2509 Ga0496111_0430765
2510 Ga0496111_0512930
2511 Ga0496111_0786568
2512 Ga0496111_0790208
2513 Ga0496111_0877483
2514 Ga0496111_1174909
2515 Ga0496112_0209718
2516 Ga0496112_0500081
2517 Ga0496112_0663507
2518 Ga0496112_1184511
2519 Ga0496113_0082131
2520 Ga0496113_0477004
2521 Ga0496113_0578509
2522 Ga0496114_0045834
2523 Ga0496114_0053634
2524 Ga0496114_0057334
2525 Ga0496114_0161756
2526 Ga0496114_0241626
2527 Ga0496114_0328466
2528 Ga0496114_0403540
2529 Ga0496114_0467899
2530 Ga0496114_0505345
2531 Ga0496114_0549470
2532 Ga0496114_0665936
2533 Ga0496114_0841424
2534 Ga0496114_0985004
2535 Ga0496114_1080707
2536 Ga0496114_1355387
2537 Ga0496114_1746814
2538 Ga0496115_0001053
2539 Ga0496115_0294981
2540 Ga0496124_0207881
2541 Ga0496124_0916845
2542 Ga0501307_034436
2543 Ga0501291_036161
2544 Ga0501311_027348
2545 Ga0501311_107219
2546 Ga0501323_055930
2547 Ga0501324_027046
2548 Ga0501031_0002572
2549 Ga0501031_0055271
2550 Ga0501031_0102489
2551 Ga0501031_0114560
2552 Ga0501031_0232391
2553 Ga0501031_0458521
2554 Ga0501031_0583582
2555 Ga0501031_0822940
2556 Ga0501031_0876639
2557 Ga0501032_0001212
2558 Ga0501032_0414597
2559 Ga0501032_0565001
2560 Ga0501032_0594548
2561 Ga0501032_0646648
2562 Ga0501033_0008061
2563 Ga0501033_0131599
2564 Ga0501033_0214508
2565 Ga0501033_0570038
2566 Ga0501033_0871309
2567 Ga0501034_0006278
2568 Ga0501034_0158844
2569 Ga0501036_0008586
2570 Ga0501036_0012956
2571 Ga0501036_0019876
2572 Ga0501036_0071186
2573 Ga0501036_0196008
2574 Ga0501036_0317640
2575 Ga0501036_0370101
2576 Ga0501036_0557629
2577 Ga0501036_0773226
2578 Ga0501036_1635440
2579 Ga0501037_0000836
2580 Ga0501037_0028438
2581 Ga0501037_0104942
2582 Ga0501037_0174556
2583 Ga0501037_0247666
2584 Ga0501037_0342779
2585 Ga0501037_0368765
2586 Ga0501037_0646738
2587 Ga0501037_0669714
2588 Ga0501038_0012780
2589 Ga0501038_0099125
2590 Ga0501038_0462595
2591 Ga0501038_1045226
2592 Ga0501039_0006931
2593 Ga0501039_0007687
2594 Ga0501039_0017109
2595 Ga0501039_0218394
2596 Ga0501039_0406298
2597 Ga0501039_0443677
2598 Ga0501039_0445896
2599 Ga0501039_0789178
2600 Ga0501039_0918402
2601 Ga0501039_1212115
2602 Ga0501039_1592677
2603 Ga0501040_0007931
2604 Ga0501040_0016197
2605 Ga0501040_0090901
2606 Ga0501040_0422601
2607 Ga0501040_0779337
2608 Ga0501040_0826673
2609 Ga0501040_1143943
2610 Ga0501041_0001518
2611 Ga0501041_0015469
2612 Ga0501041_0115663
2613 Ga0501041_0126443
2614 Ga0501041_0187938
2615 Ga0501041_0222281
2616 Ga0501041_0616911
2617 Ga0501041_0760679
2618 Ga0501042_0015097
2619 Ga0501042_0038752
2620 Ga0501042_0103321
2621 Ga0501042_0503196
2622 Ga0501042_1315790
2623 Ga0501043_0005580
2624 Ga0501043_0040260
2625 Ga0501043_1006288
2626 Ga0501046_0015697
2627 Ga0501046_0035677
2628 Ga0501046_0746690
2629 Ga0501046_0958577
2630 Ga0501046_1072862
2631 Ga0501047_0000072
2632 Ga0501047_0001607
2633 Ga0501047_0367951
2634 Ga0501048_0015295
2635 Ga0501048_0092611
2636 Ga0501048_0184517
2637 Ga0501048_0191308
2638 Ga0501048_0474050
2639 Ga0501048_1076913
2640 Ga0501067_0002181
2641 Ga0501067_0004018
2642 Ga0501067_0013763
2643 Ga0501067_0058965
2644 Ga0501067_0185940
2645 Ga0501067_0199998
2646 Ga0501067_0208202
2647 Ga0501067_0245086
2648 Ga0501067_0341939
2649 Ga0501067_0418626
2650 Ga0501068_0003236
2651 Ga0501068_0018233
2652 Ga0501068_0047246
2653 Ga0501068_0051891
2654 Ga0501068_0082305
2655 Ga0501068_0418334
2656 Ga0501068_0496504
2657 Ga0501069_0003896
2658 Ga0501069_0069416
2659 Ga0501069_0075648
2660 Ga0501069_0105900
2661 Ga0501069_0108318
2662 Ga0501069_0126822
2663 Ga0501069_0225420
2664 Ga0501069_0232788
2665 Ga0501069_0291900
2666 Ga0501069_0641964
2667 Ga0501069_0805429
2668 Ga0501069_0807536
2669 Ga0501070_0001680
2670 Ga0501070_0002630
2671 Ga0501070_0008861
2672 Ga0501070_0022760
2673 Ga0501070_0180153
2674 Ga0501070_0381976
2675 Ga0501070_0439120
2676 Ga0501070_0539223
2677 Ga0501070_0580035
2678 Ga0501070_0747712
2679 Ga0501071_0000108
2680 Ga0501071_0001602
2681 Ga0501071_0081711
2682 Ga0501071_0110608
2683 Ga0501071_0150375
2684 Ga0501071_0272135
2685 Ga0501071_0554806
2686 Ga0501071_0801199
2687 Ga0501071_1041602
2688 Ga0501071_1098280
2689 Ga0501071_1473934
2690 Ga0501072_0001898
2691 Ga0501072_0042055
2692 Ga0501072_0065449
2693 Ga0501072_0084578
2694 Ga0501072_0790243
2695 Ga0501072_1380020
2696 Ga0501073_0004339
2697 Ga0501073_0008201
2698 Ga0501073_0009415
2699 Ga0501073_0170287
2700 Ga0501073_1160285
2701 Ga0501074_0000517
2702 Ga0501074_0014007
2703 Ga0501074_0033398
2704 Ga0501074_0102899
2705 Ga0501074_0286234
2706 Ga0501074_0388369
2707 Ga0501074_0647778
2708 Ga0501075_0090711
2709 Ga0501075_0274446
2710 Ga0501075_0566983
2711 Ga0501075_0668492
2712 Ga0501075_0862178
2713 Ga0501075_0902399
2714 Ga0501076_0003333
2715 Ga0501076_0051564
2716 Ga0501076_0078789
2717 Ga0501076_0517229
2718 Ga0501076_0679460
2719 Ga0501076_1005584
2720 Ga0501077_0003084
2721 Ga0501077_0012750
2722 Ga0501077_0023052
2723 Ga0501077_0071766
2724 Ga0501077_0199282
2725 Ga0501202_026952
2726 Ga0501202_082951
2727 Ga0501206_049981
2728 Ga0501217_033097
2729 Ga0501243_017725
2730 Ga0501079_0007167
2731 Ga0501079_0012242
2732 Ga0501079_0049083
2733 Ga0501079_0208952
2734 Ga0501079_0688790
2735 Ga0501079_0743481
2736 Ga0501079_1277114
2737 Ga0501079_1283680
2738 Ga0501080_0000361
2739 Ga0501080_0004573
2740 Ga0501080_0087116
2741 Ga0501080_0121371
2742 Ga0501080_0644486
2743 Ga0501081_0010183
2744 Ga0501081_0318181
2745 Ga0501083_0005579
2746 Ga0501083_0246691
2747 Ga0501083_0918029
2748 Ga0501083_0977183
2749 Ga0501271_013784
2750 Ga0501035_0005086
2751 Ga0501035_0554317
2752 Ga0501035_0999873
2753 Ga0501044_0005927
2754 Ga0501044_0158949
2755 Ga0501044_0432368
2756 Ga0501044_0564339
2757 Ga0501044_0817724
2758 Ga0501044_1198377
2759 Ga0501044_1364078
2760 Ga0501044_1471594
2761 Ga0501045_0014996
2762 Ga0501045_0146406
2763 Ga0501045_0170785
2764 Ga0501045_0367052
2765 Ga0501045_0938898
2766 Ga0501045_1026408
2767 Ga0501045_1244408
2768 Ga0501212_069666
2769 nmdc:mga03683_121919_c1
2770 nmdc:mga03683_91187_c1
2771 nmdc:mga03n38_23326_c1
2772 nmdc:mga03n38_27426_c1
2773 nmdc:mga03n38_301779_c1
2774 nmdc:mga03n38_470672_c1
2775 nmdc:mga03n38_624460_c1
2776 nmdc:mga00v17_126040_c1
2777 nmdc:mga00v17_131259_c1
2778 nmdc:mga00v17_153617_c1
2779 nmdc:mga00v17_195991_c1
2780 nmdc:mga00v17_26578_c1
2781 nmdc:mga00v17_26998_c1
2782 nmdc:mga00v17_282229_c1
2783 nmdc:mga00v17_89688_c1
2784 nmdc:mga00v17_915528_c1
2785 nmdc:mga0yw44_1064139_c1
2786 nmdc:mga0yw44_107708_c1
2787 nmdc:mga0yw44_115859_c1
2788 nmdc:mga0yw44_142047_c1
2789 nmdc:mga0yw44_189355_c1
2790 nmdc:mga0yw44_196086_c1
2791 nmdc:mga0yw44_23011_c1
2792 nmdc:mga0yw44_276036_c1
2793 nmdc:mga0yw44_39590_c1
2794 nmdc:mga0yw44_427423_c1
2795 nmdc:mga0yw44_429_c1
2796 nmdc:mga0yw44_51107_c1
2797 nmdc:mga0yw44_519998_c1
2798 nmdc:mga0yw44_553324_c1
2799 nmdc:mga0yw44_57912_c1
2800 nmdc:mga0yw44_69910_c1
2801 nmdc:mga06z11_16557_c1
2802 nmdc:mga06z11_285866_c1
2803 nmdc:mga06z11_482484_c1
2804 nmdc:mga06z11_700670_c1
2805 nmdc:mga04h51_447460_c1
2806 nmdc:mga04h51_495640_c1
2807 nmdc:mga04h51_5000_c1
2808 nmdc:mga04h51_9575_c1
2809 nmdc:mga07m45_122922_c1
2810 nmdc:mga07m45_55078_c1
2811 nmdc:mga07m45_866533_c1
2812 nmdc:mga05p37_406788_c1
2813 nmdc:mga05p37_986830_c1
2814 nmdc:mga09592_630062_c1
2815 nmdc:mga09592_873617_c1
2816 nmdc:mga0qj67_251663_c1
2817 nmdc:mga0qj67_562005_c1
2818 nmdc:mga06r32_14124_c1
2819 nmdc:mga08y16_1156544_c1
2820 nmdc:mga08y16_13951_c1
2821 nmdc:mga08y16_1685327_c1
2822 nmdc:mga08y16_545864_c2
2823 nmdc:mga08y16_63660_c1
2824 nmdc:mga0n895_1057137_c1
2825 nmdc:mga0n895_535_c1
2826 nmdc:mga0rr50_184510_c1
2827 nmdc:mga0rr50_231255_c1
2828 nmdc:mga08x19_1032_c1
2829 nmdc:mga0a205_7445_c1
2830 Ga0495601_0264047
2831 Ga0495601_0844181
2832 Ga0495612_0003302
2833 Ga0500635_0308542
2834 Ga0495595_0230920
2835 Ga0495595_0302999
2836 Ga0495619_0092261
2837 Ga0495619_0182301
2838 Ga0495619_0689573
2839 Ga0500644_0000489
2840 Ga0500644_0037984
2841 Ga0500644_0260939
2842 Ga0500554_147461
2843 Ga0500593_000592
2844 Ga0500628_148609
2845 Ga0500559_0551658
2846 Ga0500568_0107630
2847 Ga0500573_0030403
2848 Ga0500573_0107734
2849 Ga0500573_0311348
2850 Ga0500620_083656
2851 Ga0501084_0004130
2852 Ga0501084_0028629
2853 Ga0501084_0059413
2854 Ga0501084_0148023
2855 Ga0501084_0465464
2856 Ga0501084_1423975
2857 Ga0590077_062731
2858 Ga0587091_171231
2859 Ga0587128_147832
2860 Ga0587107_133361
2861 Ga0501082_0008254
2862 Ga0501082_0059879
2863 Ga0501082_0062182
2864 Ga0501082_0127882
2865 Ga0501082_0141089
2866 Ga0501082_0620617
2867 Ga0501082_1174118
2868 Ga0501082_1877407
2869 Ga0466962_0003215
2870 Ga0466962_0009228
2871 Ga0466962_0049410
2872 Ga0466962_0058613
2873 Ga0530510_0069190
2874 Ga0530510_0085801
2875 Ga0530510_0146581
2876 Ga0530510_0149633
2877 Ga0530510_0259482
2878 Ga0530510_0313246
2879 Ga0530510_0644395
2880 Ga0530510_0687048
2881 Ga0530510_0929809
2882 Ga0530510_1336131

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

25

111

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.9812 3 88
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.9502 3 91
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.9382 3 88
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.9296 3 91
1v8c-assembly1.cif.gz_A crystal structure of moad related protein from thermus thermophilus hb8 0.9026 4 88
ID Description Score Start End Superfamily
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9502 3 91 3.10.20.30
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9296 3 91 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8729 4 86 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8448 4 86 3.10.20.30
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8374 2 88 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A6B3IN31-F1-model_v4 MoaD/ThiS family protein 1.003 1 88
AF-A0A4V2XVV1-F1-model_v4 MoaD/ThiS family protein 1 1 78
AF-A0A6B3IN31-F1-model_v4 MoaD/ThiS family protein 0.9916 1 88
AF-X8F476-F1-model_v4 deleted 0.9895 1 91
AF-A0A1Q7QFQ2-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9886 1 90

Map