F493982

General Info

Members Datasets Scaffolds Average Seq Length
1441 421 1441 137

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100077449|Ga0070706_1000774494
Length 167
Sequence MVYLTRKAEFSASHYYHNPEFTPDENQRVFGKCNNPNGHGHNYTLEVTVKGPVDPKSGFVVDLKQLKDIMSREVLDALDHRFLNKEVPEFFTKIPTTENLAIAIWQRLAPKLNAAQLHRVRVYETPDLFVDFYGEDFHDEESFGVTRERIREIETKVLIALRKQRHT

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
129 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
135 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
136 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
138 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
139 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
140 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
141 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
142 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
208 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
213 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
218 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
219 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
220 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
221 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
222 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
223 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
224 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
227 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
228 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
229 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
230 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
231 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
232 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
233 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
234 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
235 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
236 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
237 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
238 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
239 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
240 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
241 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
242 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
244 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
245 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
246 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
247 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
248 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
249 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
250 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
251 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
252 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
253 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
254 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
255 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
256 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
257 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
258 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
259 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
260 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
261 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
262 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
263 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
264 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
265 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
266 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
267 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
268 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
269 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
270 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
271 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
272 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
273 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
274 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
275 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
276 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
277 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
278 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
279 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
280 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
281 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
282 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
283 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
284 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
285 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
286 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
287 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
288 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
289 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
290 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
291 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
292 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
293 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
294 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
295 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
296 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
297 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
298 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
299 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
300 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
301 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
302 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
303 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
304 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
305 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
306 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
307 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
308 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
309 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
310 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
311 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
312 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
313 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
314 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
315 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
316 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
317 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
318 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
319 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
320 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
321 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
322 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
323 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
324 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
325 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
326 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
327 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
328 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
329 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
330 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
331 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
332 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
333 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
334 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
335 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
336 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
337 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
338 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
339 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
340 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
341 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
342 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
343 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
344 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
345 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
346 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
347 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
348 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
349 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
350 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
351 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
352 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
353 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
354 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
355 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
356 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
357 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
358 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
359 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
360 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
361 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
362 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
364 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
365 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
366 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
367 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
368 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
369 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
370 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
381 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
382 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
383 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
384 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
385 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
386 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
387 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
388 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
389 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
390 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
391 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
394 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
395 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
396 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
397 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
398 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
399 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
400 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
401 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
402 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
403 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
404 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
405 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
406 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.18
Metatranscriptomes 3.82
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 4.65
Rhizosphere 94.1
Stem 0
Stem Tuber 0
Unclassified 0.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_3103743 2162886012 Bacteria 1674
2 LJNas_1001286 3300000546 Bacteria 3725
3 JGI24752J21851_1001233 3300001976 Bacteria 3472
4 JGI24737J22298_10029521 3300001990 Bacteria 1719
5 JGI24738J21930_10128631 3300002075 Bacteria 554
6 JGI24751J29686_10002071 3300002459 Bacteria 4070
7 Ga0058861_12048564 3300004800 Bacteria 1785
8 Ga0058862_10173224 3300004803 Unclassified 592
9 Ga0058862_12495541 3300004803 Bacteria 613
10 Ga0058862_12808140 3300004803 Bacteria 762
11 Ga0065712_10221444 3300005290 Bacteria 1036
12 Ga0065712_10285988 3300005290 Bacteria 886
13 Ga0065715_10117766 3300005293 Bacteria 2336
14 Ga0065715_10293036 3300005293 Bacteria 1058
15 Ga0070658_10012556 3300005327 Bacteria 6793
16 Ga0070658_10126712 3300005327 Bacteria 2126
17 Ga0070658_10469987 3300005327 Bacteria 1085
18 Ga0070676_10056461 3300005328 Bacteria 2320
19 Ga0070676_10147316 3300005328 Unclassified 1504
20 Ga0070683_100033697 3300005329 Bacteria 4671
21 Ga0070683_100061593 3300005329 Bacteria 3489
22 Ga0070683_100200803 3300005329 Bacteria 1893
23 Ga0070683_100386630 3300005329 Bacteria 1334
24 Ga0070690_100109606 3300005330 Bacteria 1841
25 Ga0070690_100605485 3300005330 Bacteria 832
26 Ga0068869_100010295 3300005334 Bacteria 6096
27 Ga0068869_100088922 3300005334 Bacteria 2319
28 Ga0068869_100566738 3300005334 Bacteria 956
29 Ga0068869_100943758 3300005334 Bacteria 748
30 Ga0070666_10012660 3300005335 Bacteria 5329
31 Ga0070666_10042597 3300005335 Bacteria 3038
32 Ga0070666_10043191 3300005335 Bacteria 3017
33 Ga0070680_100057956 3300005336 Bacteria 3167
34 Ga0070680_100098968 3300005336 Bacteria 2419
35 Ga0070680_100107842 3300005336 Unclassified 2316
36 Ga0070680_100316411 3300005336 Unclassified 1325
37 Ga0070680_100553854 3300005336 Bacteria 986
38 Ga0070680_101930996 3300005336 Bacteria 512
39 Ga0070682_100038919 3300005337 Unclassified 2919
40 Ga0070682_100068528 3300005337 Unclassified 2263
41 Ga0070682_100074862 3300005337 Bacteria 2176
42 Ga0070682_100091560 3300005337 Bacteria 1990
43 Ga0070682_101406599 3300005337 Bacteria 597
44 Ga0068868_100031072 3300005338 Bacteria 4099
45 Ga0068868_100034745 3300005338 Bacteria 3894
46 Ga0068868_100146134 3300005338 Unclassified 1944
47 Ga0068868_100208146 3300005338 Bacteria 1633
48 Ga0070660_100003963 3300005339 Bacteria 10225
49 Ga0070660_100011766 3300005339 Bacteria 6231
50 Ga0070660_100019856 3300005339 Bacteria 4930
51 Ga0070660_100042003 3300005339 Bacteria 3488
52 Ga0070660_101260305 3300005339 Bacteria 627
53 Ga0070689_100018894 3300005340 Bacteria 5088
54 Ga0070691_10114657 3300005341 Unclassified 1351
55 Ga0070687_100629509 3300005343 Bacteria 741
56 Ga0070661_100016945 3300005344 Bacteria 5160
57 Ga0070661_100030495 3300005344 Bacteria 3896
58 Ga0070692_10111019 3300005345 Bacteria 1516
59 Ga0070692_10274097 3300005345 Unclassified 1020
60 Ga0070668_100035071 3300005347 Bacteria 3824
61 Ga0070668_100042879 3300005347 Bacteria 3468
62 Ga0070675_100484212 3300005354 Bacteria 1113
63 Ga0070675_100628569 3300005354 Bacteria 975
64 Ga0070671_100010322 3300005355 Bacteria 7492
65 Ga0070671_101714198 3300005355 Bacteria 558
66 Ga0070673_100069246 3300005364 Bacteria 2827
67 Ga0070673_100516358 3300005364 Bacteria 1082
68 Ga0070688_100005987 3300005365 Bacteria 6447
69 Ga0070688_100067329 3300005365 Unclassified 2281
70 Ga0070659_100003656 3300005366 Bacteria 10960
71 Ga0070659_100004062 3300005366 Bacteria 10437
72 Ga0070659_100091787 3300005366 Bacteria 2434
73 Ga0070659_100650862 3300005366 Bacteria 908
74 Ga0070667_100119224 3300005367 Bacteria 2294
75 Ga0070667_100225488 3300005367 Unclassified 1669
76 Ga0070667_100370220 3300005367 Unclassified 1300
77 Ga0070709_10000577 3300005434 Bacteria 21437
78 Ga0070709_10012342 3300005434 Bacteria 4780
79 Ga0070709_10066236 3300005434 Bacteria 2316
80 Ga0070709_10069913 3300005434 Bacteria 2262
81 Ga0070709_10122549 3300005434 Bacteria 1764
82 Ga0070709_10264981 3300005434 Bacteria 1243
83 Ga0070709_10278304 3300005434 Bacteria 1215
84 Ga0070709_10405357 3300005434 Bacteria 1019
85 Ga0070709_10406155 3300005434 Bacteria 1018
86 Ga0070709_10455508 3300005434 Bacteria 964
87 Ga0070709_11242588 3300005434 Unclassified 599
88 Ga0070714_100000071 3300005435 Bacteria 90189
89 Ga0070714_100021042 3300005435 Bacteria 5333
90 Ga0070714_100109078 3300005435 Bacteria 2448
91 Ga0070714_100139917 3300005435 Bacteria 2171
92 Ga0070714_100150155 3300005435 Bacteria 2099
93 Ga0070714_100327416 3300005435 Unclassified 1434
94 Ga0070714_100399601 3300005435 Bacteria 1298
95 Ga0070714_100768180 3300005435 Bacteria 932
96 Ga0070714_100804929 3300005435 Unclassified 910
97 Ga0070714_100852706 3300005435 Bacteria 883
98 Ga0070714_101216411 3300005435 Unclassified 735
99 Ga0070714_101467448 3300005435 Bacteria 666
100 Ga0070714_101489498 3300005435 Unclassified 661
101 Ga0070714_101845639 3300005435 Bacteria 590
102 Ga0070714_101971904 3300005435 Bacteria 569
103 Ga0070713_100000176 3300005436 Bacteria 42775
104 Ga0070713_100001833 3300005436 Bacteria 13718
105 Ga0070713_100008088 3300005436 Bacteria 7438
106 Ga0070713_100022893 3300005436 Bacteria 4837
107 Ga0070713_100030299 3300005436 Bacteria 4296
108 Ga0070713_100068600 3300005436 Bacteria 2988
109 Ga0070713_100075733 3300005436 Bacteria 2855
110 Ga0070713_100081923 3300005436 Bacteria 2754
111 Ga0070713_100082933 3300005436 Bacteria 2739
112 Ga0070713_100099365 3300005436 Bacteria 2517
113 Ga0070713_100169307 3300005436 Unclassified 1956
114 Ga0070713_100216338 3300005436 Bacteria 1737
115 Ga0070713_100267590 3300005436 Bacteria 1564
116 Ga0070713_100462169 3300005436 Bacteria 1193
117 Ga0070713_100522774 3300005436 Bacteria 1121
118 Ga0070713_100583341 3300005436 Bacteria 1061
119 Ga0070713_100733290 3300005436 Bacteria 945
120 Ga0070713_100760159 3300005436 Unclassified 928
121 Ga0070713_101742762 3300005436 Bacteria 605
122 Ga0070710_10001044 3300005437 Bacteria 13170
123 Ga0070710_10015921 3300005437 Bacteria 3814
124 Ga0070710_10029547 3300005437 Unclassified 2942
125 Ga0070710_10036520 3300005437 Bacteria 2687
126 Ga0070710_10081696 3300005437 Bacteria 1888
127 Ga0070710_10111175 3300005437 Bacteria 1646
128 Ga0070710_10166449 3300005437 Unclassified 1371
129 Ga0070710_10382827 3300005437 Unclassified 939
130 Ga0070710_10403632 3300005437 Bacteria 916
131 Ga0070711_100000966 3300005439 Bacteria 15201
132 Ga0070711_100006410 3300005439 Bacteria 7095
133 Ga0070711_100019818 3300005439 Bacteria 4323
134 Ga0070711_100034830 3300005439 Bacteria 3361
135 Ga0070711_100081544 3300005439 Bacteria 2306
136 Ga0070711_100145306 3300005439 Bacteria 1783
137 Ga0070711_100289916 3300005439 Bacteria 1298
138 Ga0070711_100327592 3300005439 Bacteria 1225
139 Ga0070711_100569822 3300005439 Bacteria 941
140 Ga0070711_100649946 3300005439 Unclassified 884
141 Ga0070711_100719581 3300005439 Bacteria 842
142 Ga0070711_100765134 3300005439 Unclassified 817
143 Ga0070700_100424645 3300005441 Bacteria 1005
144 Ga0070694_100716303 3300005444 Bacteria 815
145 Ga0070694_100815446 3300005444 Bacteria 766
146 Ga0070708_100000595 3300005445 Bacteria 27186
147 Ga0070708_100011692 3300005445 Bacteria 7144
148 Ga0070708_100069650 3300005445 Bacteria 3164
149 Ga0070708_100073060 3300005445 Bacteria 3091
150 Ga0070708_100137597 3300005445 Bacteria 2263
151 Ga0070708_100145777 3300005445 Unclassified 2199
152 Ga0070708_100208923 3300005445 Bacteria 1829
153 Ga0070708_100337751 3300005445 Bacteria 1420
154 Ga0070708_100396239 3300005445 Unclassified 1302
155 Ga0070708_100418570 3300005445 Bacteria 1264
156 Ga0070708_100734208 3300005445 Unclassified 929
157 Ga0070708_100820744 3300005445 Unclassified 874
158 Ga0070708_100994811 3300005445 Bacteria 786
159 Ga0070708_101508779 3300005445 Bacteria 626
160 Ga0070663_100180871 3300005455 Bacteria 1635
161 Ga0070663_100334586 3300005455 Bacteria 1221
162 Ga0070663_100522690 3300005455 Bacteria 988
163 Ga0070678_100217439 3300005456 Unclassified 1587
164 Ga0070662_100020018 3300005457 Bacteria 4554
165 Ga0070662_100049803 3300005457 Bacteria 3021
166 Ga0070662_100253587 3300005457 Bacteria 1415
167 Ga0070681_10005766 3300005458 Bacteria 11974
168 Ga0070681_10039804 3300005458 Bacteria 4712
169 Ga0070681_10186398 3300005458 Bacteria 1995
170 Ga0070681_10242387 3300005458 Unclassified 1716
171 Ga0070681_10317488 3300005458 Unclassified 1467
172 Ga0070681_10335787 3300005458 Bacteria 1421
173 Ga0070681_10515088 3300005458 Bacteria 1109
174 Ga0068867_100042005 3300005459 Bacteria 3342
175 Ga0068867_100168888 3300005459 Bacteria 1731
176 Ga0068867_100935427 3300005459 Bacteria 782
177 Ga0070685_10001863 3300005466 Bacteria 11002
178 Ga0070685_11079479 3300005466 Bacteria 606
179 Ga0070706_100005807 3300005467 Bacteria 11728
180 Ga0070706_100006462 3300005467 Bacteria 11067
181 Ga0070706_100016205 3300005467 Bacteria 6884
182 Ga0070706_100074300 3300005467 Bacteria 3147
183 Ga0070706_100077449 3300005467 Bacteria 3078
184 Ga0070706_100175311 3300005467 Bacteria 2002
185 Ga0070706_100233742 3300005467 Bacteria 1716
186 Ga0070706_100679913 3300005467 Bacteria 955
187 Ga0070706_100933752 3300005467 Unclassified 801
188 Ga0070706_101293443 3300005467 Bacteria 669
189 Ga0070707_100010010 3300005468 Bacteria 8822
190 Ga0070707_100113614 3300005468 Bacteria 2628
191 Ga0070707_100230121 3300005468 Bacteria 1804
192 Ga0070707_100308198 3300005468 Bacteria 1539
193 Ga0070707_100470196 3300005468 Bacteria 1218
194 Ga0070707_100567695 3300005468 Bacteria 1097
195 Ga0070707_100584067 3300005468 Unclassified 1079
196 Ga0070707_101285626 3300005468 Bacteria 698
197 Ga0070707_101868824 3300005468 Bacteria 568
198 Ga0070698_100001986 3300005471 Bacteria 22707
199 Ga0070698_100269984 3300005471 Bacteria 1633
200 Ga0070698_100509698 3300005471 Bacteria 1141
201 Ga0070699_100000769 3300005518 Bacteria 29610
202 Ga0070699_100014509 3300005518 Bacteria 6776
203 Ga0070699_100014709 3300005518 Bacteria 6729
204 Ga0070699_100049489 3300005518 Bacteria 3638
205 Ga0070699_100334669 3300005518 Unclassified 1362
206 Ga0070699_100696696 3300005518 Bacteria 928
207 Ga0070699_100860778 3300005518 Bacteria 830
208 Ga0070679_100014705 3300005530 Bacteria 7523
209 Ga0070679_100068802 3300005530 Bacteria 3531
210 Ga0070679_100076010 3300005530 Bacteria 3348
211 Ga0070679_100080979 3300005530 Bacteria 3236
212 Ga0070679_100178985 3300005530 Bacteria 2093
213 Ga0070679_100215062 3300005530 Bacteria 1885
214 Ga0070679_100252381 3300005530 Bacteria 1720
215 Ga0070679_100316721 3300005530 Unclassified 1509
216 Ga0070679_100361488 3300005530 Bacteria 1399
217 Ga0070679_100401953 3300005530 Bacteria 1316
218 Ga0070679_100512394 3300005530 Bacteria 1143
219 Ga0070684_100084995 3300005535 Bacteria 2806
220 Ga0070684_100156199 3300005535 Bacteria 2069
221 Ga0070684_100172317 3300005535 Bacteria 1966
222 Ga0070684_100245401 3300005535 Unclassified 1637
223 Ga0070684_101521376 3300005535 Unclassified 631
224 Ga0070697_100000481 3300005536 Bacteria 30316
225 Ga0070697_100000712 3300005536 Bacteria 24773
226 Ga0070697_100002501 3300005536 Bacteria 14144
227 Ga0070697_100004639 3300005536 Bacteria 10543
228 Ga0070697_100005737 3300005536 Bacteria 9571
229 Ga0070697_100041960 3300005536 Bacteria 3703
230 Ga0070697_100075138 3300005536 Unclassified 2777
231 Ga0070697_100256754 3300005536 Bacteria 1495
232 Ga0070697_100294565 3300005536 Bacteria 1394
233 Ga0070697_100340961 3300005536 Unclassified 1293
234 Ga0070697_100787819 3300005536 Bacteria 841
235 Ga0070697_100812642 3300005536 Bacteria 827
236 Ga0070697_100858285 3300005536 Bacteria 804
237 Ga0070697_100923447 3300005536 Bacteria 775
238 Ga0070697_100934482 3300005536 Bacteria 770
239 Ga0070697_101295908 3300005536 Unclassified 650
240 Ga0070697_101973301 3300005536 Unclassified 522
241 Ga0068853_100000036 3300005539 Bacteria 108488
242 Ga0068853_100012160 3300005539 Bacteria 6999
243 Ga0068853_100030470 3300005539 Bacteria 4556
244 Ga0068853_100112150 3300005539 Bacteria 2424
245 Ga0068853_101022687 3300005539 Bacteria 796
246 Ga0068853_102124754 3300005539 Bacteria 544
247 Ga0070672_100150419 3300005543 Bacteria 1925
248 Ga0070672_100297164 3300005543 Bacteria 1368
249 Ga0070686_100007681 3300005544 Bacteria 6025
250 Ga0070686_100064100 3300005544 Bacteria 2383
251 Ga0070686_100185470 3300005544 Bacteria 1481
252 Ga0070695_100123754 3300005545 Bacteria 1773
253 Ga0070695_100328201 3300005545 Unclassified 1140
254 Ga0070695_100345271 3300005545 Bacteria 1114
255 Ga0070696_100174116 3300005546 Unclassified 1593
256 Ga0070696_100223225 3300005546 Bacteria 1414
257 Ga0070696_100667623 3300005546 Bacteria 844
258 Ga0070693_100071182 3300005547 Bacteria 2048
259 Ga0070693_100204476 3300005547 Bacteria 1284
260 Ga0070693_100324499 3300005547 Bacteria 1045
261 Ga0070665_100002872 3300005548 Bacteria 18615
262 Ga0070665_100019435 3300005548 Bacteria 6817
263 Ga0070665_100062001 3300005548 Bacteria 3749
264 Ga0070704_100136115 3300005549 Bacteria 1911
265 Ga0068855_100027264 3300005563 Bacteria 6835
266 Ga0068855_100033347 3300005563 Bacteria 6145
267 Ga0068855_100052534 3300005563 Bacteria 4797
268 Ga0068855_100103998 3300005563 Unclassified 3266
269 Ga0068855_100195281 3300005563 Bacteria 2280
270 Ga0068855_100287020 3300005563 Bacteria 1825
271 Ga0068855_100321471 3300005563 Unclassified 1710
272 Ga0068855_100699757 3300005563 Bacteria 1084
273 Ga0070664_100099739 3300005564 Bacteria 2524
274 Ga0070664_100136975 3300005564 Bacteria 2153
275 Ga0070664_100560452 3300005564 Bacteria 1057
276 Ga0068857_100049861 3300005577 Bacteria 3714
277 Ga0068857_100088069 3300005577 Bacteria 2778
278 Ga0068857_100276411 3300005577 Bacteria 1544
279 Ga0068854_100000016 3300005578 Bacteria 145396
280 Ga0068854_100049478 3300005578 Bacteria 3002
281 Ga0068854_100050453 3300005578 Bacteria 2977
282 Ga0068854_100090789 3300005578 Bacteria 2272
283 Ga0068854_100987272 3300005578 Unclassified 745
284 Ga0068856_100004126 3300005614 Bacteria 14519
285 Ga0068856_100021897 3300005614 Bacteria 6213
286 Ga0068856_100029101 3300005614 Bacteria 5396
287 Ga0068856_100029645 3300005614 Bacteria 5345
288 Ga0068856_100058934 3300005614 Bacteria 3792
289 Ga0068856_100215148 3300005614 Unclassified 1937
290 Ga0068856_100444085 3300005614 Unclassified 1318
291 Ga0068856_100561208 3300005614 Bacteria 1163
292 Ga0068856_100631626 3300005614 Bacteria 1091
293 Ga0068856_101512608 3300005614 Bacteria 685
294 Ga0068856_101568026 3300005614 Bacteria 672
295 Ga0070702_100017900 3300005615 Bacteria 3664
296 Ga0068852_100049385 3300005616 Bacteria 3599
297 Ga0068852_100371910 3300005616 Bacteria 1400
298 Ga0068859_100072280 3300005617 Bacteria 3486
299 Ga0068859_100082517 3300005617 Bacteria 3257
300 Ga0068859_100233843 3300005617 Bacteria 1926
301 Ga0068859_100904383 3300005617 Bacteria 967
302 Ga0068859_102552010 3300005617 Unclassified 562
303 Ga0068864_100024157 3300005618 Bacteria 5110
304 Ga0068864_100974645 3300005618 Bacteria 840
305 Ga0068866_10019938 3300005718 Bacteria 3063
306 Ga0068866_10224565 3300005718 Bacteria 1135
307 Ga0068866_10266656 3300005718 Bacteria 1055
308 Ga0068866_10486804 3300005718 Bacteria 814
309 Ga0068861_100127387 3300005719 Unclassified 2062
310 Ga0068861_100237458 3300005719 Bacteria 1549
311 Ga0068851_10005216 3300005834 Bacteria 5896
312 Ga0068851_10098820 3300005834 Bacteria 1546
313 Ga0068851_10109140 3300005834 Bacteria 1476
314 Ga0068870_10003076 3300005840 Bacteria 7035
315 Ga0068870_10176439 3300005840 Unclassified 1279
316 Ga0068863_100025635 3300005841 Bacteria 5622
317 Ga0068863_100078852 3300005841 Bacteria 3119
318 Ga0068863_100124056 3300005841 Bacteria 2464
319 Ga0068863_100432277 3300005841 Bacteria 1290
320 Ga0068858_100006610 3300005842 Bacteria 11282
321 Ga0068858_100015612 3300005842 Bacteria 7143
322 Ga0068860_100078483 3300005843 Bacteria 3140
323 Ga0068860_100133824 3300005843 Bacteria 2380
324 Ga0068860_100238106 3300005843 Bacteria 1770
325 Ga0068860_100311200 3300005843 Unclassified 1544
326 Ga0068860_100934457 3300005843 Unclassified 884
327 Ga0068862_100041491 3300005844 Bacteria 3915
328 Ga0068862_100094144 3300005844 Bacteria 2613
329 Ga0068862_100218140 3300005844 Bacteria 1726
330 Ga0070717_10001512 3300006028 Bacteria 16106
331 Ga0070717_10001792 3300006028 Bacteria 14982
332 Ga0070717_10024162 3300006028 Bacteria 4823
333 Ga0070717_10027429 3300006028 Bacteria 4552
334 Ga0070717_10069253 3300006028 Bacteria 2938
335 Ga0070717_10084455 3300006028 Bacteria 2671
336 Ga0070717_10106763 3300006028 Bacteria 2384
337 Ga0070717_10143584 3300006028 Bacteria 2060
338 Ga0070717_10147400 3300006028 Bacteria 2034
339 Ga0070717_10155232 3300006028 Bacteria 1982
340 Ga0070717_10174302 3300006028 Bacteria 1872
341 Ga0070717_10225978 3300006028 Bacteria 1647
342 Ga0070717_10270703 3300006028 Bacteria 1504
343 Ga0070717_10284046 3300006028 Bacteria 1468
344 Ga0070717_10885821 3300006028 Unclassified 812
345 Ga0070717_11110919 3300006028 Bacteria 720
346 Ga0070717_11125772 3300006028 Unclassified 715
347 Ga0070717_11158799 3300006028 Unclassified 704
348 Ga0070717_11500681 3300006028 Bacteria 611
349 Ga0070715_10001488 3300006163 Bacteria 6828
350 Ga0070715_10002372 3300006163 Bacteria 5764
351 Ga0070715_10053362 3300006163 Bacteria 1747
352 Ga0070716_100000165 3300006173 Bacteria 26115
353 Ga0070716_100006958 3300006173 Bacteria 5545
354 Ga0070716_100012077 3300006173 Bacteria 4366
355 Ga0070716_100030314 3300006173 Bacteria 2933
356 Ga0070716_100034500 3300006173 Bacteria 2775
357 Ga0070716_100065842 3300006173 Bacteria 2111
358 Ga0070716_100096122 3300006173 Unclassified 1805
359 Ga0070716_100126878 3300006173 Bacteria 1606
360 Ga0070716_100161379 3300006173 Bacteria 1453
361 Ga0070716_100330826 3300006173 Bacteria 1071
362 Ga0070716_100332352 3300006173 Bacteria 1069
363 Ga0070716_100573682 3300006173 Unclassified 845
364 Ga0070716_100589073 3300006173 Bacteria 835
365 Ga0070716_100671512 3300006173 Bacteria 788
366 Ga0070716_100830313 3300006173 Bacteria 718
367 Ga0070712_100000512 3300006175 Bacteria 22246
368 Ga0070712_100002724 3300006175 Bacteria 10907
369 Ga0070712_100003444 3300006175 Bacteria 9737
370 Ga0070712_100005055 3300006175 Bacteria 8169
371 Ga0070712_100128370 3300006175 Bacteria 1918
372 Ga0070712_100138688 3300006175 Bacteria 1853
373 Ga0070712_100156315 3300006175 Bacteria 1756
374 Ga0070712_100175004 3300006175 Bacteria 1668
375 Ga0070712_100423199 3300006175 Bacteria 1104
376 Ga0070712_100678739 3300006175 Bacteria 877
377 Ga0070712_101527072 3300006175 Bacteria 584
378 Ga0097621_100005593 3300006237 Bacteria 8861
379 Ga0097621_100186732 3300006237 Bacteria 1793
380 Ga0097621_100235117 3300006237 Unclassified 1600
381 Ga0097621_100669637 3300006237 Unclassified 953
382 Ga0097621_101171811 3300006237 Bacteria 723
383 Ga0097621_102011981 3300006237 Unclassified 552
384 Ga0068871_100001005 3300006358 Bacteria 18907
385 Ga0068871_100194171 3300006358 Bacteria 1750
386 Ga0068871_100207314 3300006358 Bacteria 1694
387 Ga0068871_100313566 3300006358 Bacteria 1379
388 Ga0068871_100481107 3300006358 Bacteria 1117
389 Ga0068871_100688815 3300006358 Bacteria 935
390 Ga0075433_10077924 3300006852 Bacteria 2920
391 Ga0075433_10404022 3300006852 Bacteria 1205
392 Ga0075434_100005454 3300006871 Bacteria 11589
393 Ga0075434_100100731 3300006871 Bacteria 2895
394 Ga0075434_100126340 3300006871 Bacteria 2574
395 Ga0068865_100078921 3300006881 Bacteria 2356
396 Ga0068865_100109618 3300006881 Bacteria 2034
397 Ga0068865_100161534 3300006881 Unclassified 1710
398 Ga0068865_100677285 3300006881 Bacteria 879
399 Ga0075436_100091120 3300006914 Bacteria 2119
400 Ga0075436_100091462 3300006914 Bacteria 2115
401 Ga0075436_100366095 3300006914 Bacteria 1041
402 Ga0075436_100860353 3300006914 Bacteria 677
403 Ga0097620_100072279 3300006931 Bacteria 3486
404 Ga0097620_100082514 3300006931 Bacteria 3257
405 Ga0097620_100233856 3300006931 Bacteria 1926
406 Ga0097620_100904536 3300006931 Bacteria 967
407 Ga0097620_102552525 3300006931 Unclassified 562
408 Ga0075435_101031404 3300007076 Bacteria 718
409 Ga0075435_101909289 3300007076 Unclassified 521
410 Ga0099794_10096584 3300007265 Bacteria 1471
411 Ga0099795_10029274 3300007788 Bacteria 1881
412 Ga0099795_10068657 3300007788 Unclassified 1332
413 Ga0099795_10133261 3300007788 Unclassified 1004
414 Ga0099795_10290377 3300007788 Bacteria 716
415 Ga0105250_10059622 3300009092 Bacteria 1533
416 Ga0105250_10090811 3300009092 Bacteria 1242
417 Ga0105240_10011052 3300009093 Bacteria 12622
418 Ga0105240_10017920 3300009093 Bacteria 9525
419 Ga0105240_10057321 3300009093 Bacteria 4868
420 Ga0105240_10108242 3300009093 Bacteria 3368
421 Ga0105240_10203049 3300009093 Bacteria 2322
422 Ga0105240_10203311 3300009093 Bacteria 2320
423 Ga0105240_10227639 3300009093 Bacteria 2168
424 Ga0105240_10280119 3300009093 Bacteria 1916
425 Ga0105240_10387689 3300009093 Bacteria 1577
426 Ga0105240_10425086 3300009093 Bacteria 1492
427 Ga0105240_10693976 3300009093 Unclassified 1112
428 Ga0105240_10741823 3300009093 Bacteria 1068
429 Ga0105240_10772516 3300009093 Bacteria 1043
430 Ga0111539_13422582 3300009094 Unclassified 510
431 Ga0105245_10004851 3300009098 Bacteria 11845
432 Ga0105245_10009762 3300009098 Bacteria 8364
433 Ga0105245_10016455 3300009098 Bacteria 6452
434 Ga0105245_10020232 3300009098 Bacteria 5834
435 Ga0105245_10186384 3300009098 Bacteria 1985
436 Ga0105245_10351218 3300009098 Bacteria 1461
437 Ga0105247_10005153 3300009101 Bacteria 8267
438 Ga0105247_10113834 3300009101 Unclassified 1744
439 Ga0105247_10117294 3300009101 Bacteria 1720
440 Ga0105247_10312901 3300009101 Bacteria 1093
441 Ga0105247_10718445 3300009101 Bacteria 754
442 Ga0114129_10134956 3300009147 Bacteria 3386
443 Ga0105243_10010844 3300009148 Bacteria 6894
444 Ga0105243_10827306 3300009148 Bacteria 915
445 Ga0105241_10014792 3300009174 Bacteria 5712
446 Ga0105241_10024356 3300009174 Bacteria 4494
447 Ga0105241_10052926 3300009174 Bacteria 3102
448 Ga0105241_10103390 3300009174 Bacteria 2268
449 Ga0105241_10169467 3300009174 Unclassified 1802
450 Ga0105241_10392461 3300009174 Bacteria 1215
451 Ga0105241_10921061 3300009174 Bacteria 813
452 Ga0105241_10981569 3300009174 Unclassified 789
453 Ga0105241_11112823 3300009174 Bacteria 744
454 Ga0105241_11313187 3300009174 Bacteria 689
455 Ga0105242_10014914 3300009176 Bacteria 6024
456 Ga0105242_10051360 3300009176 Bacteria 3360
457 Ga0105242_10085880 3300009176 Bacteria 2639
458 Ga0105242_10183599 3300009176 Unclassified 1847
459 Ga0105242_10302212 3300009176 Bacteria 1461
460 Ga0105242_11020491 3300009176 Bacteria 836
461 Ga0105248_10006030 3300009177 Bacteria 13305
462 Ga0105248_10022462 3300009177 Bacteria 6997
463 Ga0105248_10033924 3300009177 Bacteria 5704
464 Ga0105248_10040691 3300009177 Bacteria 5210
465 Ga0105248_10046669 3300009177 Bacteria 4856
466 Ga0105248_10099568 3300009177 Bacteria 3276
467 Ga0105248_10653666 3300009177 Bacteria 1186
468 Ga0105248_10960232 3300009177 Unclassified 965
469 Ga0105237_10145036 3300009545 Unclassified 2369
470 Ga0105237_10185600 3300009545 Bacteria 2080
471 Ga0105237_10216712 3300009545 Bacteria 1914
472 Ga0105237_10238627 3300009545 Unclassified 1819
473 Ga0105237_10442818 3300009545 Bacteria 1305
474 Ga0105237_10486380 3300009545 Bacteria 1240
475 Ga0105237_10493746 3300009545 Bacteria 1231
476 Ga0105237_10574824 3300009545 Unclassified 1134
477 Ga0105237_10640727 3300009545 Bacteria 1069
478 Ga0105237_10668843 3300009545 Bacteria 1045
479 Ga0105237_10826068 3300009545 Bacteria 933
480 Ga0105237_10888205 3300009545 Bacteria 898
481 Ga0105238_10069773 3300009551 Bacteria 3515
482 Ga0105238_10159725 3300009551 Bacteria 2229
483 Ga0105238_10160120 3300009551 Bacteria 2226
484 Ga0105238_10250500 3300009551 Bacteria 1749
485 Ga0105238_11537681 3300009551 Unclassified 695
486 Ga0105238_12789853 3300009551 Unclassified 525
487 Ga0105249_10006219 3300009553 Bacteria 10366
488 Ga0105249_10089016 3300009553 Bacteria 2884
489 Ga0099796_10083568 3300010159 Bacteria 1175
490 Ga0105239_10015139 3300010375 Bacteria 8548
491 Ga0105239_10117996 3300010375 Bacteria 2945
492 Ga0105239_10121809 3300010375 Bacteria 2897
493 Ga0105239_10125781 3300010375 Bacteria 2849
494 Ga0105239_10146891 3300010375 Bacteria 2630
495 Ga0105239_10209637 3300010375 Bacteria 2184
496 Ga0105239_10283736 3300010375 Bacteria 1864
497 Ga0105239_10587043 3300010375 Bacteria 1270
498 Ga0105239_10715296 3300010375 Bacteria 1145
499 Ga0105239_10799726 3300010375 Bacteria 1080
500 Ga0105239_10920790 3300010375 Unclassified 1004
501 Ga0105239_11006269 3300010375 Bacteria 958
502 Ga0105246_10011057 3300011119 Bacteria 5592
503 Ga0105246_10149635 3300011119 Bacteria 1765
504 Ga0157373_10018541 3300013100 Bacteria 5064
505 Ga0157373_10022240 3300013100 Bacteria 4601
506 Ga0157373_10124675 3300013100 Unclassified 1811
507 Ga0157373_10202892 3300013100 Bacteria 1398
508 Ga0157373_10331298 3300013100 Unclassified 1084
509 Ga0157371_10044943 3300013102 Bacteria 3144
510 Ga0157371_10153483 3300013102 Bacteria 1643
511 Ga0157370_10055091 3300013104 Bacteria 3790
512 Ga0157370_10058746 3300013104 Bacteria 3655
513 Ga0157370_10175265 3300013104 Bacteria 1993
514 Ga0157370_10183810 3300013104 Bacteria 1941
515 Ga0157370_10512389 3300013104 Bacteria 1101
516 Ga0157370_10541511 3300013104 Bacteria 1067
517 Ga0157369_10000707 3300013105 Bacteria 42987
518 Ga0157369_10017834 3300013105 Bacteria 7969
519 Ga0157369_10056193 3300013105 Unclassified 4248
520 Ga0157369_10084664 3300013105 Bacteria 3389
521 Ga0157369_10103348 3300013105 Bacteria 3035
522 Ga0157369_10118530 3300013105 Bacteria 2810
523 Ga0157369_10174208 3300013105 Unclassified 2265
524 Ga0157369_10188711 3300013105 Bacteria 2166
525 Ga0157369_10229963 3300013105 Bacteria 1939
526 Ga0157369_10496976 3300013105 Unclassified 1262
527 Ga0157369_10511548 3300013105 Bacteria 1242
528 Ga0157374_10003832 3300013296 Bacteria 12626
529 Ga0157374_10010610 3300013296 Bacteria 7932
530 Ga0157374_10019807 3300013296 Bacteria 5963
531 Ga0157374_10024541 3300013296 Bacteria 5407
532 Ga0157374_10037327 3300013296 Bacteria 4459
533 Ga0157374_10049414 3300013296 Bacteria 3906
534 Ga0157374_10057314 3300013296 Bacteria 3638
535 Ga0157374_10545002 3300013296 Bacteria 1167
536 Ga0157374_10578746 3300013296 Bacteria 1132
537 Ga0157374_10598276 3300013296 Bacteria 1113
538 Ga0157378_10003236 3300013297 Bacteria 14493
539 Ga0157378_10040674 3300013297 Bacteria 4123
540 Ga0157378_10095198 3300013297 Bacteria 2712
541 Ga0157378_10097524 3300013297 Bacteria 2679
542 Ga0157378_10108002 3300013297 Bacteria 2547
543 Ga0157378_10146829 3300013297 Bacteria 2194
544 Ga0157378_11531095 3300013297 Bacteria 712
545 Ga0157378_12540754 3300013297 Unclassified 564
546 Ga0163162_10002584 3300013306 Bacteria 17140
547 Ga0163162_10057165 3300013306 Bacteria 3929
548 Ga0163162_10087454 3300013306 Bacteria 3195
549 Ga0163162_10146213 3300013306 Bacteria 2480
550 Ga0163162_10173768 3300013306 Bacteria 2279
551 Ga0163162_12037148 3300013306 Bacteria 658
552 Ga0157372_10024072 3300013307 Bacteria 6607
553 Ga0157372_10035556 3300013307 Bacteria 5485
554 Ga0157372_10071311 3300013307 Bacteria 3912
555 Ga0157372_10094877 3300013307 Bacteria 3398
556 Ga0157372_10135827 3300013307 Bacteria 2832
557 Ga0157372_10301875 3300013307 Bacteria 1862
558 Ga0157372_10426664 3300013307 Bacteria 1545
559 Ga0157372_12091759 3300013307 Bacteria 650
560 Ga0157372_12165411 3300013307 Bacteria 639
561 Ga0157375_10057643 3300013308 Bacteria 3840
562 Ga0157375_10059700 3300013308 Bacteria 3779
563 Ga0157375_10150332 3300013308 Bacteria 2463
564 Ga0157375_10890963 3300013308 Unclassified 1034
565 Ga0157375_11813944 3300013308 Bacteria 723
566 Ga0163163_10004284 3300014325 Bacteria 12156
567 Ga0163163_10025301 3300014325 Bacteria 5659
568 Ga0163163_10066872 3300014325 Bacteria 3571
569 Ga0163163_10137382 3300014325 Bacteria 2486
570 Ga0163163_10158114 3300014325 Unclassified 2311
571 Ga0163163_10571754 3300014325 Bacteria 1193
572 Ga0157380_10097667 3300014326 Bacteria 2438
573 Ga0182008_10014485 3300014497 Bacteria 4128
574 Ga0182008_10105273 3300014497 Bacteria 1395
575 Ga0157377_10005240 3300014745 Bacteria 6071
576 Ga0157379_10004435 3300014968 Bacteria 12032
577 Ga0157379_10096867 3300014968 Bacteria 2648
578 Ga0157379_10100573 3300014968 Bacteria 2595
579 Ga0157379_10111829 3300014968 Bacteria 2454
580 Ga0157379_10488929 3300014968 Bacteria 1140
581 Ga0157379_10778526 3300014968 Bacteria 902
582 Ga0157376_10014350 3300014969 Bacteria 5944
583 Ga0157376_10043385 3300014969 Bacteria 3691
584 Ga0157376_10093650 3300014969 Bacteria 2608
585 Ga0157376_10116574 3300014969 Bacteria 2360
586 Ga0157376_10145929 3300014969 Bacteria 2128
587 Ga0157376_10254571 3300014969 Bacteria 1642
588 Ga0157376_10277376 3300014969 Bacteria 1577
589 Ga0157376_10302623 3300014969 Unclassified 1514
590 Ga0157376_10490811 3300014969 Bacteria 1205
591 Ga0157376_10646919 3300014969 Bacteria 1057
592 Ga0182006_1032101 3300015261 Unclassified 2112
593 Ga0182006_1053815 3300015261 Bacteria 1541
594 Ga0182007_10001865 3300015262 Bacteria 10993
595 Ga0182007_10049641 3300015262 Unclassified 1386
596 Ga0182007_10077491 3300015262 Unclassified 1090
597 Ga0163161_10009823 3300017792 Bacteria 6627
598 Ga0163161_11275062 3300017792 Bacteria 638
599 Ga0206356_10210281 3300020070 Bacteria 914
600 Ga0206356_10311722 3300020070 Unclassified 638
601 Ga0206356_10438923 3300020070 Bacteria 1065
602 Ga0206356_10612756 3300020070 Unclassified 667
603 Ga0206355_1464592 3300020076 Bacteria 1235
604 Ga0206352_10191777 3300020078 Bacteria 685
605 Ga0206352_10634928 3300020078 Bacteria 1118
606 Ga0206352_10695361 3300020078 Bacteria 1105
607 Ga0206350_10302303 3300020080 Unclassified 1331
608 Ga0206350_10697226 3300020080 Bacteria 547
609 Ga0206350_11198039 3300020080 Bacteria 549
610 Ga0206354_10056872 3300020081 Bacteria 1067
611 Ga0206354_11350274 3300020081 Unclassified 657
612 Ga0206353_10355093 3300020082 Unclassified 856
613 Ga0154015_1659564 3300020610 Bacteria 1186
614 Ga0213873_10080339 3300021358 Bacteria 912
615 Ga0213873_10148211 3300021358 Bacteria 705
616 Ga0213874_10077321 3300021377 Bacteria 1072
617 Ga0224712_10564322 3300022467 Bacteria 554
618 Ga0224712_10606936 3300022467 Unclassified 534
619 Ga0224570_100774 3300022730 Bacteria 2545
620 Ga0224569_100532 3300022732 Bacteria 3275
621 Ga0224569_101700 3300022732 Bacteria 1828
622 Ga0224571_103364 3300022734 Bacteria 1030
623 Ga0224572_1002657 3300024225 Bacteria 2926
624 Ga0228598_1000510 3300024227 Bacteria 8048
625 Ga0228598_1004675 3300024227 Bacteria 2892
626 Ga0228598_1007492 3300024227 Bacteria 2220
627 Ga0228598_1030081 3300024227 Bacteria 1068
628 Ga0207697_10087108 3300025315 Bacteria 1321
629 Ga0207656_10015304 3300025321 Bacteria 2967
630 Ga0207656_10082347 3300025321 Bacteria 1448
631 Ga0207656_10096892 3300025321 Bacteria 1347
632 Ga0207682_10163094 3300025893 Bacteria 1011
633 Ga0207692_10005710 3300025898 Bacteria 5000
634 Ga0207692_10042774 3300025898 Bacteria 2251
635 Ga0207692_10117150 3300025898 Bacteria 1486
636 Ga0207692_10123064 3300025898 Bacteria 1455
637 Ga0207692_10196084 3300025898 Bacteria 1184
638 Ga0207692_10220407 3300025898 Bacteria 1124
639 Ga0207692_10240395 3300025898 Unclassified 1081
640 Ga0207692_10349459 3300025898 Unclassified 911
641 Ga0207692_10362334 3300025898 Bacteria 896
642 Ga0207692_10567827 3300025898 Bacteria 726
643 Ga0207642_10112666 3300025899 Bacteria 1388
644 Ga0207642_10212168 3300025899 Unclassified 1076
645 Ga0207642_10285457 3300025899 Bacteria 951
646 Ga0207688_10042678 3300025901 Bacteria 2525
647 Ga0207680_10011489 3300025903 Bacteria 4477
648 Ga0207680_10024741 3300025903 Bacteria 3300
649 Ga0207680_10303359 3300025903 Bacteria 1113
650 Ga0207647_10001878 3300025904 Bacteria 16087
651 Ga0207647_10003039 3300025904 Bacteria 12616
652 Ga0207647_10196899 3300025904 Unclassified 1166
653 Ga0207647_10268662 3300025904 Bacteria 975
654 Ga0207685_10014444 3300025905 Unclassified 2473
655 Ga0207685_10172731 3300025905 Unclassified 996
656 Ga0207685_10195996 3300025905 Unclassified 946
657 Ga0207685_10264438 3300025905 Bacteria 837
658 Ga0207699_10000600 3300025906 Bacteria 17723
659 Ga0207699_10011735 3300025906 Unclassified 4435
660 Ga0207699_10016494 3300025906 Unclassified 3866
661 Ga0207699_10021063 3300025906 Bacteria 3506
662 Ga0207699_10039071 3300025906 Bacteria 2724
663 Ga0207699_10070588 3300025906 Bacteria 2133
664 Ga0207699_10152092 3300025906 Bacteria 1532
665 Ga0207699_10163152 3300025906 Bacteria 1485
666 Ga0207699_10222492 3300025906 Bacteria 1289
667 Ga0207699_10268950 3300025906 Bacteria 1181
668 Ga0207699_10298153 3300025906 Bacteria 1125
669 Ga0207699_10301622 3300025906 Bacteria 1119
670 Ga0207699_10667079 3300025906 Bacteria 760
671 Ga0207699_11222621 3300025906 Unclassified 556
672 Ga0207645_10000371 3300025907 Bacteria 37175
673 Ga0207645_10004258 3300025907 Bacteria 10627
674 Ga0207643_10000668 3300025908 Bacteria 21347
675 Ga0207643_10252787 3300025908 Unclassified 1086
676 Ga0207705_10123716 3300025909 Bacteria 1921
677 Ga0207705_10493707 3300025909 Bacteria 950
678 Ga0207684_10001112 3300025910 Bacteria 30047
679 Ga0207684_10002188 3300025910 Bacteria 19999
680 Ga0207684_10014160 3300025910 Bacteria 6884
681 Ga0207684_10039463 3300025910 Bacteria 4005
682 Ga0207684_10079990 3300025910 Bacteria 2780
683 Ga0207684_10144360 3300025910 Bacteria 2047
684 Ga0207684_10463773 3300025910 Bacteria 1087
685 Ga0207654_10015891 3300025911 Bacteria 3914
686 Ga0207654_10032488 3300025911 Bacteria 2885
687 Ga0207654_10074199 3300025911 Bacteria 2030
688 Ga0207654_10250040 3300025911 Bacteria 1188
689 Ga0207654_10533990 3300025911 Bacteria 832
690 Ga0207654_10896892 3300025911 Bacteria 643
691 Ga0207654_11181100 3300025911 Bacteria 558
692 Ga0207707_10009572 3300025912 Bacteria 8406
693 Ga0207707_10032167 3300025912 Bacteria 4592
694 Ga0207707_10034370 3300025912 Bacteria 4435
695 Ga0207707_10187702 3300025912 Bacteria 1804
696 Ga0207707_10194395 3300025912 Bacteria 1770
697 Ga0207707_10283226 3300025912 Bacteria 1435
698 Ga0207707_10380984 3300025912 Bacteria 1212
699 Ga0207707_10735244 3300025912 Bacteria 826
700 Ga0207707_10823231 3300025912 Unclassified 772
701 Ga0207695_10007947 3300025913 Bacteria 13381
702 Ga0207695_10051286 3300025913 Bacteria 4334
703 Ga0207695_10062042 3300025913 Bacteria 3861
704 Ga0207695_10078217 3300025913 Bacteria 3356
705 Ga0207695_10122567 3300025913 Bacteria 2566
706 Ga0207695_10129257 3300025913 Bacteria 2485
707 Ga0207695_10172154 3300025913 Bacteria 2090
708 Ga0207695_10190541 3300025913 Unclassified 1968
709 Ga0207695_10200176 3300025913 Unclassified 1911
710 Ga0207695_10508985 3300025913 Unclassified 1086
711 Ga0207671_10078488 3300025914 Bacteria 2473
712 Ga0207671_10125848 3300025914 Bacteria 1963
713 Ga0207671_10279119 3300025914 Bacteria 1317
714 Ga0207671_10298020 3300025914 Bacteria 1273
715 Ga0207671_10413562 3300025914 Bacteria 1073
716 Ga0207671_10421326 3300025914 Bacteria 1062
717 Ga0207671_10877717 3300025914 Bacteria 710
718 Ga0207671_10975400 3300025914 Unclassified 668
719 Ga0207671_11184555 3300025914 Unclassified 598
720 Ga0207693_10000203 3300025915 Bacteria 54373
721 Ga0207693_10000260 3300025915 Bacteria 48765
722 Ga0207693_10000719 3300025915 Bacteria 29815
723 Ga0207693_10001323 3300025915 Bacteria 21964
724 Ga0207693_10002101 3300025915 Bacteria 17385
725 Ga0207693_10006854 3300025915 Bacteria 9406
726 Ga0207693_10018421 3300025915 Bacteria 5562
727 Ga0207693_10164348 3300025915 Bacteria 1747
728 Ga0207693_10262763 3300025915 Bacteria 1353
729 Ga0207693_10287167 3300025915 Bacteria 1289
730 Ga0207693_10323422 3300025915 Bacteria 1207
731 Ga0207693_10393245 3300025915 Bacteria 1084
732 Ga0207693_10495128 3300025915 Bacteria 954
733 Ga0207693_10674661 3300025915 Unclassified 802
734 Ga0207693_10735207 3300025915 Unclassified 763
735 Ga0207663_10000234 3300025916 Bacteria 24595
736 Ga0207663_10009111 3300025916 Bacteria 5232
737 Ga0207663_10027040 3300025916 Bacteria 3338
738 Ga0207663_10046178 3300025916 Bacteria 2682
739 Ga0207663_10058176 3300025916 Bacteria 2438
740 Ga0207663_10221098 3300025916 Bacteria 1378
741 Ga0207663_10314371 3300025916 Bacteria 1175
742 Ga0207663_10491669 3300025916 Bacteria 952
743 Ga0207663_10616492 3300025916 Unclassified 854
744 Ga0207663_10629776 3300025916 Bacteria 845
745 Ga0207663_10709639 3300025916 Bacteria 797
746 Ga0207663_10966252 3300025916 Unclassified 683
747 Ga0207660_10005436 3300025917 Bacteria 8265
748 Ga0207660_10084603 3300025917 Unclassified 2338
749 Ga0207660_10158636 3300025917 Bacteria 1743
750 Ga0207660_10217538 3300025917 Unclassified 1498
751 Ga0207660_10375660 3300025917 Bacteria 1142
752 Ga0207660_10745639 3300025917 Unclassified 799
753 Ga0207657_10001697 3300025919 Bacteria 23757
754 Ga0207657_10001941 3300025919 Bacteria 22339
755 Ga0207657_10002583 3300025919 Bacteria 19589
756 Ga0207657_10006727 3300025919 Bacteria 11870
757 Ga0207657_10152903 3300025919 Bacteria 1878
758 Ga0207657_10477825 3300025919 Bacteria 977
759 Ga0207657_10637885 3300025919 Bacteria 830
760 Ga0207649_10001595 3300025920 Bacteria 13187
761 Ga0207649_10024357 3300025920 Bacteria 3517
762 Ga0207649_10026399 3300025920 Bacteria 3397
763 Ga0207652_10008095 3300025921 Bacteria 8439
764 Ga0207652_10111678 3300025921 Bacteria 2424
765 Ga0207652_10158582 3300025921 Bacteria 2028
766 Ga0207652_10165821 3300025921 Bacteria 1981
767 Ga0207652_10185006 3300025921 Bacteria 1873
768 Ga0207652_10208087 3300025921 Bacteria 1761
769 Ga0207652_10291838 3300025921 Bacteria 1471
770 Ga0207652_10356950 3300025921 Unclassified 1319
771 Ga0207652_10868872 3300025921 Bacteria 798
772 Ga0207646_10002802 3300025922 Bacteria 20298
773 Ga0207646_10003770 3300025922 Bacteria 16885
774 Ga0207646_10106496 3300025922 Bacteria 2515
775 Ga0207646_10172894 3300025922 Bacteria 1951
776 Ga0207646_10219502 3300025922 Bacteria 1718
777 Ga0207646_10961150 3300025922 Unclassified 756
778 Ga0207681_10411228 3300025923 Bacteria 1094
779 Ga0207694_10047768 3300025924 Bacteria 3310
780 Ga0207694_10156697 3300025924 Bacteria 1837
781 Ga0207694_10234067 3300025924 Bacteria 1500
782 Ga0207694_10361321 3300025924 Unclassified 1203
783 Ga0207694_10817306 3300025924 Bacteria 787
784 Ga0207694_11702598 3300025924 Bacteria 531
785 Ga0207650_10000040 3300025925 Bacteria 204095
786 Ga0207659_10060149 3300025926 Bacteria 2733
787 Ga0207659_10525363 3300025926 Bacteria 1004
788 Ga0207687_10003152 3300025927 Bacteria 11188
789 Ga0207687_10006117 3300025927 Bacteria 7966
790 Ga0207687_10009144 3300025927 Bacteria 6479
791 Ga0207687_10031507 3300025927 Bacteria 3584
792 Ga0207687_10575921 3300025927 Bacteria 947
793 Ga0207687_10580749 3300025927 Bacteria 943
794 Ga0207687_11208949 3300025927 Bacteria 649
795 Ga0207700_10000163 3300025928 Bacteria 39724
796 Ga0207700_10000928 3300025928 Bacteria 16844
797 Ga0207700_10001536 3300025928 Bacteria 13075
798 Ga0207700_10017211 3300025928 Bacteria 4824
799 Ga0207700_10076594 3300025928 Bacteria 2596
800 Ga0207700_10128542 3300025928 Bacteria 2065
801 Ga0207700_10130640 3300025928 Bacteria 2050
802 Ga0207700_10154978 3300025928 Bacteria 1897
803 Ga0207700_10234189 3300025928 Bacteria 1563
804 Ga0207700_10338117 3300025928 Bacteria 1308
805 Ga0207700_10372437 3300025928 Bacteria 1247
806 Ga0207700_10406223 3300025928 Bacteria 1194
807 Ga0207700_10415722 3300025928 Bacteria 1180
808 Ga0207700_10474508 3300025928 Bacteria 1105
809 Ga0207700_10727142 3300025928 Bacteria 887
810 Ga0207700_10775914 3300025928 Unclassified 857
811 Ga0207700_11120305 3300025928 Bacteria 703
812 Ga0207700_11170893 3300025928 Bacteria 687
813 Ga0207664_10000017 3300025929 Bacteria 230967
814 Ga0207664_10021558 3300025929 Bacteria 4794
815 Ga0207664_10023722 3300025929 Bacteria 4601
816 Ga0207664_10088175 3300025929 Unclassified 2538
817 Ga0207664_10220311 3300025929 Bacteria 1645
818 Ga0207664_10702953 3300025929 Bacteria 909
819 Ga0207664_10862307 3300025929 Bacteria 814
820 Ga0207644_10061223 3300025931 Bacteria 2725
821 Ga0207644_10187542 3300025931 Bacteria 1625
822 Ga0207690_10007447 3300025932 Bacteria 6495
823 Ga0207690_10056237 3300025932 Bacteria 2653
824 Ga0207690_10152711 3300025932 Unclassified 1713
825 Ga0207690_10225428 3300025932 Unclassified 1436
826 Ga0207690_10346903 3300025932 Unclassified 1173
827 Ga0207706_10000141 3300025933 Bacteria 78380
828 Ga0207706_10000897 3300025933 Bacteria 30555
829 Ga0207706_10089808 3300025933 Bacteria 2701
830 Ga0207706_10653037 3300025933 Bacteria 901
831 Ga0207686_10007765 3300025934 Bacteria 5782
832 Ga0207686_10090253 3300025934 Bacteria 2021
833 Ga0207686_10157415 3300025934 Bacteria 1589
834 Ga0207686_10367499 3300025934 Bacteria 1087
835 Ga0207686_10672185 3300025934 Unclassified 821
836 Ga0207709_10228426 3300025935 Bacteria 1347
837 Ga0207670_10011213 3300025936 Bacteria 5194
838 Ga0207704_10028369 3300025938 Bacteria 3104
839 Ga0207704_10272849 3300025938 Bacteria 1281
840 Ga0207704_11032289 3300025938 Bacteria 696
841 Ga0207665_10000357 3300025939 Bacteria 31691
842 Ga0207665_10011158 3300025939 Bacteria 5895
843 Ga0207665_10011331 3300025939 Bacteria 5854
844 Ga0207665_10011722 3300025939 Bacteria 5759
845 Ga0207665_10012249 3300025939 Bacteria 5631
846 Ga0207665_10026163 3300025939 Bacteria 3851
847 Ga0207665_10045668 3300025939 Bacteria 2933
848 Ga0207665_10137426 3300025939 Bacteria 1740
849 Ga0207665_10193781 3300025939 Bacteria 1478
850 Ga0207665_10196551 3300025939 Bacteria 1468
851 Ga0207665_10448598 3300025939 Bacteria 990
852 Ga0207665_10449845 3300025939 Bacteria 988
853 Ga0207665_10492134 3300025939 Bacteria 946
854 Ga0207665_10588600 3300025939 Bacteria 868
855 Ga0207665_10619085 3300025939 Bacteria 846
856 Ga0207665_10926786 3300025939 Unclassified 691
857 Ga0207691_10000120 3300025940 Bacteria 70657
858 Ga0207691_10181062 3300025940 Bacteria 1841
859 Ga0207711_10000977 3300025941 Bacteria 27397
860 Ga0207711_10032693 3300025941 Bacteria 4399
861 Ga0207711_10035011 3300025941 Bacteria 4254
862 Ga0207689_10000695 3300025942 Bacteria 32215
863 Ga0207689_10005702 3300025942 Bacteria 11073
864 Ga0207689_10052617 3300025942 Bacteria 3355
865 Ga0207689_10128892 3300025942 Bacteria 2082
866 Ga0207661_10000294 3300025944 Bacteria 31581
867 Ga0207661_10105187 3300025944 Bacteria 2378
868 Ga0207661_10618286 3300025944 Unclassified 995
869 Ga0207679_10001510 3300025945 Bacteria 14548
870 Ga0207679_10040950 3300025945 Bacteria 3319
871 Ga0207679_10086298 3300025945 Bacteria 2413
872 Ga0207667_10011908 3300025949 Bacteria 10073
873 Ga0207667_10022056 3300025949 Bacteria 7045
874 Ga0207667_10024637 3300025949 Bacteria 6602
875 Ga0207667_10042168 3300025949 Bacteria 4852
876 Ga0207667_10209440 3300025949 Bacteria 1998
877 Ga0207667_10466625 3300025949 Bacteria 1282
878 Ga0207667_10515822 3300025949 Bacteria 1211
879 Ga0207667_11353029 3300025949 Bacteria 687
880 Ga0207651_10005407 3300025960 Bacteria 6549
881 Ga0207651_11234823 3300025960 Unclassified 671
882 Ga0207651_11775657 3300025960 Bacteria 555
883 Ga0207712_10007469 3300025961 Bacteria 6901
884 Ga0207712_10473848 3300025961 Bacteria 1066
885 Ga0207668_10045209 3300025972 Bacteria 3001
886 Ga0207640_10000001 3300025981 Bacteria 628778
887 Ga0207640_10053109 3300025981 Bacteria 2643
888 Ga0207640_10078577 3300025981 Bacteria 2247
889 Ga0207640_10715885 3300025981 Bacteria 860
890 Ga0207658_10046062 3300025986 Bacteria 3182
891 Ga0207658_10385906 3300025986 Unclassified 1228
892 Ga0207677_10145690 3300026023 Bacteria 1819
893 Ga0207677_10259758 3300026023 Unclassified 1415
894 Ga0207677_10333278 3300026023 Bacteria 1265
895 Ga0207677_10736755 3300026023 Unclassified 877
896 Ga0207703_10008458 3300026035 Bacteria 8132
897 Ga0207703_10113799 3300026035 Bacteria 2313
898 Ga0207703_10114429 3300026035 Bacteria 2307
899 Ga0207703_10404408 3300026035 Bacteria 1267
900 Ga0207703_11111301 3300026035 Bacteria 759
901 Ga0207703_12268601 3300026035 Bacteria 519
902 Ga0207639_10000058 3300026041 Bacteria 108456
903 Ga0207639_10043552 3300026041 Bacteria 3370
904 Ga0207639_10133233 3300026041 Bacteria 2060
905 Ga0207639_10204915 3300026041 Bacteria 1694
906 Ga0207639_10228810 3300026041 Bacteria 1610
907 Ga0207639_10741627 3300026041 Bacteria 913
908 Ga0207678_10000058 3300026067 Bacteria 86018
909 Ga0207678_10003304 3300026067 Bacteria 14535
910 Ga0207678_10071953 3300026067 Bacteria 2963
911 Ga0207678_10161249 3300026067 Bacteria 1915
912 Ga0207678_11745337 3300026067 Bacteria 546
913 Ga0207708_10392881 3300026075 Bacteria 1145
914 Ga0207702_10002510 3300026078 Bacteria 17306
915 Ga0207702_10047336 3300026078 Bacteria 3623
916 Ga0207702_10233478 3300026078 Bacteria 1720
917 Ga0207702_10373211 3300026078 Bacteria 1370
918 Ga0207702_10436316 3300026078 Bacteria 1269
919 Ga0207702_10442580 3300026078 Bacteria 1260
920 Ga0207702_11316665 3300026078 Unclassified 716
921 Ga0207702_11409470 3300026078 Bacteria 691
922 Ga0207702_11434258 3300026078 Bacteria 684
923 Ga0207702_12084793 3300026078 Bacteria 557
924 Ga0207702_12523184 3300026078 Unclassified 500
925 Ga0207641_10000009 3300026088 Bacteria 407901
926 Ga0207641_10013093 3300026088 Bacteria 6803
927 Ga0207641_10245806 3300026088 Bacteria 1669
928 Ga0207641_10417081 3300026088 Bacteria 1292
929 Ga0207641_10459540 3300026088 Bacteria 1231
930 Ga0207648_10016140 3300026089 Bacteria 6838
931 Ga0207648_10032780 3300026089 Bacteria 4584
932 Ga0207648_10084326 3300026089 Bacteria 2771
933 Ga0207648_10963456 3300026089 Bacteria 798
934 Ga0207676_10000153 3300026095 Bacteria 60008
935 Ga0207676_10008783 3300026095 Bacteria 7191
936 Ga0207676_10963210 3300026095 Bacteria 839
937 Ga0207674_10000010 3300026116 Bacteria 196710
938 Ga0207674_10044614 3300026116 Bacteria 4566
939 Ga0207674_10307282 3300026116 Unclassified 1535
940 Ga0207674_10319795 3300026116 Unclassified 1501
941 Ga0207674_10593569 3300026116 Unclassified 1070
942 Ga0207675_100014445 3300026118 Bacteria 7361
943 Ga0207675_100283510 3300026118 Unclassified 1610
944 Ga0207683_10002699 3300026121 Bacteria 15506
945 Ga0207683_10082208 3300026121 Bacteria 2861
946 Ga0207698_10135314 3300026142 Unclassified 2113
947 Ga0207698_10266490 3300026142 Bacteria 1576
948 Ga0207698_10509647 3300026142 Bacteria 1172
949 Ga0207698_11972466 3300026142 Bacteria 598
950 Ga0207698_12028741 3300026142 Unclassified 589
951 Ga0209966_1010828 3300027695 Bacteria 1654
952 Ga0265354_1014282 3300028016 Bacteria 752
953 Ga0265356_1000376 3300028017 Bacteria 8112
954 Ga0268266_10006583 3300028379 Bacteria 10612
955 Ga0268266_10012346 3300028379 Bacteria 7388
956 Ga0268266_10022853 3300028379 Bacteria 5322
957 Ga0268266_10045437 3300028379 Bacteria 3757
958 Ga0268266_10064482 3300028379 Bacteria 3165
959 Ga0268265_10012306 3300028380 Bacteria 5798
960 Ga0268265_10025236 3300028380 Bacteria 4216
961 Ga0268264_10240699 3300028381 Bacteria 1676
962 Ga0268264_10274447 3300028381 Bacteria 1576
963 Ga0268264_10454759 3300028381 Unclassified 1241
964 Ga0268264_11011710 3300028381 Unclassified 838
965 Ga0265338_10001433 3300028800 Bacteria 38741
966 Ga0265338_10030364 3300028800 Bacteria 5325
967 Ga0265338_10137732 3300028800 Bacteria 1916
968 Ga0265338_10143301 3300028800 Bacteria 1868
969 Ga0265338_10259064 3300028800 Bacteria 1279
970 Ga0265338_10575674 3300028800 Unclassified 786
971 Ga0265762_1000311 3300030760 Bacteria 8261
972 Ga0265762_1000664 3300030760 Bacteria 6068
973 Ga0265762_1001754 3300030760 Bacteria 3941
974 Ga0265762_1009779 3300030760 Bacteria 1711
975 Ga0265762_1035242 3300030760 Bacteria 962
976 Ga0265770_1006714 3300030878 Bacteria 1603
977 Ga0265770_1030091 3300030878 Bacteria 905
978 Ga0265765_1018861 3300030879 Bacteria 822
979 Ga0265760_10000112 3300031090 Bacteria 20679
980 Ga0265760_10000553 3300031090 Bacteria 10580
981 Ga0265760_10005449 3300031090 Bacteria 3649
982 Ga0265760_10018718 3300031090 Bacteria 1995
983 Ga0265760_10022273 3300031090 Bacteria 1836
984 Ga0265760_10053749 3300031090 Bacteria 1215
985 Ga0265330_10034152 3300031235 Bacteria 2272
986 Ga0265330_10200816 3300031235 Bacteria 843
987 Ga0265330_10318825 3300031235 Bacteria 656
988 Ga0265332_10051239 3300031238 Bacteria 1773
989 Ga0265332_10404748 3300031238 Unclassified 564
990 Ga0265325_10006501 3300031241 Bacteria 7086
991 Ga0265325_10020381 3300031241 Bacteria 3655
992 Ga0265325_10021392 3300031241 Bacteria 3553
993 Ga0265340_10016242 3300031247 Bacteria 3858
994 Ga0265340_10021295 3300031247 Bacteria 3325
995 Ga0265340_10041436 3300031247 Bacteria 2264
996 Ga0265340_10058212 3300031247 Bacteria 1856
997 Ga0265339_10043867 3300031249 Bacteria 2470
998 Ga0265339_10070799 3300031249 Bacteria 1859
999 Ga0265339_10080145 3300031249 Unclassified 1727
1000 Ga0265331_10237334 3300031250 Bacteria 818
1001 Ga0265327_10098207 3300031251 Bacteria 1417
1002 Ga0265316_10000706 3300031344 Bacteria 36971
1003 Ga0265316_10105530 3300031344 Bacteria 2138
1004 Ga0265316_10732373 3300031344 Bacteria 696
1005 Ga0265316_11119459 3300031344 Bacteria 546
1006 Ga0307408_100090522 3300031548 Bacteria 2309
1007 Ga0307408_100618990 3300031548 Unclassified 964
1008 Ga0265313_10019555 3300031595 Bacteria 3764
1009 Ga0265314_10001717 3300031711 Bacteria 23774
1010 Ga0265314_10021063 3300031711 Bacteria 5024
1011 Ga0265314_10164347 3300031711 Bacteria 1347
1012 Ga0265314_10173096 3300031711 Bacteria 1301
1013 Ga0265342_10324743 3300031712 Bacteria 806
1014 Ga0307405_10117911 3300031731 Unclassified 1811
1015 Ga0307409_100236970 3300031995 Bacteria 1658
1016 Ga0307409_100571568 3300031995 Bacteria 1113
1017 Ga0307409_101604950 3300031995 Bacteria 679
1018 Ga0307414_10675481 3300032004 Bacteria 933
1019 Ga0307411_10222402 3300032005 Bacteria 1466
1020 Ga0307411_11841729 3300032005 Bacteria 562
1021 Ga0307415_100066794 3300032126 Bacteria 2511
1022 Ga0307415_100366303 3300032126 Bacteria 1219
1023 Ga0307510_10020741 3300033180 Bacteria 7672
1024 Ga0307510_10105447 3300033180 Bacteria 2587
1025 Ga0316212_1002277 3300033547 Bacteria 2727
1026 Ga0373959_0137685 3300034820 Bacteria 609
1027 Ga0373938_0221381 3300034957 Bacteria 532
1028 Ga0373926_0072512 3300035083 Bacteria 1266
1029 Ga0373929_0079412 3300035085 Bacteria 797
1030 Ga0373934_0065120 3300035086 Bacteria 1455
1031 Ga0373944_0041686 3300035089 Bacteria 1421
1032 Ga0373923_0065269 3300035111 Bacteria 1553
1033 Ga0373923_0596110 3300035111 Bacteria 544
1034 Ga0373936_0000589 3300035113 Bacteria 12529
1035 Ga0373936_0047620 3300035113 Bacteria 1729
1036 Ga0373936_0052483 3300035113 Bacteria 1652
1037 Ga0373941_0031269 3300035115 Bacteria 1585
1038 Ga0373945_0000849 3300035116 Bacteria 8994
1039 Ga0373945_0068189 3300035116 Unclassified 1341
1040 Ga0373945_0165952 3300035116 Bacteria 902
1041 Ga0373945_0307140 3300035116 Bacteria 680
1042 Ga0373953_0013504 3300035117 Unclassified 2919
1043 Ga0373956_0051924 3300035119 Bacteria 1843
1044 Ga0373956_0106449 3300035119 Bacteria 1304
1045 Ga0373956_0312409 3300035119 Unclassified 749
1046 Ga0373957_0035087 3300035120 Bacteria 1862
1047 Ga0373957_0099863 3300035120 Bacteria 1161
1048 Ga0373943_0000002 3300035170 Bacteria 106064
1049 Ga0373943_0008395 3300035170 Bacteria 4634
1050 Ga0373946_0067918 3300035171 Bacteria 1532
1051 Ga0373955_0031012 3300035172 Bacteria 2797
1052 Ga0373955_0506853 3300035172 Unclassified 737
1053 Ga0373955_0765020 3300035172 Bacteria 593
1054 Ga0373942_0380450 3300035207 Bacteria 504
1055 Ga0373962_0052640 3300035242 Bacteria 1177
1056 Ga0373924_0000068 3300035410 Bacteria 27359
1057 Ga0373924_0013747 3300035410 Bacteria 3046
1058 Ga0373924_0049930 3300035410 Bacteria 1732
1059 Ga0373924_0093919 3300035410 Bacteria 1285
1060 Ga0373924_0110977 3300035410 Bacteria 1185
1061 Ga0373931_0015086 3300035691 Bacteria 3786
1062 Ga0373931_0065961 3300035691 Bacteria 1963
1063 Ga0373931_0219192 3300035691 Bacteria 1145
1064 Ga0373931_0413978 3300035691 Bacteria 856
1065 Ga0373931_0513186 3300035691 Unclassified 775
1066 Ga0373935_0001922 3300035692 Bacteria 11688
1067 Ga0373935_0044182 3300035692 Bacteria 2807
1068 Ga0373935_0062312 3300035692 Bacteria 2389
1069 Ga0373935_0088998 3300035692 Bacteria 2018
1070 Ga0373935_0154531 3300035692 Bacteria 1559
1071 Ga0373935_0441896 3300035692 Bacteria 938
1072 Ga0373927_0000021 3300035695 Bacteria 124647
1073 Ga0373927_0004851 3300035695 Bacteria 9354
1074 Ga0373927_0132432 3300035695 Bacteria 1629
1075 Ga0373933_0044565 3300035724 Bacteria 2628
1076 Ga0373933_0114449 3300035724 Bacteria 1685
1077 Ga0373933_0269322 3300035724 Unclassified 1099
1078 Ga0373933_0288608 3300035724 Bacteria 1061
1079 Ga0373933_0736590 3300035724 Bacteria 648
1080 Ga0373947_0002466 3300035725 Bacteria 11131
1081 Ga0373947_0037855 3300035725 Bacteria 2863
1082 Ga0373947_0114539 3300035725 Bacteria 1707
1083 Ga0373947_0119751 3300035725 Bacteria 1671
1084 Ga0373947_0176034 3300035725 Bacteria 1390
1085 Ga0373947_0471783 3300035725 Bacteria 851
1086 Ga0373947_0848632 3300035725 Unclassified 624
1087 Ga0373937_0042488 3300036401 Bacteria 4148
1088 Ga0373937_0086605 3300036401 Bacteria 2899
1089 Ga0373937_0105084 3300036401 Bacteria 2624
1090 Ga0373937_0244543 3300036401 Bacteria 1691
1091 Ga0373937_0965987 3300036401 Bacteria 801
1092 Ga0373937_1327605 3300036401 Bacteria 667
1093 Ga0373925_0004097 3300037068 Bacteria 11059
1094 Ga0373925_0004660 3300037068 Bacteria 10345
1095 Ga0373925_0025607 3300037068 Bacteria 4312
1096 Ga0373925_0039398 3300037068 Bacteria 3496
1097 Ga0373925_0043648 3300037068 Bacteria 3329
1098 Ga0373925_0627372 3300037068 Bacteria 886
1099 Ga0373925_1104428 3300037068 Bacteria 652
1100 Ga0373925_1478035 3300037068 Unclassified 556
1101 Ga0373925_1625014 3300037068 Unclassified 528
1102 Ga0395898_0234003 3300037466 Unclassified 1752
1103 Ga0395905_0979428 3300037471 Unclassified 749
1104 Ga0436364_0856169 3300037853 Unclassified 1985
1105 Ga0395901_0214172 3300038443 Unclassified 2015
1106 Ga0242420_029312 3300038996 Bacteria 1015
1107 Ga0436365_1421008 3300039437 Bacteria 1729
1108 Ga0436360_0525893 3300039438 Bacteria 1212
1109 Ga0436360_0727080 3300039438 Bacteria 612
1110 Ga0436361_0936610 3300039447 Bacteria 584
1111 Ga0436363_0654277 3300039450 Bacteria 5140
1112 Ga0436363_0682772 3300039450 Bacteria 9687
1113 Ga0436363_0957099 3300039450 Bacteria 717
1114 Ga0436363_1305165 3300039450 Bacteria 3951
1115 Ga0436362_0212779 3300039453 Unclassified 955
1116 Ga0436362_0857316 3300039453 Bacteria 7608
1117 Ga0436362_1069201 3300039453 Unclassified 696
1118 Ga0436362_1157553 3300039453 Bacteria 896
1119 Ga0451577_0642420 3300042876 Bacteria 962
1120 Ga0453683_0137055 3300044673 Bacteria 1544
1121 Ga0466963_0002948 3300044694 Bacteria 9615
1122 Ga0453684_1999474 3300044712 Unclassified 584
1123 Ga0466957_0150619 3300044842 Unclassified 1504
1124 Ga0466959_0276036 3300045049 Unclassified 1154
1125 Ga0451576_0027604 3300045051 Bacteria 6094
1126 Ga0466958_0223860 3300045836 Bacteria 1200
1127 Ga0466958_1068782 3300045836 Bacteria 527
1128 Ga0466967_0006861 3300045976 Bacteria 8127
1129 Ga0466967_0203797 3300045976 Bacteria 1874
1130 Ga0466967_0250375 3300045976 Bacteria 1692
1131 Ga0466967_0271668 3300045976 Bacteria 1624
1132 Ga0466967_1104559 3300045976 Unclassified 790
1133 Ga0495592_0100581 3300046454 Bacteria 2061
1134 Ga0495603_0003176 3300046455 Bacteria 9771
1135 Ga0495603_0036976 3300046455 Bacteria 2930
1136 Ga0495590_0391819 3300046457 Unclassified 532
1137 Ga0495629_0006749 3300046459 Bacteria 8486
1138 Ga0495629_0008385 3300046459 Bacteria 7602
1139 Ga0495629_0011889 3300046459 Bacteria 6312
1140 Ga0495651_0068984 3300046462 Bacteria 2694
1141 Ga0495651_0100433 3300046462 Unclassified 2155
1142 Ga0495651_0232111 3300046462 Bacteria 1270
1143 Ga0495653_0010025 3300046463 Bacteria 7751
1144 Ga0495653_0446137 3300046463 Unclassified 815
1145 Ga0495650_0000009 3300046471 Bacteria 653845
1146 Ga0495650_0003359 3300046471 Bacteria 11742
1147 Ga0495580_0000563 3300046472 Bacteria 31329
1148 Ga0495580_0001106 3300046472 Bacteria 23674
1149 Ga0495580_0001748 3300046472 Bacteria 19098
1150 Ga0495580_0013714 3300046472 Bacteria 6174
1151 Ga0495580_0018608 3300046472 Bacteria 5170
1152 Ga0495580_0047537 3300046472 Unclassified 3041
1153 Ga0495580_0053405 3300046472 Bacteria 2851
1154 Ga0495580_0081309 3300046472 Bacteria 2258
1155 Ga0495580_0112833 3300046472 Unclassified 1888
1156 Ga0495580_0142393 3300046472 Bacteria 1662
1157 Ga0495580_0147585 3300046472 Bacteria 1630
1158 Ga0495580_0170471 3300046472 Bacteria 1505
1159 Ga0495580_0185593 3300046472 Unclassified 1435
1160 Ga0495580_0254121 3300046472 Unclassified 1203
1161 Ga0495580_0371882 3300046472 Bacteria 966
1162 Ga0495580_0483342 3300046472 Bacteria 828
1163 Ga0495582_0001590 3300046473 Bacteria 12805
1164 Ga0495582_0014685 3300046473 Bacteria 4303
1165 Ga0495582_0057323 3300046473 Unclassified 2148
1166 Ga0495582_0080426 3300046473 Bacteria 1809
1167 Ga0495582_0475200 3300046473 Unclassified 722
1168 Ga0495639_0016680 3300046475 Bacteria 3189
1169 Ga0495639_0055433 3300046475 Bacteria 1808
1170 Ga0495662_0002003 3300046476 Bacteria 10206
1171 Ga0495664_0003430 3300046477 Bacteria 8621
1172 Ga0495664_0012639 3300046477 Bacteria 4783
1173 Ga0495664_0088960 3300046477 Unclassified 1856
1174 Ga0495594_0000239 3300046499 Bacteria 26556
1175 Ga0495594_0001215 3300046499 Bacteria 13462
1176 Ga0495594_0001953 3300046499 Bacteria 10758
1177 Ga0495594_0054356 3300046499 Bacteria 2207
1178 Ga0495594_0058561 3300046499 Bacteria 2129
1179 Ga0495583_0017801 3300046506 Bacteria 3760
1180 Ga0495583_0068635 3300046506 Bacteria 1563
1181 Ga0495606_0092760 3300046507 Unclassified 1854
1182 Ga0495606_0156825 3300046507 Bacteria 1331
1183 Ga0495606_0191197 3300046507 Bacteria 1173
1184 Ga0495608_0272050 3300046511 Unclassified 1053
1185 Ga0495616_0274619 3300046513 Unclassified 718
1186 Ga0495618_0117408 3300046514 Bacteria 1703
1187 Ga0495628_0001498 3300046516 Bacteria 21393
1188 Ga0495628_0105147 3300046516 Bacteria 2175
1189 Ga0495628_0439843 3300046516 Bacteria 948
1190 Ga0495630_0034429 3300046517 Bacteria 3782
1191 Ga0495630_0250199 3300046517 Bacteria 1354
1192 Ga0495630_0267091 3300046517 Unclassified 1307
1193 Ga0495632_0315876 3300046519 Bacteria 691
1194 Ga0495644_0000290 3300046523 Bacteria 23232
1195 Ga0495648_0254472 3300046524 Bacteria 846
1196 Ga0495666_0000987 3300046526 Bacteria 13455
1197 Ga0495642_0054436 3300046528 Bacteria 1650
1198 Ga0495642_0259879 3300046528 Bacteria 759
1199 Ga0495652_0003983 3300046529 Bacteria 14306
1200 Ga0495652_0093786 3300046529 Bacteria 2450
1201 Ga0495652_0154130 3300046529 Bacteria 1791
1202 Ga0495652_0895144 3300046529 Bacteria 586
1203 Ga0495665_0001222 3300046531 Bacteria 13725
1204 Ga0495665_0079395 3300046531 Bacteria 1726
1205 Ga0495665_0181929 3300046531 Unclassified 1092
1206 Ga0495665_0222318 3300046531 Bacteria 976
1207 Ga0495640_0004227 3300046533 Bacteria 11483
1208 Ga0495586_0001012 3300046535 Bacteria 15861
1209 Ga0495586_0050652 3300046535 Bacteria 2247
1210 Ga0495587_0138502 3300046536 Bacteria 1390
1211 Ga0495609_0023923 3300046538 Bacteria 2804
1212 Ga0495645_0004045 3300046543 Bacteria 10013
1213 Ga0495645_0180992 3300046543 Bacteria 1444
1214 Ga0495645_0675006 3300046543 Unclassified 629
1215 Ga0495645_0790021 3300046543 Unclassified 570
1216 Ga0495622_0103638 3300046557 Unclassified 1303
1217 Ga0495633_0024953 3300046558 Bacteria 2949
1218 Ga0495667_0005674 3300046559 Bacteria 8445
1219 Ga0495667_0407871 3300046559 Bacteria 856
1220 Ga0495667_0528035 3300046559 Unclassified 738
1221 Ga0495668_0143043 3300046616 Bacteria 1309
1222 Ga0495668_0328252 3300046616 Unclassified 839
1223 Ga0495668_0444382 3300046616 Bacteria 713
1224 Ga0495634_0001395 3300046642 Bacteria 21738
1225 Ga0495634_0267213 3300046642 Bacteria 1042
1226 Ga0495611_0031459 3300046648 Bacteria 2336
1227 Ga0495625_0000174 3300046660 Bacteria 100401
1228 Ga0495625_0051081 3300046660 Bacteria 2965
1229 Ga0495625_0082604 3300046660 Bacteria 2234
1230 Ga0495625_0107056 3300046660 Bacteria 1914
1231 Ga0495625_0373775 3300046660 Bacteria 896
1232 Ga0495635_0003625 3300046663 Bacteria 10702
1233 Ga0495635_0171085 3300046663 Bacteria 1477
1234 Ga0495635_0466388 3300046663 Bacteria 834
1235 Ga0495657_0072194 3300046675 Bacteria 2252
1236 Ga0495657_0164998 3300046675 Bacteria 1368
1237 Ga0495599_0010918 3300046678 Bacteria 5568
1238 Ga0495599_0485170 3300046678 Bacteria 729
1239 Ga0495623_0044332 3300046679 Bacteria 2826
1240 Ga0495623_0538859 3300046679 Unclassified 612
1241 Ga0495623_0551408 3300046679 Bacteria 603
1242 Ga0495646_0001575 3300046680 Bacteria 13600
1243 Ga0495646_0170319 3300046680 Unclassified 1200
1244 Ga0495646_0443667 3300046680 Unclassified 671
1245 Ga0495669_0008466 3300046684 Bacteria 4327
1246 Ga0495669_0089066 3300046684 Bacteria 1423
1247 Ga0495613_0001438 3300046689 Bacteria 18178
1248 Ga0495613_1126122 3300046689 Unclassified 500
1249 Ga0495624_0014189 3300046690 Bacteria 5415
1250 Ga0495624_0147020 3300046690 Bacteria 1442
1251 Ga0495624_0308226 3300046690 Bacteria 954
1252 Ga0495624_0412238 3300046690 Bacteria 811
1253 Ga0495624_0537790 3300046690 Bacteria 698
1254 Ga0495600_0004609 3300046809 Bacteria 8258
1255 Ga0495600_0125257 3300046809 Bacteria 1671
1256 Ga0495581_0000697 3300047315 Bacteria 17641
1257 Ga0495581_0025866 3300047315 Bacteria 3404
1258 Ga0495581_0531185 3300047315 Unclassified 683
1259 Ga0495604_0037535 3300047317 Bacteria 3815
1260 Ga0495636_0102648 3300047318 Bacteria 1252
1261 Ga0495674_0011347 3300047319 Bacteria 8411
1262 Ga0495674_0073736 3300047319 Bacteria 2941
1263 Ga0495674_0203153 3300047319 Bacteria 1643
1264 Ga0495674_0668975 3300047319 Bacteria 817
1265 Ga0495672_0004082 3300047320 Bacteria 12180
1266 Ga0495672_0145954 3300047320 Bacteria 1231
1267 Ga0495672_0290943 3300047320 Bacteria 777
1268 Ga0495676_0000317 3300047321 Bacteria 39240
1269 Ga0495676_0747485 3300047321 Bacteria 631
1270 Ga0495680_0008074 3300047322 Bacteria 9596
1271 Ga0495680_0756055 3300047322 Unclassified 638
1272 Ga0495683_0236034 3300047323 Bacteria 808
1273 Ga0495675_0002311 3300047444 Bacteria 11387
1274 Ga0495675_0112728 3300047444 Unclassified 1697
1275 Ga0495677_0042322 3300047445 Bacteria 1668
1276 Ga0495673_0054735 3300047469 Bacteria 1734
1277 Ga0495673_0097231 3300047469 Bacteria 1195
1278 Ga0495684_0454239 3300047471 Bacteria 890
1279 Ga0495684_0508018 3300047471 Unclassified 828
1280 Ga0495686_0000087 3300047472 Bacteria 196747
1281 Ga0495686_0002533 3300047472 Bacteria 17095
1282 Ga0495686_0035701 3300047472 Bacteria 3194
1283 Ga0495686_0081466 3300047472 Bacteria 1977
1284 Ga0495593_0018843 3300047673 Bacteria 3874
1285 Ga0495602_0148731 3300048088 Bacteria 1844
1286 Ga0495602_0446062 3300048088 Unclassified 914
1287 Ga0495602_0464006 3300048088 Bacteria 892
1288 Ga0495602_0472318 3300048088 Unclassified 881
1289 Ga0495614_0000365 3300048089 Bacteria 18172
1290 Ga0495614_0060575 3300048089 Bacteria 1626
1291 Ga0496100_0103946 3300048903 Bacteria 1962
1292 Ga0496100_0288884 3300048903 Unclassified 1225
1293 Ga0496100_0838500 3300048903 Unclassified 721
1294 Ga0496101_0086554 3300048904 Bacteria 2324
1295 Ga0496101_0258323 3300048904 Bacteria 1358
1296 Ga0496101_0457649 3300048904 Bacteria 1007
1297 Ga0496101_0812690 3300048904 Unclassified 737
1298 Ga0496102_0001500 3300048905 Bacteria 20613
1299 Ga0496102_0041202 3300048905 Bacteria 4180
1300 Ga0496102_0112371 3300048905 Unclassified 2541
1301 Ga0496102_0169589 3300048905 Bacteria 2055
1302 Ga0496102_0327497 3300048905 Bacteria 1443
1303 Ga0496102_0463468 3300048905 Bacteria 1188
1304 Ga0496102_0821426 3300048905 Bacteria 852
1305 Ga0496103_0010834 3300048906 Bacteria 5396
1306 Ga0496103_0108522 3300048906 Bacteria 1761
1307 Ga0496103_0186427 3300048906 Bacteria 1334
1308 Ga0496104_0002436 3300048907 Bacteria 16033
1309 Ga0496104_0022220 3300048907 Bacteria 5826
1310 Ga0496104_0023786 3300048907 Bacteria 5634
1311 Ga0496104_0023902 3300048907 Bacteria 5622
1312 Ga0496104_0115202 3300048907 Unclassified 2579
1313 Ga0496104_0296989 3300048907 Unclassified 1528
1314 Ga0496104_0433274 3300048907 Bacteria 1227
1315 Ga0496104_0567751 3300048907 Bacteria 1045
1316 Ga0496104_0779242 3300048907 Unclassified 863
1317 Ga0496104_1441986 3300048907 Bacteria 591
1318 Ga0496105_0098109 3300048908 Unclassified 2420
1319 Ga0496105_0213099 3300048908 Bacteria 1574
1320 Ga0496106_0031172 3300048909 Bacteria 3973
1321 Ga0496106_0090342 3300048909 Bacteria 2363
1322 Ga0496106_0179820 3300048909 Bacteria 1679
1323 Ga0496106_0266849 3300048909 Unclassified 1370
1324 Ga0496107_0189850 3300048910 Bacteria 1526
1325 Ga0496107_0206222 3300048910 Unclassified 1461
1326 Ga0496107_0269813 3300048910 Bacteria 1266
1327 Ga0496108_0000422 3300048911 Bacteria 34654
1328 Ga0496108_0151919 3300048911 Bacteria 1998
1329 Ga0496108_1167986 3300048911 Bacteria 652
1330 Ga0496108_1218765 3300048911 Unclassified 636
1331 Ga0496109_0001507 3300048912 Bacteria 19375
1332 Ga0496109_0218740 3300048912 Bacteria 1791
1333 Ga0496109_0539880 3300048912 Bacteria 1100
1334 Ga0496109_0982305 3300048912 Bacteria 782
1335 Ga0496110_0014240 3300048913 Bacteria 6598
1336 Ga0496110_0054816 3300048913 Bacteria 3507
1337 Ga0496111_0008180 3300048914 Bacteria 6914
1338 Ga0496111_0019854 3300048914 Bacteria 4672
1339 Ga0496111_0308824 3300048914 Bacteria 1172
1340 Ga0496112_0001888 3300048915 Bacteria 16525
1341 Ga0496112_0008075 3300048915 Bacteria 9397
1342 Ga0496112_0013759 3300048915 Bacteria 7482
1343 Ga0496112_0015992 3300048915 Bacteria 7015
1344 Ga0496112_0021039 3300048915 Bacteria 6196
1345 Ga0496112_0068332 3300048915 Bacteria 3508
1346 Ga0496112_0982343 3300048915 Bacteria 764
1347 Ga0496113_0001069 3300048916 Bacteria 14806
1348 Ga0496113_0023620 3300048916 Bacteria 4360
1349 Ga0496113_0064705 3300048916 Bacteria 2765
1350 Ga0496113_0119797 3300048916 Bacteria 2057
1351 Ga0496113_0438773 3300048916 Unclassified 1049
1352 Ga0496114_1613234 3300048917 Bacteria 537
1353 Ga0496115_0004078 3300048918 Bacteria 10553
1354 Ga0496115_0021623 3300048918 Bacteria 4972
1355 Ga0496115_0065184 3300048918 Bacteria 2942
1356 Ga0496115_0281670 3300048918 Bacteria 1365
1357 Ga0496115_0926645 3300048918 Bacteria 670
1358 Ga0496126_0000139 3300048929 Bacteria 167097
1359 Ga0496126_0003176 3300048929 Bacteria 21151
1360 Ga0496126_0197453 3300048929 Bacteria 1701
1361 Ga0501306_103997 3300049127 Unclassified 510
1362 Ga0495682_0039331 3300049460 Bacteria 1736
1363 Ga0501291_121403 3300049514 Bacteria 567
1364 Ga0501292_006508 3300049515 Bacteria 1662
1365 Ga0501296_025900 3300049519 Bacteria 770
1366 Ga0501297_012034 3300049520 Bacteria 1001
1367 Ga0501297_027267 3300049520 Bacteria 744
1368 Ga0501298_005110 3300049521 Unclassified 2092
1369 Ga0501298_014962 3300049521 Bacteria 1392
1370 Ga0501299_018295 3300049522 Bacteria 1258
1371 Ga0501031_0036477 3300049568 Bacteria 3207
1372 Ga0501032_0000638 3300049569 Bacteria 28461
1373 Ga0501033_0007918 3300049570 Bacteria 8230
1374 Ga0501033_0235156 3300049570 Bacteria 1301
1375 Ga0501034_0002797 3300049571 Bacteria 20406
1376 Ga0501036_0001803 3300049572 Bacteria 16608
1377 Ga0501037_0020105 3300049573 Bacteria 4930
1378 Ga0501037_0159778 3300049573 Bacteria 1607
1379 Ga0501038_0000571 3300049574 Bacteria 32582
1380 Ga0501043_0002729 3300049579 Bacteria 14759
1381 Ga0501046_0001246 3300049580 Bacteria 24621
1382 Ga0501047_0002082 3300049581 Bacteria 19151
1383 Ga0501073_0005596 3300049589 Bacteria 9401
1384 Ga0501073_0206060 3300049589 Bacteria 1359
1385 Ga0501073_0269169 3300049589 Bacteria 1176
1386 Ga0501077_0097755 3300049593 Bacteria 1861
1387 Ga0501224_012182 3300049664 Bacteria 1266
1388 Ga0501233_217034 3300049668 Bacteria 563
1389 Ga0501235_213456 3300049669 Unclassified 527
1390 Ga0501247_051711 3300049677 Bacteria 611
1391 Ga0501080_0023122 3300049742 Bacteria 5764
1392 Ga0501080_0515185 3300049742 Bacteria 1068
1393 Ga0501083_0206279 3300049744 Bacteria 1282
1394 Ga0501262_069869 3300049759 Bacteria 573
1395 Ga0501273_026108 3300049770 Bacteria 813
1396 Ga0501278_008949 3300049774 Bacteria 779
1397 Ga0501035_0008138 3300049822 Bacteria 9771
1398 Ga0501044_0015327 3300049823 Bacteria 8255
1399 Ga0501045_0313341 3300049824 Bacteria 1168
1400 nmdc:mga06r32_308023_c1 3300050510 Bacteria 1569
1401 nmdc:mga0n895_46183_c1 3300050512 Bacteria 4253
1402 nmdc:mga0n895_473906_c1 3300050512 Unclassified 1263
1403 nmdc:mga0n895_5110_c1 3300050512 Bacteria 10901
1404 nmdc:mga0rr50_1772902_c1 3300050513 Unclassified 520
1405 nmdc:mga0rr50_199769_c1 3300050513 Bacteria 1642
1406 nmdc:mga08x19_129199_c1 3300050514 Bacteria 1698
1407 nmdc:mga08x19_197730_c1 3300050514 Bacteria 1377
1408 nmdc:mga08x19_58901_c1 3300050514 Bacteria 2486
1409 nmdc:mga08x19_61341_c1 3300050514 Bacteria 2437
1410 nmdc:mga08x19_648199_c1 3300050514 Bacteria 749
1411 nmdc:mga0a205_553460_c1 3300050515 Bacteria 1005
1412 nmdc:mga0a205_94531_c1 3300050515 Bacteria 2888
1413 Ga0495601_0012731 3300053077 Bacteria 5048
1414 Ga0495601_0067495 3300053077 Bacteria 2279
1415 Ga0495619_0804954 3300053085 Unclassified 635
1416 Ga0495619_0934441 3300053085 Unclassified 582
1417 Ga0500643_039654 3300053087 Bacteria 1390
1418 Ga0500651_0000010 3300053093 Bacteria 253038
1419 Ga0500595_000007 3300053119 Bacteria 289461
1420 Ga0500595_023685 3300053119 Bacteria 2154
1421 Ga0501084_0296196 3300054114 Bacteria 1366
1422 Ga0500661_001206 3300055283 Bacteria 4832
1423 Ga0587066_098490 3300059490 Unclassified 661
1424 Ga0587066_109753 3300059490 Bacteria 638
1425 Ga0587073_0062006 3300059492 Bacteria 880
1426 Ga0587073_0095743 3300059492 Unclassified 763
1427 Ga0587073_0305330 3300059492 Unclassified 519
1428 Ga0587080_050009 3300059503 Bacteria 787
1429 Ga0587082_070565 3300059504 Unclassified 709
1430 Ga0587083_0084930 3300059505 Unclassified 761
1431 Ga0587090_065221 3300059510 Bacteria 700
1432 Ga0587091_069249 3300059511 Unclassified 768
1433 Ga0587092_134761 3300059512 Unclassified 539
1434 Ga0587094_105529 3300059513 Bacteria 549
1435 Ga0587101_098024 3300059623 Unclassified 579
1436 Ga0587067_158215 3300059640 Unclassified 574
1437 Ga0587075_050988 3300059644 Bacteria 722
1438 Ga0587076_033672 3300059645 Unclassified 922
1439 Ga0587114_036932 3300059655 Unclassified 775
1440 Ga0587071_134932 3300060344 Unclassified 601
1441 Ga0587111_0213486 3300060346 Unclassified 553

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007265 Ga0099794_10096584 Ga0099794_100965841 129
2 3300025939 Ga0207665_10588600 Ga0207665_105886002 133
3 3300005330 Ga0070690_100605485 Ga0070690_1006054852 135
4 3300005435 Ga0070714_100109078 Ga0070714_1001090783 135
5 3300005435 Ga0070714_101489498 Ga0070714_1014894982 135
6 3300005436 Ga0070713_100462169 Ga0070713_1004621691 135
7 3300005436 Ga0070713_100522774 Ga0070713_1005227742 135
8 3300005437 Ga0070710_10081696 Ga0070710_100816962 135
9 3300005439 Ga0070711_100145306 Ga0070711_1001453062 135
10 3300005444 Ga0070694_100716303 Ga0070694_1007163032 135
11 3300006914 Ga0075436_100091120 Ga0075436_1000911202 135
12 3300006914 Ga0075436_100366095 Ga0075436_1003660952 135
13 3300009093 Ga0105240_10108242 Ga0105240_101082423 135
14 3300009545 Ga0105237_10668843 Ga0105237_106688432 135
15 3300013297 Ga0157378_10108002 Ga0157378_101080024 135
16 3300025898 Ga0207692_10362334 Ga0207692_103623342 135
17 3300025913 Ga0207695_10122567 Ga0207695_101225671 135
18 3300026035 Ga0207703_11111301 Ga0207703_111113012 135
19 3300031548 Ga0307408_100618990 Ga0307408_1006189901 135
20 3300031731 Ga0307405_10117911 Ga0307405_101179112 135
21 3300031995 Ga0307409_100236970 Ga0307409_1002369703 135
22 3300031995 Ga0307409_100571568 Ga0307409_1005715681 135
23 3300032004 Ga0307414_10675481 Ga0307414_106754812 135
24 3300032005 Ga0307411_10222402 Ga0307411_102224022 135
25 3300032005 Ga0307411_11841729 Ga0307411_118417292 135
26 3300032126 Ga0307415_100066794 Ga0307415_1000667943 135
27 3300032126 Ga0307415_100366303 Ga0307415_1003663032 135
28 3300045976 Ga0466967_1104559 Ga0466967_1104559_353_760 135
29 3300048905 Ga0496102_0169589 Ga0496102_0169589_660_1067 135
30 3300049127 Ga0501306_103997 Ga0501306_103997_49_456 135
31 3300049514 Ga0501291_121403 Ga0501291_121403_100_507 135
32 3300049521 Ga0501298_014962 Ga0501298_014962_949_1356 135
33 3300049664 Ga0501224_012182 Ga0501224_012182_779_1186 135
34 3300049668 Ga0501233_217034 Ga0501233_217034_124_531 135
35 3300049677 Ga0501247_051711 Ga0501247_051711_168_575 135
36 3300049759 Ga0501262_069869 Ga0501262_069869_55_462 135
37 3300049770 Ga0501273_026108 Ga0501273_026108_374_781 135
38 3300050513 nmdc:mga0rr50_199769_c1 nmdc:mga0rr50_199769_c1_978_1385 135
39 3300050514 nmdc:mga08x19_58901_c1 nmdc:mga08x19_58901_c1_180_587 135
40 3300050514 nmdc:mga08x19_61341_c1 nmdc:mga08x19_61341_c1_1752_2159 135
41 3300050514 nmdc:mga08x19_648199_c1 nmdc:mga08x19_648199_c1_270_677 135
42 2162886012 MBSR1b_contig_3103743 MBSR1b_0230.00005310 136
43 3300000546 LJNas_1001286 LJNas_10012864 136
44 3300001976 JGI24752J21851_1001233 JGI24752J21851_10012332 136
45 3300001990 JGI24737J22298_10029521 JGI24737J22298_100295213 136
46 3300002075 JGI24738J21930_10128631 JGI24738J21930_101286312 136
47 3300002459 JGI24751J29686_10002071 JGI24751J29686_100020713 136
48 3300004800 Ga0058861_12048564 Ga0058861_120485641 136
49 3300004803 Ga0058862_10173224 Ga0058862_101732242 136
50 3300004803 Ga0058862_12495541 Ga0058862_124955411 136
51 3300004803 Ga0058862_12808140 Ga0058862_128081401 136
52 3300005290 Ga0065712_10221444 Ga0065712_102214442 136
53 3300005290 Ga0065712_10285988 Ga0065712_102859881 136
54 3300005293 Ga0065715_10117766 Ga0065715_101177662 136
55 3300005293 Ga0065715_10293036 Ga0065715_102930362 136
56 3300005327 Ga0070658_10012556 Ga0070658_100125562 136
57 3300005327 Ga0070658_10126712 Ga0070658_101267122 136
58 3300005327 Ga0070658_10469987 Ga0070658_104699872 136
59 3300005328 Ga0070676_10056461 Ga0070676_100564612 136
60 3300005328 Ga0070676_10147316 Ga0070676_101473162 136
61 3300005329 Ga0070683_100033697 Ga0070683_1000336972 136
62 3300005329 Ga0070683_100061593 Ga0070683_1000615932 136
63 3300005329 Ga0070683_100200803 Ga0070683_1002008033 136
64 3300005329 Ga0070683_100386630 Ga0070683_1003866302 136
65 3300005330 Ga0070690_100109606 Ga0070690_1001096062 136
66 3300005334 Ga0068869_100010295 Ga0068869_1000102952 136
67 3300005334 Ga0068869_100088922 Ga0068869_1000889222 136
68 3300005334 Ga0068869_100566738 Ga0068869_1005667382 136
69 3300005334 Ga0068869_100943758 Ga0068869_1009437582 136
70 3300005335 Ga0070666_10012660 Ga0070666_100126606 136
71 3300005335 Ga0070666_10042597 Ga0070666_100425974 136
72 3300005335 Ga0070666_10043191 Ga0070666_100431913 136
73 3300005336 Ga0070680_100057956 Ga0070680_1000579564 136
74 3300005336 Ga0070680_100098968 Ga0070680_1000989681 136
75 3300005336 Ga0070680_100107842 Ga0070680_1001078423 136
76 3300005336 Ga0070680_100316411 Ga0070680_1003164112 136
77 3300005336 Ga0070680_100553854 Ga0070680_1005538542 136
78 3300005336 Ga0070680_101930996 Ga0070680_1019309961 136
79 3300005337 Ga0070682_100038919 Ga0070682_1000389194 136
80 3300005337 Ga0070682_100068528 Ga0070682_1000685283 136
81 3300005337 Ga0070682_100074862 Ga0070682_1000748624 136
82 3300005337 Ga0070682_100091560 Ga0070682_1000915602 136
83 3300005337 Ga0070682_101406599 Ga0070682_1014065991 136
84 3300005338 Ga0068868_100031072 Ga0068868_1000310724 136
85 3300005338 Ga0068868_100034745 Ga0068868_1000347454 136
86 3300005338 Ga0068868_100146134 Ga0068868_1001461341 136
87 3300005338 Ga0068868_100208146 Ga0068868_1002081463 136
88 3300005339 Ga0070660_100003963 Ga0070660_10000396311 136
89 3300005339 Ga0070660_100011766 Ga0070660_1000117666 136
90 3300005339 Ga0070660_100019856 Ga0070660_1000198565 136
91 3300005339 Ga0070660_100042003 Ga0070660_1000420033 136
92 3300005339 Ga0070660_101260305 Ga0070660_1012603051 136
93 3300005340 Ga0070689_100018894 Ga0070689_1000188944 136
94 3300005341 Ga0070691_10114657 Ga0070691_101146572 136
95 3300005343 Ga0070687_100629509 Ga0070687_1006295092 136
96 3300005344 Ga0070661_100016945 Ga0070661_1000169452 136
97 3300005344 Ga0070661_100030495 Ga0070661_1000304955 136
98 3300005345 Ga0070692_10111019 Ga0070692_101110192 136
99 3300005345 Ga0070692_10274097 Ga0070692_102740973 136
100 3300005347 Ga0070668_100035071 Ga0070668_1000350715 136
101 3300005347 Ga0070668_100042879 Ga0070668_1000428794 136
102 3300005354 Ga0070675_100484212 Ga0070675_1004842122 136
103 3300005354 Ga0070675_100628569 Ga0070675_1006285692 136
104 3300005355 Ga0070671_100010322 Ga0070671_1000103223 136
105 3300005355 Ga0070671_101714198 Ga0070671_1017141981 136
106 3300005364 Ga0070673_100069246 Ga0070673_1000692465 136
107 3300005364 Ga0070673_100516358 Ga0070673_1005163582 136
108 3300005365 Ga0070688_100005987 Ga0070688_1000059875 136
109 3300005365 Ga0070688_100067329 Ga0070688_1000673292 136
110 3300005366 Ga0070659_100003656 Ga0070659_1000036565 136
111 3300005366 Ga0070659_100004062 Ga0070659_1000040623 136
112 3300005366 Ga0070659_100091787 Ga0070659_1000917872 136
113 3300005366 Ga0070659_100650862 Ga0070659_1006508622 136
114 3300005367 Ga0070667_100119224 Ga0070667_1001192242 136
115 3300005367 Ga0070667_100225488 Ga0070667_1002254882 136
116 3300005367 Ga0070667_100370220 Ga0070667_1003702202 136
117 3300005434 Ga0070709_10000577 Ga0070709_100005776 136
118 3300005434 Ga0070709_10012342 Ga0070709_100123422 136
119 3300005434 Ga0070709_10066236 Ga0070709_100662364 136
120 3300005434 Ga0070709_10069913 Ga0070709_100699134 136
121 3300005434 Ga0070709_10122549 Ga0070709_101225492 136
122 3300005434 Ga0070709_10264981 Ga0070709_102649812 136
123 3300005434 Ga0070709_10278304 Ga0070709_102783041 136
124 3300005434 Ga0070709_10405357 Ga0070709_104053571 136
125 3300005434 Ga0070709_10406155 Ga0070709_104061551 136
126 3300005434 Ga0070709_10455508 Ga0070709_104555082 136
127 3300005434 Ga0070709_11242588 Ga0070709_112425881 136
128 3300005435 Ga0070714_100000071 Ga0070714_10000007123 136
129 3300005435 Ga0070714_100021042 Ga0070714_1000210424 136
130 3300005435 Ga0070714_100139917 Ga0070714_1001399173 136
131 3300005435 Ga0070714_100150155 Ga0070714_1001501552 136
132 3300005435 Ga0070714_100327416 Ga0070714_1003274162 136
133 3300005435 Ga0070714_100399601 Ga0070714_1003996012 136
134 3300005435 Ga0070714_100768180 Ga0070714_1007681802 136
135 3300005435 Ga0070714_100804929 Ga0070714_1008049292 136
136 3300005435 Ga0070714_100852706 Ga0070714_1008527062 136
137 3300005435 Ga0070714_101216411 Ga0070714_1012164111 136
138 3300005435 Ga0070714_101467448 Ga0070714_1014674482 136
139 3300005435 Ga0070714_101845639 Ga0070714_1018456391 136
140 3300005435 Ga0070714_101971904 Ga0070714_1019719041 136
141 3300005436 Ga0070713_100000176 Ga0070713_10000017649 136
142 3300005436 Ga0070713_100001833 Ga0070713_1000018336 136
143 3300005436 Ga0070713_100008088 Ga0070713_10000808811 136
144 3300005436 Ga0070713_100022893 Ga0070713_1000228932 136
145 3300005436 Ga0070713_100030299 Ga0070713_1000302992 136
146 3300005436 Ga0070713_100068600 Ga0070713_1000686005 136
147 3300005436 Ga0070713_100075733 Ga0070713_1000757333 136
148 3300005436 Ga0070713_100081923 Ga0070713_1000819234 136
149 3300005436 Ga0070713_100082933 Ga0070713_1000829334 136
150 3300005436 Ga0070713_100099365 Ga0070713_1000993652 136
151 3300005436 Ga0070713_100169307 Ga0070713_1001693072 136
152 3300005436 Ga0070713_100216338 Ga0070713_1002163382 136
153 3300005436 Ga0070713_100267590 Ga0070713_1002675902 136
154 3300005436 Ga0070713_100583341 Ga0070713_1005833412 136
155 3300005436 Ga0070713_100733290 Ga0070713_1007332902 136
156 3300005436 Ga0070713_100760159 Ga0070713_1007601592 136
157 3300005436 Ga0070713_101742762 Ga0070713_1017427622 136
158 3300005437 Ga0070710_10001044 Ga0070710_100010445 136
159 3300005437 Ga0070710_10015921 Ga0070710_100159213 136
160 3300005437 Ga0070710_10029547 Ga0070710_100295473 136
161 3300005437 Ga0070710_10036520 Ga0070710_100365203 136
162 3300005437 Ga0070710_10111175 Ga0070710_101111753 136
163 3300005437 Ga0070710_10166449 Ga0070710_101664492 136
164 3300005437 Ga0070710_10382827 Ga0070710_103828272 136
165 3300005437 Ga0070710_10403632 Ga0070710_104036322 136
166 3300005439 Ga0070711_100000966 Ga0070711_10000096610 136
167 3300005439 Ga0070711_100006410 Ga0070711_1000064104 136
168 3300005439 Ga0070711_100019818 Ga0070711_1000198185 136
169 3300005439 Ga0070711_100034830 Ga0070711_1000348301 136
170 3300005439 Ga0070711_100081544 Ga0070711_1000815443 136
171 3300005439 Ga0070711_100289916 Ga0070711_1002899162 136
172 3300005439 Ga0070711_100327592 Ga0070711_1003275922 136
173 3300005439 Ga0070711_100569822 Ga0070711_1005698222 136
174 3300005439 Ga0070711_100649946 Ga0070711_1006499462 136
175 3300005439 Ga0070711_100719581 Ga0070711_1007195811 136
176 3300005439 Ga0070711_100765134 Ga0070711_1007651341 136
177 3300005441 Ga0070700_100424645 Ga0070700_1004246452 136
178 3300005444 Ga0070694_100815446 Ga0070694_1008154462 136
179 3300005445 Ga0070708_100000595 Ga0070708_1000005959 136
180 3300005445 Ga0070708_100011692 Ga0070708_1000116922 136
181 3300005445 Ga0070708_100069650 Ga0070708_1000696504 136
182 3300005445 Ga0070708_100073060 Ga0070708_1000730602 136
183 3300005445 Ga0070708_100137597 Ga0070708_1001375973 136
184 3300005445 Ga0070708_100145777 Ga0070708_1001457773 136
185 3300005445 Ga0070708_100208923 Ga0070708_1002089233 136
186 3300005445 Ga0070708_100337751 Ga0070708_1003377512 136
187 3300005445 Ga0070708_100396239 Ga0070708_1003962392 136
188 3300005445 Ga0070708_100418570 Ga0070708_1004185702 136
189 3300005445 Ga0070708_100734208 Ga0070708_1007342082 136
190 3300005445 Ga0070708_100820744 Ga0070708_1008207442 136
191 3300005445 Ga0070708_100994811 Ga0070708_1009948111 136
192 3300005445 Ga0070708_101508779 Ga0070708_1015087791 136
193 3300005455 Ga0070663_100180871 Ga0070663_1001808712 136
194 3300005455 Ga0070663_100334586 Ga0070663_1003345862 136
195 3300005455 Ga0070663_100522690 Ga0070663_1005226902 136
196 3300005456 Ga0070678_100217439 Ga0070678_1002174392 136
197 3300005457 Ga0070662_100020018 Ga0070662_1000200186 136
198 3300005457 Ga0070662_100049803 Ga0070662_1000498033 136
199 3300005457 Ga0070662_100253587 Ga0070662_1002535871 136
200 3300005458 Ga0070681_10005766 Ga0070681_100057666 136
201 3300005458 Ga0070681_10039804 Ga0070681_100398046 136
202 3300005458 Ga0070681_10186398 Ga0070681_101863983 136
203 3300005458 Ga0070681_10242387 Ga0070681_102423872 136
204 3300005458 Ga0070681_10317488 Ga0070681_103174883 136
205 3300005458 Ga0070681_10335787 Ga0070681_103357873 136
206 3300005458 Ga0070681_10515088 Ga0070681_105150882 136
207 3300005459 Ga0068867_100042005 Ga0068867_1000420052 136
208 3300005459 Ga0068867_100168888 Ga0068867_1001688882 136
209 3300005459 Ga0068867_100935427 Ga0068867_1009354272 136
210 3300005466 Ga0070685_10001863 Ga0070685_100018637 136
211 3300005466 Ga0070685_11079479 Ga0070685_110794791 136
212 3300005467 Ga0070706_100005807 Ga0070706_1000058076 136
213 3300005467 Ga0070706_100006462 Ga0070706_10000646211 136
214 3300005467 Ga0070706_100016205 Ga0070706_1000162055 136
215 3300005467 Ga0070706_100074300 Ga0070706_1000743002 136
216 3300005467 Ga0070706_100077449 Ga0070706_1000774494 136
217 3300005467 Ga0070706_100175311 Ga0070706_1001753112 136
218 3300005467 Ga0070706_100233742 Ga0070706_1002337422 136
219 3300005467 Ga0070706_100679913 Ga0070706_1006799132 136
220 3300005467 Ga0070706_100933752 Ga0070706_1009337522 136
221 3300005467 Ga0070706_101293443 Ga0070706_1012934431 136
222 3300005468 Ga0070707_100010010 Ga0070707_1000100104 136
223 3300005468 Ga0070707_100113614 Ga0070707_1001136144 136
224 3300005468 Ga0070707_100230121 Ga0070707_1002301212 136
225 3300005468 Ga0070707_100308198 Ga0070707_1003081982 136
226 3300005468 Ga0070707_100470196 Ga0070707_1004701962 136
227 3300005468 Ga0070707_100567695 Ga0070707_1005676952 136
228 3300005468 Ga0070707_100584067 Ga0070707_1005840672 136
229 3300005468 Ga0070707_101285626 Ga0070707_1012856262 136
230 3300005468 Ga0070707_101868824 Ga0070707_1018688241 136
231 3300005471 Ga0070698_100001986 Ga0070698_1000019869 136
232 3300005471 Ga0070698_100269984 Ga0070698_1002699841 136
233 3300005471 Ga0070698_100509698 Ga0070698_1005096981 136
234 3300005518 Ga0070699_100000769 Ga0070699_10000076924 136
235 3300005518 Ga0070699_100014509 Ga0070699_1000145097 136
236 3300005518 Ga0070699_100014709 Ga0070699_1000147094 136
237 3300005518 Ga0070699_100049489 Ga0070699_1000494893 136
238 3300005518 Ga0070699_100334669 Ga0070699_1003346691 136
239 3300005518 Ga0070699_100696696 Ga0070699_1006966961 136
240 3300005518 Ga0070699_100860778 Ga0070699_1008607782 136
241 3300005530 Ga0070679_100014705 Ga0070679_1000147058 136
242 3300005530 Ga0070679_100068802 Ga0070679_1000688023 136
243 3300005530 Ga0070679_100076010 Ga0070679_1000760104 136
244 3300005530 Ga0070679_100080979 Ga0070679_1000809792 136
245 3300005530 Ga0070679_100178985 Ga0070679_1001789854 136
246 3300005530 Ga0070679_100215062 Ga0070679_1002150623 136
247 3300005530 Ga0070679_100252381 Ga0070679_1002523813 136
248 3300005530 Ga0070679_100316721 Ga0070679_1003167212 136
249 3300005530 Ga0070679_100361488 Ga0070679_1003614881 136
250 3300005530 Ga0070679_100401953 Ga0070679_1004019533 136
251 3300005530 Ga0070679_100512394 Ga0070679_1005123942 136
252 3300005535 Ga0070684_100084995 Ga0070684_1000849955 136
253 3300005535 Ga0070684_100156199 Ga0070684_1001561992 136
254 3300005535 Ga0070684_100172317 Ga0070684_1001723172 136
255 3300005535 Ga0070684_100245401 Ga0070684_1002454012 136
256 3300005535 Ga0070684_101521376 Ga0070684_1015213762 136
257 3300005536 Ga0070697_100000481 Ga0070697_1000004814 136
258 3300005536 Ga0070697_100000712 Ga0070697_1000007127 136
259 3300005536 Ga0070697_100002501 Ga0070697_1000025012 136
260 3300005536 Ga0070697_100004639 Ga0070697_10000463910 136
261 3300005536 Ga0070697_100005737 Ga0070697_1000057376 136
262 3300005536 Ga0070697_100041960 Ga0070697_1000419605 136
263 3300005536 Ga0070697_100075138 Ga0070697_1000751384 136
264 3300005536 Ga0070697_100256754 Ga0070697_1002567543 136
265 3300005536 Ga0070697_100294565 Ga0070697_1002945652 136
266 3300005536 Ga0070697_100340961 Ga0070697_1003409612 136
267 3300005536 Ga0070697_100787819 Ga0070697_1007878192 136
268 3300005536 Ga0070697_100812642 Ga0070697_1008126422 136
269 3300005536 Ga0070697_100858285 Ga0070697_1008582851 136
270 3300005536 Ga0070697_100923447 Ga0070697_1009234472 136
271 3300005536 Ga0070697_100934482 Ga0070697_1009344822 136
272 3300005536 Ga0070697_101295908 Ga0070697_1012959081 136
273 3300005536 Ga0070697_101973301 Ga0070697_1019733011 136
274 3300005539 Ga0068853_100000036 Ga0068853_10000003668 136
275 3300005539 Ga0068853_100012160 Ga0068853_1000121605 136
276 3300005539 Ga0068853_100030470 Ga0068853_1000304703 136
277 3300005539 Ga0068853_100112150 Ga0068853_1001121504 136
278 3300005539 Ga0068853_101022687 Ga0068853_1010226872 136
279 3300005539 Ga0068853_102124754 Ga0068853_1021247541 136
280 3300005543 Ga0070672_100150419 Ga0070672_1001504192 136
281 3300005543 Ga0070672_100297164 Ga0070672_1002971642 136
282 3300005544 Ga0070686_100007681 Ga0070686_1000076813 136
283 3300005544 Ga0070686_100064100 Ga0070686_1000641002 136
284 3300005544 Ga0070686_100185470 Ga0070686_1001854702 136
285 3300005545 Ga0070695_100123754 Ga0070695_1001237542 136
286 3300005545 Ga0070695_100328201 Ga0070695_1003282012 136
287 3300005545 Ga0070695_100345271 Ga0070695_1003452712 136
288 3300005546 Ga0070696_100174116 Ga0070696_1001741161 136
289 3300005546 Ga0070696_100223225 Ga0070696_1002232252 136
290 3300005546 Ga0070696_100667623 Ga0070696_1006676231 136
291 3300005547 Ga0070693_100071182 Ga0070693_1000711823 136
292 3300005547 Ga0070693_100204476 Ga0070693_1002044761 136
293 3300005547 Ga0070693_100324499 Ga0070693_1003244992 136
294 3300005548 Ga0070665_100002872 Ga0070665_10000287212 136
295 3300005548 Ga0070665_100019435 Ga0070665_1000194356 136
296 3300005548 Ga0070665_100062001 Ga0070665_1000620012 136
297 3300005549 Ga0070704_100136115 Ga0070704_1001361152 136
298 3300005563 Ga0068855_100027264 Ga0068855_1000272646 136
299 3300005563 Ga0068855_100033347 Ga0068855_1000333479 136
300 3300005563 Ga0068855_100052534 Ga0068855_1000525344 136
301 3300005563 Ga0068855_100103998 Ga0068855_1001039982 136
302 3300005563 Ga0068855_100195281 Ga0068855_1001952814 136
303 3300005563 Ga0068855_100287020 Ga0068855_1002870203 136
304 3300005563 Ga0068855_100321471 Ga0068855_1003214712 136
305 3300005563 Ga0068855_100699757 Ga0068855_1006997572 136
306 3300005564 Ga0070664_100099739 Ga0070664_1000997395 136
307 3300005564 Ga0070664_100136975 Ga0070664_1001369752 136
308 3300005564 Ga0070664_100560452 Ga0070664_1005604521 136
309 3300005577 Ga0068857_100049861 Ga0068857_1000498612 136
310 3300005577 Ga0068857_100088069 Ga0068857_1000880692 136
311 3300005577 Ga0068857_100276411 Ga0068857_1002764113 136
312 3300005578 Ga0068854_100000016 Ga0068854_10000001669 136
313 3300005578 Ga0068854_100049478 Ga0068854_1000494783 136
314 3300005578 Ga0068854_100050453 Ga0068854_1000504534 136
315 3300005578 Ga0068854_100090789 Ga0068854_1000907893 136
316 3300005578 Ga0068854_100987272 Ga0068854_1009872722 136
317 3300005614 Ga0068856_100004126 Ga0068856_10000412614 136
318 3300005614 Ga0068856_100021897 Ga0068856_1000218979 136
319 3300005614 Ga0068856_100029101 Ga0068856_1000291014 136
320 3300005614 Ga0068856_100029645 Ga0068856_1000296458 136
321 3300005614 Ga0068856_100058934 Ga0068856_1000589344 136
322 3300005614 Ga0068856_100215148 Ga0068856_1002151483 136
323 3300005614 Ga0068856_100444085 Ga0068856_1004440852 136
324 3300005614 Ga0068856_100561208 Ga0068856_1005612082 136
325 3300005614 Ga0068856_100631626 Ga0068856_1006316262 136
326 3300005614 Ga0068856_101512608 Ga0068856_1015126082 136
327 3300005614 Ga0068856_101568026 Ga0068856_1015680262 136
328 3300005615 Ga0070702_100017900 Ga0070702_1000179003 136
329 3300005616 Ga0068852_100049385 Ga0068852_1000493854 136
330 3300005616 Ga0068852_100371910 Ga0068852_1003719102 136
331 3300005617 Ga0068859_100072280 Ga0068859_1000722804 136
332 3300005617 Ga0068859_100082517 Ga0068859_1000825171 136
333 3300005617 Ga0068859_100233843 Ga0068859_1002338433 136
334 3300005617 Ga0068859_100904383 Ga0068859_1009043831 136
335 3300005617 Ga0068859_102552010 Ga0068859_1025520101 136
336 3300005618 Ga0068864_100024157 Ga0068864_1000241574 136
337 3300005618 Ga0068864_100974645 Ga0068864_1009746452 136
338 3300005718 Ga0068866_10019938 Ga0068866_100199383 136
339 3300005718 Ga0068866_10224565 Ga0068866_102245651 136
340 3300005718 Ga0068866_10266656 Ga0068866_102666562 136
341 3300005718 Ga0068866_10486804 Ga0068866_104868041 136
342 3300005719 Ga0068861_100127387 Ga0068861_1001273873 136
343 3300005719 Ga0068861_100237458 Ga0068861_1002374582 136
344 3300005834 Ga0068851_10005216 Ga0068851_100052165 136
345 3300005834 Ga0068851_10098820 Ga0068851_100988202 136
346 3300005834 Ga0068851_10109140 Ga0068851_101091402 136
347 3300005840 Ga0068870_10003076 Ga0068870_100030765 136
348 3300005840 Ga0068870_10176439 Ga0068870_101764392 136
349 3300005841 Ga0068863_100025635 Ga0068863_1000256357 136
350 3300005841 Ga0068863_100078852 Ga0068863_1000788523 136
351 3300005841 Ga0068863_100124056 Ga0068863_1001240563 136
352 3300005841 Ga0068863_100432277 Ga0068863_1004322772 136
353 3300005842 Ga0068858_100006610 Ga0068858_1000066104 136
354 3300005842 Ga0068858_100015612 Ga0068858_1000156125 136
355 3300005843 Ga0068860_100078483 Ga0068860_1000784832 136
356 3300005843 Ga0068860_100133824 Ga0068860_1001338244 136
357 3300005843 Ga0068860_100238106 Ga0068860_1002381064 136
358 3300005843 Ga0068860_100311200 Ga0068860_1003112002 136
359 3300005843 Ga0068860_100934457 Ga0068860_1009344572 136
360 3300005844 Ga0068862_100041491 Ga0068862_1000414914 136
361 3300005844 Ga0068862_100094144 Ga0068862_1000941443 136
362 3300005844 Ga0068862_100218140 Ga0068862_1002181402 136
363 3300006028 Ga0070717_10001512 Ga0070717_100015125 136
364 3300006028 Ga0070717_10001792 Ga0070717_1000179214 136
365 3300006028 Ga0070717_10024162 Ga0070717_100241626 136
366 3300006028 Ga0070717_10027429 Ga0070717_100274295 136
367 3300006028 Ga0070717_10069253 Ga0070717_100692534 136
368 3300006028 Ga0070717_10084455 Ga0070717_100844553 136
369 3300006028 Ga0070717_10106763 Ga0070717_101067632 136
370 3300006028 Ga0070717_10143584 Ga0070717_101435842 136
371 3300006028 Ga0070717_10147400 Ga0070717_101474003 136
372 3300006028 Ga0070717_10155232 Ga0070717_101552323 136
373 3300006028 Ga0070717_10174302 Ga0070717_101743023 136
374 3300006028 Ga0070717_10225978 Ga0070717_102259783 136
375 3300006028 Ga0070717_10270703 Ga0070717_102707032 136
376 3300006028 Ga0070717_10284046 Ga0070717_102840462 136
377 3300006028 Ga0070717_10885821 Ga0070717_108858211 136
378 3300006028 Ga0070717_11110919 Ga0070717_111109191 136
379 3300006028 Ga0070717_11125772 Ga0070717_111257721 136
380 3300006028 Ga0070717_11158799 Ga0070717_111587992 136
381 3300006028 Ga0070717_11500681 Ga0070717_115006812 136
382 3300006163 Ga0070715_10001488 Ga0070715_100014883 136
383 3300006163 Ga0070715_10002372 Ga0070715_100023723 136
384 3300006163 Ga0070715_10053362 Ga0070715_100533623 136
385 3300006173 Ga0070716_100000165 Ga0070716_1000001657 136
386 3300006173 Ga0070716_100006958 Ga0070716_1000069582 136
387 3300006173 Ga0070716_100012077 Ga0070716_1000120773 136
388 3300006173 Ga0070716_100030314 Ga0070716_1000303143 136
389 3300006173 Ga0070716_100034500 Ga0070716_1000345002 136
390 3300006173 Ga0070716_100065842 Ga0070716_1000658422 136
391 3300006173 Ga0070716_100096122 Ga0070716_1000961223 136
392 3300006173 Ga0070716_100126878 Ga0070716_1001268782 136
393 3300006173 Ga0070716_100161379 Ga0070716_1001613792 136
394 3300006173 Ga0070716_100330826 Ga0070716_1003308261 136
395 3300006173 Ga0070716_100332352 Ga0070716_1003323522 136
396 3300006173 Ga0070716_100573682 Ga0070716_1005736822 136
397 3300006173 Ga0070716_100589073 Ga0070716_1005890732 136
398 3300006173 Ga0070716_100671512 Ga0070716_1006715122 136
399 3300006173 Ga0070716_100830313 Ga0070716_1008303131 136
400 3300006175 Ga0070712_100000512 Ga0070712_10000051214 136
401 3300006175 Ga0070712_100002724 Ga0070712_1000027249 136
402 3300006175 Ga0070712_100003444 Ga0070712_1000034446 136
403 3300006175 Ga0070712_100005055 Ga0070712_1000050556 136
404 3300006175 Ga0070712_100128370 Ga0070712_1001283703 136
405 3300006175 Ga0070712_100138688 Ga0070712_1001386882 136
406 3300006175 Ga0070712_100156315 Ga0070712_1001563152 136
407 3300006175 Ga0070712_100175004 Ga0070712_1001750042 136
408 3300006175 Ga0070712_100423199 Ga0070712_1004231992 136
409 3300006175 Ga0070712_100678739 Ga0070712_1006787392 136
410 3300006175 Ga0070712_101527072 Ga0070712_1015270721 136
411 3300006237 Ga0097621_100005593 Ga0097621_1000055939 136
412 3300006237 Ga0097621_100186732 Ga0097621_1001867322 136
413 3300006237 Ga0097621_100235117 Ga0097621_1002351173 136
414 3300006237 Ga0097621_100669637 Ga0097621_1006696372 136
415 3300006237 Ga0097621_101171811 Ga0097621_1011718112 136
416 3300006237 Ga0097621_102011981 Ga0097621_1020119811 136
417 3300006358 Ga0068871_100001005 Ga0068871_1000010052 136
418 3300006358 Ga0068871_100194171 Ga0068871_1001941713 136
419 3300006358 Ga0068871_100207314 Ga0068871_1002073142 136
420 3300006358 Ga0068871_100313566 Ga0068871_1003135662 136
421 3300006358 Ga0068871_100481107 Ga0068871_1004811072 136
422 3300006358 Ga0068871_100688815 Ga0068871_1006888152 136
423 3300006852 Ga0075433_10077924 Ga0075433_100779242 136
424 3300006852 Ga0075433_10404022 Ga0075433_104040222 136
425 3300006871 Ga0075434_100005454 Ga0075434_10000545410 136
426 3300006871 Ga0075434_100100731 Ga0075434_1001007313 136
427 3300006871 Ga0075434_100126340 Ga0075434_1001263403 136
428 3300006881 Ga0068865_100078921 Ga0068865_1000789212 136
429 3300006881 Ga0068865_100109618 Ga0068865_1001096181 136
430 3300006881 Ga0068865_100161534 Ga0068865_1001615342 136
431 3300006881 Ga0068865_100677285 Ga0068865_1006772852 136
432 3300006914 Ga0075436_100091462 Ga0075436_1000914623 136
433 3300006914 Ga0075436_100860353 Ga0075436_1008603531 136
434 3300006931 Ga0097620_100072279 Ga0097620_1000722794 136
435 3300006931 Ga0097620_100082514 Ga0097620_1000825141 136
436 3300006931 Ga0097620_100233856 Ga0097620_1002338563 136
437 3300006931 Ga0097620_100904536 Ga0097620_1009045361 136
438 3300006931 Ga0097620_102552525 Ga0097620_1025525252 136
439 3300007076 Ga0075435_101031404 Ga0075435_1010314042 136
440 3300007076 Ga0075435_101909289 Ga0075435_1019092891 136
441 3300007788 Ga0099795_10029274 Ga0099795_100292742 136
442 3300007788 Ga0099795_10068657 Ga0099795_100686573 136
443 3300007788 Ga0099795_10133261 Ga0099795_101332612 136
444 3300007788 Ga0099795_10290377 Ga0099795_102903771 136
445 3300009092 Ga0105250_10059622 Ga0105250_100596222 136
446 3300009092 Ga0105250_10090811 Ga0105250_100908112 136
447 3300009093 Ga0105240_10011052 Ga0105240_1001105212 136
448 3300009093 Ga0105240_10017920 Ga0105240_100179209 136
449 3300009093 Ga0105240_10057321 Ga0105240_100573215 136
450 3300009093 Ga0105240_10203049 Ga0105240_102030493 136
451 3300009093 Ga0105240_10203311 Ga0105240_102033112 136
452 3300009093 Ga0105240_10227639 Ga0105240_102276393 136
453 3300009093 Ga0105240_10280119 Ga0105240_102801194 136
454 3300009093 Ga0105240_10387689 Ga0105240_103876893 136
455 3300009093 Ga0105240_10425086 Ga0105240_104250862 136
456 3300009093 Ga0105240_10693976 Ga0105240_106939762 136
457 3300009093 Ga0105240_10741823 Ga0105240_107418232 136
458 3300009093 Ga0105240_10772516 Ga0105240_107725162 136
459 3300009094 Ga0111539_13422582 Ga0111539_134225821 136
460 3300009098 Ga0105245_10004851 Ga0105245_100048515 136
461 3300009098 Ga0105245_10009762 Ga0105245_100097627 136
462 3300009098 Ga0105245_10016455 Ga0105245_100164557 136
463 3300009098 Ga0105245_10020232 Ga0105245_100202324 136
464 3300009098 Ga0105245_10186384 Ga0105245_101863842 136
465 3300009098 Ga0105245_10351218 Ga0105245_103512182 136
466 3300009101 Ga0105247_10005153 Ga0105247_1000515310 136
467 3300009101 Ga0105247_10113834 Ga0105247_101138343 136
468 3300009101 Ga0105247_10117294 Ga0105247_101172941 136
469 3300009101 Ga0105247_10312901 Ga0105247_103129012 136
470 3300009101 Ga0105247_10718445 Ga0105247_107184452 136
471 3300009147 Ga0114129_10134956 Ga0114129_101349564 136
472 3300009148 Ga0105243_10010844 Ga0105243_100108445 136
473 3300009148 Ga0105243_10827306 Ga0105243_108273061 136
474 3300009174 Ga0105241_10014792 Ga0105241_100147926 136
475 3300009174 Ga0105241_10024356 Ga0105241_100243564 136
476 3300009174 Ga0105241_10052926 Ga0105241_100529264 136
477 3300009174 Ga0105241_10103390 Ga0105241_101033902 136
478 3300009174 Ga0105241_10169467 Ga0105241_101694672 136
479 3300009174 Ga0105241_10392461 Ga0105241_103924611 136
480 3300009174 Ga0105241_10921061 Ga0105241_109210612 136
481 3300009174 Ga0105241_10981569 Ga0105241_109815691 136
482 3300009174 Ga0105241_11112823 Ga0105241_111128232 136
483 3300009174 Ga0105241_11313187 Ga0105241_113131872 136
484 3300009176 Ga0105242_10014914 Ga0105242_100149145 136
485 3300009176 Ga0105242_10051360 Ga0105242_100513603 136
486 3300009176 Ga0105242_10085880 Ga0105242_100858802 136
487 3300009176 Ga0105242_10183599 Ga0105242_101835994 136
488 3300009176 Ga0105242_10302212 Ga0105242_103022123 136
489 3300009176 Ga0105242_11020491 Ga0105242_110204912 136
490 3300009177 Ga0105248_10006030 Ga0105248_1000603011 136
491 3300009177 Ga0105248_10022462 Ga0105248_100224625 136
492 3300009177 Ga0105248_10033924 Ga0105248_100339244 136
493 3300009177 Ga0105248_10040691 Ga0105248_100406915 136
494 3300009177 Ga0105248_10046669 Ga0105248_100466695 136
495 3300009177 Ga0105248_10099568 Ga0105248_100995681 136
496 3300009177 Ga0105248_10653666 Ga0105248_106536662 136
497 3300009177 Ga0105248_10960232 Ga0105248_109602322 136
498 3300009545 Ga0105237_10145036 Ga0105237_101450362 136
499 3300009545 Ga0105237_10185600 Ga0105237_101856002 136
500 3300009545 Ga0105237_10216712 Ga0105237_102167122 136
501 3300009545 Ga0105237_10238627 Ga0105237_102386272 136
502 3300009545 Ga0105237_10442818 Ga0105237_104428183 136
503 3300009545 Ga0105237_10486380 Ga0105237_104863802 136
504 3300009545 Ga0105237_10493746 Ga0105237_104937462 136
505 3300009545 Ga0105237_10574824 Ga0105237_105748242 136
506 3300009545 Ga0105237_10640727 Ga0105237_106407272 136
507 3300009545 Ga0105237_10826068 Ga0105237_108260682 136
508 3300009545 Ga0105237_10888205 Ga0105237_108882051 136
509 3300009551 Ga0105238_10069773 Ga0105238_100697734 136
510 3300009551 Ga0105238_10159725 Ga0105238_101597253 136
511 3300009551 Ga0105238_10160120 Ga0105238_101601203 136
512 3300009551 Ga0105238_10250500 Ga0105238_102505002 136
513 3300009551 Ga0105238_11537681 Ga0105238_115376812 136
514 3300009551 Ga0105238_12789853 Ga0105238_127898531 136
515 3300009553 Ga0105249_10006219 Ga0105249_1000621912 136
516 3300009553 Ga0105249_10089016 Ga0105249_100890164 136
517 3300010159 Ga0099796_10083568 Ga0099796_100835682 136
518 3300010375 Ga0105239_10015139 Ga0105239_100151393 136
519 3300010375 Ga0105239_10117996 Ga0105239_101179962 136
520 3300010375 Ga0105239_10121809 Ga0105239_101218094 136
521 3300010375 Ga0105239_10125781 Ga0105239_101257815 136
522 3300010375 Ga0105239_10146891 Ga0105239_101468913 136
523 3300010375 Ga0105239_10209637 Ga0105239_102096373 136
524 3300010375 Ga0105239_10283736 Ga0105239_102837363 136
525 3300010375 Ga0105239_10587043 Ga0105239_105870431 136
526 3300010375 Ga0105239_10715296 Ga0105239_107152963 136
527 3300010375 Ga0105239_10799726 Ga0105239_107997262 136
528 3300010375 Ga0105239_10920790 Ga0105239_109207902 136
529 3300010375 Ga0105239_11006269 Ga0105239_110062692 136
530 3300011119 Ga0105246_10011057 Ga0105246_100110577 136
531 3300011119 Ga0105246_10149635 Ga0105246_101496352 136
532 3300013100 Ga0157373_10018541 Ga0157373_100185415 136
533 3300013100 Ga0157373_10022240 Ga0157373_100222404 136
534 3300013100 Ga0157373_10124675 Ga0157373_101246753 136
535 3300013100 Ga0157373_10202892 Ga0157373_102028922 136
536 3300013100 Ga0157373_10331298 Ga0157373_103312982 136
537 3300013102 Ga0157371_10044943 Ga0157371_100449433 136
538 3300013102 Ga0157371_10153483 Ga0157371_101534833 136
539 3300013104 Ga0157370_10055091 Ga0157370_100550914 136
540 3300013104 Ga0157370_10058746 Ga0157370_100587462 136
541 3300013104 Ga0157370_10175265 Ga0157370_101752652 136
542 3300013104 Ga0157370_10183810 Ga0157370_101838101 136
543 3300013104 Ga0157370_10512389 Ga0157370_105123893 136
544 3300013104 Ga0157370_10541511 Ga0157370_105415112 136
545 3300013105 Ga0157369_10000707 Ga0157369_1000070725 136
546 3300013105 Ga0157369_10017834 Ga0157369_100178343 136
547 3300013105 Ga0157369_10056193 Ga0157369_100561931 136
548 3300013105 Ga0157369_10084664 Ga0157369_100846642 136
549 3300013105 Ga0157369_10103348 Ga0157369_101033485 136
550 3300013105 Ga0157369_10118530 Ga0157369_101185302 136
551 3300013105 Ga0157369_10174208 Ga0157369_101742083 136
552 3300013105 Ga0157369_10188711 Ga0157369_101887113 136
553 3300013105 Ga0157369_10229963 Ga0157369_102299632 136
554 3300013105 Ga0157369_10496976 Ga0157369_104969762 136
555 3300013105 Ga0157369_10511548 Ga0157369_105115481 136
556 3300013296 Ga0157374_10003832 Ga0157374_100038328 136
557 3300013296 Ga0157374_10010610 Ga0157374_100106107 136
558 3300013296 Ga0157374_10019807 Ga0157374_100198071 136
559 3300013296 Ga0157374_10024541 Ga0157374_100245416 136
560 3300013296 Ga0157374_10037327 Ga0157374_100373275 136
561 3300013296 Ga0157374_10049414 Ga0157374_100494147 136
562 3300013296 Ga0157374_10057314 Ga0157374_100573145 136
563 3300013296 Ga0157374_10545002 Ga0157374_105450022 136
564 3300013296 Ga0157374_10578746 Ga0157374_105787461 136
565 3300013296 Ga0157374_10598276 Ga0157374_105982762 136
566 3300013297 Ga0157378_10003236 Ga0157378_100032365 136
567 3300013297 Ga0157378_10040674 Ga0157378_100406742 136
568 3300013297 Ga0157378_10095198 Ga0157378_100951983 136
569 3300013297 Ga0157378_10097524 Ga0157378_100975244 136
570 3300013297 Ga0157378_10146829 Ga0157378_101468294 136
571 3300013297 Ga0157378_11531095 Ga0157378_115310952 136
572 3300013297 Ga0157378_12540754 Ga0157378_125407541 136
573 3300013306 Ga0163162_10002584 Ga0163162_100025848 136
574 3300013306 Ga0163162_10057165 Ga0163162_100571655 136
575 3300013306 Ga0163162_10087454 Ga0163162_100874543 136
576 3300013306 Ga0163162_10146213 Ga0163162_101462133 136
577 3300013306 Ga0163162_10173768 Ga0163162_101737681 136
578 3300013306 Ga0163162_12037148 Ga0163162_120371482 136
579 3300013307 Ga0157372_10024072 Ga0157372_100240724 136
580 3300013307 Ga0157372_10035556 Ga0157372_100355564 136
581 3300013307 Ga0157372_10071311 Ga0157372_100713112 136
582 3300013307 Ga0157372_10094877 Ga0157372_100948773 136
583 3300013307 Ga0157372_10135827 Ga0157372_101358274 136
584 3300013307 Ga0157372_10301875 Ga0157372_103018752 136
585 3300013307 Ga0157372_10426664 Ga0157372_104266642 136
586 3300013307 Ga0157372_12091759 Ga0157372_120917591 136
587 3300013307 Ga0157372_12165411 Ga0157372_121654111 136
588 3300013308 Ga0157375_10057643 Ga0157375_100576437 136
589 3300013308 Ga0157375_10059700 Ga0157375_100597003 136
590 3300013308 Ga0157375_10150332 Ga0157375_101503322 136
591 3300013308 Ga0157375_10890963 Ga0157375_108909631 136
592 3300013308 Ga0157375_11813944 Ga0157375_118139441 136
593 3300014325 Ga0163163_10004284 Ga0163163_100042845 136
594 3300014325 Ga0163163_10025301 Ga0163163_100253014 136
595 3300014325 Ga0163163_10066872 Ga0163163_100668724 136
596 3300014325 Ga0163163_10137382 Ga0163163_101373822 136
597 3300014325 Ga0163163_10158114 Ga0163163_101581143 136
598 3300014325 Ga0163163_10571754 Ga0163163_105717543 136
599 3300014326 Ga0157380_10097667 Ga0157380_100976674 136
600 3300014497 Ga0182008_10014485 Ga0182008_100144854 136
601 3300014497 Ga0182008_10105273 Ga0182008_101052733 136
602 3300014745 Ga0157377_10005240 Ga0157377_100052405 136
603 3300014968 Ga0157379_10004435 Ga0157379_100044354 136
604 3300014968 Ga0157379_10096867 Ga0157379_100968674 136
605 3300014968 Ga0157379_10100573 Ga0157379_101005732 136
606 3300014968 Ga0157379_10111829 Ga0157379_101118293 136
607 3300014968 Ga0157379_10488929 Ga0157379_104889291 136
608 3300014968 Ga0157379_10778526 Ga0157379_107785261 136
609 3300014969 Ga0157376_10014350 Ga0157376_100143505 136
610 3300014969 Ga0157376_10043385 Ga0157376_100433852 136
611 3300014969 Ga0157376_10093650 Ga0157376_100936502 136
612 3300014969 Ga0157376_10116574 Ga0157376_101165742 136
613 3300014969 Ga0157376_10145929 Ga0157376_101459291 136
614 3300014969 Ga0157376_10254571 Ga0157376_102545712 136
615 3300014969 Ga0157376_10277376 Ga0157376_102773762 136
616 3300014969 Ga0157376_10302623 Ga0157376_103026233 136
617 3300014969 Ga0157376_10490811 Ga0157376_104908113 136
618 3300014969 Ga0157376_10646919 Ga0157376_106469192 136
619 3300015261 Ga0182006_1032101 Ga0182006_10321013 136
620 3300015261 Ga0182006_1053815 Ga0182006_10538152 136
621 3300015262 Ga0182007_10001865 Ga0182007_100018657 136
622 3300015262 Ga0182007_10049641 Ga0182007_100496412 136
623 3300015262 Ga0182007_10077491 Ga0182007_100774912 136
624 3300017792 Ga0163161_10009823 Ga0163161_100098238 136
625 3300017792 Ga0163161_11275062 Ga0163161_112750622 136
626 3300020070 Ga0206356_10210281 Ga0206356_102102811 136
627 3300020070 Ga0206356_10311722 Ga0206356_103117221 136
628 3300020070 Ga0206356_10438923 Ga0206356_104389231 136
629 3300020070 Ga0206356_10612756 Ga0206356_106127561 136
630 3300020076 Ga0206355_1464592 Ga0206355_14645921 136
631 3300020078 Ga0206352_10191777 Ga0206352_101917771 136
632 3300020078 Ga0206352_10634928 Ga0206352_106349283 136
633 3300020078 Ga0206352_10695361 Ga0206352_106953613 136
634 3300020080 Ga0206350_10302303 Ga0206350_103023031 136
635 3300020080 Ga0206350_10697226 Ga0206350_106972261 136
636 3300020080 Ga0206350_11198039 Ga0206350_111980391 136
637 3300020081 Ga0206354_10056872 Ga0206354_100568723 136
638 3300020081 Ga0206354_11350274 Ga0206354_113502742 136
639 3300020082 Ga0206353_10355093 Ga0206353_103550932 136
640 3300020610 Ga0154015_1659564 Ga0154015_16595642 136
641 3300021358 Ga0213873_10080339 Ga0213873_100803392 136
642 3300021358 Ga0213873_10148211 Ga0213873_101482111 136
643 3300021377 Ga0213874_10077321 Ga0213874_100773212 136
644 3300022467 Ga0224712_10564322 Ga0224712_105643221 136
645 3300022467 Ga0224712_10606936 Ga0224712_106069361 136
646 3300022730 Ga0224570_100774 Ga0224570_1007743 136
647 3300022732 Ga0224569_100532 Ga0224569_1005326 136
648 3300022732 Ga0224569_101700 Ga0224569_1017002 136
649 3300022734 Ga0224571_103364 Ga0224571_1033642 136
650 3300024225 Ga0224572_1002657 Ga0224572_10026573 136
651 3300024227 Ga0228598_1000510 Ga0228598_10005106 136
652 3300024227 Ga0228598_1004675 Ga0228598_10046754 136
653 3300024227 Ga0228598_1007492 Ga0228598_10074922 136
654 3300024227 Ga0228598_1030081 Ga0228598_10300813 136
655 3300025315 Ga0207697_10087108 Ga0207697_100871082 136
656 3300025321 Ga0207656_10015304 Ga0207656_100153042 136
657 3300025321 Ga0207656_10082347 Ga0207656_100823471 136
658 3300025321 Ga0207656_10096892 Ga0207656_100968922 136
659 3300025893 Ga0207682_10163094 Ga0207682_101630942 136
660 3300025898 Ga0207692_10005710 Ga0207692_100057105 136
661 3300025898 Ga0207692_10042774 Ga0207692_100427742 136
662 3300025898 Ga0207692_10117150 Ga0207692_101171502 136
663 3300025898 Ga0207692_10123064 Ga0207692_101230642 136
664 3300025898 Ga0207692_10196084 Ga0207692_101960842 136
665 3300025898 Ga0207692_10220407 Ga0207692_102204072 136
666 3300025898 Ga0207692_10240395 Ga0207692_102403953 136
667 3300025898 Ga0207692_10349459 Ga0207692_103494591 136
668 3300025898 Ga0207692_10567827 Ga0207692_105678271 136
669 3300025899 Ga0207642_10112666 Ga0207642_101126662 136
670 3300025899 Ga0207642_10212168 Ga0207642_102121682 136
671 3300025899 Ga0207642_10285457 Ga0207642_102854572 136
672 3300025901 Ga0207688_10042678 Ga0207688_100426783 136
673 3300025903 Ga0207680_10011489 Ga0207680_100114896 136
674 3300025903 Ga0207680_10024741 Ga0207680_100247413 136
675 3300025903 Ga0207680_10303359 Ga0207680_103033592 136
676 3300025904 Ga0207647_10001878 Ga0207647_100018787 136
677 3300025904 Ga0207647_10003039 Ga0207647_100030399 136
678 3300025904 Ga0207647_10196899 Ga0207647_101968992 136
679 3300025904 Ga0207647_10268662 Ga0207647_102686622 136
680 3300025905 Ga0207685_10014444 Ga0207685_100144443 136
681 3300025905 Ga0207685_10172731 Ga0207685_101727312 136
682 3300025905 Ga0207685_10195996 Ga0207685_101959962 136
683 3300025905 Ga0207685_10264438 Ga0207685_102644382 136
684 3300025906 Ga0207699_10000600 Ga0207699_100006006 136
685 3300025906 Ga0207699_10011735 Ga0207699_100117354 136
686 3300025906 Ga0207699_10016494 Ga0207699_100164945 136
687 3300025906 Ga0207699_10021063 Ga0207699_100210635 136
688 3300025906 Ga0207699_10039071 Ga0207699_100390712 136
689 3300025906 Ga0207699_10070588 Ga0207699_100705884 136
690 3300025906 Ga0207699_10152092 Ga0207699_101520923 136
691 3300025906 Ga0207699_10163152 Ga0207699_101631522 136
692 3300025906 Ga0207699_10222492 Ga0207699_102224921 136
693 3300025906 Ga0207699_10268950 Ga0207699_102689502 136
694 3300025906 Ga0207699_10298153 Ga0207699_102981531 136
695 3300025906 Ga0207699_10301622 Ga0207699_103016221 136
696 3300025906 Ga0207699_10667079 Ga0207699_106670792 136
697 3300025906 Ga0207699_11222621 Ga0207699_112226212 136
698 3300025907 Ga0207645_10000371 Ga0207645_1000037132 136
699 3300025907 Ga0207645_10004258 Ga0207645_100042588 136
700 3300025908 Ga0207643_10000668 Ga0207643_1000066817 136
701 3300025908 Ga0207643_10252787 Ga0207643_102527872 136
702 3300025909 Ga0207705_10123716 Ga0207705_101237162 136
703 3300025909 Ga0207705_10493707 Ga0207705_104937072 136
704 3300025910 Ga0207684_10001112 Ga0207684_1000111210 136
705 3300025910 Ga0207684_10002188 Ga0207684_1000218816 136
706 3300025910 Ga0207684_10014160 Ga0207684_100141604 136
707 3300025910 Ga0207684_10039463 Ga0207684_100394634 136
708 3300025910 Ga0207684_10079990 Ga0207684_100799903 136
709 3300025910 Ga0207684_10144360 Ga0207684_101443602 136
710 3300025910 Ga0207684_10463773 Ga0207684_104637732 136
711 3300025911 Ga0207654_10015891 Ga0207654_100158914 136
712 3300025911 Ga0207654_10032488 Ga0207654_100324882 136
713 3300025911 Ga0207654_10074199 Ga0207654_100741991 136
714 3300025911 Ga0207654_10250040 Ga0207654_102500402 136
715 3300025911 Ga0207654_10533990 Ga0207654_105339901 136
716 3300025911 Ga0207654_10896892 Ga0207654_108968921 136
717 3300025911 Ga0207654_11181100 Ga0207654_111811002 136
718 3300025912 Ga0207707_10009572 Ga0207707_100095725 136
719 3300025912 Ga0207707_10032167 Ga0207707_100321676 136
720 3300025912 Ga0207707_10034370 Ga0207707_100343703 136
721 3300025912 Ga0207707_10187702 Ga0207707_101877022 136
722 3300025912 Ga0207707_10194395 Ga0207707_101943952 136
723 3300025912 Ga0207707_10283226 Ga0207707_102832263 136
724 3300025912 Ga0207707_10380984 Ga0207707_103809842 136
725 3300025912 Ga0207707_10735244 Ga0207707_107352442 136
726 3300025912 Ga0207707_10823231 Ga0207707_108232312 136
727 3300025913 Ga0207695_10007947 Ga0207695_100079479 136
728 3300025913 Ga0207695_10051286 Ga0207695_100512866 136
729 3300025913 Ga0207695_10062042 Ga0207695_100620424 136
730 3300025913 Ga0207695_10078217 Ga0207695_100782172 136
731 3300025913 Ga0207695_10129257 Ga0207695_101292574 136
732 3300025913 Ga0207695_10172154 Ga0207695_101721543 136
733 3300025913 Ga0207695_10190541 Ga0207695_101905412 136
734 3300025913 Ga0207695_10200176 Ga0207695_102001762 136
735 3300025913 Ga0207695_10508985 Ga0207695_105089852 136
736 3300025914 Ga0207671_10078488 Ga0207671_100784883 136
737 3300025914 Ga0207671_10125848 Ga0207671_101258482 136
738 3300025914 Ga0207671_10279119 Ga0207671_102791192 136
739 3300025914 Ga0207671_10298020 Ga0207671_102980202 136
740 3300025914 Ga0207671_10413562 Ga0207671_104135622 136
741 3300025914 Ga0207671_10421326 Ga0207671_104213262 136
742 3300025914 Ga0207671_10877717 Ga0207671_108777172 136
743 3300025914 Ga0207671_10975400 Ga0207671_109754002 136
744 3300025914 Ga0207671_11184555 Ga0207671_111845552 136
745 3300025915 Ga0207693_10000203 Ga0207693_1000020314 136
746 3300025915 Ga0207693_10000260 Ga0207693_1000026058 136
747 3300025915 Ga0207693_10000719 Ga0207693_1000071926 136
748 3300025915 Ga0207693_10001323 Ga0207693_1000132322 136
749 3300025915 Ga0207693_10002101 Ga0207693_1000210111 136
750 3300025915 Ga0207693_10006854 Ga0207693_100068544 136
751 3300025915 Ga0207693_10018421 Ga0207693_100184211 136
752 3300025915 Ga0207693_10164348 Ga0207693_101643482 136
753 3300025915 Ga0207693_10262763 Ga0207693_102627631 136
754 3300025915 Ga0207693_10287167 Ga0207693_102871672 136
755 3300025915 Ga0207693_10323422 Ga0207693_103234222 136
756 3300025915 Ga0207693_10393245 Ga0207693_103932452 136
757 3300025915 Ga0207693_10495128 Ga0207693_104951282 136
758 3300025915 Ga0207693_10674661 Ga0207693_106746611 136
759 3300025915 Ga0207693_10735207 Ga0207693_107352072 136
760 3300025916 Ga0207663_10000234 Ga0207663_100002345 136
761 3300025916 Ga0207663_10009111 Ga0207663_100091114 136
762 3300025916 Ga0207663_10027040 Ga0207663_100270403 136
763 3300025916 Ga0207663_10046178 Ga0207663_100461783 136
764 3300025916 Ga0207663_10058176 Ga0207663_100581763 136
765 3300025916 Ga0207663_10221098 Ga0207663_102210982 136
766 3300025916 Ga0207663_10314371 Ga0207663_103143711 136
767 3300025916 Ga0207663_10491669 Ga0207663_104916692 136
768 3300025916 Ga0207663_10616492 Ga0207663_106164922 136
769 3300025916 Ga0207663_10629776 Ga0207663_106297762 136
770 3300025916 Ga0207663_10709639 Ga0207663_107096392 136
771 3300025916 Ga0207663_10966252 Ga0207663_109662521 136
772 3300025917 Ga0207660_10005436 Ga0207660_100054368 136
773 3300025917 Ga0207660_10084603 Ga0207660_100846032 136
774 3300025917 Ga0207660_10158636 Ga0207660_101586362 136
775 3300025917 Ga0207660_10217538 Ga0207660_102175382 136
776 3300025917 Ga0207660_10375660 Ga0207660_103756602 136
777 3300025917 Ga0207660_10745639 Ga0207660_107456391 136
778 3300025919 Ga0207657_10001697 Ga0207657_1000169711 136
779 3300025919 Ga0207657_10001941 Ga0207657_100019414 136
780 3300025919 Ga0207657_10002583 Ga0207657_1000258311 136
781 3300025919 Ga0207657_10006727 Ga0207657_100067274 136
782 3300025919 Ga0207657_10152903 Ga0207657_101529033 136
783 3300025919 Ga0207657_10477825 Ga0207657_104778252 136
784 3300025919 Ga0207657_10637885 Ga0207657_106378852 136
785 3300025920 Ga0207649_10001595 Ga0207649_1000159514 136
786 3300025920 Ga0207649_10024357 Ga0207649_100243573 136
787 3300025920 Ga0207649_10026399 Ga0207649_100263993 136
788 3300025921 Ga0207652_10008095 Ga0207652_100080958 136
789 3300025921 Ga0207652_10111678 Ga0207652_101116783 136
790 3300025921 Ga0207652_10158582 Ga0207652_101585821 136
791 3300025921 Ga0207652_10165821 Ga0207652_101658213 136
792 3300025921 Ga0207652_10185006 Ga0207652_101850061 136
793 3300025921 Ga0207652_10208087 Ga0207652_102080871 136
794 3300025921 Ga0207652_10291838 Ga0207652_102918382 136
795 3300025921 Ga0207652_10356950 Ga0207652_103569502 136
796 3300025921 Ga0207652_10868872 Ga0207652_108688722 136
797 3300025922 Ga0207646_10002802 Ga0207646_1000280214 136
798 3300025922 Ga0207646_10003770 Ga0207646_100037709 136
799 3300025922 Ga0207646_10106496 Ga0207646_101064964 136
800 3300025922 Ga0207646_10172894 Ga0207646_101728941 136
801 3300025922 Ga0207646_10219502 Ga0207646_102195022 136
802 3300025922 Ga0207646_10961150 Ga0207646_109611502 136
803 3300025923 Ga0207681_10411228 Ga0207681_104112282 136
804 3300025924 Ga0207694_10047768 Ga0207694_100477685 136
805 3300025924 Ga0207694_10156697 Ga0207694_101566973 136
806 3300025924 Ga0207694_10234067 Ga0207694_102340673 136
807 3300025924 Ga0207694_10361321 Ga0207694_103613212 136
808 3300025924 Ga0207694_10817306 Ga0207694_108173062 136
809 3300025924 Ga0207694_11702598 Ga0207694_117025981 136
810 3300025925 Ga0207650_10000040 Ga0207650_1000004088 136
811 3300025926 Ga0207659_10060149 Ga0207659_100601492 136
812 3300025926 Ga0207659_10525363 Ga0207659_105253631 136
813 3300025927 Ga0207687_10003152 Ga0207687_100031522 136
814 3300025927 Ga0207687_10006117 Ga0207687_100061174 136
815 3300025927 Ga0207687_10009144 Ga0207687_100091442 136
816 3300025927 Ga0207687_10031507 Ga0207687_100315073 136
817 3300025927 Ga0207687_10575921 Ga0207687_105759212 136
818 3300025927 Ga0207687_10580749 Ga0207687_105807491 136
819 3300025927 Ga0207687_11208949 Ga0207687_112089492 136
820 3300025928 Ga0207700_10000163 Ga0207700_1000016327 136
821 3300025928 Ga0207700_10000928 Ga0207700_100009286 136
822 3300025928 Ga0207700_10001536 Ga0207700_100015366 136
823 3300025928 Ga0207700_10017211 Ga0207700_100172112 136
824 3300025928 Ga0207700_10076594 Ga0207700_100765942 136
825 3300025928 Ga0207700_10128542 Ga0207700_101285423 136
826 3300025928 Ga0207700_10130640 Ga0207700_101306403 136
827 3300025928 Ga0207700_10154978 Ga0207700_101549784 136
828 3300025928 Ga0207700_10234189 Ga0207700_102341893 136
829 3300025928 Ga0207700_10338117 Ga0207700_103381172 136
830 3300025928 Ga0207700_10372437 Ga0207700_103724372 136
831 3300025928 Ga0207700_10406223 Ga0207700_104062232 136
832 3300025928 Ga0207700_10415722 Ga0207700_104157222 136
833 3300025928 Ga0207700_10474508 Ga0207700_104745081 136
834 3300025928 Ga0207700_10727142 Ga0207700_107271422 136
835 3300025928 Ga0207700_10775914 Ga0207700_107759142 136
836 3300025928 Ga0207700_11120305 Ga0207700_111203051 136
837 3300025928 Ga0207700_11170893 Ga0207700_111708932 136
838 3300025929 Ga0207664_10000017 Ga0207664_1000001723 136
839 3300025929 Ga0207664_10021558 Ga0207664_100215583 136
840 3300025929 Ga0207664_10023722 Ga0207664_100237223 136
841 3300025929 Ga0207664_10088175 Ga0207664_100881752 136
842 3300025929 Ga0207664_10220311 Ga0207664_102203112 136
843 3300025929 Ga0207664_10702953 Ga0207664_107029532 136
844 3300025929 Ga0207664_10862307 Ga0207664_108623072 136
845 3300025931 Ga0207644_10061223 Ga0207644_100612233 136
846 3300025931 Ga0207644_10187542 Ga0207644_101875421 136
847 3300025932 Ga0207690_10007447 Ga0207690_100074477 136
848 3300025932 Ga0207690_10056237 Ga0207690_100562374 136
849 3300025932 Ga0207690_10152711 Ga0207690_101527112 136
850 3300025932 Ga0207690_10225428 Ga0207690_102254282 136
851 3300025932 Ga0207690_10346903 Ga0207690_103469032 136
852 3300025933 Ga0207706_10000141 Ga0207706_1000014171 136
853 3300025933 Ga0207706_10000897 Ga0207706_100008975 136
854 3300025933 Ga0207706_10089808 Ga0207706_100898083 136
855 3300025933 Ga0207706_10653037 Ga0207706_106530372 136
856 3300025934 Ga0207686_10007765 Ga0207686_100077654 136
857 3300025934 Ga0207686_10090253 Ga0207686_100902533 136
858 3300025934 Ga0207686_10157415 Ga0207686_101574153 136
859 3300025934 Ga0207686_10367499 Ga0207686_103674991 136
860 3300025934 Ga0207686_10672185 Ga0207686_106721852 136
861 3300025935 Ga0207709_10228426 Ga0207709_102284262 136
862 3300025936 Ga0207670_10011213 Ga0207670_100112133 136
863 3300025938 Ga0207704_10028369 Ga0207704_100283694 136
864 3300025938 Ga0207704_10272849 Ga0207704_102728493 136
865 3300025938 Ga0207704_11032289 Ga0207704_110322892 136
866 3300025939 Ga0207665_10000357 Ga0207665_1000035727 136
867 3300025939 Ga0207665_10011158 Ga0207665_100111585 136
868 3300025939 Ga0207665_10011331 Ga0207665_100113313 136
869 3300025939 Ga0207665_10011722 Ga0207665_100117225 136
870 3300025939 Ga0207665_10012249 Ga0207665_100122498 136
871 3300025939 Ga0207665_10026163 Ga0207665_100261633 136
872 3300025939 Ga0207665_10045668 Ga0207665_100456683 136
873 3300025939 Ga0207665_10137426 Ga0207665_101374262 136
874 3300025939 Ga0207665_10193781 Ga0207665_101937813 136
875 3300025939 Ga0207665_10196551 Ga0207665_101965511 136
876 3300025939 Ga0207665_10448598 Ga0207665_104485981 136
877 3300025939 Ga0207665_10449845 Ga0207665_104498452 136
878 3300025939 Ga0207665_10492134 Ga0207665_104921341 136
879 3300025939 Ga0207665_10619085 Ga0207665_106190852 136
880 3300025939 Ga0207665_10926786 Ga0207665_109267861 136
881 3300025940 Ga0207691_10000120 Ga0207691_1000012059 136
882 3300025940 Ga0207691_10181062 Ga0207691_101810623 136
883 3300025941 Ga0207711_10000977 Ga0207711_1000097713 136
884 3300025941 Ga0207711_10032693 Ga0207711_100326935 136
885 3300025941 Ga0207711_10035011 Ga0207711_100350112 136
886 3300025942 Ga0207689_10000695 Ga0207689_100006953 136
887 3300025942 Ga0207689_10005702 Ga0207689_100057025 136
888 3300025942 Ga0207689_10052617 Ga0207689_100526173 136
889 3300025942 Ga0207689_10128892 Ga0207689_101288923 136
890 3300025944 Ga0207661_10000294 Ga0207661_100002943 136
891 3300025944 Ga0207661_10105187 Ga0207661_101051872 136
892 3300025944 Ga0207661_10618286 Ga0207661_106182862 136
893 3300025945 Ga0207679_10001510 Ga0207679_100015105 136
894 3300025945 Ga0207679_10040950 Ga0207679_100409502 136
895 3300025945 Ga0207679_10086298 Ga0207679_100862982 136
896 3300025949 Ga0207667_10011908 Ga0207667_100119082 136
897 3300025949 Ga0207667_10022056 Ga0207667_100220568 136
898 3300025949 Ga0207667_10024637 Ga0207667_100246379 136
899 3300025949 Ga0207667_10042168 Ga0207667_100421683 136
900 3300025949 Ga0207667_10209440 Ga0207667_102094403 136
901 3300025949 Ga0207667_10466625 Ga0207667_104666251 136
902 3300025949 Ga0207667_10515822 Ga0207667_105158222 136
903 3300025949 Ga0207667_11353029 Ga0207667_113530291 136
904 3300025960 Ga0207651_10005407 Ga0207651_100054072 136
905 3300025960 Ga0207651_11234823 Ga0207651_112348232 136
906 3300025960 Ga0207651_11775657 Ga0207651_117756571 136
907 3300025961 Ga0207712_10007469 Ga0207712_100074695 136
908 3300025961 Ga0207712_10473848 Ga0207712_104738481 136
909 3300025972 Ga0207668_10045209 Ga0207668_100452093 136
910 3300025981 Ga0207640_10000001 Ga0207640_10000001339 136
911 3300025981 Ga0207640_10053109 Ga0207640_100531094 136
912 3300025981 Ga0207640_10078577 Ga0207640_100785773 136
913 3300025981 Ga0207640_10715885 Ga0207640_107158852 136
914 3300025986 Ga0207658_10046062 Ga0207658_100460623 136
915 3300025986 Ga0207658_10385906 Ga0207658_103859061 136
916 3300026023 Ga0207677_10145690 Ga0207677_101456902 136
917 3300026023 Ga0207677_10259758 Ga0207677_102597583 136
918 3300026023 Ga0207677_10333278 Ga0207677_103332781 136
919 3300026023 Ga0207677_10736755 Ga0207677_107367552 136
920 3300026035 Ga0207703_10008458 Ga0207703_100084584 136
921 3300026035 Ga0207703_10113799 Ga0207703_101137993 136
922 3300026035 Ga0207703_10114429 Ga0207703_101144293 136
923 3300026035 Ga0207703_10404408 Ga0207703_104044082 136
924 3300026035 Ga0207703_12268601 Ga0207703_122686011 136
925 3300026041 Ga0207639_10000058 Ga0207639_1000005829 136
926 3300026041 Ga0207639_10043552 Ga0207639_100435524 136
927 3300026041 Ga0207639_10133233 Ga0207639_101332333 136
928 3300026041 Ga0207639_10204915 Ga0207639_102049151 136
929 3300026041 Ga0207639_10228810 Ga0207639_102288101 136
930 3300026041 Ga0207639_10741627 Ga0207639_107416271 136
931 3300026067 Ga0207678_10000058 Ga0207678_100000589 136
932 3300026067 Ga0207678_10003304 Ga0207678_100033043 136
933 3300026067 Ga0207678_10071953 Ga0207678_100719535 136
934 3300026067 Ga0207678_10161249 Ga0207678_101612493 136
935 3300026067 Ga0207678_11745337 Ga0207678_117453371 136
936 3300026075 Ga0207708_10392881 Ga0207708_103928812 136
937 3300026078 Ga0207702_10002510 Ga0207702_100025106 136
938 3300026078 Ga0207702_10047336 Ga0207702_100473364 136
939 3300026078 Ga0207702_10233478 Ga0207702_102334782 136
940 3300026078 Ga0207702_10373211 Ga0207702_103732113 136
941 3300026078 Ga0207702_10436316 Ga0207702_104363162 136
942 3300026078 Ga0207702_10442580 Ga0207702_104425802 136
943 3300026078 Ga0207702_11316665 Ga0207702_113166652 136
944 3300026078 Ga0207702_11409470 Ga0207702_114094702 136
945 3300026078 Ga0207702_11434258 Ga0207702_114342581 136
946 3300026078 Ga0207702_12084793 Ga0207702_120847931 136
947 3300026078 Ga0207702_12523184 Ga0207702_125231841 136
948 3300026088 Ga0207641_10000009 Ga0207641_10000009285 136
949 3300026088 Ga0207641_10013093 Ga0207641_100130937 136
950 3300026088 Ga0207641_10245806 Ga0207641_102458062 136
951 3300026088 Ga0207641_10417081 Ga0207641_104170812 136
952 3300026088 Ga0207641_10459540 Ga0207641_104595402 136
953 3300026089 Ga0207648_10016140 Ga0207648_100161404 136
954 3300026089 Ga0207648_10032780 Ga0207648_100327806 136
955 3300026089 Ga0207648_10084326 Ga0207648_100843263 136
956 3300026089 Ga0207648_10963456 Ga0207648_109634562 136
957 3300026095 Ga0207676_10000153 Ga0207676_1000015350 136
958 3300026095 Ga0207676_10008783 Ga0207676_100087834 136
959 3300026095 Ga0207676_10963210 Ga0207676_109632101 136
960 3300026116 Ga0207674_10000010 Ga0207674_10000010110 136
961 3300026116 Ga0207674_10044614 Ga0207674_100446141 136
962 3300026116 Ga0207674_10307282 Ga0207674_103072822 136
963 3300026116 Ga0207674_10319795 Ga0207674_103197953 136
964 3300026116 Ga0207674_10593569 Ga0207674_105935692 136
965 3300026118 Ga0207675_100014445 Ga0207675_1000144455 136
966 3300026118 Ga0207675_100283510 Ga0207675_1002835102 136
967 3300026121 Ga0207683_10002699 Ga0207683_100026998 136
968 3300026121 Ga0207683_10082208 Ga0207683_100822084 136
969 3300026142 Ga0207698_10135314 Ga0207698_101353142 136
970 3300026142 Ga0207698_10266490 Ga0207698_102664903 136
971 3300026142 Ga0207698_10509647 Ga0207698_105096472 136
972 3300026142 Ga0207698_11972466 Ga0207698_119724662 136
973 3300026142 Ga0207698_12028741 Ga0207698_120287412 136
974 3300027695 Ga0209966_1010828 Ga0209966_10108283 136
975 3300028016 Ga0265354_1014282 Ga0265354_10142821 136
976 3300028017 Ga0265356_1000376 Ga0265356_10003766 136
977 3300028379 Ga0268266_10006583 Ga0268266_100065838 136
978 3300028379 Ga0268266_10012346 Ga0268266_100123467 136
979 3300028379 Ga0268266_10022853 Ga0268266_100228534 136
980 3300028379 Ga0268266_10045437 Ga0268266_100454372 136
981 3300028379 Ga0268266_10064482 Ga0268266_100644823 136
982 3300028380 Ga0268265_10012306 Ga0268265_100123068 136
983 3300028380 Ga0268265_10025236 Ga0268265_100252365 136
984 3300028381 Ga0268264_10240699 Ga0268264_102406991 136
985 3300028381 Ga0268264_10274447 Ga0268264_102744471 136
986 3300028381 Ga0268264_10454759 Ga0268264_104547592 136
987 3300028381 Ga0268264_11011710 Ga0268264_110117102 136
988 3300028800 Ga0265338_10001433 Ga0265338_1000143336 136
989 3300028800 Ga0265338_10030364 Ga0265338_100303646 136
990 3300028800 Ga0265338_10137732 Ga0265338_101377322 136
991 3300028800 Ga0265338_10143301 Ga0265338_101433013 136
992 3300028800 Ga0265338_10259064 Ga0265338_102590642 136
993 3300028800 Ga0265338_10575674 Ga0265338_105756742 136
994 3300030760 Ga0265762_1000311 Ga0265762_10003112 136
995 3300030760 Ga0265762_1000664 Ga0265762_10006644 136
996 3300030760 Ga0265762_1001754 Ga0265762_10017544 136
997 3300030760 Ga0265762_1009779 Ga0265762_10097793 136
998 3300030760 Ga0265762_1035242 Ga0265762_10352422 136
999 3300030878 Ga0265770_1006714 Ga0265770_10067141 136
1000 3300030878 Ga0265770_1030091 Ga0265770_10300912 136
1001 3300030879 Ga0265765_1018861 Ga0265765_10188611 136
1002 3300031090 Ga0265760_10000112 Ga0265760_100001124 136
1003 3300031090 Ga0265760_10000553 Ga0265760_100005537 136
1004 3300031090 Ga0265760_10005449 Ga0265760_100054494 136
1005 3300031090 Ga0265760_10018718 Ga0265760_100187182 136
1006 3300031090 Ga0265760_10022273 Ga0265760_100222732 136
1007 3300031090 Ga0265760_10053749 Ga0265760_100537492 136
1008 3300031235 Ga0265330_10034152 Ga0265330_100341523 136
1009 3300031235 Ga0265330_10200816 Ga0265330_102008162 136
1010 3300031235 Ga0265330_10318825 Ga0265330_103188252 136
1011 3300031238 Ga0265332_10051239 Ga0265332_100512392 136
1012 3300031238 Ga0265332_10404748 Ga0265332_104047481 136
1013 3300031241 Ga0265325_10006501 Ga0265325_100065017 136
1014 3300031241 Ga0265325_10020381 Ga0265325_100203813 136
1015 3300031241 Ga0265325_10021392 Ga0265325_100213924 136
1016 3300031247 Ga0265340_10016242 Ga0265340_100162422 136
1017 3300031247 Ga0265340_10021295 Ga0265340_100212954 136
1018 3300031247 Ga0265340_10041436 Ga0265340_100414363 136
1019 3300031247 Ga0265340_10058212 Ga0265340_100582124 136
1020 3300031249 Ga0265339_10043867 Ga0265339_100438672 136
1021 3300031249 Ga0265339_10070799 Ga0265339_100707992 136
1022 3300031249 Ga0265339_10080145 Ga0265339_100801452 136
1023 3300031250 Ga0265331_10237334 Ga0265331_102373342 136
1024 3300031251 Ga0265327_10098207 Ga0265327_100982072 136
1025 3300031344 Ga0265316_10000706 Ga0265316_100007066 136
1026 3300031344 Ga0265316_10105530 Ga0265316_101055303 136
1027 3300031344 Ga0265316_10732373 Ga0265316_107323732 136
1028 3300031344 Ga0265316_11119459 Ga0265316_111194591 136
1029 3300031548 Ga0307408_100090522 Ga0307408_1000905222 136
1030 3300031595 Ga0265313_10019555 Ga0265313_100195554 136
1031 3300031711 Ga0265314_10001717 Ga0265314_1000171710 136
1032 3300031711 Ga0265314_10021063 Ga0265314_100210632 136
1033 3300031711 Ga0265314_10164347 Ga0265314_101643472 136
1034 3300031711 Ga0265314_10173096 Ga0265314_101730962 136
1035 3300031712 Ga0265342_10324743 Ga0265342_103247432 136
1036 3300031995 Ga0307409_101604950 Ga0307409_1016049501 136
1037 3300033180 Ga0307510_10020741 Ga0307510_100207412 136
1038 3300033180 Ga0307510_10105447 Ga0307510_101054473 136
1039 3300033547 Ga0316212_1002277 Ga0316212_10022774 136
1040 3300034820 Ga0373959_0137685 Ga0373959_0137685_10_420 136
1041 3300034957 Ga0373938_0221381 Ga0373938_0221381_51_461 136
1042 3300035083 Ga0373926_0072512 Ga0373926_0072512_570_980 136
1043 3300035085 Ga0373929_0079412 Ga0373929_0079412_287_697 136
1044 3300035086 Ga0373934_0065120 Ga0373934_0065120_884_1294 136
1045 3300035089 Ga0373944_0041686 Ga0373944_0041686_71_481 136
1046 3300035111 Ga0373923_0065269 Ga0373923_0065269_466_876 136
1047 3300035111 Ga0373923_0596110 Ga0373923_0596110_45_455 136
1048 3300035113 Ga0373936_0000589 Ga0373936_0000589_12045_12455 136
1049 3300035113 Ga0373936_0047620 Ga0373936_0047620_1070_1573 136
1050 3300035113 Ga0373936_0052483 Ga0373936_0052483_775_1188 136
1051 3300035115 Ga0373941_0031269 Ga0373941_0031269_824_1234 136
1052 3300035116 Ga0373945_0000849 Ga0373945_0000849_857_1267 136
1053 3300035116 Ga0373945_0068189 Ga0373945_0068189_136_549 136
1054 3300035116 Ga0373945_0165952 Ga0373945_0165952_158_568 136
1055 3300035116 Ga0373945_0307140 Ga0373945_0307140_158_661 136
1056 3300035117 Ga0373953_0013504 Ga0373953_0013504_165_575 136
1057 3300035119 Ga0373956_0051924 Ga0373956_0051924_525_935 136
1058 3300035119 Ga0373956_0106449 Ga0373956_0106449_332_742 136
1059 3300035119 Ga0373956_0312409 Ga0373956_0312409_321_731 136
1060 3300035120 Ga0373957_0035087 Ga0373957_0035087_669_1079 136
1061 3300035120 Ga0373957_0099863 Ga0373957_0099863_195_605 136
1062 3300035170 Ga0373943_0000002 Ga0373943_0000002_33687_34097 136
1063 3300035170 Ga0373943_0008395 Ga0373943_0008395_1023_1433 136
1064 3300035171 Ga0373946_0067918 Ga0373946_0067918_156_569 136
1065 3300035172 Ga0373955_0031012 Ga0373955_0031012_1266_1676 136
1066 3300035172 Ga0373955_0506853 Ga0373955_0506853_176_589 136
1067 3300035172 Ga0373955_0765020 Ga0373955_0765020_43_453 136
1068 3300035207 Ga0373942_0380450 Ga0373942_0380450_46_456 136
1069 3300035242 Ga0373962_0052640 Ga0373962_0052640_329_739 136
1070 3300035410 Ga0373924_0000068 Ga0373924_0000068_21516_21926 136
1071 3300035410 Ga0373924_0013747 Ga0373924_0013747_317_727 136
1072 3300035410 Ga0373924_0049930 Ga0373924_0049930_1255_1665 136
1073 3300035410 Ga0373924_0093919 Ga0373924_0093919_769_1179 136
1074 3300035410 Ga0373924_0110977 Ga0373924_0110977_656_1066 136
1075 3300035691 Ga0373931_0015086 Ga0373931_0015086_744_1154 136
1076 3300035691 Ga0373931_0065961 Ga0373931_0065961_222_632 136
1077 3300035691 Ga0373931_0219192 Ga0373931_0219192_688_1104 136
1078 3300035691 Ga0373931_0413978 Ga0373931_0413978_355_765 136
1079 3300035691 Ga0373931_0513186 Ga0373931_0513186_35_448 136
1080 3300035692 Ga0373935_0001922 Ga0373935_0001922_5701_6111 136
1081 3300035692 Ga0373935_0044182 Ga0373935_0044182_459_872 136
1082 3300035692 Ga0373935_0062312 Ga0373935_0062312_118_528 136
1083 3300035692 Ga0373935_0088998 Ga0373935_0088998_762_1175 136
1084 3300035692 Ga0373935_0154531 Ga0373935_0154531_992_1402 136
1085 3300035692 Ga0373935_0441896 Ga0373935_0441896_278_781 136
1086 3300035695 Ga0373927_0000021 Ga0373927_0000021_34856_35266 136
1087 3300035695 Ga0373927_0004851 Ga0373927_0004851_4311_4721 136
1088 3300035695 Ga0373927_0132432 Ga0373927_0132432_1013_1423 136
1089 3300035724 Ga0373933_0044565 Ga0373933_0044565_588_998 136
1090 3300035724 Ga0373933_0114449 Ga0373933_0114449_359_769 136
1091 3300035724 Ga0373933_0269322 Ga0373933_0269322_190_600 136
1092 3300035724 Ga0373933_0288608 Ga0373933_0288608_581_991 136
1093 3300035724 Ga0373933_0736590 Ga0373933_0736590_160_570 136
1094 3300035725 Ga0373947_0002466 Ga0373947_0002466_6846_7256 136
1095 3300035725 Ga0373947_0037855 Ga0373947_0037855_188_598 136
1096 3300035725 Ga0373947_0114539 Ga0373947_0114539_651_1061 136
1097 3300035725 Ga0373947_0119751 Ga0373947_0119751_1165_1575 136
1098 3300035725 Ga0373947_0176034 Ga0373947_0176034_335_745 136
1099 3300035725 Ga0373947_0471783 Ga0373947_0471783_351_764 136
1100 3300035725 Ga0373947_0848632 Ga0373947_0848632_56_469 136
1101 3300036401 Ga0373937_0042488 Ga0373937_0042488_3337_3747 136
1102 3300036401 Ga0373937_0086605 Ga0373937_0086605_444_857 136
1103 3300036401 Ga0373937_0105084 Ga0373937_0105084_831_1241 136
1104 3300036401 Ga0373937_0244543 Ga0373937_0244543_156_566 136
1105 3300036401 Ga0373937_0965987 Ga0373937_0965987_68_478 136
1106 3300036401 Ga0373937_1327605 Ga0373937_1327605_129_539 136
1107 3300037068 Ga0373925_0004097 Ga0373925_0004097_2981_3391 136
1108 3300037068 Ga0373925_0004660 Ga0373925_0004660_2094_2504 136
1109 3300037068 Ga0373925_0025607 Ga0373925_0025607_3787_4200 136
1110 3300037068 Ga0373925_0039398 Ga0373925_0039398_150_560 136
1111 3300037068 Ga0373925_0043648 Ga0373925_0043648_374_784 136
1112 3300037068 Ga0373925_0627372 Ga0373925_0627372_163_576 136
1113 3300037068 Ga0373925_1104428 Ga0373925_1104428_92_502 136
1114 3300037068 Ga0373925_1478035 Ga0373925_1478035_134_544 136
1115 3300037068 Ga0373925_1625014 Ga0373925_1625014_47_460 136
1116 3300037466 Ga0395898_0234003 Ga0395898_0234003_1070_1480 136
1117 3300037471 Ga0395905_0979428 Ga0395905_0979428_211_621 136
1118 3300037853 Ga0436364_0856169 Ga0436364_0856169_1315_1731 136
1119 3300038443 Ga0395901_0214172 Ga0395901_0214172_1482_1892 136
1120 3300038996 Ga0242420_029312 Ga0242420_029312_530_940 136
1121 3300039437 Ga0436365_1421008 Ga0436365_1421008_778_1188 136
1122 3300039438 Ga0436360_0525893 Ga0436360_0525893_632_1042 136
1123 3300039438 Ga0436360_0727080 Ga0436360_0727080_92_502 136
1124 3300039447 Ga0436361_0936610 Ga0436361_0936610_106_516 136
1125 3300039450 Ga0436363_0654277 Ga0436363_0654277_2604_3020 136
1126 3300039450 Ga0436363_0682772 Ga0436363_0682772_2270_2680 136
1127 3300039450 Ga0436363_0957099 Ga0436363_0957099_239_649 136
1128 3300039450 Ga0436363_1305165 Ga0436363_1305165_710_1135 136
1129 3300039453 Ga0436362_0212779 Ga0436362_0212779_530_943 136
1130 3300039453 Ga0436362_0857316 Ga0436362_0857316_2807_3217 136
1131 3300039453 Ga0436362_1069201 Ga0436362_1069201_252_662 136
1132 3300039453 Ga0436362_1157553 Ga0436362_1157553_47_457 136
1133 3300042876 Ga0451577_0642420 Ga0451577_0642420_85_495 136
1134 3300044673 Ga0453683_0137055 Ga0453683_0137055_706_1116 136
1135 3300044694 Ga0466963_0002948 Ga0466963_0002948_6628_7038 136
1136 3300044712 Ga0453684_1999474 Ga0453684_1999474_99_509 136
1137 3300044842 Ga0466957_0150619 Ga0466957_0150619_540_950 136
1138 3300045049 Ga0466959_0276036 Ga0466959_0276036_264_674 136
1139 3300045051 Ga0451576_0027604 Ga0451576_0027604_3606_4016 136
1140 3300045836 Ga0466958_0223860 Ga0466958_0223860_724_1134 136
1141 3300045836 Ga0466958_1068782 Ga0466958_1068782_76_486 136
1142 3300045976 Ga0466967_0006861 Ga0466967_0006861_657_1067 136
1143 3300045976 Ga0466967_0203797 Ga0466967_0203797_421_834 136
1144 3300045976 Ga0466967_0250375 Ga0466967_0250375_759_1169 136
1145 3300045976 Ga0466967_0271668 Ga0466967_0271668_749_1159 136
1146 3300046454 Ga0495592_0100581 Ga0495592_0100581_1604_2017 136
1147 3300046455 Ga0495603_0003176 Ga0495603_0003176_2142_2555 136
1148 3300046455 Ga0495603_0036976 Ga0495603_0036976_993_1406 136
1149 3300046457 Ga0495590_0391819 Ga0495590_0391819_96_506 136
1150 3300046459 Ga0495629_0006749 Ga0495629_0006749_7693_8106 136
1151 3300046459 Ga0495629_0008385 Ga0495629_0008385_3567_3980 136
1152 3300046459 Ga0495629_0011889 Ga0495629_0011889_5785_6195 136
1153 3300046462 Ga0495651_0068984 Ga0495651_0068984_1453_1866 136
1154 3300046462 Ga0495651_0100433 Ga0495651_0100433_415_828 136
1155 3300046462 Ga0495651_0232111 Ga0495651_0232111_327_737 136
1156 3300046463 Ga0495653_0010025 Ga0495653_0010025_4948_5361 136
1157 3300046463 Ga0495653_0446137 Ga0495653_0446137_255_665 136
1158 3300046471 Ga0495650_0000009 Ga0495650_0000009_386666_387079 136
1159 3300046471 Ga0495650_0003359 Ga0495650_0003359_1945_2358 136
1160 3300046472 Ga0495580_0000563 Ga0495580_0000563_5578_5991 136
1161 3300046472 Ga0495580_0001106 Ga0495580_0001106_9836_10246 136
1162 3300046472 Ga0495580_0001748 Ga0495580_0001748_1964_2377 136
1163 3300046472 Ga0495580_0013714 Ga0495580_0013714_2760_3176 136
1164 3300046472 Ga0495580_0018608 Ga0495580_0018608_1151_1561 136
1165 3300046472 Ga0495580_0047537 Ga0495580_0047537_2484_2897 136
1166 3300046472 Ga0495580_0053405 Ga0495580_0053405_1568_1978 136
1167 3300046472 Ga0495580_0081309 Ga0495580_0081309_1498_1908 136
1168 3300046472 Ga0495580_0112833 Ga0495580_0112833_52_462 136
1169 3300046472 Ga0495580_0142393 Ga0495580_0142393_770_1180 136
1170 3300046472 Ga0495580_0147585 Ga0495580_0147585_312_722 136
1171 3300046472 Ga0495580_0170471 Ga0495580_0170471_164_577 136
1172 3300046472 Ga0495580_0185593 Ga0495580_0185593_655_1065 136
1173 3300046472 Ga0495580_0254121 Ga0495580_0254121_360_770 136
1174 3300046472 Ga0495580_0371882 Ga0495580_0371882_367_780 136
1175 3300046472 Ga0495580_0483342 Ga0495580_0483342_340_750 136
1176 3300046473 Ga0495582_0001590 Ga0495582_0001590_7747_8160 136
1177 3300046473 Ga0495582_0014685 Ga0495582_0014685_3838_4248 136
1178 3300046473 Ga0495582_0057323 Ga0495582_0057323_93_503 136
1179 3300046473 Ga0495582_0080426 Ga0495582_0080426_391_801 136
1180 3300046473 Ga0495582_0475200 Ga0495582_0475200_54_467 136
1181 3300046475 Ga0495639_0016680 Ga0495639_0016680_2624_3037 136
1182 3300046475 Ga0495639_0055433 Ga0495639_0055433_496_906 136
1183 3300046476 Ga0495662_0002003 Ga0495662_0002003_3108_3521 136
1184 3300046477 Ga0495664_0003430 Ga0495664_0003430_2959_3372 136
1185 3300046477 Ga0495664_0012639 Ga0495664_0012639_3944_4354 136
1186 3300046477 Ga0495664_0088960 Ga0495664_0088960_1315_1728 136
1187 3300046499 Ga0495594_0000239 Ga0495594_0000239_7263_7676 136
1188 3300046499 Ga0495594_0001215 Ga0495594_0001215_8510_8923 136
1189 3300046499 Ga0495594_0001953 Ga0495594_0001953_8429_8842 136
1190 3300046499 Ga0495594_0054356 Ga0495594_0054356_61_471 136
1191 3300046499 Ga0495594_0058561 Ga0495594_0058561_1238_1651 136
1192 3300046506 Ga0495583_0017801 Ga0495583_0017801_1998_2411 136
1193 3300046506 Ga0495583_0068635 Ga0495583_0068635_250_663 136
1194 3300046507 Ga0495606_0092760 Ga0495606_0092760_540_953 136
1195 3300046507 Ga0495606_0156825 Ga0495606_0156825_676_1089 136
1196 3300046507 Ga0495606_0191197 Ga0495606_0191197_638_1051 136
1197 3300046511 Ga0495608_0272050 Ga0495608_0272050_239_652 136
1198 3300046513 Ga0495616_0274619 Ga0495616_0274619_46_459 136
1199 3300046514 Ga0495618_0117408 Ga0495618_0117408_1071_1484 136
1200 3300046516 Ga0495628_0001498 Ga0495628_0001498_6482_6895 136
1201 3300046516 Ga0495628_0105147 Ga0495628_0105147_948_1358 136
1202 3300046516 Ga0495628_0439843 Ga0495628_0439843_413_823 136
1203 3300046517 Ga0495630_0034429 Ga0495630_0034429_2254_2664 136
1204 3300046517 Ga0495630_0250199 Ga0495630_0250199_74_484 136
1205 3300046517 Ga0495630_0267091 Ga0495630_0267091_868_1281 136
1206 3300046519 Ga0495632_0315876 Ga0495632_0315876_96_509 136
1207 3300046523 Ga0495644_0000290 Ga0495644_0000290_2186_2599 136
1208 3300046524 Ga0495648_0254472 Ga0495648_0254472_208_621 136
1209 3300046526 Ga0495666_0000987 Ga0495666_0000987_8086_8499 136
1210 3300046528 Ga0495642_0054436 Ga0495642_0054436_1214_1627 136
1211 3300046528 Ga0495642_0259879 Ga0495642_0259879_336_749 136
1212 3300046529 Ga0495652_0003983 Ga0495652_0003983_6660_7073 136
1213 3300046529 Ga0495652_0093786 Ga0495652_0093786_1766_2176 136
1214 3300046529 Ga0495652_0154130 Ga0495652_0154130_609_1022 136
1215 3300046529 Ga0495652_0895144 Ga0495652_0895144_139_549 136
1216 3300046531 Ga0495665_0001222 Ga0495665_0001222_7069_7482 136
1217 3300046531 Ga0495665_0079395 Ga0495665_0079395_1180_1590 136
1218 3300046531 Ga0495665_0181929 Ga0495665_0181929_206_616 136
1219 3300046531 Ga0495665_0222318 Ga0495665_0222318_197_610 136
1220 3300046533 Ga0495640_0004227 Ga0495640_0004227_2162_2575 136
1221 3300046535 Ga0495586_0001012 Ga0495586_0001012_12897_13310 136
1222 3300046535 Ga0495586_0050652 Ga0495586_0050652_38_541 136
1223 3300046536 Ga0495587_0138502 Ga0495587_0138502_277_690 136
1224 3300046538 Ga0495609_0023923 Ga0495609_0023923_1450_1863 136
1225 3300046543 Ga0495645_0004045 Ga0495645_0004045_5578_5991 136
1226 3300046543 Ga0495645_0180992 Ga0495645_0180992_116_529 136
1227 3300046543 Ga0495645_0675006 Ga0495645_0675006_65_475 136
1228 3300046543 Ga0495645_0790021 Ga0495645_0790021_89_502 136
1229 3300046557 Ga0495622_0103638 Ga0495622_0103638_875_1288 136
1230 3300046558 Ga0495633_0024953 Ga0495633_0024953_1364_1777 136
1231 3300046559 Ga0495667_0005674 Ga0495667_0005674_2783_3196 136
1232 3300046559 Ga0495667_0407871 Ga0495667_0407871_121_534 136
1233 3300046559 Ga0495667_0528035 Ga0495667_0528035_46_456 136
1234 3300046616 Ga0495668_0143043 Ga0495668_0143043_544_957 136
1235 3300046616 Ga0495668_0328252 Ga0495668_0328252_321_734 136
1236 3300046616 Ga0495668_0444382 Ga0495668_0444382_255_668 136
1237 3300046642 Ga0495634_0001395 Ga0495634_0001395_3144_3557 136
1238 3300046642 Ga0495634_0267213 Ga0495634_0267213_437_847 136
1239 3300046648 Ga0495611_0031459 Ga0495611_0031459_568_981 136
1240 3300046660 Ga0495625_0000174 Ga0495625_0000174_57879_58307 136
1241 3300046660 Ga0495625_0051081 Ga0495625_0051081_1319_1732 136
1242 3300046660 Ga0495625_0082604 Ga0495625_0082604_1246_1659 136
1243 3300046660 Ga0495625_0107056 Ga0495625_0107056_332_745 136
1244 3300046660 Ga0495625_0373775 Ga0495625_0373775_181_594 136
1245 3300046663 Ga0495635_0003625 Ga0495635_0003625_4307_4720 136
1246 3300046663 Ga0495635_0171085 Ga0495635_0171085_65_475 136
1247 3300046663 Ga0495635_0466388 Ga0495635_0466388_405_818 136
1248 3300046675 Ga0495657_0072194 Ga0495657_0072194_1293_1703 136
1249 3300046675 Ga0495657_0164998 Ga0495657_0164998_890_1303 136
1250 3300046678 Ga0495599_0010918 Ga0495599_0010918_2618_3031 136
1251 3300046678 Ga0495599_0485170 Ga0495599_0485170_207_617 136
1252 3300046679 Ga0495623_0044332 Ga0495623_0044332_1138_1548 136
1253 3300046679 Ga0495623_0538859 Ga0495623_0538859_19_429 136
1254 3300046679 Ga0495623_0551408 Ga0495623_0551408_175_588 136
1255 3300046680 Ga0495646_0001575 Ga0495646_0001575_8909_9322 136
1256 3300046680 Ga0495646_0170319 Ga0495646_0170319_162_575 136
1257 3300046680 Ga0495646_0443667 Ga0495646_0443667_245_658 136
1258 3300046684 Ga0495669_0008466 Ga0495669_0008466_433_846 136
1259 3300046684 Ga0495669_0089066 Ga0495669_0089066_725_1135 136
1260 3300046689 Ga0495613_0001438 Ga0495613_0001438_9092_9505 136
1261 3300046689 Ga0495613_1126122 Ga0495613_1126122_10_420 136
1262 3300046690 Ga0495624_0014189 Ga0495624_0014189_2652_3065 136
1263 3300046690 Ga0495624_0147020 Ga0495624_0147020_357_767 136
1264 3300046690 Ga0495624_0308226 Ga0495624_0308226_206_616 136
1265 3300046690 Ga0495624_0412238 Ga0495624_0412238_200_610 136
1266 3300046690 Ga0495624_0537790 Ga0495624_0537790_253_663 136
1267 3300046809 Ga0495600_0004609 Ga0495600_0004609_3887_4300 136
1268 3300046809 Ga0495600_0125257 Ga0495600_0125257_702_1115 136
1269 3300047315 Ga0495581_0000697 Ga0495581_0000697_5312_5725 136
1270 3300047315 Ga0495581_0025866 Ga0495581_0025866_1047_1460 136
1271 3300047315 Ga0495581_0531185 Ga0495581_0531185_46_549 136
1272 3300047317 Ga0495604_0037535 Ga0495604_0037535_47_457 136
1273 3300047318 Ga0495636_0102648 Ga0495636_0102648_17_430 136
1274 3300047319 Ga0495674_0011347 Ga0495674_0011347_3983_4396 136
1275 3300047319 Ga0495674_0073736 Ga0495674_0073736_2331_2744 136
1276 3300047319 Ga0495674_0203153 Ga0495674_0203153_150_563 136
1277 3300047319 Ga0495674_0668975 Ga0495674_0668975_391_801 136
1278 3300047320 Ga0495672_0004082 Ga0495672_0004082_2369_2797 136
1279 3300047320 Ga0495672_0145954 Ga0495672_0145954_774_1187 136
1280 3300047320 Ga0495672_0290943 Ga0495672_0290943_70_483 136
1281 3300047321 Ga0495676_0000317 Ga0495676_0000317_22114_22527 136
1282 3300047321 Ga0495676_0747485 Ga0495676_0747485_69_479 136
1283 3300047322 Ga0495680_0008074 Ga0495680_0008074_7719_8132 136
1284 3300047322 Ga0495680_0756055 Ga0495680_0756055_202_612 136
1285 3300047323 Ga0495683_0236034 Ga0495683_0236034_45_458 136
1286 3300047444 Ga0495675_0002311 Ga0495675_0002311_4150_4563 136
1287 3300047444 Ga0495675_0112728 Ga0495675_0112728_821_1231 136
1288 3300047445 Ga0495677_0042322 Ga0495677_0042322_33_446 136
1289 3300047469 Ga0495673_0054735 Ga0495673_0054735_144_557 136
1290 3300047469 Ga0495673_0097231 Ga0495673_0097231_704_1117 136
1291 3300047471 Ga0495684_0454239 Ga0495684_0454239_224_637 136
1292 3300047471 Ga0495684_0508018 Ga0495684_0508018_221_631 136
1293 3300047472 Ga0495686_0000087 Ga0495686_0000087_108530_108952 136
1294 3300047472 Ga0495686_0002533 Ga0495686_0002533_12638_13051 136
1295 3300047472 Ga0495686_0035701 Ga0495686_0035701_1510_1929 136
1296 3300047472 Ga0495686_0081466 Ga0495686_0081466_411_833 136
1297 3300047673 Ga0495593_0018843 Ga0495593_0018843_1586_1999 136
1298 3300048088 Ga0495602_0148731 Ga0495602_0148731_804_1214 136
1299 3300048088 Ga0495602_0446062 Ga0495602_0446062_360_770 136
1300 3300048088 Ga0495602_0464006 Ga0495602_0464006_22_432 136
1301 3300048088 Ga0495602_0472318 Ga0495602_0472318_361_771 136
1302 3300048089 Ga0495614_0000365 Ga0495614_0000365_9605_10018 136
1303 3300048089 Ga0495614_0060575 Ga0495614_0060575_1092_1505 136
1304 3300048903 Ga0496100_0103946 Ga0496100_0103946_389_799 136
1305 3300048903 Ga0496100_0288884 Ga0496100_0288884_691_1101 136
1306 3300048903 Ga0496100_0838500 Ga0496100_0838500_48_458 136
1307 3300048904 Ga0496101_0086554 Ga0496101_0086554_25_435 136
1308 3300048904 Ga0496101_0258323 Ga0496101_0258323_695_1105 136
1309 3300048904 Ga0496101_0457649 Ga0496101_0457649_22_432 136
1310 3300048904 Ga0496101_0812690 Ga0496101_0812690_235_645 136
1311 3300048905 Ga0496102_0001500 Ga0496102_0001500_1841_2251 136
1312 3300048905 Ga0496102_0041202 Ga0496102_0041202_243_653 136
1313 3300048905 Ga0496102_0112371 Ga0496102_0112371_2022_2432 136
1314 3300048905 Ga0496102_0327497 Ga0496102_0327497_198_608 136
1315 3300048905 Ga0496102_0463468 Ga0496102_0463468_441_851 136
1316 3300048905 Ga0496102_0821426 Ga0496102_0821426_246_656 136
1317 3300048906 Ga0496103_0010834 Ga0496103_0010834_3855_4265 136
1318 3300048906 Ga0496103_0108522 Ga0496103_0108522_508_918 136
1319 3300048906 Ga0496103_0186427 Ga0496103_0186427_760_1170 136
1320 3300048907 Ga0496104_0002436 Ga0496104_0002436_15016_15438 136
1321 3300048907 Ga0496104_0022220 Ga0496104_0022220_4731_5141 136
1322 3300048907 Ga0496104_0023786 Ga0496104_0023786_4598_5008 136
1323 3300048907 Ga0496104_0023902 Ga0496104_0023902_3834_4247 136
1324 3300048907 Ga0496104_0115202 Ga0496104_0115202_2088_2498 136
1325 3300048907 Ga0496104_0296989 Ga0496104_0296989_112_531 136
1326 3300048907 Ga0496104_0433274 Ga0496104_0433274_227_679 136
1327 3300048907 Ga0496104_0567751 Ga0496104_0567751_276_686 136
1328 3300048907 Ga0496104_0779242 Ga0496104_0779242_137_550 136
1329 3300048907 Ga0496104_1441986 Ga0496104_1441986_15_425 136
1330 3300048908 Ga0496105_0098109 Ga0496105_0098109_1197_1607 136
1331 3300048908 Ga0496105_0213099 Ga0496105_0213099_76_486 136
1332 3300048909 Ga0496106_0031172 Ga0496106_0031172_477_887 136
1333 3300048909 Ga0496106_0090342 Ga0496106_0090342_892_1302 136
1334 3300048909 Ga0496106_0179820 Ga0496106_0179820_1061_1471 136
1335 3300048909 Ga0496106_0266849 Ga0496106_0266849_54_464 136
1336 3300048910 Ga0496107_0189850 Ga0496107_0189850_1060_1470 136
1337 3300048910 Ga0496107_0206222 Ga0496107_0206222_415_825 136
1338 3300048910 Ga0496107_0269813 Ga0496107_0269813_468_878 136
1339 3300048911 Ga0496108_0000422 Ga0496108_0000422_11779_12231 136
1340 3300048911 Ga0496108_0151919 Ga0496108_0151919_1029_1439 136
1341 3300048911 Ga0496108_1167986 Ga0496108_1167986_99_509 136
1342 3300048911 Ga0496108_1218765 Ga0496108_1218765_193_606 136
1343 3300048912 Ga0496109_0001507 Ga0496109_0001507_6017_6469 136
1344 3300048912 Ga0496109_0218740 Ga0496109_0218740_441_851 136
1345 3300048912 Ga0496109_0539880 Ga0496109_0539880_460_870 136
1346 3300048912 Ga0496109_0982305 Ga0496109_0982305_181_591 136
1347 3300048913 Ga0496110_0014240 Ga0496110_0014240_3345_3755 136
1348 3300048913 Ga0496110_0054816 Ga0496110_0054816_1103_1513 136
1349 3300048914 Ga0496111_0008180 Ga0496111_0008180_6038_6448 136
1350 3300048914 Ga0496111_0019854 Ga0496111_0019854_2984_3394 136
1351 3300048914 Ga0496111_0308824 Ga0496111_0308824_382_792 136
1352 3300048915 Ga0496112_0001888 Ga0496112_0001888_3167_3619 136
1353 3300048915 Ga0496112_0008075 Ga0496112_0008075_2815_3225 136
1354 3300048915 Ga0496112_0013759 Ga0496112_0013759_6765_7175 136
1355 3300048915 Ga0496112_0015992 Ga0496112_0015992_5122_5532 136
1356 3300048915 Ga0496112_0021039 Ga0496112_0021039_870_1280 136
1357 3300048915 Ga0496112_0068332 Ga0496112_0068332_2099_2509 136
1358 3300048915 Ga0496112_0982343 Ga0496112_0982343_33_443 136
1359 3300048916 Ga0496113_0001069 Ga0496113_0001069_14379_14789 136
1360 3300048916 Ga0496113_0023620 Ga0496113_0023620_2323_2733 136
1361 3300048916 Ga0496113_0064705 Ga0496113_0064705_511_921 136
1362 3300048916 Ga0496113_0119797 Ga0496113_0119797_1597_2007 136
1363 3300048916 Ga0496113_0438773 Ga0496113_0438773_17_427 136
1364 3300048917 Ga0496114_1613234 Ga0496114_1613234_16_426 136
1365 3300048918 Ga0496115_0004078 Ga0496115_0004078_10110_10520 136
1366 3300048918 Ga0496115_0021623 Ga0496115_0021623_1796_2206 136
1367 3300048918 Ga0496115_0065184 Ga0496115_0065184_436_849 136
1368 3300048918 Ga0496115_0281670 Ga0496115_0281670_497_916 136
1369 3300048918 Ga0496115_0926645 Ga0496115_0926645_42_452 136
1370 3300048929 Ga0496126_0000139 Ga0496126_0000139_82277_82687 136
1371 3300048929 Ga0496126_0003176 Ga0496126_0003176_8882_9295 136
1372 3300048929 Ga0496126_0197453 Ga0496126_0197453_1020_1433 136
1373 3300049460 Ga0495682_0039331 Ga0495682_0039331_252_665 136
1374 3300049515 Ga0501292_006508 Ga0501292_006508_1127_1615 136
1375 3300049519 Ga0501296_025900 Ga0501296_025900_157_645 136
1376 3300049520 Ga0501297_012034 Ga0501297_012034_565_975 136
1377 3300049520 Ga0501297_027267 Ga0501297_027267_122_532 136
1378 3300049521 Ga0501298_005110 Ga0501298_005110_543_953 136
1379 3300049522 Ga0501299_018295 Ga0501299_018295_440_850 136
1380 3300049568 Ga0501031_0036477 Ga0501031_0036477_1213_1626 136
1381 3300049569 Ga0501032_0000638 Ga0501032_0000638_20149_20562 136
1382 3300049570 Ga0501033_0007918 Ga0501033_0007918_783_1196 136
1383 3300049570 Ga0501033_0235156 Ga0501033_0235156_847_1260 136
1384 3300049571 Ga0501034_0002797 Ga0501034_0002797_14971_15384 136
1385 3300049572 Ga0501036_0001803 Ga0501036_0001803_8359_8772 136
1386 3300049573 Ga0501037_0020105 Ga0501037_0020105_1470_1883 136
1387 3300049573 Ga0501037_0159778 Ga0501037_0159778_1181_1594 136
1388 3300049574 Ga0501038_0000571 Ga0501038_0000571_8227_8640 136
1389 3300049579 Ga0501043_0002729 Ga0501043_0002729_13067_13480 136
1390 3300049580 Ga0501046_0001246 Ga0501046_0001246_21561_21974 136
1391 3300049581 Ga0501047_0002082 Ga0501047_0002082_10337_10750 136
1392 3300049589 Ga0501073_0005596 Ga0501073_0005596_1022_1435 136
1393 3300049589 Ga0501073_0206060 Ga0501073_0206060_680_1090 136
1394 3300049589 Ga0501073_0269169 Ga0501073_0269169_146_559 136
1395 3300049593 Ga0501077_0097755 Ga0501077_0097755_1247_1657 136
1396 3300049669 Ga0501235_213456 Ga0501235_213456_11_499 136
1397 3300049742 Ga0501080_0023122 Ga0501080_0023122_1423_1836 136
1398 3300049742 Ga0501080_0515185 Ga0501080_0515185_593_1006 136
1399 3300049744 Ga0501083_0206279 Ga0501083_0206279_318_728 136
1400 3300049774 Ga0501278_008949 Ga0501278_008949_139_627 136
1401 3300049822 Ga0501035_0008138 Ga0501035_0008138_2035_2448 136
1402 3300049823 Ga0501044_0015327 Ga0501044_0015327_4515_4928 136
1403 3300049824 Ga0501045_0313341 Ga0501045_0313341_635_1048 136
1404 3300050510 nmdc:mga06r32_308023_c1 nmdc:mga06r32_308023_c1_462_872 136
1405 3300050512 nmdc:mga0n895_46183_c1 nmdc:mga0n895_46183_c1_1724_2134 136
1406 3300050512 nmdc:mga0n895_473906_c1 nmdc:mga0n895_473906_c1_642_1052 136
1407 3300050512 nmdc:mga0n895_5110_c1 nmdc:mga0n895_5110_c1_2749_3159 136
1408 3300050513 nmdc:mga0rr50_1772902_c1 nmdc:mga0rr50_1772902_c1_77_487 136
1409 3300050514 nmdc:mga08x19_129199_c1 nmdc:mga08x19_129199_c1_311_721 136
1410 3300050514 nmdc:mga08x19_197730_c1 nmdc:mga08x19_197730_c1_755_1165 136
1411 3300050515 nmdc:mga0a205_553460_c1 nmdc:mga0a205_553460_c1_424_834 136
1412 3300050515 nmdc:mga0a205_94531_c1 nmdc:mga0a205_94531_c1_711_1121 136
1413 3300053077 Ga0495601_0012731 Ga0495601_0012731_162_572 136
1414 3300053077 Ga0495601_0067495 Ga0495601_0067495_1501_1914 136
1415 3300053085 Ga0495619_0804954 Ga0495619_0804954_87_590 136
1416 3300053085 Ga0495619_0934441 Ga0495619_0934441_84_497 136
1417 3300053087 Ga0500643_039654 Ga0500643_039654_680_1093 136
1418 3300053093 Ga0500651_0000010 Ga0500651_0000010_252157_252570 136
1419 3300053119 Ga0500595_000007 Ga0500595_000007_266239_266652 136
1420 3300053119 Ga0500595_023685 Ga0500595_023685_1621_2034 136
1421 3300054114 Ga0501084_0296196 Ga0501084_0296196_730_1140 136
1422 3300055283 Ga0500661_001206 Ga0500661_001206_1859_2284 136
1423 3300059490 Ga0587066_098490 Ga0587066_098490_164_574 136
1424 3300059490 Ga0587066_109753 Ga0587066_109753_126_536 136
1425 3300059492 Ga0587073_0062006 Ga0587073_0062006_375_785 136
1426 3300059492 Ga0587073_0095743 Ga0587073_0095743_279_689 136
1427 3300059492 Ga0587073_0305330 Ga0587073_0305330_72_485 136
1428 3300059503 Ga0587080_050009 Ga0587080_050009_356_766 136
1429 3300059504 Ga0587082_070565 Ga0587082_070565_186_596 136
1430 3300059505 Ga0587083_0084930 Ga0587083_0084930_53_463 136
1431 3300059510 Ga0587090_065221 Ga0587090_065221_165_575 136
1432 3300059511 Ga0587091_069249 Ga0587091_069249_284_694 136
1433 3300059512 Ga0587092_134761 Ga0587092_134761_76_486 136
1434 3300059513 Ga0587094_105529 Ga0587094_105529_83_493 136
1435 3300059623 Ga0587101_098024 Ga0587101_098024_18_428 136
1436 3300059640 Ga0587067_158215 Ga0587067_158215_74_484 136
1437 3300059644 Ga0587075_050988 Ga0587075_050988_170_580 136
1438 3300059645 Ga0587076_033672 Ga0587076_033672_313_723 136
1439 3300059655 Ga0587114_036932 Ga0587114_036932_284_694 136
1440 3300060344 Ga0587071_134932 Ga0587071_134932_104_514 136
1441 3300060346 Ga0587111_0213486 Ga0587111_0213486_69_479 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

3

135

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i2b-assembly3.cif.gz_I the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase 0.9511 2 135
1b66-assembly1.cif.gz_A 6-pyruvoyl tetrahydropterin synthase 0.9479 2 135
2dtt-assembly1.cif.gz_A crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.9406 2 133
2g64-assembly1.cif.gz_A structure of caenorhabditis elegans 6-pyruvoyl tetrahydropterin synthase 0.9342 2 135
3i2b-assembly3.cif.gz_I the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase 0.931 2 135
ID Description Score Start End Superfamily
af_Q1ZXI0_1_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9478 2 135 3.30.479.10
2g64A00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9342 2 135 3.30.479.10
2g64A00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9146 2 135 3.30.479.10
af_Q1ZXI0_1_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9142 2 135 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.909 1 134 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A7C7N2I5-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9767 3 133 GO:0003874
GO:0006729
GO:0046872
GO:0070497
AF-A0A1F2SIV9-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9763 1 134 GO:0003874
GO:0006729
GO:0046872
GO:0070497
AF-A0A522AXJ6-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9759 2 136 GO:0003874
GO:0006729
GO:0046872
GO:0070497
AF-A0A1H4JCJ5-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9757 1 135 GO:0046872
GO:0070497
AF-A0A7X3UJW7-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9754 3 135 GO:0003874
GO:0006729
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.01 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map