F493982
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1441 | 421 | 1441 | 137 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_100077449|Ga0070706_1000774494 |
| Length | 167 |
| Sequence | MVYLTRKAEFSASHYYHNPEFTPDENQRVFGKCNNPNGHGHNYTLEVTVKGPVDPKSGFVVDLKQLKDIMSREVLDALDHRFLNKEVPEFFTKIPTTENLAIAIWQRLAPKLNAAQLHRVRVYETPDLFVDFYGEDFHDEESFGVTRERIREIETKVLIALRKQRHT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 92 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 93 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 129 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 134 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 135 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 136 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 138 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 139 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 140 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 141 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 142 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 208 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 220 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 221 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 223 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 224 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 225 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 226 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 229 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 230 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 231 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 232 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 233 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 234 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 235 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 236 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 237 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 238 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 239 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 240 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 244 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 246 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 247 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 249 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 250 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 251 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 252 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 254 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 255 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 256 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 257 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 258 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 259 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 260 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 263 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 264 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 265 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 266 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 267 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 268 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 269 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 270 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 271 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 272 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 273 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 274 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 275 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 276 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 277 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 278 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 279 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 280 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 281 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 348 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 349 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 350 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 351 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 352 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 353 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 356 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 357 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 358 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 359 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 360 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 361 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 362 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 365 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 366 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 367 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 368 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 369 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 370 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 383 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 384 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 385 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 386 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 389 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 390 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 391 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 402 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 403 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 404 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 406 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.18 |
| Metatranscriptomes | 3.82 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.35 |
| Nodule | 0 |
| Rhizoplane | 4.65 |
| Rhizosphere | 94.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_3103743 | 2162886012 | Bacteria | 1674 |
| 2 | LJNas_1001286 | 3300000546 | Bacteria | 3725 |
| 3 | JGI24752J21851_1001233 | 3300001976 | Bacteria | 3472 |
| 4 | JGI24737J22298_10029521 | 3300001990 | Bacteria | 1719 |
| 5 | JGI24738J21930_10128631 | 3300002075 | Bacteria | 554 |
| 6 | JGI24751J29686_10002071 | 3300002459 | Bacteria | 4070 |
| 7 | Ga0058861_12048564 | 3300004800 | Bacteria | 1785 |
| 8 | Ga0058862_10173224 | 3300004803 | Unclassified | 592 |
| 9 | Ga0058862_12495541 | 3300004803 | Bacteria | 613 |
| 10 | Ga0058862_12808140 | 3300004803 | Bacteria | 762 |
| 11 | Ga0065712_10221444 | 3300005290 | Bacteria | 1036 |
| 12 | Ga0065712_10285988 | 3300005290 | Bacteria | 886 |
| 13 | Ga0065715_10117766 | 3300005293 | Bacteria | 2336 |
| 14 | Ga0065715_10293036 | 3300005293 | Bacteria | 1058 |
| 15 | Ga0070658_10012556 | 3300005327 | Bacteria | 6793 |
| 16 | Ga0070658_10126712 | 3300005327 | Bacteria | 2126 |
| 17 | Ga0070658_10469987 | 3300005327 | Bacteria | 1085 |
| 18 | Ga0070676_10056461 | 3300005328 | Bacteria | 2320 |
| 19 | Ga0070676_10147316 | 3300005328 | Unclassified | 1504 |
| 20 | Ga0070683_100033697 | 3300005329 | Bacteria | 4671 |
| 21 | Ga0070683_100061593 | 3300005329 | Bacteria | 3489 |
| 22 | Ga0070683_100200803 | 3300005329 | Bacteria | 1893 |
| 23 | Ga0070683_100386630 | 3300005329 | Bacteria | 1334 |
| 24 | Ga0070690_100109606 | 3300005330 | Bacteria | 1841 |
| 25 | Ga0070690_100605485 | 3300005330 | Bacteria | 832 |
| 26 | Ga0068869_100010295 | 3300005334 | Bacteria | 6096 |
| 27 | Ga0068869_100088922 | 3300005334 | Bacteria | 2319 |
| 28 | Ga0068869_100566738 | 3300005334 | Bacteria | 956 |
| 29 | Ga0068869_100943758 | 3300005334 | Bacteria | 748 |
| 30 | Ga0070666_10012660 | 3300005335 | Bacteria | 5329 |
| 31 | Ga0070666_10042597 | 3300005335 | Bacteria | 3038 |
| 32 | Ga0070666_10043191 | 3300005335 | Bacteria | 3017 |
| 33 | Ga0070680_100057956 | 3300005336 | Bacteria | 3167 |
| 34 | Ga0070680_100098968 | 3300005336 | Bacteria | 2419 |
| 35 | Ga0070680_100107842 | 3300005336 | Unclassified | 2316 |
| 36 | Ga0070680_100316411 | 3300005336 | Unclassified | 1325 |
| 37 | Ga0070680_100553854 | 3300005336 | Bacteria | 986 |
| 38 | Ga0070680_101930996 | 3300005336 | Bacteria | 512 |
| 39 | Ga0070682_100038919 | 3300005337 | Unclassified | 2919 |
| 40 | Ga0070682_100068528 | 3300005337 | Unclassified | 2263 |
| 41 | Ga0070682_100074862 | 3300005337 | Bacteria | 2176 |
| 42 | Ga0070682_100091560 | 3300005337 | Bacteria | 1990 |
| 43 | Ga0070682_101406599 | 3300005337 | Bacteria | 597 |
| 44 | Ga0068868_100031072 | 3300005338 | Bacteria | 4099 |
| 45 | Ga0068868_100034745 | 3300005338 | Bacteria | 3894 |
| 46 | Ga0068868_100146134 | 3300005338 | Unclassified | 1944 |
| 47 | Ga0068868_100208146 | 3300005338 | Bacteria | 1633 |
| 48 | Ga0070660_100003963 | 3300005339 | Bacteria | 10225 |
| 49 | Ga0070660_100011766 | 3300005339 | Bacteria | 6231 |
| 50 | Ga0070660_100019856 | 3300005339 | Bacteria | 4930 |
| 51 | Ga0070660_100042003 | 3300005339 | Bacteria | 3488 |
| 52 | Ga0070660_101260305 | 3300005339 | Bacteria | 627 |
| 53 | Ga0070689_100018894 | 3300005340 | Bacteria | 5088 |
| 54 | Ga0070691_10114657 | 3300005341 | Unclassified | 1351 |
| 55 | Ga0070687_100629509 | 3300005343 | Bacteria | 741 |
| 56 | Ga0070661_100016945 | 3300005344 | Bacteria | 5160 |
| 57 | Ga0070661_100030495 | 3300005344 | Bacteria | 3896 |
| 58 | Ga0070692_10111019 | 3300005345 | Bacteria | 1516 |
| 59 | Ga0070692_10274097 | 3300005345 | Unclassified | 1020 |
| 60 | Ga0070668_100035071 | 3300005347 | Bacteria | 3824 |
| 61 | Ga0070668_100042879 | 3300005347 | Bacteria | 3468 |
| 62 | Ga0070675_100484212 | 3300005354 | Bacteria | 1113 |
| 63 | Ga0070675_100628569 | 3300005354 | Bacteria | 975 |
| 64 | Ga0070671_100010322 | 3300005355 | Bacteria | 7492 |
| 65 | Ga0070671_101714198 | 3300005355 | Bacteria | 558 |
| 66 | Ga0070673_100069246 | 3300005364 | Bacteria | 2827 |
| 67 | Ga0070673_100516358 | 3300005364 | Bacteria | 1082 |
| 68 | Ga0070688_100005987 | 3300005365 | Bacteria | 6447 |
| 69 | Ga0070688_100067329 | 3300005365 | Unclassified | 2281 |
| 70 | Ga0070659_100003656 | 3300005366 | Bacteria | 10960 |
| 71 | Ga0070659_100004062 | 3300005366 | Bacteria | 10437 |
| 72 | Ga0070659_100091787 | 3300005366 | Bacteria | 2434 |
| 73 | Ga0070659_100650862 | 3300005366 | Bacteria | 908 |
| 74 | Ga0070667_100119224 | 3300005367 | Bacteria | 2294 |
| 75 | Ga0070667_100225488 | 3300005367 | Unclassified | 1669 |
| 76 | Ga0070667_100370220 | 3300005367 | Unclassified | 1300 |
| 77 | Ga0070709_10000577 | 3300005434 | Bacteria | 21437 |
| 78 | Ga0070709_10012342 | 3300005434 | Bacteria | 4780 |
| 79 | Ga0070709_10066236 | 3300005434 | Bacteria | 2316 |
| 80 | Ga0070709_10069913 | 3300005434 | Bacteria | 2262 |
| 81 | Ga0070709_10122549 | 3300005434 | Bacteria | 1764 |
| 82 | Ga0070709_10264981 | 3300005434 | Bacteria | 1243 |
| 83 | Ga0070709_10278304 | 3300005434 | Bacteria | 1215 |
| 84 | Ga0070709_10405357 | 3300005434 | Bacteria | 1019 |
| 85 | Ga0070709_10406155 | 3300005434 | Bacteria | 1018 |
| 86 | Ga0070709_10455508 | 3300005434 | Bacteria | 964 |
| 87 | Ga0070709_11242588 | 3300005434 | Unclassified | 599 |
| 88 | Ga0070714_100000071 | 3300005435 | Bacteria | 90189 |
| 89 | Ga0070714_100021042 | 3300005435 | Bacteria | 5333 |
| 90 | Ga0070714_100109078 | 3300005435 | Bacteria | 2448 |
| 91 | Ga0070714_100139917 | 3300005435 | Bacteria | 2171 |
| 92 | Ga0070714_100150155 | 3300005435 | Bacteria | 2099 |
| 93 | Ga0070714_100327416 | 3300005435 | Unclassified | 1434 |
| 94 | Ga0070714_100399601 | 3300005435 | Bacteria | 1298 |
| 95 | Ga0070714_100768180 | 3300005435 | Bacteria | 932 |
| 96 | Ga0070714_100804929 | 3300005435 | Unclassified | 910 |
| 97 | Ga0070714_100852706 | 3300005435 | Bacteria | 883 |
| 98 | Ga0070714_101216411 | 3300005435 | Unclassified | 735 |
| 99 | Ga0070714_101467448 | 3300005435 | Bacteria | 666 |
| 100 | Ga0070714_101489498 | 3300005435 | Unclassified | 661 |
| 101 | Ga0070714_101845639 | 3300005435 | Bacteria | 590 |
| 102 | Ga0070714_101971904 | 3300005435 | Bacteria | 569 |
| 103 | Ga0070713_100000176 | 3300005436 | Bacteria | 42775 |
| 104 | Ga0070713_100001833 | 3300005436 | Bacteria | 13718 |
| 105 | Ga0070713_100008088 | 3300005436 | Bacteria | 7438 |
| 106 | Ga0070713_100022893 | 3300005436 | Bacteria | 4837 |
| 107 | Ga0070713_100030299 | 3300005436 | Bacteria | 4296 |
| 108 | Ga0070713_100068600 | 3300005436 | Bacteria | 2988 |
| 109 | Ga0070713_100075733 | 3300005436 | Bacteria | 2855 |
| 110 | Ga0070713_100081923 | 3300005436 | Bacteria | 2754 |
| 111 | Ga0070713_100082933 | 3300005436 | Bacteria | 2739 |
| 112 | Ga0070713_100099365 | 3300005436 | Bacteria | 2517 |
| 113 | Ga0070713_100169307 | 3300005436 | Unclassified | 1956 |
| 114 | Ga0070713_100216338 | 3300005436 | Bacteria | 1737 |
| 115 | Ga0070713_100267590 | 3300005436 | Bacteria | 1564 |
| 116 | Ga0070713_100462169 | 3300005436 | Bacteria | 1193 |
| 117 | Ga0070713_100522774 | 3300005436 | Bacteria | 1121 |
| 118 | Ga0070713_100583341 | 3300005436 | Bacteria | 1061 |
| 119 | Ga0070713_100733290 | 3300005436 | Bacteria | 945 |
| 120 | Ga0070713_100760159 | 3300005436 | Unclassified | 928 |
| 121 | Ga0070713_101742762 | 3300005436 | Bacteria | 605 |
| 122 | Ga0070710_10001044 | 3300005437 | Bacteria | 13170 |
| 123 | Ga0070710_10015921 | 3300005437 | Bacteria | 3814 |
| 124 | Ga0070710_10029547 | 3300005437 | Unclassified | 2942 |
| 125 | Ga0070710_10036520 | 3300005437 | Bacteria | 2687 |
| 126 | Ga0070710_10081696 | 3300005437 | Bacteria | 1888 |
| 127 | Ga0070710_10111175 | 3300005437 | Bacteria | 1646 |
| 128 | Ga0070710_10166449 | 3300005437 | Unclassified | 1371 |
| 129 | Ga0070710_10382827 | 3300005437 | Unclassified | 939 |
| 130 | Ga0070710_10403632 | 3300005437 | Bacteria | 916 |
| 131 | Ga0070711_100000966 | 3300005439 | Bacteria | 15201 |
| 132 | Ga0070711_100006410 | 3300005439 | Bacteria | 7095 |
| 133 | Ga0070711_100019818 | 3300005439 | Bacteria | 4323 |
| 134 | Ga0070711_100034830 | 3300005439 | Bacteria | 3361 |
| 135 | Ga0070711_100081544 | 3300005439 | Bacteria | 2306 |
| 136 | Ga0070711_100145306 | 3300005439 | Bacteria | 1783 |
| 137 | Ga0070711_100289916 | 3300005439 | Bacteria | 1298 |
| 138 | Ga0070711_100327592 | 3300005439 | Bacteria | 1225 |
| 139 | Ga0070711_100569822 | 3300005439 | Bacteria | 941 |
| 140 | Ga0070711_100649946 | 3300005439 | Unclassified | 884 |
| 141 | Ga0070711_100719581 | 3300005439 | Bacteria | 842 |
| 142 | Ga0070711_100765134 | 3300005439 | Unclassified | 817 |
| 143 | Ga0070700_100424645 | 3300005441 | Bacteria | 1005 |
| 144 | Ga0070694_100716303 | 3300005444 | Bacteria | 815 |
| 145 | Ga0070694_100815446 | 3300005444 | Bacteria | 766 |
| 146 | Ga0070708_100000595 | 3300005445 | Bacteria | 27186 |
| 147 | Ga0070708_100011692 | 3300005445 | Bacteria | 7144 |
| 148 | Ga0070708_100069650 | 3300005445 | Bacteria | 3164 |
| 149 | Ga0070708_100073060 | 3300005445 | Bacteria | 3091 |
| 150 | Ga0070708_100137597 | 3300005445 | Bacteria | 2263 |
| 151 | Ga0070708_100145777 | 3300005445 | Unclassified | 2199 |
| 152 | Ga0070708_100208923 | 3300005445 | Bacteria | 1829 |
| 153 | Ga0070708_100337751 | 3300005445 | Bacteria | 1420 |
| 154 | Ga0070708_100396239 | 3300005445 | Unclassified | 1302 |
| 155 | Ga0070708_100418570 | 3300005445 | Bacteria | 1264 |
| 156 | Ga0070708_100734208 | 3300005445 | Unclassified | 929 |
| 157 | Ga0070708_100820744 | 3300005445 | Unclassified | 874 |
| 158 | Ga0070708_100994811 | 3300005445 | Bacteria | 786 |
| 159 | Ga0070708_101508779 | 3300005445 | Bacteria | 626 |
| 160 | Ga0070663_100180871 | 3300005455 | Bacteria | 1635 |
| 161 | Ga0070663_100334586 | 3300005455 | Bacteria | 1221 |
| 162 | Ga0070663_100522690 | 3300005455 | Bacteria | 988 |
| 163 | Ga0070678_100217439 | 3300005456 | Unclassified | 1587 |
| 164 | Ga0070662_100020018 | 3300005457 | Bacteria | 4554 |
| 165 | Ga0070662_100049803 | 3300005457 | Bacteria | 3021 |
| 166 | Ga0070662_100253587 | 3300005457 | Bacteria | 1415 |
| 167 | Ga0070681_10005766 | 3300005458 | Bacteria | 11974 |
| 168 | Ga0070681_10039804 | 3300005458 | Bacteria | 4712 |
| 169 | Ga0070681_10186398 | 3300005458 | Bacteria | 1995 |
| 170 | Ga0070681_10242387 | 3300005458 | Unclassified | 1716 |
| 171 | Ga0070681_10317488 | 3300005458 | Unclassified | 1467 |
| 172 | Ga0070681_10335787 | 3300005458 | Bacteria | 1421 |
| 173 | Ga0070681_10515088 | 3300005458 | Bacteria | 1109 |
| 174 | Ga0068867_100042005 | 3300005459 | Bacteria | 3342 |
| 175 | Ga0068867_100168888 | 3300005459 | Bacteria | 1731 |
| 176 | Ga0068867_100935427 | 3300005459 | Bacteria | 782 |
| 177 | Ga0070685_10001863 | 3300005466 | Bacteria | 11002 |
| 178 | Ga0070685_11079479 | 3300005466 | Bacteria | 606 |
| 179 | Ga0070706_100005807 | 3300005467 | Bacteria | 11728 |
| 180 | Ga0070706_100006462 | 3300005467 | Bacteria | 11067 |
| 181 | Ga0070706_100016205 | 3300005467 | Bacteria | 6884 |
| 182 | Ga0070706_100074300 | 3300005467 | Bacteria | 3147 |
| 183 | Ga0070706_100077449 | 3300005467 | Bacteria | 3078 |
| 184 | Ga0070706_100175311 | 3300005467 | Bacteria | 2002 |
| 185 | Ga0070706_100233742 | 3300005467 | Bacteria | 1716 |
| 186 | Ga0070706_100679913 | 3300005467 | Bacteria | 955 |
| 187 | Ga0070706_100933752 | 3300005467 | Unclassified | 801 |
| 188 | Ga0070706_101293443 | 3300005467 | Bacteria | 669 |
| 189 | Ga0070707_100010010 | 3300005468 | Bacteria | 8822 |
| 190 | Ga0070707_100113614 | 3300005468 | Bacteria | 2628 |
| 191 | Ga0070707_100230121 | 3300005468 | Bacteria | 1804 |
| 192 | Ga0070707_100308198 | 3300005468 | Bacteria | 1539 |
| 193 | Ga0070707_100470196 | 3300005468 | Bacteria | 1218 |
| 194 | Ga0070707_100567695 | 3300005468 | Bacteria | 1097 |
| 195 | Ga0070707_100584067 | 3300005468 | Unclassified | 1079 |
| 196 | Ga0070707_101285626 | 3300005468 | Bacteria | 698 |
| 197 | Ga0070707_101868824 | 3300005468 | Bacteria | 568 |
| 198 | Ga0070698_100001986 | 3300005471 | Bacteria | 22707 |
| 199 | Ga0070698_100269984 | 3300005471 | Bacteria | 1633 |
| 200 | Ga0070698_100509698 | 3300005471 | Bacteria | 1141 |
| 201 | Ga0070699_100000769 | 3300005518 | Bacteria | 29610 |
| 202 | Ga0070699_100014509 | 3300005518 | Bacteria | 6776 |
| 203 | Ga0070699_100014709 | 3300005518 | Bacteria | 6729 |
| 204 | Ga0070699_100049489 | 3300005518 | Bacteria | 3638 |
| 205 | Ga0070699_100334669 | 3300005518 | Unclassified | 1362 |
| 206 | Ga0070699_100696696 | 3300005518 | Bacteria | 928 |
| 207 | Ga0070699_100860778 | 3300005518 | Bacteria | 830 |
| 208 | Ga0070679_100014705 | 3300005530 | Bacteria | 7523 |
| 209 | Ga0070679_100068802 | 3300005530 | Bacteria | 3531 |
| 210 | Ga0070679_100076010 | 3300005530 | Bacteria | 3348 |
| 211 | Ga0070679_100080979 | 3300005530 | Bacteria | 3236 |
| 212 | Ga0070679_100178985 | 3300005530 | Bacteria | 2093 |
| 213 | Ga0070679_100215062 | 3300005530 | Bacteria | 1885 |
| 214 | Ga0070679_100252381 | 3300005530 | Bacteria | 1720 |
| 215 | Ga0070679_100316721 | 3300005530 | Unclassified | 1509 |
| 216 | Ga0070679_100361488 | 3300005530 | Bacteria | 1399 |
| 217 | Ga0070679_100401953 | 3300005530 | Bacteria | 1316 |
| 218 | Ga0070679_100512394 | 3300005530 | Bacteria | 1143 |
| 219 | Ga0070684_100084995 | 3300005535 | Bacteria | 2806 |
| 220 | Ga0070684_100156199 | 3300005535 | Bacteria | 2069 |
| 221 | Ga0070684_100172317 | 3300005535 | Bacteria | 1966 |
| 222 | Ga0070684_100245401 | 3300005535 | Unclassified | 1637 |
| 223 | Ga0070684_101521376 | 3300005535 | Unclassified | 631 |
| 224 | Ga0070697_100000481 | 3300005536 | Bacteria | 30316 |
| 225 | Ga0070697_100000712 | 3300005536 | Bacteria | 24773 |
| 226 | Ga0070697_100002501 | 3300005536 | Bacteria | 14144 |
| 227 | Ga0070697_100004639 | 3300005536 | Bacteria | 10543 |
| 228 | Ga0070697_100005737 | 3300005536 | Bacteria | 9571 |
| 229 | Ga0070697_100041960 | 3300005536 | Bacteria | 3703 |
| 230 | Ga0070697_100075138 | 3300005536 | Unclassified | 2777 |
| 231 | Ga0070697_100256754 | 3300005536 | Bacteria | 1495 |
| 232 | Ga0070697_100294565 | 3300005536 | Bacteria | 1394 |
| 233 | Ga0070697_100340961 | 3300005536 | Unclassified | 1293 |
| 234 | Ga0070697_100787819 | 3300005536 | Bacteria | 841 |
| 235 | Ga0070697_100812642 | 3300005536 | Bacteria | 827 |
| 236 | Ga0070697_100858285 | 3300005536 | Bacteria | 804 |
| 237 | Ga0070697_100923447 | 3300005536 | Bacteria | 775 |
| 238 | Ga0070697_100934482 | 3300005536 | Bacteria | 770 |
| 239 | Ga0070697_101295908 | 3300005536 | Unclassified | 650 |
| 240 | Ga0070697_101973301 | 3300005536 | Unclassified | 522 |
| 241 | Ga0068853_100000036 | 3300005539 | Bacteria | 108488 |
| 242 | Ga0068853_100012160 | 3300005539 | Bacteria | 6999 |
| 243 | Ga0068853_100030470 | 3300005539 | Bacteria | 4556 |
| 244 | Ga0068853_100112150 | 3300005539 | Bacteria | 2424 |
| 245 | Ga0068853_101022687 | 3300005539 | Bacteria | 796 |
| 246 | Ga0068853_102124754 | 3300005539 | Bacteria | 544 |
| 247 | Ga0070672_100150419 | 3300005543 | Bacteria | 1925 |
| 248 | Ga0070672_100297164 | 3300005543 | Bacteria | 1368 |
| 249 | Ga0070686_100007681 | 3300005544 | Bacteria | 6025 |
| 250 | Ga0070686_100064100 | 3300005544 | Bacteria | 2383 |
| 251 | Ga0070686_100185470 | 3300005544 | Bacteria | 1481 |
| 252 | Ga0070695_100123754 | 3300005545 | Bacteria | 1773 |
| 253 | Ga0070695_100328201 | 3300005545 | Unclassified | 1140 |
| 254 | Ga0070695_100345271 | 3300005545 | Bacteria | 1114 |
| 255 | Ga0070696_100174116 | 3300005546 | Unclassified | 1593 |
| 256 | Ga0070696_100223225 | 3300005546 | Bacteria | 1414 |
| 257 | Ga0070696_100667623 | 3300005546 | Bacteria | 844 |
| 258 | Ga0070693_100071182 | 3300005547 | Bacteria | 2048 |
| 259 | Ga0070693_100204476 | 3300005547 | Bacteria | 1284 |
| 260 | Ga0070693_100324499 | 3300005547 | Bacteria | 1045 |
| 261 | Ga0070665_100002872 | 3300005548 | Bacteria | 18615 |
| 262 | Ga0070665_100019435 | 3300005548 | Bacteria | 6817 |
| 263 | Ga0070665_100062001 | 3300005548 | Bacteria | 3749 |
| 264 | Ga0070704_100136115 | 3300005549 | Bacteria | 1911 |
| 265 | Ga0068855_100027264 | 3300005563 | Bacteria | 6835 |
| 266 | Ga0068855_100033347 | 3300005563 | Bacteria | 6145 |
| 267 | Ga0068855_100052534 | 3300005563 | Bacteria | 4797 |
| 268 | Ga0068855_100103998 | 3300005563 | Unclassified | 3266 |
| 269 | Ga0068855_100195281 | 3300005563 | Bacteria | 2280 |
| 270 | Ga0068855_100287020 | 3300005563 | Bacteria | 1825 |
| 271 | Ga0068855_100321471 | 3300005563 | Unclassified | 1710 |
| 272 | Ga0068855_100699757 | 3300005563 | Bacteria | 1084 |
| 273 | Ga0070664_100099739 | 3300005564 | Bacteria | 2524 |
| 274 | Ga0070664_100136975 | 3300005564 | Bacteria | 2153 |
| 275 | Ga0070664_100560452 | 3300005564 | Bacteria | 1057 |
| 276 | Ga0068857_100049861 | 3300005577 | Bacteria | 3714 |
| 277 | Ga0068857_100088069 | 3300005577 | Bacteria | 2778 |
| 278 | Ga0068857_100276411 | 3300005577 | Bacteria | 1544 |
| 279 | Ga0068854_100000016 | 3300005578 | Bacteria | 145396 |
| 280 | Ga0068854_100049478 | 3300005578 | Bacteria | 3002 |
| 281 | Ga0068854_100050453 | 3300005578 | Bacteria | 2977 |
| 282 | Ga0068854_100090789 | 3300005578 | Bacteria | 2272 |
| 283 | Ga0068854_100987272 | 3300005578 | Unclassified | 745 |
| 284 | Ga0068856_100004126 | 3300005614 | Bacteria | 14519 |
| 285 | Ga0068856_100021897 | 3300005614 | Bacteria | 6213 |
| 286 | Ga0068856_100029101 | 3300005614 | Bacteria | 5396 |
| 287 | Ga0068856_100029645 | 3300005614 | Bacteria | 5345 |
| 288 | Ga0068856_100058934 | 3300005614 | Bacteria | 3792 |
| 289 | Ga0068856_100215148 | 3300005614 | Unclassified | 1937 |
| 290 | Ga0068856_100444085 | 3300005614 | Unclassified | 1318 |
| 291 | Ga0068856_100561208 | 3300005614 | Bacteria | 1163 |
| 292 | Ga0068856_100631626 | 3300005614 | Bacteria | 1091 |
| 293 | Ga0068856_101512608 | 3300005614 | Bacteria | 685 |
| 294 | Ga0068856_101568026 | 3300005614 | Bacteria | 672 |
| 295 | Ga0070702_100017900 | 3300005615 | Bacteria | 3664 |
| 296 | Ga0068852_100049385 | 3300005616 | Bacteria | 3599 |
| 297 | Ga0068852_100371910 | 3300005616 | Bacteria | 1400 |
| 298 | Ga0068859_100072280 | 3300005617 | Bacteria | 3486 |
| 299 | Ga0068859_100082517 | 3300005617 | Bacteria | 3257 |
| 300 | Ga0068859_100233843 | 3300005617 | Bacteria | 1926 |
| 301 | Ga0068859_100904383 | 3300005617 | Bacteria | 967 |
| 302 | Ga0068859_102552010 | 3300005617 | Unclassified | 562 |
| 303 | Ga0068864_100024157 | 3300005618 | Bacteria | 5110 |
| 304 | Ga0068864_100974645 | 3300005618 | Bacteria | 840 |
| 305 | Ga0068866_10019938 | 3300005718 | Bacteria | 3063 |
| 306 | Ga0068866_10224565 | 3300005718 | Bacteria | 1135 |
| 307 | Ga0068866_10266656 | 3300005718 | Bacteria | 1055 |
| 308 | Ga0068866_10486804 | 3300005718 | Bacteria | 814 |
| 309 | Ga0068861_100127387 | 3300005719 | Unclassified | 2062 |
| 310 | Ga0068861_100237458 | 3300005719 | Bacteria | 1549 |
| 311 | Ga0068851_10005216 | 3300005834 | Bacteria | 5896 |
| 312 | Ga0068851_10098820 | 3300005834 | Bacteria | 1546 |
| 313 | Ga0068851_10109140 | 3300005834 | Bacteria | 1476 |
| 314 | Ga0068870_10003076 | 3300005840 | Bacteria | 7035 |
| 315 | Ga0068870_10176439 | 3300005840 | Unclassified | 1279 |
| 316 | Ga0068863_100025635 | 3300005841 | Bacteria | 5622 |
| 317 | Ga0068863_100078852 | 3300005841 | Bacteria | 3119 |
| 318 | Ga0068863_100124056 | 3300005841 | Bacteria | 2464 |
| 319 | Ga0068863_100432277 | 3300005841 | Bacteria | 1290 |
| 320 | Ga0068858_100006610 | 3300005842 | Bacteria | 11282 |
| 321 | Ga0068858_100015612 | 3300005842 | Bacteria | 7143 |
| 322 | Ga0068860_100078483 | 3300005843 | Bacteria | 3140 |
| 323 | Ga0068860_100133824 | 3300005843 | Bacteria | 2380 |
| 324 | Ga0068860_100238106 | 3300005843 | Bacteria | 1770 |
| 325 | Ga0068860_100311200 | 3300005843 | Unclassified | 1544 |
| 326 | Ga0068860_100934457 | 3300005843 | Unclassified | 884 |
| 327 | Ga0068862_100041491 | 3300005844 | Bacteria | 3915 |
| 328 | Ga0068862_100094144 | 3300005844 | Bacteria | 2613 |
| 329 | Ga0068862_100218140 | 3300005844 | Bacteria | 1726 |
| 330 | Ga0070717_10001512 | 3300006028 | Bacteria | 16106 |
| 331 | Ga0070717_10001792 | 3300006028 | Bacteria | 14982 |
| 332 | Ga0070717_10024162 | 3300006028 | Bacteria | 4823 |
| 333 | Ga0070717_10027429 | 3300006028 | Bacteria | 4552 |
| 334 | Ga0070717_10069253 | 3300006028 | Bacteria | 2938 |
| 335 | Ga0070717_10084455 | 3300006028 | Bacteria | 2671 |
| 336 | Ga0070717_10106763 | 3300006028 | Bacteria | 2384 |
| 337 | Ga0070717_10143584 | 3300006028 | Bacteria | 2060 |
| 338 | Ga0070717_10147400 | 3300006028 | Bacteria | 2034 |
| 339 | Ga0070717_10155232 | 3300006028 | Bacteria | 1982 |
| 340 | Ga0070717_10174302 | 3300006028 | Bacteria | 1872 |
| 341 | Ga0070717_10225978 | 3300006028 | Bacteria | 1647 |
| 342 | Ga0070717_10270703 | 3300006028 | Bacteria | 1504 |
| 343 | Ga0070717_10284046 | 3300006028 | Bacteria | 1468 |
| 344 | Ga0070717_10885821 | 3300006028 | Unclassified | 812 |
| 345 | Ga0070717_11110919 | 3300006028 | Bacteria | 720 |
| 346 | Ga0070717_11125772 | 3300006028 | Unclassified | 715 |
| 347 | Ga0070717_11158799 | 3300006028 | Unclassified | 704 |
| 348 | Ga0070717_11500681 | 3300006028 | Bacteria | 611 |
| 349 | Ga0070715_10001488 | 3300006163 | Bacteria | 6828 |
| 350 | Ga0070715_10002372 | 3300006163 | Bacteria | 5764 |
| 351 | Ga0070715_10053362 | 3300006163 | Bacteria | 1747 |
| 352 | Ga0070716_100000165 | 3300006173 | Bacteria | 26115 |
| 353 | Ga0070716_100006958 | 3300006173 | Bacteria | 5545 |
| 354 | Ga0070716_100012077 | 3300006173 | Bacteria | 4366 |
| 355 | Ga0070716_100030314 | 3300006173 | Bacteria | 2933 |
| 356 | Ga0070716_100034500 | 3300006173 | Bacteria | 2775 |
| 357 | Ga0070716_100065842 | 3300006173 | Bacteria | 2111 |
| 358 | Ga0070716_100096122 | 3300006173 | Unclassified | 1805 |
| 359 | Ga0070716_100126878 | 3300006173 | Bacteria | 1606 |
| 360 | Ga0070716_100161379 | 3300006173 | Bacteria | 1453 |
| 361 | Ga0070716_100330826 | 3300006173 | Bacteria | 1071 |
| 362 | Ga0070716_100332352 | 3300006173 | Bacteria | 1069 |
| 363 | Ga0070716_100573682 | 3300006173 | Unclassified | 845 |
| 364 | Ga0070716_100589073 | 3300006173 | Bacteria | 835 |
| 365 | Ga0070716_100671512 | 3300006173 | Bacteria | 788 |
| 366 | Ga0070716_100830313 | 3300006173 | Bacteria | 718 |
| 367 | Ga0070712_100000512 | 3300006175 | Bacteria | 22246 |
| 368 | Ga0070712_100002724 | 3300006175 | Bacteria | 10907 |
| 369 | Ga0070712_100003444 | 3300006175 | Bacteria | 9737 |
| 370 | Ga0070712_100005055 | 3300006175 | Bacteria | 8169 |
| 371 | Ga0070712_100128370 | 3300006175 | Bacteria | 1918 |
| 372 | Ga0070712_100138688 | 3300006175 | Bacteria | 1853 |
| 373 | Ga0070712_100156315 | 3300006175 | Bacteria | 1756 |
| 374 | Ga0070712_100175004 | 3300006175 | Bacteria | 1668 |
| 375 | Ga0070712_100423199 | 3300006175 | Bacteria | 1104 |
| 376 | Ga0070712_100678739 | 3300006175 | Bacteria | 877 |
| 377 | Ga0070712_101527072 | 3300006175 | Bacteria | 584 |
| 378 | Ga0097621_100005593 | 3300006237 | Bacteria | 8861 |
| 379 | Ga0097621_100186732 | 3300006237 | Bacteria | 1793 |
| 380 | Ga0097621_100235117 | 3300006237 | Unclassified | 1600 |
| 381 | Ga0097621_100669637 | 3300006237 | Unclassified | 953 |
| 382 | Ga0097621_101171811 | 3300006237 | Bacteria | 723 |
| 383 | Ga0097621_102011981 | 3300006237 | Unclassified | 552 |
| 384 | Ga0068871_100001005 | 3300006358 | Bacteria | 18907 |
| 385 | Ga0068871_100194171 | 3300006358 | Bacteria | 1750 |
| 386 | Ga0068871_100207314 | 3300006358 | Bacteria | 1694 |
| 387 | Ga0068871_100313566 | 3300006358 | Bacteria | 1379 |
| 388 | Ga0068871_100481107 | 3300006358 | Bacteria | 1117 |
| 389 | Ga0068871_100688815 | 3300006358 | Bacteria | 935 |
| 390 | Ga0075433_10077924 | 3300006852 | Bacteria | 2920 |
| 391 | Ga0075433_10404022 | 3300006852 | Bacteria | 1205 |
| 392 | Ga0075434_100005454 | 3300006871 | Bacteria | 11589 |
| 393 | Ga0075434_100100731 | 3300006871 | Bacteria | 2895 |
| 394 | Ga0075434_100126340 | 3300006871 | Bacteria | 2574 |
| 395 | Ga0068865_100078921 | 3300006881 | Bacteria | 2356 |
| 396 | Ga0068865_100109618 | 3300006881 | Bacteria | 2034 |
| 397 | Ga0068865_100161534 | 3300006881 | Unclassified | 1710 |
| 398 | Ga0068865_100677285 | 3300006881 | Bacteria | 879 |
| 399 | Ga0075436_100091120 | 3300006914 | Bacteria | 2119 |
| 400 | Ga0075436_100091462 | 3300006914 | Bacteria | 2115 |
| 401 | Ga0075436_100366095 | 3300006914 | Bacteria | 1041 |
| 402 | Ga0075436_100860353 | 3300006914 | Bacteria | 677 |
| 403 | Ga0097620_100072279 | 3300006931 | Bacteria | 3486 |
| 404 | Ga0097620_100082514 | 3300006931 | Bacteria | 3257 |
| 405 | Ga0097620_100233856 | 3300006931 | Bacteria | 1926 |
| 406 | Ga0097620_100904536 | 3300006931 | Bacteria | 967 |
| 407 | Ga0097620_102552525 | 3300006931 | Unclassified | 562 |
| 408 | Ga0075435_101031404 | 3300007076 | Bacteria | 718 |
| 409 | Ga0075435_101909289 | 3300007076 | Unclassified | 521 |
| 410 | Ga0099794_10096584 | 3300007265 | Bacteria | 1471 |
| 411 | Ga0099795_10029274 | 3300007788 | Bacteria | 1881 |
| 412 | Ga0099795_10068657 | 3300007788 | Unclassified | 1332 |
| 413 | Ga0099795_10133261 | 3300007788 | Unclassified | 1004 |
| 414 | Ga0099795_10290377 | 3300007788 | Bacteria | 716 |
| 415 | Ga0105250_10059622 | 3300009092 | Bacteria | 1533 |
| 416 | Ga0105250_10090811 | 3300009092 | Bacteria | 1242 |
| 417 | Ga0105240_10011052 | 3300009093 | Bacteria | 12622 |
| 418 | Ga0105240_10017920 | 3300009093 | Bacteria | 9525 |
| 419 | Ga0105240_10057321 | 3300009093 | Bacteria | 4868 |
| 420 | Ga0105240_10108242 | 3300009093 | Bacteria | 3368 |
| 421 | Ga0105240_10203049 | 3300009093 | Bacteria | 2322 |
| 422 | Ga0105240_10203311 | 3300009093 | Bacteria | 2320 |
| 423 | Ga0105240_10227639 | 3300009093 | Bacteria | 2168 |
| 424 | Ga0105240_10280119 | 3300009093 | Bacteria | 1916 |
| 425 | Ga0105240_10387689 | 3300009093 | Bacteria | 1577 |
| 426 | Ga0105240_10425086 | 3300009093 | Bacteria | 1492 |
| 427 | Ga0105240_10693976 | 3300009093 | Unclassified | 1112 |
| 428 | Ga0105240_10741823 | 3300009093 | Bacteria | 1068 |
| 429 | Ga0105240_10772516 | 3300009093 | Bacteria | 1043 |
| 430 | Ga0111539_13422582 | 3300009094 | Unclassified | 510 |
| 431 | Ga0105245_10004851 | 3300009098 | Bacteria | 11845 |
| 432 | Ga0105245_10009762 | 3300009098 | Bacteria | 8364 |
| 433 | Ga0105245_10016455 | 3300009098 | Bacteria | 6452 |
| 434 | Ga0105245_10020232 | 3300009098 | Bacteria | 5834 |
| 435 | Ga0105245_10186384 | 3300009098 | Bacteria | 1985 |
| 436 | Ga0105245_10351218 | 3300009098 | Bacteria | 1461 |
| 437 | Ga0105247_10005153 | 3300009101 | Bacteria | 8267 |
| 438 | Ga0105247_10113834 | 3300009101 | Unclassified | 1744 |
| 439 | Ga0105247_10117294 | 3300009101 | Bacteria | 1720 |
| 440 | Ga0105247_10312901 | 3300009101 | Bacteria | 1093 |
| 441 | Ga0105247_10718445 | 3300009101 | Bacteria | 754 |
| 442 | Ga0114129_10134956 | 3300009147 | Bacteria | 3386 |
| 443 | Ga0105243_10010844 | 3300009148 | Bacteria | 6894 |
| 444 | Ga0105243_10827306 | 3300009148 | Bacteria | 915 |
| 445 | Ga0105241_10014792 | 3300009174 | Bacteria | 5712 |
| 446 | Ga0105241_10024356 | 3300009174 | Bacteria | 4494 |
| 447 | Ga0105241_10052926 | 3300009174 | Bacteria | 3102 |
| 448 | Ga0105241_10103390 | 3300009174 | Bacteria | 2268 |
| 449 | Ga0105241_10169467 | 3300009174 | Unclassified | 1802 |
| 450 | Ga0105241_10392461 | 3300009174 | Bacteria | 1215 |
| 451 | Ga0105241_10921061 | 3300009174 | Bacteria | 813 |
| 452 | Ga0105241_10981569 | 3300009174 | Unclassified | 789 |
| 453 | Ga0105241_11112823 | 3300009174 | Bacteria | 744 |
| 454 | Ga0105241_11313187 | 3300009174 | Bacteria | 689 |
| 455 | Ga0105242_10014914 | 3300009176 | Bacteria | 6024 |
| 456 | Ga0105242_10051360 | 3300009176 | Bacteria | 3360 |
| 457 | Ga0105242_10085880 | 3300009176 | Bacteria | 2639 |
| 458 | Ga0105242_10183599 | 3300009176 | Unclassified | 1847 |
| 459 | Ga0105242_10302212 | 3300009176 | Bacteria | 1461 |
| 460 | Ga0105242_11020491 | 3300009176 | Bacteria | 836 |
| 461 | Ga0105248_10006030 | 3300009177 | Bacteria | 13305 |
| 462 | Ga0105248_10022462 | 3300009177 | Bacteria | 6997 |
| 463 | Ga0105248_10033924 | 3300009177 | Bacteria | 5704 |
| 464 | Ga0105248_10040691 | 3300009177 | Bacteria | 5210 |
| 465 | Ga0105248_10046669 | 3300009177 | Bacteria | 4856 |
| 466 | Ga0105248_10099568 | 3300009177 | Bacteria | 3276 |
| 467 | Ga0105248_10653666 | 3300009177 | Bacteria | 1186 |
| 468 | Ga0105248_10960232 | 3300009177 | Unclassified | 965 |
| 469 | Ga0105237_10145036 | 3300009545 | Unclassified | 2369 |
| 470 | Ga0105237_10185600 | 3300009545 | Bacteria | 2080 |
| 471 | Ga0105237_10216712 | 3300009545 | Bacteria | 1914 |
| 472 | Ga0105237_10238627 | 3300009545 | Unclassified | 1819 |
| 473 | Ga0105237_10442818 | 3300009545 | Bacteria | 1305 |
| 474 | Ga0105237_10486380 | 3300009545 | Bacteria | 1240 |
| 475 | Ga0105237_10493746 | 3300009545 | Bacteria | 1231 |
| 476 | Ga0105237_10574824 | 3300009545 | Unclassified | 1134 |
| 477 | Ga0105237_10640727 | 3300009545 | Bacteria | 1069 |
| 478 | Ga0105237_10668843 | 3300009545 | Bacteria | 1045 |
| 479 | Ga0105237_10826068 | 3300009545 | Bacteria | 933 |
| 480 | Ga0105237_10888205 | 3300009545 | Bacteria | 898 |
| 481 | Ga0105238_10069773 | 3300009551 | Bacteria | 3515 |
| 482 | Ga0105238_10159725 | 3300009551 | Bacteria | 2229 |
| 483 | Ga0105238_10160120 | 3300009551 | Bacteria | 2226 |
| 484 | Ga0105238_10250500 | 3300009551 | Bacteria | 1749 |
| 485 | Ga0105238_11537681 | 3300009551 | Unclassified | 695 |
| 486 | Ga0105238_12789853 | 3300009551 | Unclassified | 525 |
| 487 | Ga0105249_10006219 | 3300009553 | Bacteria | 10366 |
| 488 | Ga0105249_10089016 | 3300009553 | Bacteria | 2884 |
| 489 | Ga0099796_10083568 | 3300010159 | Bacteria | 1175 |
| 490 | Ga0105239_10015139 | 3300010375 | Bacteria | 8548 |
| 491 | Ga0105239_10117996 | 3300010375 | Bacteria | 2945 |
| 492 | Ga0105239_10121809 | 3300010375 | Bacteria | 2897 |
| 493 | Ga0105239_10125781 | 3300010375 | Bacteria | 2849 |
| 494 | Ga0105239_10146891 | 3300010375 | Bacteria | 2630 |
| 495 | Ga0105239_10209637 | 3300010375 | Bacteria | 2184 |
| 496 | Ga0105239_10283736 | 3300010375 | Bacteria | 1864 |
| 497 | Ga0105239_10587043 | 3300010375 | Bacteria | 1270 |
| 498 | Ga0105239_10715296 | 3300010375 | Bacteria | 1145 |
| 499 | Ga0105239_10799726 | 3300010375 | Bacteria | 1080 |
| 500 | Ga0105239_10920790 | 3300010375 | Unclassified | 1004 |
| 501 | Ga0105239_11006269 | 3300010375 | Bacteria | 958 |
| 502 | Ga0105246_10011057 | 3300011119 | Bacteria | 5592 |
| 503 | Ga0105246_10149635 | 3300011119 | Bacteria | 1765 |
| 504 | Ga0157373_10018541 | 3300013100 | Bacteria | 5064 |
| 505 | Ga0157373_10022240 | 3300013100 | Bacteria | 4601 |
| 506 | Ga0157373_10124675 | 3300013100 | Unclassified | 1811 |
| 507 | Ga0157373_10202892 | 3300013100 | Bacteria | 1398 |
| 508 | Ga0157373_10331298 | 3300013100 | Unclassified | 1084 |
| 509 | Ga0157371_10044943 | 3300013102 | Bacteria | 3144 |
| 510 | Ga0157371_10153483 | 3300013102 | Bacteria | 1643 |
| 511 | Ga0157370_10055091 | 3300013104 | Bacteria | 3790 |
| 512 | Ga0157370_10058746 | 3300013104 | Bacteria | 3655 |
| 513 | Ga0157370_10175265 | 3300013104 | Bacteria | 1993 |
| 514 | Ga0157370_10183810 | 3300013104 | Bacteria | 1941 |
| 515 | Ga0157370_10512389 | 3300013104 | Bacteria | 1101 |
| 516 | Ga0157370_10541511 | 3300013104 | Bacteria | 1067 |
| 517 | Ga0157369_10000707 | 3300013105 | Bacteria | 42987 |
| 518 | Ga0157369_10017834 | 3300013105 | Bacteria | 7969 |
| 519 | Ga0157369_10056193 | 3300013105 | Unclassified | 4248 |
| 520 | Ga0157369_10084664 | 3300013105 | Bacteria | 3389 |
| 521 | Ga0157369_10103348 | 3300013105 | Bacteria | 3035 |
| 522 | Ga0157369_10118530 | 3300013105 | Bacteria | 2810 |
| 523 | Ga0157369_10174208 | 3300013105 | Unclassified | 2265 |
| 524 | Ga0157369_10188711 | 3300013105 | Bacteria | 2166 |
| 525 | Ga0157369_10229963 | 3300013105 | Bacteria | 1939 |
| 526 | Ga0157369_10496976 | 3300013105 | Unclassified | 1262 |
| 527 | Ga0157369_10511548 | 3300013105 | Bacteria | 1242 |
| 528 | Ga0157374_10003832 | 3300013296 | Bacteria | 12626 |
| 529 | Ga0157374_10010610 | 3300013296 | Bacteria | 7932 |
| 530 | Ga0157374_10019807 | 3300013296 | Bacteria | 5963 |
| 531 | Ga0157374_10024541 | 3300013296 | Bacteria | 5407 |
| 532 | Ga0157374_10037327 | 3300013296 | Bacteria | 4459 |
| 533 | Ga0157374_10049414 | 3300013296 | Bacteria | 3906 |
| 534 | Ga0157374_10057314 | 3300013296 | Bacteria | 3638 |
| 535 | Ga0157374_10545002 | 3300013296 | Bacteria | 1167 |
| 536 | Ga0157374_10578746 | 3300013296 | Bacteria | 1132 |
| 537 | Ga0157374_10598276 | 3300013296 | Bacteria | 1113 |
| 538 | Ga0157378_10003236 | 3300013297 | Bacteria | 14493 |
| 539 | Ga0157378_10040674 | 3300013297 | Bacteria | 4123 |
| 540 | Ga0157378_10095198 | 3300013297 | Bacteria | 2712 |
| 541 | Ga0157378_10097524 | 3300013297 | Bacteria | 2679 |
| 542 | Ga0157378_10108002 | 3300013297 | Bacteria | 2547 |
| 543 | Ga0157378_10146829 | 3300013297 | Bacteria | 2194 |
| 544 | Ga0157378_11531095 | 3300013297 | Bacteria | 712 |
| 545 | Ga0157378_12540754 | 3300013297 | Unclassified | 564 |
| 546 | Ga0163162_10002584 | 3300013306 | Bacteria | 17140 |
| 547 | Ga0163162_10057165 | 3300013306 | Bacteria | 3929 |
| 548 | Ga0163162_10087454 | 3300013306 | Bacteria | 3195 |
| 549 | Ga0163162_10146213 | 3300013306 | Bacteria | 2480 |
| 550 | Ga0163162_10173768 | 3300013306 | Bacteria | 2279 |
| 551 | Ga0163162_12037148 | 3300013306 | Bacteria | 658 |
| 552 | Ga0157372_10024072 | 3300013307 | Bacteria | 6607 |
| 553 | Ga0157372_10035556 | 3300013307 | Bacteria | 5485 |
| 554 | Ga0157372_10071311 | 3300013307 | Bacteria | 3912 |
| 555 | Ga0157372_10094877 | 3300013307 | Bacteria | 3398 |
| 556 | Ga0157372_10135827 | 3300013307 | Bacteria | 2832 |
| 557 | Ga0157372_10301875 | 3300013307 | Bacteria | 1862 |
| 558 | Ga0157372_10426664 | 3300013307 | Bacteria | 1545 |
| 559 | Ga0157372_12091759 | 3300013307 | Bacteria | 650 |
| 560 | Ga0157372_12165411 | 3300013307 | Bacteria | 639 |
| 561 | Ga0157375_10057643 | 3300013308 | Bacteria | 3840 |
| 562 | Ga0157375_10059700 | 3300013308 | Bacteria | 3779 |
| 563 | Ga0157375_10150332 | 3300013308 | Bacteria | 2463 |
| 564 | Ga0157375_10890963 | 3300013308 | Unclassified | 1034 |
| 565 | Ga0157375_11813944 | 3300013308 | Bacteria | 723 |
| 566 | Ga0163163_10004284 | 3300014325 | Bacteria | 12156 |
| 567 | Ga0163163_10025301 | 3300014325 | Bacteria | 5659 |
| 568 | Ga0163163_10066872 | 3300014325 | Bacteria | 3571 |
| 569 | Ga0163163_10137382 | 3300014325 | Bacteria | 2486 |
| 570 | Ga0163163_10158114 | 3300014325 | Unclassified | 2311 |
| 571 | Ga0163163_10571754 | 3300014325 | Bacteria | 1193 |
| 572 | Ga0157380_10097667 | 3300014326 | Bacteria | 2438 |
| 573 | Ga0182008_10014485 | 3300014497 | Bacteria | 4128 |
| 574 | Ga0182008_10105273 | 3300014497 | Bacteria | 1395 |
| 575 | Ga0157377_10005240 | 3300014745 | Bacteria | 6071 |
| 576 | Ga0157379_10004435 | 3300014968 | Bacteria | 12032 |
| 577 | Ga0157379_10096867 | 3300014968 | Bacteria | 2648 |
| 578 | Ga0157379_10100573 | 3300014968 | Bacteria | 2595 |
| 579 | Ga0157379_10111829 | 3300014968 | Bacteria | 2454 |
| 580 | Ga0157379_10488929 | 3300014968 | Bacteria | 1140 |
| 581 | Ga0157379_10778526 | 3300014968 | Bacteria | 902 |
| 582 | Ga0157376_10014350 | 3300014969 | Bacteria | 5944 |
| 583 | Ga0157376_10043385 | 3300014969 | Bacteria | 3691 |
| 584 | Ga0157376_10093650 | 3300014969 | Bacteria | 2608 |
| 585 | Ga0157376_10116574 | 3300014969 | Bacteria | 2360 |
| 586 | Ga0157376_10145929 | 3300014969 | Bacteria | 2128 |
| 587 | Ga0157376_10254571 | 3300014969 | Bacteria | 1642 |
| 588 | Ga0157376_10277376 | 3300014969 | Bacteria | 1577 |
| 589 | Ga0157376_10302623 | 3300014969 | Unclassified | 1514 |
| 590 | Ga0157376_10490811 | 3300014969 | Bacteria | 1205 |
| 591 | Ga0157376_10646919 | 3300014969 | Bacteria | 1057 |
| 592 | Ga0182006_1032101 | 3300015261 | Unclassified | 2112 |
| 593 | Ga0182006_1053815 | 3300015261 | Bacteria | 1541 |
| 594 | Ga0182007_10001865 | 3300015262 | Bacteria | 10993 |
| 595 | Ga0182007_10049641 | 3300015262 | Unclassified | 1386 |
| 596 | Ga0182007_10077491 | 3300015262 | Unclassified | 1090 |
| 597 | Ga0163161_10009823 | 3300017792 | Bacteria | 6627 |
| 598 | Ga0163161_11275062 | 3300017792 | Bacteria | 638 |
| 599 | Ga0206356_10210281 | 3300020070 | Bacteria | 914 |
| 600 | Ga0206356_10311722 | 3300020070 | Unclassified | 638 |
| 601 | Ga0206356_10438923 | 3300020070 | Bacteria | 1065 |
| 602 | Ga0206356_10612756 | 3300020070 | Unclassified | 667 |
| 603 | Ga0206355_1464592 | 3300020076 | Bacteria | 1235 |
| 604 | Ga0206352_10191777 | 3300020078 | Bacteria | 685 |
| 605 | Ga0206352_10634928 | 3300020078 | Bacteria | 1118 |
| 606 | Ga0206352_10695361 | 3300020078 | Bacteria | 1105 |
| 607 | Ga0206350_10302303 | 3300020080 | Unclassified | 1331 |
| 608 | Ga0206350_10697226 | 3300020080 | Bacteria | 547 |
| 609 | Ga0206350_11198039 | 3300020080 | Bacteria | 549 |
| 610 | Ga0206354_10056872 | 3300020081 | Bacteria | 1067 |
| 611 | Ga0206354_11350274 | 3300020081 | Unclassified | 657 |
| 612 | Ga0206353_10355093 | 3300020082 | Unclassified | 856 |
| 613 | Ga0154015_1659564 | 3300020610 | Bacteria | 1186 |
| 614 | Ga0213873_10080339 | 3300021358 | Bacteria | 912 |
| 615 | Ga0213873_10148211 | 3300021358 | Bacteria | 705 |
| 616 | Ga0213874_10077321 | 3300021377 | Bacteria | 1072 |
| 617 | Ga0224712_10564322 | 3300022467 | Bacteria | 554 |
| 618 | Ga0224712_10606936 | 3300022467 | Unclassified | 534 |
| 619 | Ga0224570_100774 | 3300022730 | Bacteria | 2545 |
| 620 | Ga0224569_100532 | 3300022732 | Bacteria | 3275 |
| 621 | Ga0224569_101700 | 3300022732 | Bacteria | 1828 |
| 622 | Ga0224571_103364 | 3300022734 | Bacteria | 1030 |
| 623 | Ga0224572_1002657 | 3300024225 | Bacteria | 2926 |
| 624 | Ga0228598_1000510 | 3300024227 | Bacteria | 8048 |
| 625 | Ga0228598_1004675 | 3300024227 | Bacteria | 2892 |
| 626 | Ga0228598_1007492 | 3300024227 | Bacteria | 2220 |
| 627 | Ga0228598_1030081 | 3300024227 | Bacteria | 1068 |
| 628 | Ga0207697_10087108 | 3300025315 | Bacteria | 1321 |
| 629 | Ga0207656_10015304 | 3300025321 | Bacteria | 2967 |
| 630 | Ga0207656_10082347 | 3300025321 | Bacteria | 1448 |
| 631 | Ga0207656_10096892 | 3300025321 | Bacteria | 1347 |
| 632 | Ga0207682_10163094 | 3300025893 | Bacteria | 1011 |
| 633 | Ga0207692_10005710 | 3300025898 | Bacteria | 5000 |
| 634 | Ga0207692_10042774 | 3300025898 | Bacteria | 2251 |
| 635 | Ga0207692_10117150 | 3300025898 | Bacteria | 1486 |
| 636 | Ga0207692_10123064 | 3300025898 | Bacteria | 1455 |
| 637 | Ga0207692_10196084 | 3300025898 | Bacteria | 1184 |
| 638 | Ga0207692_10220407 | 3300025898 | Bacteria | 1124 |
| 639 | Ga0207692_10240395 | 3300025898 | Unclassified | 1081 |
| 640 | Ga0207692_10349459 | 3300025898 | Unclassified | 911 |
| 641 | Ga0207692_10362334 | 3300025898 | Bacteria | 896 |
| 642 | Ga0207692_10567827 | 3300025898 | Bacteria | 726 |
| 643 | Ga0207642_10112666 | 3300025899 | Bacteria | 1388 |
| 644 | Ga0207642_10212168 | 3300025899 | Unclassified | 1076 |
| 645 | Ga0207642_10285457 | 3300025899 | Bacteria | 951 |
| 646 | Ga0207688_10042678 | 3300025901 | Bacteria | 2525 |
| 647 | Ga0207680_10011489 | 3300025903 | Bacteria | 4477 |
| 648 | Ga0207680_10024741 | 3300025903 | Bacteria | 3300 |
| 649 | Ga0207680_10303359 | 3300025903 | Bacteria | 1113 |
| 650 | Ga0207647_10001878 | 3300025904 | Bacteria | 16087 |
| 651 | Ga0207647_10003039 | 3300025904 | Bacteria | 12616 |
| 652 | Ga0207647_10196899 | 3300025904 | Unclassified | 1166 |
| 653 | Ga0207647_10268662 | 3300025904 | Bacteria | 975 |
| 654 | Ga0207685_10014444 | 3300025905 | Unclassified | 2473 |
| 655 | Ga0207685_10172731 | 3300025905 | Unclassified | 996 |
| 656 | Ga0207685_10195996 | 3300025905 | Unclassified | 946 |
| 657 | Ga0207685_10264438 | 3300025905 | Bacteria | 837 |
| 658 | Ga0207699_10000600 | 3300025906 | Bacteria | 17723 |
| 659 | Ga0207699_10011735 | 3300025906 | Unclassified | 4435 |
| 660 | Ga0207699_10016494 | 3300025906 | Unclassified | 3866 |
| 661 | Ga0207699_10021063 | 3300025906 | Bacteria | 3506 |
| 662 | Ga0207699_10039071 | 3300025906 | Bacteria | 2724 |
| 663 | Ga0207699_10070588 | 3300025906 | Bacteria | 2133 |
| 664 | Ga0207699_10152092 | 3300025906 | Bacteria | 1532 |
| 665 | Ga0207699_10163152 | 3300025906 | Bacteria | 1485 |
| 666 | Ga0207699_10222492 | 3300025906 | Bacteria | 1289 |
| 667 | Ga0207699_10268950 | 3300025906 | Bacteria | 1181 |
| 668 | Ga0207699_10298153 | 3300025906 | Bacteria | 1125 |
| 669 | Ga0207699_10301622 | 3300025906 | Bacteria | 1119 |
| 670 | Ga0207699_10667079 | 3300025906 | Bacteria | 760 |
| 671 | Ga0207699_11222621 | 3300025906 | Unclassified | 556 |
| 672 | Ga0207645_10000371 | 3300025907 | Bacteria | 37175 |
| 673 | Ga0207645_10004258 | 3300025907 | Bacteria | 10627 |
| 674 | Ga0207643_10000668 | 3300025908 | Bacteria | 21347 |
| 675 | Ga0207643_10252787 | 3300025908 | Unclassified | 1086 |
| 676 | Ga0207705_10123716 | 3300025909 | Bacteria | 1921 |
| 677 | Ga0207705_10493707 | 3300025909 | Bacteria | 950 |
| 678 | Ga0207684_10001112 | 3300025910 | Bacteria | 30047 |
| 679 | Ga0207684_10002188 | 3300025910 | Bacteria | 19999 |
| 680 | Ga0207684_10014160 | 3300025910 | Bacteria | 6884 |
| 681 | Ga0207684_10039463 | 3300025910 | Bacteria | 4005 |
| 682 | Ga0207684_10079990 | 3300025910 | Bacteria | 2780 |
| 683 | Ga0207684_10144360 | 3300025910 | Bacteria | 2047 |
| 684 | Ga0207684_10463773 | 3300025910 | Bacteria | 1087 |
| 685 | Ga0207654_10015891 | 3300025911 | Bacteria | 3914 |
| 686 | Ga0207654_10032488 | 3300025911 | Bacteria | 2885 |
| 687 | Ga0207654_10074199 | 3300025911 | Bacteria | 2030 |
| 688 | Ga0207654_10250040 | 3300025911 | Bacteria | 1188 |
| 689 | Ga0207654_10533990 | 3300025911 | Bacteria | 832 |
| 690 | Ga0207654_10896892 | 3300025911 | Bacteria | 643 |
| 691 | Ga0207654_11181100 | 3300025911 | Bacteria | 558 |
| 692 | Ga0207707_10009572 | 3300025912 | Bacteria | 8406 |
| 693 | Ga0207707_10032167 | 3300025912 | Bacteria | 4592 |
| 694 | Ga0207707_10034370 | 3300025912 | Bacteria | 4435 |
| 695 | Ga0207707_10187702 | 3300025912 | Bacteria | 1804 |
| 696 | Ga0207707_10194395 | 3300025912 | Bacteria | 1770 |
| 697 | Ga0207707_10283226 | 3300025912 | Bacteria | 1435 |
| 698 | Ga0207707_10380984 | 3300025912 | Bacteria | 1212 |
| 699 | Ga0207707_10735244 | 3300025912 | Bacteria | 826 |
| 700 | Ga0207707_10823231 | 3300025912 | Unclassified | 772 |
| 701 | Ga0207695_10007947 | 3300025913 | Bacteria | 13381 |
| 702 | Ga0207695_10051286 | 3300025913 | Bacteria | 4334 |
| 703 | Ga0207695_10062042 | 3300025913 | Bacteria | 3861 |
| 704 | Ga0207695_10078217 | 3300025913 | Bacteria | 3356 |
| 705 | Ga0207695_10122567 | 3300025913 | Bacteria | 2566 |
| 706 | Ga0207695_10129257 | 3300025913 | Bacteria | 2485 |
| 707 | Ga0207695_10172154 | 3300025913 | Bacteria | 2090 |
| 708 | Ga0207695_10190541 | 3300025913 | Unclassified | 1968 |
| 709 | Ga0207695_10200176 | 3300025913 | Unclassified | 1911 |
| 710 | Ga0207695_10508985 | 3300025913 | Unclassified | 1086 |
| 711 | Ga0207671_10078488 | 3300025914 | Bacteria | 2473 |
| 712 | Ga0207671_10125848 | 3300025914 | Bacteria | 1963 |
| 713 | Ga0207671_10279119 | 3300025914 | Bacteria | 1317 |
| 714 | Ga0207671_10298020 | 3300025914 | Bacteria | 1273 |
| 715 | Ga0207671_10413562 | 3300025914 | Bacteria | 1073 |
| 716 | Ga0207671_10421326 | 3300025914 | Bacteria | 1062 |
| 717 | Ga0207671_10877717 | 3300025914 | Bacteria | 710 |
| 718 | Ga0207671_10975400 | 3300025914 | Unclassified | 668 |
| 719 | Ga0207671_11184555 | 3300025914 | Unclassified | 598 |
| 720 | Ga0207693_10000203 | 3300025915 | Bacteria | 54373 |
| 721 | Ga0207693_10000260 | 3300025915 | Bacteria | 48765 |
| 722 | Ga0207693_10000719 | 3300025915 | Bacteria | 29815 |
| 723 | Ga0207693_10001323 | 3300025915 | Bacteria | 21964 |
| 724 | Ga0207693_10002101 | 3300025915 | Bacteria | 17385 |
| 725 | Ga0207693_10006854 | 3300025915 | Bacteria | 9406 |
| 726 | Ga0207693_10018421 | 3300025915 | Bacteria | 5562 |
| 727 | Ga0207693_10164348 | 3300025915 | Bacteria | 1747 |
| 728 | Ga0207693_10262763 | 3300025915 | Bacteria | 1353 |
| 729 | Ga0207693_10287167 | 3300025915 | Bacteria | 1289 |
| 730 | Ga0207693_10323422 | 3300025915 | Bacteria | 1207 |
| 731 | Ga0207693_10393245 | 3300025915 | Bacteria | 1084 |
| 732 | Ga0207693_10495128 | 3300025915 | Bacteria | 954 |
| 733 | Ga0207693_10674661 | 3300025915 | Unclassified | 802 |
| 734 | Ga0207693_10735207 | 3300025915 | Unclassified | 763 |
| 735 | Ga0207663_10000234 | 3300025916 | Bacteria | 24595 |
| 736 | Ga0207663_10009111 | 3300025916 | Bacteria | 5232 |
| 737 | Ga0207663_10027040 | 3300025916 | Bacteria | 3338 |
| 738 | Ga0207663_10046178 | 3300025916 | Bacteria | 2682 |
| 739 | Ga0207663_10058176 | 3300025916 | Bacteria | 2438 |
| 740 | Ga0207663_10221098 | 3300025916 | Bacteria | 1378 |
| 741 | Ga0207663_10314371 | 3300025916 | Bacteria | 1175 |
| 742 | Ga0207663_10491669 | 3300025916 | Bacteria | 952 |
| 743 | Ga0207663_10616492 | 3300025916 | Unclassified | 854 |
| 744 | Ga0207663_10629776 | 3300025916 | Bacteria | 845 |
| 745 | Ga0207663_10709639 | 3300025916 | Bacteria | 797 |
| 746 | Ga0207663_10966252 | 3300025916 | Unclassified | 683 |
| 747 | Ga0207660_10005436 | 3300025917 | Bacteria | 8265 |
| 748 | Ga0207660_10084603 | 3300025917 | Unclassified | 2338 |
| 749 | Ga0207660_10158636 | 3300025917 | Bacteria | 1743 |
| 750 | Ga0207660_10217538 | 3300025917 | Unclassified | 1498 |
| 751 | Ga0207660_10375660 | 3300025917 | Bacteria | 1142 |
| 752 | Ga0207660_10745639 | 3300025917 | Unclassified | 799 |
| 753 | Ga0207657_10001697 | 3300025919 | Bacteria | 23757 |
| 754 | Ga0207657_10001941 | 3300025919 | Bacteria | 22339 |
| 755 | Ga0207657_10002583 | 3300025919 | Bacteria | 19589 |
| 756 | Ga0207657_10006727 | 3300025919 | Bacteria | 11870 |
| 757 | Ga0207657_10152903 | 3300025919 | Bacteria | 1878 |
| 758 | Ga0207657_10477825 | 3300025919 | Bacteria | 977 |
| 759 | Ga0207657_10637885 | 3300025919 | Bacteria | 830 |
| 760 | Ga0207649_10001595 | 3300025920 | Bacteria | 13187 |
| 761 | Ga0207649_10024357 | 3300025920 | Bacteria | 3517 |
| 762 | Ga0207649_10026399 | 3300025920 | Bacteria | 3397 |
| 763 | Ga0207652_10008095 | 3300025921 | Bacteria | 8439 |
| 764 | Ga0207652_10111678 | 3300025921 | Bacteria | 2424 |
| 765 | Ga0207652_10158582 | 3300025921 | Bacteria | 2028 |
| 766 | Ga0207652_10165821 | 3300025921 | Bacteria | 1981 |
| 767 | Ga0207652_10185006 | 3300025921 | Bacteria | 1873 |
| 768 | Ga0207652_10208087 | 3300025921 | Bacteria | 1761 |
| 769 | Ga0207652_10291838 | 3300025921 | Bacteria | 1471 |
| 770 | Ga0207652_10356950 | 3300025921 | Unclassified | 1319 |
| 771 | Ga0207652_10868872 | 3300025921 | Bacteria | 798 |
| 772 | Ga0207646_10002802 | 3300025922 | Bacteria | 20298 |
| 773 | Ga0207646_10003770 | 3300025922 | Bacteria | 16885 |
| 774 | Ga0207646_10106496 | 3300025922 | Bacteria | 2515 |
| 775 | Ga0207646_10172894 | 3300025922 | Bacteria | 1951 |
| 776 | Ga0207646_10219502 | 3300025922 | Bacteria | 1718 |
| 777 | Ga0207646_10961150 | 3300025922 | Unclassified | 756 |
| 778 | Ga0207681_10411228 | 3300025923 | Bacteria | 1094 |
| 779 | Ga0207694_10047768 | 3300025924 | Bacteria | 3310 |
| 780 | Ga0207694_10156697 | 3300025924 | Bacteria | 1837 |
| 781 | Ga0207694_10234067 | 3300025924 | Bacteria | 1500 |
| 782 | Ga0207694_10361321 | 3300025924 | Unclassified | 1203 |
| 783 | Ga0207694_10817306 | 3300025924 | Bacteria | 787 |
| 784 | Ga0207694_11702598 | 3300025924 | Bacteria | 531 |
| 785 | Ga0207650_10000040 | 3300025925 | Bacteria | 204095 |
| 786 | Ga0207659_10060149 | 3300025926 | Bacteria | 2733 |
| 787 | Ga0207659_10525363 | 3300025926 | Bacteria | 1004 |
| 788 | Ga0207687_10003152 | 3300025927 | Bacteria | 11188 |
| 789 | Ga0207687_10006117 | 3300025927 | Bacteria | 7966 |
| 790 | Ga0207687_10009144 | 3300025927 | Bacteria | 6479 |
| 791 | Ga0207687_10031507 | 3300025927 | Bacteria | 3584 |
| 792 | Ga0207687_10575921 | 3300025927 | Bacteria | 947 |
| 793 | Ga0207687_10580749 | 3300025927 | Bacteria | 943 |
| 794 | Ga0207687_11208949 | 3300025927 | Bacteria | 649 |
| 795 | Ga0207700_10000163 | 3300025928 | Bacteria | 39724 |
| 796 | Ga0207700_10000928 | 3300025928 | Bacteria | 16844 |
| 797 | Ga0207700_10001536 | 3300025928 | Bacteria | 13075 |
| 798 | Ga0207700_10017211 | 3300025928 | Bacteria | 4824 |
| 799 | Ga0207700_10076594 | 3300025928 | Bacteria | 2596 |
| 800 | Ga0207700_10128542 | 3300025928 | Bacteria | 2065 |
| 801 | Ga0207700_10130640 | 3300025928 | Bacteria | 2050 |
| 802 | Ga0207700_10154978 | 3300025928 | Bacteria | 1897 |
| 803 | Ga0207700_10234189 | 3300025928 | Bacteria | 1563 |
| 804 | Ga0207700_10338117 | 3300025928 | Bacteria | 1308 |
| 805 | Ga0207700_10372437 | 3300025928 | Bacteria | 1247 |
| 806 | Ga0207700_10406223 | 3300025928 | Bacteria | 1194 |
| 807 | Ga0207700_10415722 | 3300025928 | Bacteria | 1180 |
| 808 | Ga0207700_10474508 | 3300025928 | Bacteria | 1105 |
| 809 | Ga0207700_10727142 | 3300025928 | Bacteria | 887 |
| 810 | Ga0207700_10775914 | 3300025928 | Unclassified | 857 |
| 811 | Ga0207700_11120305 | 3300025928 | Bacteria | 703 |
| 812 | Ga0207700_11170893 | 3300025928 | Bacteria | 687 |
| 813 | Ga0207664_10000017 | 3300025929 | Bacteria | 230967 |
| 814 | Ga0207664_10021558 | 3300025929 | Bacteria | 4794 |
| 815 | Ga0207664_10023722 | 3300025929 | Bacteria | 4601 |
| 816 | Ga0207664_10088175 | 3300025929 | Unclassified | 2538 |
| 817 | Ga0207664_10220311 | 3300025929 | Bacteria | 1645 |
| 818 | Ga0207664_10702953 | 3300025929 | Bacteria | 909 |
| 819 | Ga0207664_10862307 | 3300025929 | Bacteria | 814 |
| 820 | Ga0207644_10061223 | 3300025931 | Bacteria | 2725 |
| 821 | Ga0207644_10187542 | 3300025931 | Bacteria | 1625 |
| 822 | Ga0207690_10007447 | 3300025932 | Bacteria | 6495 |
| 823 | Ga0207690_10056237 | 3300025932 | Bacteria | 2653 |
| 824 | Ga0207690_10152711 | 3300025932 | Unclassified | 1713 |
| 825 | Ga0207690_10225428 | 3300025932 | Unclassified | 1436 |
| 826 | Ga0207690_10346903 | 3300025932 | Unclassified | 1173 |
| 827 | Ga0207706_10000141 | 3300025933 | Bacteria | 78380 |
| 828 | Ga0207706_10000897 | 3300025933 | Bacteria | 30555 |
| 829 | Ga0207706_10089808 | 3300025933 | Bacteria | 2701 |
| 830 | Ga0207706_10653037 | 3300025933 | Bacteria | 901 |
| 831 | Ga0207686_10007765 | 3300025934 | Bacteria | 5782 |
| 832 | Ga0207686_10090253 | 3300025934 | Bacteria | 2021 |
| 833 | Ga0207686_10157415 | 3300025934 | Bacteria | 1589 |
| 834 | Ga0207686_10367499 | 3300025934 | Bacteria | 1087 |
| 835 | Ga0207686_10672185 | 3300025934 | Unclassified | 821 |
| 836 | Ga0207709_10228426 | 3300025935 | Bacteria | 1347 |
| 837 | Ga0207670_10011213 | 3300025936 | Bacteria | 5194 |
| 838 | Ga0207704_10028369 | 3300025938 | Bacteria | 3104 |
| 839 | Ga0207704_10272849 | 3300025938 | Bacteria | 1281 |
| 840 | Ga0207704_11032289 | 3300025938 | Bacteria | 696 |
| 841 | Ga0207665_10000357 | 3300025939 | Bacteria | 31691 |
| 842 | Ga0207665_10011158 | 3300025939 | Bacteria | 5895 |
| 843 | Ga0207665_10011331 | 3300025939 | Bacteria | 5854 |
| 844 | Ga0207665_10011722 | 3300025939 | Bacteria | 5759 |
| 845 | Ga0207665_10012249 | 3300025939 | Bacteria | 5631 |
| 846 | Ga0207665_10026163 | 3300025939 | Bacteria | 3851 |
| 847 | Ga0207665_10045668 | 3300025939 | Bacteria | 2933 |
| 848 | Ga0207665_10137426 | 3300025939 | Bacteria | 1740 |
| 849 | Ga0207665_10193781 | 3300025939 | Bacteria | 1478 |
| 850 | Ga0207665_10196551 | 3300025939 | Bacteria | 1468 |
| 851 | Ga0207665_10448598 | 3300025939 | Bacteria | 990 |
| 852 | Ga0207665_10449845 | 3300025939 | Bacteria | 988 |
| 853 | Ga0207665_10492134 | 3300025939 | Bacteria | 946 |
| 854 | Ga0207665_10588600 | 3300025939 | Bacteria | 868 |
| 855 | Ga0207665_10619085 | 3300025939 | Bacteria | 846 |
| 856 | Ga0207665_10926786 | 3300025939 | Unclassified | 691 |
| 857 | Ga0207691_10000120 | 3300025940 | Bacteria | 70657 |
| 858 | Ga0207691_10181062 | 3300025940 | Bacteria | 1841 |
| 859 | Ga0207711_10000977 | 3300025941 | Bacteria | 27397 |
| 860 | Ga0207711_10032693 | 3300025941 | Bacteria | 4399 |
| 861 | Ga0207711_10035011 | 3300025941 | Bacteria | 4254 |
| 862 | Ga0207689_10000695 | 3300025942 | Bacteria | 32215 |
| 863 | Ga0207689_10005702 | 3300025942 | Bacteria | 11073 |
| 864 | Ga0207689_10052617 | 3300025942 | Bacteria | 3355 |
| 865 | Ga0207689_10128892 | 3300025942 | Bacteria | 2082 |
| 866 | Ga0207661_10000294 | 3300025944 | Bacteria | 31581 |
| 867 | Ga0207661_10105187 | 3300025944 | Bacteria | 2378 |
| 868 | Ga0207661_10618286 | 3300025944 | Unclassified | 995 |
| 869 | Ga0207679_10001510 | 3300025945 | Bacteria | 14548 |
| 870 | Ga0207679_10040950 | 3300025945 | Bacteria | 3319 |
| 871 | Ga0207679_10086298 | 3300025945 | Bacteria | 2413 |
| 872 | Ga0207667_10011908 | 3300025949 | Bacteria | 10073 |
| 873 | Ga0207667_10022056 | 3300025949 | Bacteria | 7045 |
| 874 | Ga0207667_10024637 | 3300025949 | Bacteria | 6602 |
| 875 | Ga0207667_10042168 | 3300025949 | Bacteria | 4852 |
| 876 | Ga0207667_10209440 | 3300025949 | Bacteria | 1998 |
| 877 | Ga0207667_10466625 | 3300025949 | Bacteria | 1282 |
| 878 | Ga0207667_10515822 | 3300025949 | Bacteria | 1211 |
| 879 | Ga0207667_11353029 | 3300025949 | Bacteria | 687 |
| 880 | Ga0207651_10005407 | 3300025960 | Bacteria | 6549 |
| 881 | Ga0207651_11234823 | 3300025960 | Unclassified | 671 |
| 882 | Ga0207651_11775657 | 3300025960 | Bacteria | 555 |
| 883 | Ga0207712_10007469 | 3300025961 | Bacteria | 6901 |
| 884 | Ga0207712_10473848 | 3300025961 | Bacteria | 1066 |
| 885 | Ga0207668_10045209 | 3300025972 | Bacteria | 3001 |
| 886 | Ga0207640_10000001 | 3300025981 | Bacteria | 628778 |
| 887 | Ga0207640_10053109 | 3300025981 | Bacteria | 2643 |
| 888 | Ga0207640_10078577 | 3300025981 | Bacteria | 2247 |
| 889 | Ga0207640_10715885 | 3300025981 | Bacteria | 860 |
| 890 | Ga0207658_10046062 | 3300025986 | Bacteria | 3182 |
| 891 | Ga0207658_10385906 | 3300025986 | Unclassified | 1228 |
| 892 | Ga0207677_10145690 | 3300026023 | Bacteria | 1819 |
| 893 | Ga0207677_10259758 | 3300026023 | Unclassified | 1415 |
| 894 | Ga0207677_10333278 | 3300026023 | Bacteria | 1265 |
| 895 | Ga0207677_10736755 | 3300026023 | Unclassified | 877 |
| 896 | Ga0207703_10008458 | 3300026035 | Bacteria | 8132 |
| 897 | Ga0207703_10113799 | 3300026035 | Bacteria | 2313 |
| 898 | Ga0207703_10114429 | 3300026035 | Bacteria | 2307 |
| 899 | Ga0207703_10404408 | 3300026035 | Bacteria | 1267 |
| 900 | Ga0207703_11111301 | 3300026035 | Bacteria | 759 |
| 901 | Ga0207703_12268601 | 3300026035 | Bacteria | 519 |
| 902 | Ga0207639_10000058 | 3300026041 | Bacteria | 108456 |
| 903 | Ga0207639_10043552 | 3300026041 | Bacteria | 3370 |
| 904 | Ga0207639_10133233 | 3300026041 | Bacteria | 2060 |
| 905 | Ga0207639_10204915 | 3300026041 | Bacteria | 1694 |
| 906 | Ga0207639_10228810 | 3300026041 | Bacteria | 1610 |
| 907 | Ga0207639_10741627 | 3300026041 | Bacteria | 913 |
| 908 | Ga0207678_10000058 | 3300026067 | Bacteria | 86018 |
| 909 | Ga0207678_10003304 | 3300026067 | Bacteria | 14535 |
| 910 | Ga0207678_10071953 | 3300026067 | Bacteria | 2963 |
| 911 | Ga0207678_10161249 | 3300026067 | Bacteria | 1915 |
| 912 | Ga0207678_11745337 | 3300026067 | Bacteria | 546 |
| 913 | Ga0207708_10392881 | 3300026075 | Bacteria | 1145 |
| 914 | Ga0207702_10002510 | 3300026078 | Bacteria | 17306 |
| 915 | Ga0207702_10047336 | 3300026078 | Bacteria | 3623 |
| 916 | Ga0207702_10233478 | 3300026078 | Bacteria | 1720 |
| 917 | Ga0207702_10373211 | 3300026078 | Bacteria | 1370 |
| 918 | Ga0207702_10436316 | 3300026078 | Bacteria | 1269 |
| 919 | Ga0207702_10442580 | 3300026078 | Bacteria | 1260 |
| 920 | Ga0207702_11316665 | 3300026078 | Unclassified | 716 |
| 921 | Ga0207702_11409470 | 3300026078 | Bacteria | 691 |
| 922 | Ga0207702_11434258 | 3300026078 | Bacteria | 684 |
| 923 | Ga0207702_12084793 | 3300026078 | Bacteria | 557 |
| 924 | Ga0207702_12523184 | 3300026078 | Unclassified | 500 |
| 925 | Ga0207641_10000009 | 3300026088 | Bacteria | 407901 |
| 926 | Ga0207641_10013093 | 3300026088 | Bacteria | 6803 |
| 927 | Ga0207641_10245806 | 3300026088 | Bacteria | 1669 |
| 928 | Ga0207641_10417081 | 3300026088 | Bacteria | 1292 |
| 929 | Ga0207641_10459540 | 3300026088 | Bacteria | 1231 |
| 930 | Ga0207648_10016140 | 3300026089 | Bacteria | 6838 |
| 931 | Ga0207648_10032780 | 3300026089 | Bacteria | 4584 |
| 932 | Ga0207648_10084326 | 3300026089 | Bacteria | 2771 |
| 933 | Ga0207648_10963456 | 3300026089 | Bacteria | 798 |
| 934 | Ga0207676_10000153 | 3300026095 | Bacteria | 60008 |
| 935 | Ga0207676_10008783 | 3300026095 | Bacteria | 7191 |
| 936 | Ga0207676_10963210 | 3300026095 | Bacteria | 839 |
| 937 | Ga0207674_10000010 | 3300026116 | Bacteria | 196710 |
| 938 | Ga0207674_10044614 | 3300026116 | Bacteria | 4566 |
| 939 | Ga0207674_10307282 | 3300026116 | Unclassified | 1535 |
| 940 | Ga0207674_10319795 | 3300026116 | Unclassified | 1501 |
| 941 | Ga0207674_10593569 | 3300026116 | Unclassified | 1070 |
| 942 | Ga0207675_100014445 | 3300026118 | Bacteria | 7361 |
| 943 | Ga0207675_100283510 | 3300026118 | Unclassified | 1610 |
| 944 | Ga0207683_10002699 | 3300026121 | Bacteria | 15506 |
| 945 | Ga0207683_10082208 | 3300026121 | Bacteria | 2861 |
| 946 | Ga0207698_10135314 | 3300026142 | Unclassified | 2113 |
| 947 | Ga0207698_10266490 | 3300026142 | Bacteria | 1576 |
| 948 | Ga0207698_10509647 | 3300026142 | Bacteria | 1172 |
| 949 | Ga0207698_11972466 | 3300026142 | Bacteria | 598 |
| 950 | Ga0207698_12028741 | 3300026142 | Unclassified | 589 |
| 951 | Ga0209966_1010828 | 3300027695 | Bacteria | 1654 |
| 952 | Ga0265354_1014282 | 3300028016 | Bacteria | 752 |
| 953 | Ga0265356_1000376 | 3300028017 | Bacteria | 8112 |
| 954 | Ga0268266_10006583 | 3300028379 | Bacteria | 10612 |
| 955 | Ga0268266_10012346 | 3300028379 | Bacteria | 7388 |
| 956 | Ga0268266_10022853 | 3300028379 | Bacteria | 5322 |
| 957 | Ga0268266_10045437 | 3300028379 | Bacteria | 3757 |
| 958 | Ga0268266_10064482 | 3300028379 | Bacteria | 3165 |
| 959 | Ga0268265_10012306 | 3300028380 | Bacteria | 5798 |
| 960 | Ga0268265_10025236 | 3300028380 | Bacteria | 4216 |
| 961 | Ga0268264_10240699 | 3300028381 | Bacteria | 1676 |
| 962 | Ga0268264_10274447 | 3300028381 | Bacteria | 1576 |
| 963 | Ga0268264_10454759 | 3300028381 | Unclassified | 1241 |
| 964 | Ga0268264_11011710 | 3300028381 | Unclassified | 838 |
| 965 | Ga0265338_10001433 | 3300028800 | Bacteria | 38741 |
| 966 | Ga0265338_10030364 | 3300028800 | Bacteria | 5325 |
| 967 | Ga0265338_10137732 | 3300028800 | Bacteria | 1916 |
| 968 | Ga0265338_10143301 | 3300028800 | Bacteria | 1868 |
| 969 | Ga0265338_10259064 | 3300028800 | Bacteria | 1279 |
| 970 | Ga0265338_10575674 | 3300028800 | Unclassified | 786 |
| 971 | Ga0265762_1000311 | 3300030760 | Bacteria | 8261 |
| 972 | Ga0265762_1000664 | 3300030760 | Bacteria | 6068 |
| 973 | Ga0265762_1001754 | 3300030760 | Bacteria | 3941 |
| 974 | Ga0265762_1009779 | 3300030760 | Bacteria | 1711 |
| 975 | Ga0265762_1035242 | 3300030760 | Bacteria | 962 |
| 976 | Ga0265770_1006714 | 3300030878 | Bacteria | 1603 |
| 977 | Ga0265770_1030091 | 3300030878 | Bacteria | 905 |
| 978 | Ga0265765_1018861 | 3300030879 | Bacteria | 822 |
| 979 | Ga0265760_10000112 | 3300031090 | Bacteria | 20679 |
| 980 | Ga0265760_10000553 | 3300031090 | Bacteria | 10580 |
| 981 | Ga0265760_10005449 | 3300031090 | Bacteria | 3649 |
| 982 | Ga0265760_10018718 | 3300031090 | Bacteria | 1995 |
| 983 | Ga0265760_10022273 | 3300031090 | Bacteria | 1836 |
| 984 | Ga0265760_10053749 | 3300031090 | Bacteria | 1215 |
| 985 | Ga0265330_10034152 | 3300031235 | Bacteria | 2272 |
| 986 | Ga0265330_10200816 | 3300031235 | Bacteria | 843 |
| 987 | Ga0265330_10318825 | 3300031235 | Bacteria | 656 |
| 988 | Ga0265332_10051239 | 3300031238 | Bacteria | 1773 |
| 989 | Ga0265332_10404748 | 3300031238 | Unclassified | 564 |
| 990 | Ga0265325_10006501 | 3300031241 | Bacteria | 7086 |
| 991 | Ga0265325_10020381 | 3300031241 | Bacteria | 3655 |
| 992 | Ga0265325_10021392 | 3300031241 | Bacteria | 3553 |
| 993 | Ga0265340_10016242 | 3300031247 | Bacteria | 3858 |
| 994 | Ga0265340_10021295 | 3300031247 | Bacteria | 3325 |
| 995 | Ga0265340_10041436 | 3300031247 | Bacteria | 2264 |
| 996 | Ga0265340_10058212 | 3300031247 | Bacteria | 1856 |
| 997 | Ga0265339_10043867 | 3300031249 | Bacteria | 2470 |
| 998 | Ga0265339_10070799 | 3300031249 | Bacteria | 1859 |
| 999 | Ga0265339_10080145 | 3300031249 | Unclassified | 1727 |
| 1000 | Ga0265331_10237334 | 3300031250 | Bacteria | 818 |
| 1001 | Ga0265327_10098207 | 3300031251 | Bacteria | 1417 |
| 1002 | Ga0265316_10000706 | 3300031344 | Bacteria | 36971 |
| 1003 | Ga0265316_10105530 | 3300031344 | Bacteria | 2138 |
| 1004 | Ga0265316_10732373 | 3300031344 | Bacteria | 696 |
| 1005 | Ga0265316_11119459 | 3300031344 | Bacteria | 546 |
| 1006 | Ga0307408_100090522 | 3300031548 | Bacteria | 2309 |
| 1007 | Ga0307408_100618990 | 3300031548 | Unclassified | 964 |
| 1008 | Ga0265313_10019555 | 3300031595 | Bacteria | 3764 |
| 1009 | Ga0265314_10001717 | 3300031711 | Bacteria | 23774 |
| 1010 | Ga0265314_10021063 | 3300031711 | Bacteria | 5024 |
| 1011 | Ga0265314_10164347 | 3300031711 | Bacteria | 1347 |
| 1012 | Ga0265314_10173096 | 3300031711 | Bacteria | 1301 |
| 1013 | Ga0265342_10324743 | 3300031712 | Bacteria | 806 |
| 1014 | Ga0307405_10117911 | 3300031731 | Unclassified | 1811 |
| 1015 | Ga0307409_100236970 | 3300031995 | Bacteria | 1658 |
| 1016 | Ga0307409_100571568 | 3300031995 | Bacteria | 1113 |
| 1017 | Ga0307409_101604950 | 3300031995 | Bacteria | 679 |
| 1018 | Ga0307414_10675481 | 3300032004 | Bacteria | 933 |
| 1019 | Ga0307411_10222402 | 3300032005 | Bacteria | 1466 |
| 1020 | Ga0307411_11841729 | 3300032005 | Bacteria | 562 |
| 1021 | Ga0307415_100066794 | 3300032126 | Bacteria | 2511 |
| 1022 | Ga0307415_100366303 | 3300032126 | Bacteria | 1219 |
| 1023 | Ga0307510_10020741 | 3300033180 | Bacteria | 7672 |
| 1024 | Ga0307510_10105447 | 3300033180 | Bacteria | 2587 |
| 1025 | Ga0316212_1002277 | 3300033547 | Bacteria | 2727 |
| 1026 | Ga0373959_0137685 | 3300034820 | Bacteria | 609 |
| 1027 | Ga0373938_0221381 | 3300034957 | Bacteria | 532 |
| 1028 | Ga0373926_0072512 | 3300035083 | Bacteria | 1266 |
| 1029 | Ga0373929_0079412 | 3300035085 | Bacteria | 797 |
| 1030 | Ga0373934_0065120 | 3300035086 | Bacteria | 1455 |
| 1031 | Ga0373944_0041686 | 3300035089 | Bacteria | 1421 |
| 1032 | Ga0373923_0065269 | 3300035111 | Bacteria | 1553 |
| 1033 | Ga0373923_0596110 | 3300035111 | Bacteria | 544 |
| 1034 | Ga0373936_0000589 | 3300035113 | Bacteria | 12529 |
| 1035 | Ga0373936_0047620 | 3300035113 | Bacteria | 1729 |
| 1036 | Ga0373936_0052483 | 3300035113 | Bacteria | 1652 |
| 1037 | Ga0373941_0031269 | 3300035115 | Bacteria | 1585 |
| 1038 | Ga0373945_0000849 | 3300035116 | Bacteria | 8994 |
| 1039 | Ga0373945_0068189 | 3300035116 | Unclassified | 1341 |
| 1040 | Ga0373945_0165952 | 3300035116 | Bacteria | 902 |
| 1041 | Ga0373945_0307140 | 3300035116 | Bacteria | 680 |
| 1042 | Ga0373953_0013504 | 3300035117 | Unclassified | 2919 |
| 1043 | Ga0373956_0051924 | 3300035119 | Bacteria | 1843 |
| 1044 | Ga0373956_0106449 | 3300035119 | Bacteria | 1304 |
| 1045 | Ga0373956_0312409 | 3300035119 | Unclassified | 749 |
| 1046 | Ga0373957_0035087 | 3300035120 | Bacteria | 1862 |
| 1047 | Ga0373957_0099863 | 3300035120 | Bacteria | 1161 |
| 1048 | Ga0373943_0000002 | 3300035170 | Bacteria | 106064 |
| 1049 | Ga0373943_0008395 | 3300035170 | Bacteria | 4634 |
| 1050 | Ga0373946_0067918 | 3300035171 | Bacteria | 1532 |
| 1051 | Ga0373955_0031012 | 3300035172 | Bacteria | 2797 |
| 1052 | Ga0373955_0506853 | 3300035172 | Unclassified | 737 |
| 1053 | Ga0373955_0765020 | 3300035172 | Bacteria | 593 |
| 1054 | Ga0373942_0380450 | 3300035207 | Bacteria | 504 |
| 1055 | Ga0373962_0052640 | 3300035242 | Bacteria | 1177 |
| 1056 | Ga0373924_0000068 | 3300035410 | Bacteria | 27359 |
| 1057 | Ga0373924_0013747 | 3300035410 | Bacteria | 3046 |
| 1058 | Ga0373924_0049930 | 3300035410 | Bacteria | 1732 |
| 1059 | Ga0373924_0093919 | 3300035410 | Bacteria | 1285 |
| 1060 | Ga0373924_0110977 | 3300035410 | Bacteria | 1185 |
| 1061 | Ga0373931_0015086 | 3300035691 | Bacteria | 3786 |
| 1062 | Ga0373931_0065961 | 3300035691 | Bacteria | 1963 |
| 1063 | Ga0373931_0219192 | 3300035691 | Bacteria | 1145 |
| 1064 | Ga0373931_0413978 | 3300035691 | Bacteria | 856 |
| 1065 | Ga0373931_0513186 | 3300035691 | Unclassified | 775 |
| 1066 | Ga0373935_0001922 | 3300035692 | Bacteria | 11688 |
| 1067 | Ga0373935_0044182 | 3300035692 | Bacteria | 2807 |
| 1068 | Ga0373935_0062312 | 3300035692 | Bacteria | 2389 |
| 1069 | Ga0373935_0088998 | 3300035692 | Bacteria | 2018 |
| 1070 | Ga0373935_0154531 | 3300035692 | Bacteria | 1559 |
| 1071 | Ga0373935_0441896 | 3300035692 | Bacteria | 938 |
| 1072 | Ga0373927_0000021 | 3300035695 | Bacteria | 124647 |
| 1073 | Ga0373927_0004851 | 3300035695 | Bacteria | 9354 |
| 1074 | Ga0373927_0132432 | 3300035695 | Bacteria | 1629 |
| 1075 | Ga0373933_0044565 | 3300035724 | Bacteria | 2628 |
| 1076 | Ga0373933_0114449 | 3300035724 | Bacteria | 1685 |
| 1077 | Ga0373933_0269322 | 3300035724 | Unclassified | 1099 |
| 1078 | Ga0373933_0288608 | 3300035724 | Bacteria | 1061 |
| 1079 | Ga0373933_0736590 | 3300035724 | Bacteria | 648 |
| 1080 | Ga0373947_0002466 | 3300035725 | Bacteria | 11131 |
| 1081 | Ga0373947_0037855 | 3300035725 | Bacteria | 2863 |
| 1082 | Ga0373947_0114539 | 3300035725 | Bacteria | 1707 |
| 1083 | Ga0373947_0119751 | 3300035725 | Bacteria | 1671 |
| 1084 | Ga0373947_0176034 | 3300035725 | Bacteria | 1390 |
| 1085 | Ga0373947_0471783 | 3300035725 | Bacteria | 851 |
| 1086 | Ga0373947_0848632 | 3300035725 | Unclassified | 624 |
| 1087 | Ga0373937_0042488 | 3300036401 | Bacteria | 4148 |
| 1088 | Ga0373937_0086605 | 3300036401 | Bacteria | 2899 |
| 1089 | Ga0373937_0105084 | 3300036401 | Bacteria | 2624 |
| 1090 | Ga0373937_0244543 | 3300036401 | Bacteria | 1691 |
| 1091 | Ga0373937_0965987 | 3300036401 | Bacteria | 801 |
| 1092 | Ga0373937_1327605 | 3300036401 | Bacteria | 667 |
| 1093 | Ga0373925_0004097 | 3300037068 | Bacteria | 11059 |
| 1094 | Ga0373925_0004660 | 3300037068 | Bacteria | 10345 |
| 1095 | Ga0373925_0025607 | 3300037068 | Bacteria | 4312 |
| 1096 | Ga0373925_0039398 | 3300037068 | Bacteria | 3496 |
| 1097 | Ga0373925_0043648 | 3300037068 | Bacteria | 3329 |
| 1098 | Ga0373925_0627372 | 3300037068 | Bacteria | 886 |
| 1099 | Ga0373925_1104428 | 3300037068 | Bacteria | 652 |
| 1100 | Ga0373925_1478035 | 3300037068 | Unclassified | 556 |
| 1101 | Ga0373925_1625014 | 3300037068 | Unclassified | 528 |
| 1102 | Ga0395898_0234003 | 3300037466 | Unclassified | 1752 |
| 1103 | Ga0395905_0979428 | 3300037471 | Unclassified | 749 |
| 1104 | Ga0436364_0856169 | 3300037853 | Unclassified | 1985 |
| 1105 | Ga0395901_0214172 | 3300038443 | Unclassified | 2015 |
| 1106 | Ga0242420_029312 | 3300038996 | Bacteria | 1015 |
| 1107 | Ga0436365_1421008 | 3300039437 | Bacteria | 1729 |
| 1108 | Ga0436360_0525893 | 3300039438 | Bacteria | 1212 |
| 1109 | Ga0436360_0727080 | 3300039438 | Bacteria | 612 |
| 1110 | Ga0436361_0936610 | 3300039447 | Bacteria | 584 |
| 1111 | Ga0436363_0654277 | 3300039450 | Bacteria | 5140 |
| 1112 | Ga0436363_0682772 | 3300039450 | Bacteria | 9687 |
| 1113 | Ga0436363_0957099 | 3300039450 | Bacteria | 717 |
| 1114 | Ga0436363_1305165 | 3300039450 | Bacteria | 3951 |
| 1115 | Ga0436362_0212779 | 3300039453 | Unclassified | 955 |
| 1116 | Ga0436362_0857316 | 3300039453 | Bacteria | 7608 |
| 1117 | Ga0436362_1069201 | 3300039453 | Unclassified | 696 |
| 1118 | Ga0436362_1157553 | 3300039453 | Bacteria | 896 |
| 1119 | Ga0451577_0642420 | 3300042876 | Bacteria | 962 |
| 1120 | Ga0453683_0137055 | 3300044673 | Bacteria | 1544 |
| 1121 | Ga0466963_0002948 | 3300044694 | Bacteria | 9615 |
| 1122 | Ga0453684_1999474 | 3300044712 | Unclassified | 584 |
| 1123 | Ga0466957_0150619 | 3300044842 | Unclassified | 1504 |
| 1124 | Ga0466959_0276036 | 3300045049 | Unclassified | 1154 |
| 1125 | Ga0451576_0027604 | 3300045051 | Bacteria | 6094 |
| 1126 | Ga0466958_0223860 | 3300045836 | Bacteria | 1200 |
| 1127 | Ga0466958_1068782 | 3300045836 | Bacteria | 527 |
| 1128 | Ga0466967_0006861 | 3300045976 | Bacteria | 8127 |
| 1129 | Ga0466967_0203797 | 3300045976 | Bacteria | 1874 |
| 1130 | Ga0466967_0250375 | 3300045976 | Bacteria | 1692 |
| 1131 | Ga0466967_0271668 | 3300045976 | Bacteria | 1624 |
| 1132 | Ga0466967_1104559 | 3300045976 | Unclassified | 790 |
| 1133 | Ga0495592_0100581 | 3300046454 | Bacteria | 2061 |
| 1134 | Ga0495603_0003176 | 3300046455 | Bacteria | 9771 |
| 1135 | Ga0495603_0036976 | 3300046455 | Bacteria | 2930 |
| 1136 | Ga0495590_0391819 | 3300046457 | Unclassified | 532 |
| 1137 | Ga0495629_0006749 | 3300046459 | Bacteria | 8486 |
| 1138 | Ga0495629_0008385 | 3300046459 | Bacteria | 7602 |
| 1139 | Ga0495629_0011889 | 3300046459 | Bacteria | 6312 |
| 1140 | Ga0495651_0068984 | 3300046462 | Bacteria | 2694 |
| 1141 | Ga0495651_0100433 | 3300046462 | Unclassified | 2155 |
| 1142 | Ga0495651_0232111 | 3300046462 | Bacteria | 1270 |
| 1143 | Ga0495653_0010025 | 3300046463 | Bacteria | 7751 |
| 1144 | Ga0495653_0446137 | 3300046463 | Unclassified | 815 |
| 1145 | Ga0495650_0000009 | 3300046471 | Bacteria | 653845 |
| 1146 | Ga0495650_0003359 | 3300046471 | Bacteria | 11742 |
| 1147 | Ga0495580_0000563 | 3300046472 | Bacteria | 31329 |
| 1148 | Ga0495580_0001106 | 3300046472 | Bacteria | 23674 |
| 1149 | Ga0495580_0001748 | 3300046472 | Bacteria | 19098 |
| 1150 | Ga0495580_0013714 | 3300046472 | Bacteria | 6174 |
| 1151 | Ga0495580_0018608 | 3300046472 | Bacteria | 5170 |
| 1152 | Ga0495580_0047537 | 3300046472 | Unclassified | 3041 |
| 1153 | Ga0495580_0053405 | 3300046472 | Bacteria | 2851 |
| 1154 | Ga0495580_0081309 | 3300046472 | Bacteria | 2258 |
| 1155 | Ga0495580_0112833 | 3300046472 | Unclassified | 1888 |
| 1156 | Ga0495580_0142393 | 3300046472 | Bacteria | 1662 |
| 1157 | Ga0495580_0147585 | 3300046472 | Bacteria | 1630 |
| 1158 | Ga0495580_0170471 | 3300046472 | Bacteria | 1505 |
| 1159 | Ga0495580_0185593 | 3300046472 | Unclassified | 1435 |
| 1160 | Ga0495580_0254121 | 3300046472 | Unclassified | 1203 |
| 1161 | Ga0495580_0371882 | 3300046472 | Bacteria | 966 |
| 1162 | Ga0495580_0483342 | 3300046472 | Bacteria | 828 |
| 1163 | Ga0495582_0001590 | 3300046473 | Bacteria | 12805 |
| 1164 | Ga0495582_0014685 | 3300046473 | Bacteria | 4303 |
| 1165 | Ga0495582_0057323 | 3300046473 | Unclassified | 2148 |
| 1166 | Ga0495582_0080426 | 3300046473 | Bacteria | 1809 |
| 1167 | Ga0495582_0475200 | 3300046473 | Unclassified | 722 |
| 1168 | Ga0495639_0016680 | 3300046475 | Bacteria | 3189 |
| 1169 | Ga0495639_0055433 | 3300046475 | Bacteria | 1808 |
| 1170 | Ga0495662_0002003 | 3300046476 | Bacteria | 10206 |
| 1171 | Ga0495664_0003430 | 3300046477 | Bacteria | 8621 |
| 1172 | Ga0495664_0012639 | 3300046477 | Bacteria | 4783 |
| 1173 | Ga0495664_0088960 | 3300046477 | Unclassified | 1856 |
| 1174 | Ga0495594_0000239 | 3300046499 | Bacteria | 26556 |
| 1175 | Ga0495594_0001215 | 3300046499 | Bacteria | 13462 |
| 1176 | Ga0495594_0001953 | 3300046499 | Bacteria | 10758 |
| 1177 | Ga0495594_0054356 | 3300046499 | Bacteria | 2207 |
| 1178 | Ga0495594_0058561 | 3300046499 | Bacteria | 2129 |
| 1179 | Ga0495583_0017801 | 3300046506 | Bacteria | 3760 |
| 1180 | Ga0495583_0068635 | 3300046506 | Bacteria | 1563 |
| 1181 | Ga0495606_0092760 | 3300046507 | Unclassified | 1854 |
| 1182 | Ga0495606_0156825 | 3300046507 | Bacteria | 1331 |
| 1183 | Ga0495606_0191197 | 3300046507 | Bacteria | 1173 |
| 1184 | Ga0495608_0272050 | 3300046511 | Unclassified | 1053 |
| 1185 | Ga0495616_0274619 | 3300046513 | Unclassified | 718 |
| 1186 | Ga0495618_0117408 | 3300046514 | Bacteria | 1703 |
| 1187 | Ga0495628_0001498 | 3300046516 | Bacteria | 21393 |
| 1188 | Ga0495628_0105147 | 3300046516 | Bacteria | 2175 |
| 1189 | Ga0495628_0439843 | 3300046516 | Bacteria | 948 |
| 1190 | Ga0495630_0034429 | 3300046517 | Bacteria | 3782 |
| 1191 | Ga0495630_0250199 | 3300046517 | Bacteria | 1354 |
| 1192 | Ga0495630_0267091 | 3300046517 | Unclassified | 1307 |
| 1193 | Ga0495632_0315876 | 3300046519 | Bacteria | 691 |
| 1194 | Ga0495644_0000290 | 3300046523 | Bacteria | 23232 |
| 1195 | Ga0495648_0254472 | 3300046524 | Bacteria | 846 |
| 1196 | Ga0495666_0000987 | 3300046526 | Bacteria | 13455 |
| 1197 | Ga0495642_0054436 | 3300046528 | Bacteria | 1650 |
| 1198 | Ga0495642_0259879 | 3300046528 | Bacteria | 759 |
| 1199 | Ga0495652_0003983 | 3300046529 | Bacteria | 14306 |
| 1200 | Ga0495652_0093786 | 3300046529 | Bacteria | 2450 |
| 1201 | Ga0495652_0154130 | 3300046529 | Bacteria | 1791 |
| 1202 | Ga0495652_0895144 | 3300046529 | Bacteria | 586 |
| 1203 | Ga0495665_0001222 | 3300046531 | Bacteria | 13725 |
| 1204 | Ga0495665_0079395 | 3300046531 | Bacteria | 1726 |
| 1205 | Ga0495665_0181929 | 3300046531 | Unclassified | 1092 |
| 1206 | Ga0495665_0222318 | 3300046531 | Bacteria | 976 |
| 1207 | Ga0495640_0004227 | 3300046533 | Bacteria | 11483 |
| 1208 | Ga0495586_0001012 | 3300046535 | Bacteria | 15861 |
| 1209 | Ga0495586_0050652 | 3300046535 | Bacteria | 2247 |
| 1210 | Ga0495587_0138502 | 3300046536 | Bacteria | 1390 |
| 1211 | Ga0495609_0023923 | 3300046538 | Bacteria | 2804 |
| 1212 | Ga0495645_0004045 | 3300046543 | Bacteria | 10013 |
| 1213 | Ga0495645_0180992 | 3300046543 | Bacteria | 1444 |
| 1214 | Ga0495645_0675006 | 3300046543 | Unclassified | 629 |
| 1215 | Ga0495645_0790021 | 3300046543 | Unclassified | 570 |
| 1216 | Ga0495622_0103638 | 3300046557 | Unclassified | 1303 |
| 1217 | Ga0495633_0024953 | 3300046558 | Bacteria | 2949 |
| 1218 | Ga0495667_0005674 | 3300046559 | Bacteria | 8445 |
| 1219 | Ga0495667_0407871 | 3300046559 | Bacteria | 856 |
| 1220 | Ga0495667_0528035 | 3300046559 | Unclassified | 738 |
| 1221 | Ga0495668_0143043 | 3300046616 | Bacteria | 1309 |
| 1222 | Ga0495668_0328252 | 3300046616 | Unclassified | 839 |
| 1223 | Ga0495668_0444382 | 3300046616 | Bacteria | 713 |
| 1224 | Ga0495634_0001395 | 3300046642 | Bacteria | 21738 |
| 1225 | Ga0495634_0267213 | 3300046642 | Bacteria | 1042 |
| 1226 | Ga0495611_0031459 | 3300046648 | Bacteria | 2336 |
| 1227 | Ga0495625_0000174 | 3300046660 | Bacteria | 100401 |
| 1228 | Ga0495625_0051081 | 3300046660 | Bacteria | 2965 |
| 1229 | Ga0495625_0082604 | 3300046660 | Bacteria | 2234 |
| 1230 | Ga0495625_0107056 | 3300046660 | Bacteria | 1914 |
| 1231 | Ga0495625_0373775 | 3300046660 | Bacteria | 896 |
| 1232 | Ga0495635_0003625 | 3300046663 | Bacteria | 10702 |
| 1233 | Ga0495635_0171085 | 3300046663 | Bacteria | 1477 |
| 1234 | Ga0495635_0466388 | 3300046663 | Bacteria | 834 |
| 1235 | Ga0495657_0072194 | 3300046675 | Bacteria | 2252 |
| 1236 | Ga0495657_0164998 | 3300046675 | Bacteria | 1368 |
| 1237 | Ga0495599_0010918 | 3300046678 | Bacteria | 5568 |
| 1238 | Ga0495599_0485170 | 3300046678 | Bacteria | 729 |
| 1239 | Ga0495623_0044332 | 3300046679 | Bacteria | 2826 |
| 1240 | Ga0495623_0538859 | 3300046679 | Unclassified | 612 |
| 1241 | Ga0495623_0551408 | 3300046679 | Bacteria | 603 |
| 1242 | Ga0495646_0001575 | 3300046680 | Bacteria | 13600 |
| 1243 | Ga0495646_0170319 | 3300046680 | Unclassified | 1200 |
| 1244 | Ga0495646_0443667 | 3300046680 | Unclassified | 671 |
| 1245 | Ga0495669_0008466 | 3300046684 | Bacteria | 4327 |
| 1246 | Ga0495669_0089066 | 3300046684 | Bacteria | 1423 |
| 1247 | Ga0495613_0001438 | 3300046689 | Bacteria | 18178 |
| 1248 | Ga0495613_1126122 | 3300046689 | Unclassified | 500 |
| 1249 | Ga0495624_0014189 | 3300046690 | Bacteria | 5415 |
| 1250 | Ga0495624_0147020 | 3300046690 | Bacteria | 1442 |
| 1251 | Ga0495624_0308226 | 3300046690 | Bacteria | 954 |
| 1252 | Ga0495624_0412238 | 3300046690 | Bacteria | 811 |
| 1253 | Ga0495624_0537790 | 3300046690 | Bacteria | 698 |
| 1254 | Ga0495600_0004609 | 3300046809 | Bacteria | 8258 |
| 1255 | Ga0495600_0125257 | 3300046809 | Bacteria | 1671 |
| 1256 | Ga0495581_0000697 | 3300047315 | Bacteria | 17641 |
| 1257 | Ga0495581_0025866 | 3300047315 | Bacteria | 3404 |
| 1258 | Ga0495581_0531185 | 3300047315 | Unclassified | 683 |
| 1259 | Ga0495604_0037535 | 3300047317 | Bacteria | 3815 |
| 1260 | Ga0495636_0102648 | 3300047318 | Bacteria | 1252 |
| 1261 | Ga0495674_0011347 | 3300047319 | Bacteria | 8411 |
| 1262 | Ga0495674_0073736 | 3300047319 | Bacteria | 2941 |
| 1263 | Ga0495674_0203153 | 3300047319 | Bacteria | 1643 |
| 1264 | Ga0495674_0668975 | 3300047319 | Bacteria | 817 |
| 1265 | Ga0495672_0004082 | 3300047320 | Bacteria | 12180 |
| 1266 | Ga0495672_0145954 | 3300047320 | Bacteria | 1231 |
| 1267 | Ga0495672_0290943 | 3300047320 | Bacteria | 777 |
| 1268 | Ga0495676_0000317 | 3300047321 | Bacteria | 39240 |
| 1269 | Ga0495676_0747485 | 3300047321 | Bacteria | 631 |
| 1270 | Ga0495680_0008074 | 3300047322 | Bacteria | 9596 |
| 1271 | Ga0495680_0756055 | 3300047322 | Unclassified | 638 |
| 1272 | Ga0495683_0236034 | 3300047323 | Bacteria | 808 |
| 1273 | Ga0495675_0002311 | 3300047444 | Bacteria | 11387 |
| 1274 | Ga0495675_0112728 | 3300047444 | Unclassified | 1697 |
| 1275 | Ga0495677_0042322 | 3300047445 | Bacteria | 1668 |
| 1276 | Ga0495673_0054735 | 3300047469 | Bacteria | 1734 |
| 1277 | Ga0495673_0097231 | 3300047469 | Bacteria | 1195 |
| 1278 | Ga0495684_0454239 | 3300047471 | Bacteria | 890 |
| 1279 | Ga0495684_0508018 | 3300047471 | Unclassified | 828 |
| 1280 | Ga0495686_0000087 | 3300047472 | Bacteria | 196747 |
| 1281 | Ga0495686_0002533 | 3300047472 | Bacteria | 17095 |
| 1282 | Ga0495686_0035701 | 3300047472 | Bacteria | 3194 |
| 1283 | Ga0495686_0081466 | 3300047472 | Bacteria | 1977 |
| 1284 | Ga0495593_0018843 | 3300047673 | Bacteria | 3874 |
| 1285 | Ga0495602_0148731 | 3300048088 | Bacteria | 1844 |
| 1286 | Ga0495602_0446062 | 3300048088 | Unclassified | 914 |
| 1287 | Ga0495602_0464006 | 3300048088 | Bacteria | 892 |
| 1288 | Ga0495602_0472318 | 3300048088 | Unclassified | 881 |
| 1289 | Ga0495614_0000365 | 3300048089 | Bacteria | 18172 |
| 1290 | Ga0495614_0060575 | 3300048089 | Bacteria | 1626 |
| 1291 | Ga0496100_0103946 | 3300048903 | Bacteria | 1962 |
| 1292 | Ga0496100_0288884 | 3300048903 | Unclassified | 1225 |
| 1293 | Ga0496100_0838500 | 3300048903 | Unclassified | 721 |
| 1294 | Ga0496101_0086554 | 3300048904 | Bacteria | 2324 |
| 1295 | Ga0496101_0258323 | 3300048904 | Bacteria | 1358 |
| 1296 | Ga0496101_0457649 | 3300048904 | Bacteria | 1007 |
| 1297 | Ga0496101_0812690 | 3300048904 | Unclassified | 737 |
| 1298 | Ga0496102_0001500 | 3300048905 | Bacteria | 20613 |
| 1299 | Ga0496102_0041202 | 3300048905 | Bacteria | 4180 |
| 1300 | Ga0496102_0112371 | 3300048905 | Unclassified | 2541 |
| 1301 | Ga0496102_0169589 | 3300048905 | Bacteria | 2055 |
| 1302 | Ga0496102_0327497 | 3300048905 | Bacteria | 1443 |
| 1303 | Ga0496102_0463468 | 3300048905 | Bacteria | 1188 |
| 1304 | Ga0496102_0821426 | 3300048905 | Bacteria | 852 |
| 1305 | Ga0496103_0010834 | 3300048906 | Bacteria | 5396 |
| 1306 | Ga0496103_0108522 | 3300048906 | Bacteria | 1761 |
| 1307 | Ga0496103_0186427 | 3300048906 | Bacteria | 1334 |
| 1308 | Ga0496104_0002436 | 3300048907 | Bacteria | 16033 |
| 1309 | Ga0496104_0022220 | 3300048907 | Bacteria | 5826 |
| 1310 | Ga0496104_0023786 | 3300048907 | Bacteria | 5634 |
| 1311 | Ga0496104_0023902 | 3300048907 | Bacteria | 5622 |
| 1312 | Ga0496104_0115202 | 3300048907 | Unclassified | 2579 |
| 1313 | Ga0496104_0296989 | 3300048907 | Unclassified | 1528 |
| 1314 | Ga0496104_0433274 | 3300048907 | Bacteria | 1227 |
| 1315 | Ga0496104_0567751 | 3300048907 | Bacteria | 1045 |
| 1316 | Ga0496104_0779242 | 3300048907 | Unclassified | 863 |
| 1317 | Ga0496104_1441986 | 3300048907 | Bacteria | 591 |
| 1318 | Ga0496105_0098109 | 3300048908 | Unclassified | 2420 |
| 1319 | Ga0496105_0213099 | 3300048908 | Bacteria | 1574 |
| 1320 | Ga0496106_0031172 | 3300048909 | Bacteria | 3973 |
| 1321 | Ga0496106_0090342 | 3300048909 | Bacteria | 2363 |
| 1322 | Ga0496106_0179820 | 3300048909 | Bacteria | 1679 |
| 1323 | Ga0496106_0266849 | 3300048909 | Unclassified | 1370 |
| 1324 | Ga0496107_0189850 | 3300048910 | Bacteria | 1526 |
| 1325 | Ga0496107_0206222 | 3300048910 | Unclassified | 1461 |
| 1326 | Ga0496107_0269813 | 3300048910 | Bacteria | 1266 |
| 1327 | Ga0496108_0000422 | 3300048911 | Bacteria | 34654 |
| 1328 | Ga0496108_0151919 | 3300048911 | Bacteria | 1998 |
| 1329 | Ga0496108_1167986 | 3300048911 | Bacteria | 652 |
| 1330 | Ga0496108_1218765 | 3300048911 | Unclassified | 636 |
| 1331 | Ga0496109_0001507 | 3300048912 | Bacteria | 19375 |
| 1332 | Ga0496109_0218740 | 3300048912 | Bacteria | 1791 |
| 1333 | Ga0496109_0539880 | 3300048912 | Bacteria | 1100 |
| 1334 | Ga0496109_0982305 | 3300048912 | Bacteria | 782 |
| 1335 | Ga0496110_0014240 | 3300048913 | Bacteria | 6598 |
| 1336 | Ga0496110_0054816 | 3300048913 | Bacteria | 3507 |
| 1337 | Ga0496111_0008180 | 3300048914 | Bacteria | 6914 |
| 1338 | Ga0496111_0019854 | 3300048914 | Bacteria | 4672 |
| 1339 | Ga0496111_0308824 | 3300048914 | Bacteria | 1172 |
| 1340 | Ga0496112_0001888 | 3300048915 | Bacteria | 16525 |
| 1341 | Ga0496112_0008075 | 3300048915 | Bacteria | 9397 |
| 1342 | Ga0496112_0013759 | 3300048915 | Bacteria | 7482 |
| 1343 | Ga0496112_0015992 | 3300048915 | Bacteria | 7015 |
| 1344 | Ga0496112_0021039 | 3300048915 | Bacteria | 6196 |
| 1345 | Ga0496112_0068332 | 3300048915 | Bacteria | 3508 |
| 1346 | Ga0496112_0982343 | 3300048915 | Bacteria | 764 |
| 1347 | Ga0496113_0001069 | 3300048916 | Bacteria | 14806 |
| 1348 | Ga0496113_0023620 | 3300048916 | Bacteria | 4360 |
| 1349 | Ga0496113_0064705 | 3300048916 | Bacteria | 2765 |
| 1350 | Ga0496113_0119797 | 3300048916 | Bacteria | 2057 |
| 1351 | Ga0496113_0438773 | 3300048916 | Unclassified | 1049 |
| 1352 | Ga0496114_1613234 | 3300048917 | Bacteria | 537 |
| 1353 | Ga0496115_0004078 | 3300048918 | Bacteria | 10553 |
| 1354 | Ga0496115_0021623 | 3300048918 | Bacteria | 4972 |
| 1355 | Ga0496115_0065184 | 3300048918 | Bacteria | 2942 |
| 1356 | Ga0496115_0281670 | 3300048918 | Bacteria | 1365 |
| 1357 | Ga0496115_0926645 | 3300048918 | Bacteria | 670 |
| 1358 | Ga0496126_0000139 | 3300048929 | Bacteria | 167097 |
| 1359 | Ga0496126_0003176 | 3300048929 | Bacteria | 21151 |
| 1360 | Ga0496126_0197453 | 3300048929 | Bacteria | 1701 |
| 1361 | Ga0501306_103997 | 3300049127 | Unclassified | 510 |
| 1362 | Ga0495682_0039331 | 3300049460 | Bacteria | 1736 |
| 1363 | Ga0501291_121403 | 3300049514 | Bacteria | 567 |
| 1364 | Ga0501292_006508 | 3300049515 | Bacteria | 1662 |
| 1365 | Ga0501296_025900 | 3300049519 | Bacteria | 770 |
| 1366 | Ga0501297_012034 | 3300049520 | Bacteria | 1001 |
| 1367 | Ga0501297_027267 | 3300049520 | Bacteria | 744 |
| 1368 | Ga0501298_005110 | 3300049521 | Unclassified | 2092 |
| 1369 | Ga0501298_014962 | 3300049521 | Bacteria | 1392 |
| 1370 | Ga0501299_018295 | 3300049522 | Bacteria | 1258 |
| 1371 | Ga0501031_0036477 | 3300049568 | Bacteria | 3207 |
| 1372 | Ga0501032_0000638 | 3300049569 | Bacteria | 28461 |
| 1373 | Ga0501033_0007918 | 3300049570 | Bacteria | 8230 |
| 1374 | Ga0501033_0235156 | 3300049570 | Bacteria | 1301 |
| 1375 | Ga0501034_0002797 | 3300049571 | Bacteria | 20406 |
| 1376 | Ga0501036_0001803 | 3300049572 | Bacteria | 16608 |
| 1377 | Ga0501037_0020105 | 3300049573 | Bacteria | 4930 |
| 1378 | Ga0501037_0159778 | 3300049573 | Bacteria | 1607 |
| 1379 | Ga0501038_0000571 | 3300049574 | Bacteria | 32582 |
| 1380 | Ga0501043_0002729 | 3300049579 | Bacteria | 14759 |
| 1381 | Ga0501046_0001246 | 3300049580 | Bacteria | 24621 |
| 1382 | Ga0501047_0002082 | 3300049581 | Bacteria | 19151 |
| 1383 | Ga0501073_0005596 | 3300049589 | Bacteria | 9401 |
| 1384 | Ga0501073_0206060 | 3300049589 | Bacteria | 1359 |
| 1385 | Ga0501073_0269169 | 3300049589 | Bacteria | 1176 |
| 1386 | Ga0501077_0097755 | 3300049593 | Bacteria | 1861 |
| 1387 | Ga0501224_012182 | 3300049664 | Bacteria | 1266 |
| 1388 | Ga0501233_217034 | 3300049668 | Bacteria | 563 |
| 1389 | Ga0501235_213456 | 3300049669 | Unclassified | 527 |
| 1390 | Ga0501247_051711 | 3300049677 | Bacteria | 611 |
| 1391 | Ga0501080_0023122 | 3300049742 | Bacteria | 5764 |
| 1392 | Ga0501080_0515185 | 3300049742 | Bacteria | 1068 |
| 1393 | Ga0501083_0206279 | 3300049744 | Bacteria | 1282 |
| 1394 | Ga0501262_069869 | 3300049759 | Bacteria | 573 |
| 1395 | Ga0501273_026108 | 3300049770 | Bacteria | 813 |
| 1396 | Ga0501278_008949 | 3300049774 | Bacteria | 779 |
| 1397 | Ga0501035_0008138 | 3300049822 | Bacteria | 9771 |
| 1398 | Ga0501044_0015327 | 3300049823 | Bacteria | 8255 |
| 1399 | Ga0501045_0313341 | 3300049824 | Bacteria | 1168 |
| 1400 | nmdc:mga06r32_308023_c1 | 3300050510 | Bacteria | 1569 |
| 1401 | nmdc:mga0n895_46183_c1 | 3300050512 | Bacteria | 4253 |
| 1402 | nmdc:mga0n895_473906_c1 | 3300050512 | Unclassified | 1263 |
| 1403 | nmdc:mga0n895_5110_c1 | 3300050512 | Bacteria | 10901 |
| 1404 | nmdc:mga0rr50_1772902_c1 | 3300050513 | Unclassified | 520 |
| 1405 | nmdc:mga0rr50_199769_c1 | 3300050513 | Bacteria | 1642 |
| 1406 | nmdc:mga08x19_129199_c1 | 3300050514 | Bacteria | 1698 |
| 1407 | nmdc:mga08x19_197730_c1 | 3300050514 | Bacteria | 1377 |
| 1408 | nmdc:mga08x19_58901_c1 | 3300050514 | Bacteria | 2486 |
| 1409 | nmdc:mga08x19_61341_c1 | 3300050514 | Bacteria | 2437 |
| 1410 | nmdc:mga08x19_648199_c1 | 3300050514 | Bacteria | 749 |
| 1411 | nmdc:mga0a205_553460_c1 | 3300050515 | Bacteria | 1005 |
| 1412 | nmdc:mga0a205_94531_c1 | 3300050515 | Bacteria | 2888 |
| 1413 | Ga0495601_0012731 | 3300053077 | Bacteria | 5048 |
| 1414 | Ga0495601_0067495 | 3300053077 | Bacteria | 2279 |
| 1415 | Ga0495619_0804954 | 3300053085 | Unclassified | 635 |
| 1416 | Ga0495619_0934441 | 3300053085 | Unclassified | 582 |
| 1417 | Ga0500643_039654 | 3300053087 | Bacteria | 1390 |
| 1418 | Ga0500651_0000010 | 3300053093 | Bacteria | 253038 |
| 1419 | Ga0500595_000007 | 3300053119 | Bacteria | 289461 |
| 1420 | Ga0500595_023685 | 3300053119 | Bacteria | 2154 |
| 1421 | Ga0501084_0296196 | 3300054114 | Bacteria | 1366 |
| 1422 | Ga0500661_001206 | 3300055283 | Bacteria | 4832 |
| 1423 | Ga0587066_098490 | 3300059490 | Unclassified | 661 |
| 1424 | Ga0587066_109753 | 3300059490 | Bacteria | 638 |
| 1425 | Ga0587073_0062006 | 3300059492 | Bacteria | 880 |
| 1426 | Ga0587073_0095743 | 3300059492 | Unclassified | 763 |
| 1427 | Ga0587073_0305330 | 3300059492 | Unclassified | 519 |
| 1428 | Ga0587080_050009 | 3300059503 | Bacteria | 787 |
| 1429 | Ga0587082_070565 | 3300059504 | Unclassified | 709 |
| 1430 | Ga0587083_0084930 | 3300059505 | Unclassified | 761 |
| 1431 | Ga0587090_065221 | 3300059510 | Bacteria | 700 |
| 1432 | Ga0587091_069249 | 3300059511 | Unclassified | 768 |
| 1433 | Ga0587092_134761 | 3300059512 | Unclassified | 539 |
| 1434 | Ga0587094_105529 | 3300059513 | Bacteria | 549 |
| 1435 | Ga0587101_098024 | 3300059623 | Unclassified | 579 |
| 1436 | Ga0587067_158215 | 3300059640 | Unclassified | 574 |
| 1437 | Ga0587075_050988 | 3300059644 | Bacteria | 722 |
| 1438 | Ga0587076_033672 | 3300059645 | Unclassified | 922 |
| 1439 | Ga0587114_036932 | 3300059655 | Unclassified | 775 |
| 1440 | Ga0587071_134932 | 3300060344 | Unclassified | 601 |
| 1441 | Ga0587111_0213486 | 3300060346 | Unclassified | 553 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300007265 | Ga0099794_10096584 | Ga0099794_100965841 | 129 |
| 2 | 3300025939 | Ga0207665_10588600 | Ga0207665_105886002 | 133 |
| 3 | 3300005330 | Ga0070690_100605485 | Ga0070690_1006054852 | 135 |
| 4 | 3300005435 | Ga0070714_100109078 | Ga0070714_1001090783 | 135 |
| 5 | 3300005435 | Ga0070714_101489498 | Ga0070714_1014894982 | 135 |
| 6 | 3300005436 | Ga0070713_100462169 | Ga0070713_1004621691 | 135 |
| 7 | 3300005436 | Ga0070713_100522774 | Ga0070713_1005227742 | 135 |
| 8 | 3300005437 | Ga0070710_10081696 | Ga0070710_100816962 | 135 |
| 9 | 3300005439 | Ga0070711_100145306 | Ga0070711_1001453062 | 135 |
| 10 | 3300005444 | Ga0070694_100716303 | Ga0070694_1007163032 | 135 |
| 11 | 3300006914 | Ga0075436_100091120 | Ga0075436_1000911202 | 135 |
| 12 | 3300006914 | Ga0075436_100366095 | Ga0075436_1003660952 | 135 |
| 13 | 3300009093 | Ga0105240_10108242 | Ga0105240_101082423 | 135 |
| 14 | 3300009545 | Ga0105237_10668843 | Ga0105237_106688432 | 135 |
| 15 | 3300013297 | Ga0157378_10108002 | Ga0157378_101080024 | 135 |
| 16 | 3300025898 | Ga0207692_10362334 | Ga0207692_103623342 | 135 |
| 17 | 3300025913 | Ga0207695_10122567 | Ga0207695_101225671 | 135 |
| 18 | 3300026035 | Ga0207703_11111301 | Ga0207703_111113012 | 135 |
| 19 | 3300031548 | Ga0307408_100618990 | Ga0307408_1006189901 | 135 |
| 20 | 3300031731 | Ga0307405_10117911 | Ga0307405_101179112 | 135 |
| 21 | 3300031995 | Ga0307409_100236970 | Ga0307409_1002369703 | 135 |
| 22 | 3300031995 | Ga0307409_100571568 | Ga0307409_1005715681 | 135 |
| 23 | 3300032004 | Ga0307414_10675481 | Ga0307414_106754812 | 135 |
| 24 | 3300032005 | Ga0307411_10222402 | Ga0307411_102224022 | 135 |
| 25 | 3300032005 | Ga0307411_11841729 | Ga0307411_118417292 | 135 |
| 26 | 3300032126 | Ga0307415_100066794 | Ga0307415_1000667943 | 135 |
| 27 | 3300032126 | Ga0307415_100366303 | Ga0307415_1003663032 | 135 |
| 28 | 3300045976 | Ga0466967_1104559 | Ga0466967_1104559_353_760 | 135 |
| 29 | 3300048905 | Ga0496102_0169589 | Ga0496102_0169589_660_1067 | 135 |
| 30 | 3300049127 | Ga0501306_103997 | Ga0501306_103997_49_456 | 135 |
| 31 | 3300049514 | Ga0501291_121403 | Ga0501291_121403_100_507 | 135 |
| 32 | 3300049521 | Ga0501298_014962 | Ga0501298_014962_949_1356 | 135 |
| 33 | 3300049664 | Ga0501224_012182 | Ga0501224_012182_779_1186 | 135 |
| 34 | 3300049668 | Ga0501233_217034 | Ga0501233_217034_124_531 | 135 |
| 35 | 3300049677 | Ga0501247_051711 | Ga0501247_051711_168_575 | 135 |
| 36 | 3300049759 | Ga0501262_069869 | Ga0501262_069869_55_462 | 135 |
| 37 | 3300049770 | Ga0501273_026108 | Ga0501273_026108_374_781 | 135 |
| 38 | 3300050513 | nmdc:mga0rr50_199769_c1 | nmdc:mga0rr50_199769_c1_978_1385 | 135 |
| 39 | 3300050514 | nmdc:mga08x19_58901_c1 | nmdc:mga08x19_58901_c1_180_587 | 135 |
| 40 | 3300050514 | nmdc:mga08x19_61341_c1 | nmdc:mga08x19_61341_c1_1752_2159 | 135 |
| 41 | 3300050514 | nmdc:mga08x19_648199_c1 | nmdc:mga08x19_648199_c1_270_677 | 135 |
| 42 | 2162886012 | MBSR1b_contig_3103743 | MBSR1b_0230.00005310 | 136 |
| 43 | 3300000546 | LJNas_1001286 | LJNas_10012864 | 136 |
| 44 | 3300001976 | JGI24752J21851_1001233 | JGI24752J21851_10012332 | 136 |
| 45 | 3300001990 | JGI24737J22298_10029521 | JGI24737J22298_100295213 | 136 |
| 46 | 3300002075 | JGI24738J21930_10128631 | JGI24738J21930_101286312 | 136 |
| 47 | 3300002459 | JGI24751J29686_10002071 | JGI24751J29686_100020713 | 136 |
| 48 | 3300004800 | Ga0058861_12048564 | Ga0058861_120485641 | 136 |
| 49 | 3300004803 | Ga0058862_10173224 | Ga0058862_101732242 | 136 |
| 50 | 3300004803 | Ga0058862_12495541 | Ga0058862_124955411 | 136 |
| 51 | 3300004803 | Ga0058862_12808140 | Ga0058862_128081401 | 136 |
| 52 | 3300005290 | Ga0065712_10221444 | Ga0065712_102214442 | 136 |
| 53 | 3300005290 | Ga0065712_10285988 | Ga0065712_102859881 | 136 |
| 54 | 3300005293 | Ga0065715_10117766 | Ga0065715_101177662 | 136 |
| 55 | 3300005293 | Ga0065715_10293036 | Ga0065715_102930362 | 136 |
| 56 | 3300005327 | Ga0070658_10012556 | Ga0070658_100125562 | 136 |
| 57 | 3300005327 | Ga0070658_10126712 | Ga0070658_101267122 | 136 |
| 58 | 3300005327 | Ga0070658_10469987 | Ga0070658_104699872 | 136 |
| 59 | 3300005328 | Ga0070676_10056461 | Ga0070676_100564612 | 136 |
| 60 | 3300005328 | Ga0070676_10147316 | Ga0070676_101473162 | 136 |
| 61 | 3300005329 | Ga0070683_100033697 | Ga0070683_1000336972 | 136 |
| 62 | 3300005329 | Ga0070683_100061593 | Ga0070683_1000615932 | 136 |
| 63 | 3300005329 | Ga0070683_100200803 | Ga0070683_1002008033 | 136 |
| 64 | 3300005329 | Ga0070683_100386630 | Ga0070683_1003866302 | 136 |
| 65 | 3300005330 | Ga0070690_100109606 | Ga0070690_1001096062 | 136 |
| 66 | 3300005334 | Ga0068869_100010295 | Ga0068869_1000102952 | 136 |
| 67 | 3300005334 | Ga0068869_100088922 | Ga0068869_1000889222 | 136 |
| 68 | 3300005334 | Ga0068869_100566738 | Ga0068869_1005667382 | 136 |
| 69 | 3300005334 | Ga0068869_100943758 | Ga0068869_1009437582 | 136 |
| 70 | 3300005335 | Ga0070666_10012660 | Ga0070666_100126606 | 136 |
| 71 | 3300005335 | Ga0070666_10042597 | Ga0070666_100425974 | 136 |
| 72 | 3300005335 | Ga0070666_10043191 | Ga0070666_100431913 | 136 |
| 73 | 3300005336 | Ga0070680_100057956 | Ga0070680_1000579564 | 136 |
| 74 | 3300005336 | Ga0070680_100098968 | Ga0070680_1000989681 | 136 |
| 75 | 3300005336 | Ga0070680_100107842 | Ga0070680_1001078423 | 136 |
| 76 | 3300005336 | Ga0070680_100316411 | Ga0070680_1003164112 | 136 |
| 77 | 3300005336 | Ga0070680_100553854 | Ga0070680_1005538542 | 136 |
| 78 | 3300005336 | Ga0070680_101930996 | Ga0070680_1019309961 | 136 |
| 79 | 3300005337 | Ga0070682_100038919 | Ga0070682_1000389194 | 136 |
| 80 | 3300005337 | Ga0070682_100068528 | Ga0070682_1000685283 | 136 |
| 81 | 3300005337 | Ga0070682_100074862 | Ga0070682_1000748624 | 136 |
| 82 | 3300005337 | Ga0070682_100091560 | Ga0070682_1000915602 | 136 |
| 83 | 3300005337 | Ga0070682_101406599 | Ga0070682_1014065991 | 136 |
| 84 | 3300005338 | Ga0068868_100031072 | Ga0068868_1000310724 | 136 |
| 85 | 3300005338 | Ga0068868_100034745 | Ga0068868_1000347454 | 136 |
| 86 | 3300005338 | Ga0068868_100146134 | Ga0068868_1001461341 | 136 |
| 87 | 3300005338 | Ga0068868_100208146 | Ga0068868_1002081463 | 136 |
| 88 | 3300005339 | Ga0070660_100003963 | Ga0070660_10000396311 | 136 |
| 89 | 3300005339 | Ga0070660_100011766 | Ga0070660_1000117666 | 136 |
| 90 | 3300005339 | Ga0070660_100019856 | Ga0070660_1000198565 | 136 |
| 91 | 3300005339 | Ga0070660_100042003 | Ga0070660_1000420033 | 136 |
| 92 | 3300005339 | Ga0070660_101260305 | Ga0070660_1012603051 | 136 |
| 93 | 3300005340 | Ga0070689_100018894 | Ga0070689_1000188944 | 136 |
| 94 | 3300005341 | Ga0070691_10114657 | Ga0070691_101146572 | 136 |
| 95 | 3300005343 | Ga0070687_100629509 | Ga0070687_1006295092 | 136 |
| 96 | 3300005344 | Ga0070661_100016945 | Ga0070661_1000169452 | 136 |
| 97 | 3300005344 | Ga0070661_100030495 | Ga0070661_1000304955 | 136 |
| 98 | 3300005345 | Ga0070692_10111019 | Ga0070692_101110192 | 136 |
| 99 | 3300005345 | Ga0070692_10274097 | Ga0070692_102740973 | 136 |
| 100 | 3300005347 | Ga0070668_100035071 | Ga0070668_1000350715 | 136 |
| 101 | 3300005347 | Ga0070668_100042879 | Ga0070668_1000428794 | 136 |
| 102 | 3300005354 | Ga0070675_100484212 | Ga0070675_1004842122 | 136 |
| 103 | 3300005354 | Ga0070675_100628569 | Ga0070675_1006285692 | 136 |
| 104 | 3300005355 | Ga0070671_100010322 | Ga0070671_1000103223 | 136 |
| 105 | 3300005355 | Ga0070671_101714198 | Ga0070671_1017141981 | 136 |
| 106 | 3300005364 | Ga0070673_100069246 | Ga0070673_1000692465 | 136 |
| 107 | 3300005364 | Ga0070673_100516358 | Ga0070673_1005163582 | 136 |
| 108 | 3300005365 | Ga0070688_100005987 | Ga0070688_1000059875 | 136 |
| 109 | 3300005365 | Ga0070688_100067329 | Ga0070688_1000673292 | 136 |
| 110 | 3300005366 | Ga0070659_100003656 | Ga0070659_1000036565 | 136 |
| 111 | 3300005366 | Ga0070659_100004062 | Ga0070659_1000040623 | 136 |
| 112 | 3300005366 | Ga0070659_100091787 | Ga0070659_1000917872 | 136 |
| 113 | 3300005366 | Ga0070659_100650862 | Ga0070659_1006508622 | 136 |
| 114 | 3300005367 | Ga0070667_100119224 | Ga0070667_1001192242 | 136 |
| 115 | 3300005367 | Ga0070667_100225488 | Ga0070667_1002254882 | 136 |
| 116 | 3300005367 | Ga0070667_100370220 | Ga0070667_1003702202 | 136 |
| 117 | 3300005434 | Ga0070709_10000577 | Ga0070709_100005776 | 136 |
| 118 | 3300005434 | Ga0070709_10012342 | Ga0070709_100123422 | 136 |
| 119 | 3300005434 | Ga0070709_10066236 | Ga0070709_100662364 | 136 |
| 120 | 3300005434 | Ga0070709_10069913 | Ga0070709_100699134 | 136 |
| 121 | 3300005434 | Ga0070709_10122549 | Ga0070709_101225492 | 136 |
| 122 | 3300005434 | Ga0070709_10264981 | Ga0070709_102649812 | 136 |
| 123 | 3300005434 | Ga0070709_10278304 | Ga0070709_102783041 | 136 |
| 124 | 3300005434 | Ga0070709_10405357 | Ga0070709_104053571 | 136 |
| 125 | 3300005434 | Ga0070709_10406155 | Ga0070709_104061551 | 136 |
| 126 | 3300005434 | Ga0070709_10455508 | Ga0070709_104555082 | 136 |
| 127 | 3300005434 | Ga0070709_11242588 | Ga0070709_112425881 | 136 |
| 128 | 3300005435 | Ga0070714_100000071 | Ga0070714_10000007123 | 136 |
| 129 | 3300005435 | Ga0070714_100021042 | Ga0070714_1000210424 | 136 |
| 130 | 3300005435 | Ga0070714_100139917 | Ga0070714_1001399173 | 136 |
| 131 | 3300005435 | Ga0070714_100150155 | Ga0070714_1001501552 | 136 |
| 132 | 3300005435 | Ga0070714_100327416 | Ga0070714_1003274162 | 136 |
| 133 | 3300005435 | Ga0070714_100399601 | Ga0070714_1003996012 | 136 |
| 134 | 3300005435 | Ga0070714_100768180 | Ga0070714_1007681802 | 136 |
| 135 | 3300005435 | Ga0070714_100804929 | Ga0070714_1008049292 | 136 |
| 136 | 3300005435 | Ga0070714_100852706 | Ga0070714_1008527062 | 136 |
| 137 | 3300005435 | Ga0070714_101216411 | Ga0070714_1012164111 | 136 |
| 138 | 3300005435 | Ga0070714_101467448 | Ga0070714_1014674482 | 136 |
| 139 | 3300005435 | Ga0070714_101845639 | Ga0070714_1018456391 | 136 |
| 140 | 3300005435 | Ga0070714_101971904 | Ga0070714_1019719041 | 136 |
| 141 | 3300005436 | Ga0070713_100000176 | Ga0070713_10000017649 | 136 |
| 142 | 3300005436 | Ga0070713_100001833 | Ga0070713_1000018336 | 136 |
| 143 | 3300005436 | Ga0070713_100008088 | Ga0070713_10000808811 | 136 |
| 144 | 3300005436 | Ga0070713_100022893 | Ga0070713_1000228932 | 136 |
| 145 | 3300005436 | Ga0070713_100030299 | Ga0070713_1000302992 | 136 |
| 146 | 3300005436 | Ga0070713_100068600 | Ga0070713_1000686005 | 136 |
| 147 | 3300005436 | Ga0070713_100075733 | Ga0070713_1000757333 | 136 |
| 148 | 3300005436 | Ga0070713_100081923 | Ga0070713_1000819234 | 136 |
| 149 | 3300005436 | Ga0070713_100082933 | Ga0070713_1000829334 | 136 |
| 150 | 3300005436 | Ga0070713_100099365 | Ga0070713_1000993652 | 136 |
| 151 | 3300005436 | Ga0070713_100169307 | Ga0070713_1001693072 | 136 |
| 152 | 3300005436 | Ga0070713_100216338 | Ga0070713_1002163382 | 136 |
| 153 | 3300005436 | Ga0070713_100267590 | Ga0070713_1002675902 | 136 |
| 154 | 3300005436 | Ga0070713_100583341 | Ga0070713_1005833412 | 136 |
| 155 | 3300005436 | Ga0070713_100733290 | Ga0070713_1007332902 | 136 |
| 156 | 3300005436 | Ga0070713_100760159 | Ga0070713_1007601592 | 136 |
| 157 | 3300005436 | Ga0070713_101742762 | Ga0070713_1017427622 | 136 |
| 158 | 3300005437 | Ga0070710_10001044 | Ga0070710_100010445 | 136 |
| 159 | 3300005437 | Ga0070710_10015921 | Ga0070710_100159213 | 136 |
| 160 | 3300005437 | Ga0070710_10029547 | Ga0070710_100295473 | 136 |
| 161 | 3300005437 | Ga0070710_10036520 | Ga0070710_100365203 | 136 |
| 162 | 3300005437 | Ga0070710_10111175 | Ga0070710_101111753 | 136 |
| 163 | 3300005437 | Ga0070710_10166449 | Ga0070710_101664492 | 136 |
| 164 | 3300005437 | Ga0070710_10382827 | Ga0070710_103828272 | 136 |
| 165 | 3300005437 | Ga0070710_10403632 | Ga0070710_104036322 | 136 |
| 166 | 3300005439 | Ga0070711_100000966 | Ga0070711_10000096610 | 136 |
| 167 | 3300005439 | Ga0070711_100006410 | Ga0070711_1000064104 | 136 |
| 168 | 3300005439 | Ga0070711_100019818 | Ga0070711_1000198185 | 136 |
| 169 | 3300005439 | Ga0070711_100034830 | Ga0070711_1000348301 | 136 |
| 170 | 3300005439 | Ga0070711_100081544 | Ga0070711_1000815443 | 136 |
| 171 | 3300005439 | Ga0070711_100289916 | Ga0070711_1002899162 | 136 |
| 172 | 3300005439 | Ga0070711_100327592 | Ga0070711_1003275922 | 136 |
| 173 | 3300005439 | Ga0070711_100569822 | Ga0070711_1005698222 | 136 |
| 174 | 3300005439 | Ga0070711_100649946 | Ga0070711_1006499462 | 136 |
| 175 | 3300005439 | Ga0070711_100719581 | Ga0070711_1007195811 | 136 |
| 176 | 3300005439 | Ga0070711_100765134 | Ga0070711_1007651341 | 136 |
| 177 | 3300005441 | Ga0070700_100424645 | Ga0070700_1004246452 | 136 |
| 178 | 3300005444 | Ga0070694_100815446 | Ga0070694_1008154462 | 136 |
| 179 | 3300005445 | Ga0070708_100000595 | Ga0070708_1000005959 | 136 |
| 180 | 3300005445 | Ga0070708_100011692 | Ga0070708_1000116922 | 136 |
| 181 | 3300005445 | Ga0070708_100069650 | Ga0070708_1000696504 | 136 |
| 182 | 3300005445 | Ga0070708_100073060 | Ga0070708_1000730602 | 136 |
| 183 | 3300005445 | Ga0070708_100137597 | Ga0070708_1001375973 | 136 |
| 184 | 3300005445 | Ga0070708_100145777 | Ga0070708_1001457773 | 136 |
| 185 | 3300005445 | Ga0070708_100208923 | Ga0070708_1002089233 | 136 |
| 186 | 3300005445 | Ga0070708_100337751 | Ga0070708_1003377512 | 136 |
| 187 | 3300005445 | Ga0070708_100396239 | Ga0070708_1003962392 | 136 |
| 188 | 3300005445 | Ga0070708_100418570 | Ga0070708_1004185702 | 136 |
| 189 | 3300005445 | Ga0070708_100734208 | Ga0070708_1007342082 | 136 |
| 190 | 3300005445 | Ga0070708_100820744 | Ga0070708_1008207442 | 136 |
| 191 | 3300005445 | Ga0070708_100994811 | Ga0070708_1009948111 | 136 |
| 192 | 3300005445 | Ga0070708_101508779 | Ga0070708_1015087791 | 136 |
| 193 | 3300005455 | Ga0070663_100180871 | Ga0070663_1001808712 | 136 |
| 194 | 3300005455 | Ga0070663_100334586 | Ga0070663_1003345862 | 136 |
| 195 | 3300005455 | Ga0070663_100522690 | Ga0070663_1005226902 | 136 |
| 196 | 3300005456 | Ga0070678_100217439 | Ga0070678_1002174392 | 136 |
| 197 | 3300005457 | Ga0070662_100020018 | Ga0070662_1000200186 | 136 |
| 198 | 3300005457 | Ga0070662_100049803 | Ga0070662_1000498033 | 136 |
| 199 | 3300005457 | Ga0070662_100253587 | Ga0070662_1002535871 | 136 |
| 200 | 3300005458 | Ga0070681_10005766 | Ga0070681_100057666 | 136 |
| 201 | 3300005458 | Ga0070681_10039804 | Ga0070681_100398046 | 136 |
| 202 | 3300005458 | Ga0070681_10186398 | Ga0070681_101863983 | 136 |
| 203 | 3300005458 | Ga0070681_10242387 | Ga0070681_102423872 | 136 |
| 204 | 3300005458 | Ga0070681_10317488 | Ga0070681_103174883 | 136 |
| 205 | 3300005458 | Ga0070681_10335787 | Ga0070681_103357873 | 136 |
| 206 | 3300005458 | Ga0070681_10515088 | Ga0070681_105150882 | 136 |
| 207 | 3300005459 | Ga0068867_100042005 | Ga0068867_1000420052 | 136 |
| 208 | 3300005459 | Ga0068867_100168888 | Ga0068867_1001688882 | 136 |
| 209 | 3300005459 | Ga0068867_100935427 | Ga0068867_1009354272 | 136 |
| 210 | 3300005466 | Ga0070685_10001863 | Ga0070685_100018637 | 136 |
| 211 | 3300005466 | Ga0070685_11079479 | Ga0070685_110794791 | 136 |
| 212 | 3300005467 | Ga0070706_100005807 | Ga0070706_1000058076 | 136 |
| 213 | 3300005467 | Ga0070706_100006462 | Ga0070706_10000646211 | 136 |
| 214 | 3300005467 | Ga0070706_100016205 | Ga0070706_1000162055 | 136 |
| 215 | 3300005467 | Ga0070706_100074300 | Ga0070706_1000743002 | 136 |
| 216 | 3300005467 | Ga0070706_100077449 | Ga0070706_1000774494 | 136 |
| 217 | 3300005467 | Ga0070706_100175311 | Ga0070706_1001753112 | 136 |
| 218 | 3300005467 | Ga0070706_100233742 | Ga0070706_1002337422 | 136 |
| 219 | 3300005467 | Ga0070706_100679913 | Ga0070706_1006799132 | 136 |
| 220 | 3300005467 | Ga0070706_100933752 | Ga0070706_1009337522 | 136 |
| 221 | 3300005467 | Ga0070706_101293443 | Ga0070706_1012934431 | 136 |
| 222 | 3300005468 | Ga0070707_100010010 | Ga0070707_1000100104 | 136 |
| 223 | 3300005468 | Ga0070707_100113614 | Ga0070707_1001136144 | 136 |
| 224 | 3300005468 | Ga0070707_100230121 | Ga0070707_1002301212 | 136 |
| 225 | 3300005468 | Ga0070707_100308198 | Ga0070707_1003081982 | 136 |
| 226 | 3300005468 | Ga0070707_100470196 | Ga0070707_1004701962 | 136 |
| 227 | 3300005468 | Ga0070707_100567695 | Ga0070707_1005676952 | 136 |
| 228 | 3300005468 | Ga0070707_100584067 | Ga0070707_1005840672 | 136 |
| 229 | 3300005468 | Ga0070707_101285626 | Ga0070707_1012856262 | 136 |
| 230 | 3300005468 | Ga0070707_101868824 | Ga0070707_1018688241 | 136 |
| 231 | 3300005471 | Ga0070698_100001986 | Ga0070698_1000019869 | 136 |
| 232 | 3300005471 | Ga0070698_100269984 | Ga0070698_1002699841 | 136 |
| 233 | 3300005471 | Ga0070698_100509698 | Ga0070698_1005096981 | 136 |
| 234 | 3300005518 | Ga0070699_100000769 | Ga0070699_10000076924 | 136 |
| 235 | 3300005518 | Ga0070699_100014509 | Ga0070699_1000145097 | 136 |
| 236 | 3300005518 | Ga0070699_100014709 | Ga0070699_1000147094 | 136 |
| 237 | 3300005518 | Ga0070699_100049489 | Ga0070699_1000494893 | 136 |
| 238 | 3300005518 | Ga0070699_100334669 | Ga0070699_1003346691 | 136 |
| 239 | 3300005518 | Ga0070699_100696696 | Ga0070699_1006966961 | 136 |
| 240 | 3300005518 | Ga0070699_100860778 | Ga0070699_1008607782 | 136 |
| 241 | 3300005530 | Ga0070679_100014705 | Ga0070679_1000147058 | 136 |
| 242 | 3300005530 | Ga0070679_100068802 | Ga0070679_1000688023 | 136 |
| 243 | 3300005530 | Ga0070679_100076010 | Ga0070679_1000760104 | 136 |
| 244 | 3300005530 | Ga0070679_100080979 | Ga0070679_1000809792 | 136 |
| 245 | 3300005530 | Ga0070679_100178985 | Ga0070679_1001789854 | 136 |
| 246 | 3300005530 | Ga0070679_100215062 | Ga0070679_1002150623 | 136 |
| 247 | 3300005530 | Ga0070679_100252381 | Ga0070679_1002523813 | 136 |
| 248 | 3300005530 | Ga0070679_100316721 | Ga0070679_1003167212 | 136 |
| 249 | 3300005530 | Ga0070679_100361488 | Ga0070679_1003614881 | 136 |
| 250 | 3300005530 | Ga0070679_100401953 | Ga0070679_1004019533 | 136 |
| 251 | 3300005530 | Ga0070679_100512394 | Ga0070679_1005123942 | 136 |
| 252 | 3300005535 | Ga0070684_100084995 | Ga0070684_1000849955 | 136 |
| 253 | 3300005535 | Ga0070684_100156199 | Ga0070684_1001561992 | 136 |
| 254 | 3300005535 | Ga0070684_100172317 | Ga0070684_1001723172 | 136 |
| 255 | 3300005535 | Ga0070684_100245401 | Ga0070684_1002454012 | 136 |
| 256 | 3300005535 | Ga0070684_101521376 | Ga0070684_1015213762 | 136 |
| 257 | 3300005536 | Ga0070697_100000481 | Ga0070697_1000004814 | 136 |
| 258 | 3300005536 | Ga0070697_100000712 | Ga0070697_1000007127 | 136 |
| 259 | 3300005536 | Ga0070697_100002501 | Ga0070697_1000025012 | 136 |
| 260 | 3300005536 | Ga0070697_100004639 | Ga0070697_10000463910 | 136 |
| 261 | 3300005536 | Ga0070697_100005737 | Ga0070697_1000057376 | 136 |
| 262 | 3300005536 | Ga0070697_100041960 | Ga0070697_1000419605 | 136 |
| 263 | 3300005536 | Ga0070697_100075138 | Ga0070697_1000751384 | 136 |
| 264 | 3300005536 | Ga0070697_100256754 | Ga0070697_1002567543 | 136 |
| 265 | 3300005536 | Ga0070697_100294565 | Ga0070697_1002945652 | 136 |
| 266 | 3300005536 | Ga0070697_100340961 | Ga0070697_1003409612 | 136 |
| 267 | 3300005536 | Ga0070697_100787819 | Ga0070697_1007878192 | 136 |
| 268 | 3300005536 | Ga0070697_100812642 | Ga0070697_1008126422 | 136 |
| 269 | 3300005536 | Ga0070697_100858285 | Ga0070697_1008582851 | 136 |
| 270 | 3300005536 | Ga0070697_100923447 | Ga0070697_1009234472 | 136 |
| 271 | 3300005536 | Ga0070697_100934482 | Ga0070697_1009344822 | 136 |
| 272 | 3300005536 | Ga0070697_101295908 | Ga0070697_1012959081 | 136 |
| 273 | 3300005536 | Ga0070697_101973301 | Ga0070697_1019733011 | 136 |
| 274 | 3300005539 | Ga0068853_100000036 | Ga0068853_10000003668 | 136 |
| 275 | 3300005539 | Ga0068853_100012160 | Ga0068853_1000121605 | 136 |
| 276 | 3300005539 | Ga0068853_100030470 | Ga0068853_1000304703 | 136 |
| 277 | 3300005539 | Ga0068853_100112150 | Ga0068853_1001121504 | 136 |
| 278 | 3300005539 | Ga0068853_101022687 | Ga0068853_1010226872 | 136 |
| 279 | 3300005539 | Ga0068853_102124754 | Ga0068853_1021247541 | 136 |
| 280 | 3300005543 | Ga0070672_100150419 | Ga0070672_1001504192 | 136 |
| 281 | 3300005543 | Ga0070672_100297164 | Ga0070672_1002971642 | 136 |
| 282 | 3300005544 | Ga0070686_100007681 | Ga0070686_1000076813 | 136 |
| 283 | 3300005544 | Ga0070686_100064100 | Ga0070686_1000641002 | 136 |
| 284 | 3300005544 | Ga0070686_100185470 | Ga0070686_1001854702 | 136 |
| 285 | 3300005545 | Ga0070695_100123754 | Ga0070695_1001237542 | 136 |
| 286 | 3300005545 | Ga0070695_100328201 | Ga0070695_1003282012 | 136 |
| 287 | 3300005545 | Ga0070695_100345271 | Ga0070695_1003452712 | 136 |
| 288 | 3300005546 | Ga0070696_100174116 | Ga0070696_1001741161 | 136 |
| 289 | 3300005546 | Ga0070696_100223225 | Ga0070696_1002232252 | 136 |
| 290 | 3300005546 | Ga0070696_100667623 | Ga0070696_1006676231 | 136 |
| 291 | 3300005547 | Ga0070693_100071182 | Ga0070693_1000711823 | 136 |
| 292 | 3300005547 | Ga0070693_100204476 | Ga0070693_1002044761 | 136 |
| 293 | 3300005547 | Ga0070693_100324499 | Ga0070693_1003244992 | 136 |
| 294 | 3300005548 | Ga0070665_100002872 | Ga0070665_10000287212 | 136 |
| 295 | 3300005548 | Ga0070665_100019435 | Ga0070665_1000194356 | 136 |
| 296 | 3300005548 | Ga0070665_100062001 | Ga0070665_1000620012 | 136 |
| 297 | 3300005549 | Ga0070704_100136115 | Ga0070704_1001361152 | 136 |
| 298 | 3300005563 | Ga0068855_100027264 | Ga0068855_1000272646 | 136 |
| 299 | 3300005563 | Ga0068855_100033347 | Ga0068855_1000333479 | 136 |
| 300 | 3300005563 | Ga0068855_100052534 | Ga0068855_1000525344 | 136 |
| 301 | 3300005563 | Ga0068855_100103998 | Ga0068855_1001039982 | 136 |
| 302 | 3300005563 | Ga0068855_100195281 | Ga0068855_1001952814 | 136 |
| 303 | 3300005563 | Ga0068855_100287020 | Ga0068855_1002870203 | 136 |
| 304 | 3300005563 | Ga0068855_100321471 | Ga0068855_1003214712 | 136 |
| 305 | 3300005563 | Ga0068855_100699757 | Ga0068855_1006997572 | 136 |
| 306 | 3300005564 | Ga0070664_100099739 | Ga0070664_1000997395 | 136 |
| 307 | 3300005564 | Ga0070664_100136975 | Ga0070664_1001369752 | 136 |
| 308 | 3300005564 | Ga0070664_100560452 | Ga0070664_1005604521 | 136 |
| 309 | 3300005577 | Ga0068857_100049861 | Ga0068857_1000498612 | 136 |
| 310 | 3300005577 | Ga0068857_100088069 | Ga0068857_1000880692 | 136 |
| 311 | 3300005577 | Ga0068857_100276411 | Ga0068857_1002764113 | 136 |
| 312 | 3300005578 | Ga0068854_100000016 | Ga0068854_10000001669 | 136 |
| 313 | 3300005578 | Ga0068854_100049478 | Ga0068854_1000494783 | 136 |
| 314 | 3300005578 | Ga0068854_100050453 | Ga0068854_1000504534 | 136 |
| 315 | 3300005578 | Ga0068854_100090789 | Ga0068854_1000907893 | 136 |
| 316 | 3300005578 | Ga0068854_100987272 | Ga0068854_1009872722 | 136 |
| 317 | 3300005614 | Ga0068856_100004126 | Ga0068856_10000412614 | 136 |
| 318 | 3300005614 | Ga0068856_100021897 | Ga0068856_1000218979 | 136 |
| 319 | 3300005614 | Ga0068856_100029101 | Ga0068856_1000291014 | 136 |
| 320 | 3300005614 | Ga0068856_100029645 | Ga0068856_1000296458 | 136 |
| 321 | 3300005614 | Ga0068856_100058934 | Ga0068856_1000589344 | 136 |
| 322 | 3300005614 | Ga0068856_100215148 | Ga0068856_1002151483 | 136 |
| 323 | 3300005614 | Ga0068856_100444085 | Ga0068856_1004440852 | 136 |
| 324 | 3300005614 | Ga0068856_100561208 | Ga0068856_1005612082 | 136 |
| 325 | 3300005614 | Ga0068856_100631626 | Ga0068856_1006316262 | 136 |
| 326 | 3300005614 | Ga0068856_101512608 | Ga0068856_1015126082 | 136 |
| 327 | 3300005614 | Ga0068856_101568026 | Ga0068856_1015680262 | 136 |
| 328 | 3300005615 | Ga0070702_100017900 | Ga0070702_1000179003 | 136 |
| 329 | 3300005616 | Ga0068852_100049385 | Ga0068852_1000493854 | 136 |
| 330 | 3300005616 | Ga0068852_100371910 | Ga0068852_1003719102 | 136 |
| 331 | 3300005617 | Ga0068859_100072280 | Ga0068859_1000722804 | 136 |
| 332 | 3300005617 | Ga0068859_100082517 | Ga0068859_1000825171 | 136 |
| 333 | 3300005617 | Ga0068859_100233843 | Ga0068859_1002338433 | 136 |
| 334 | 3300005617 | Ga0068859_100904383 | Ga0068859_1009043831 | 136 |
| 335 | 3300005617 | Ga0068859_102552010 | Ga0068859_1025520101 | 136 |
| 336 | 3300005618 | Ga0068864_100024157 | Ga0068864_1000241574 | 136 |
| 337 | 3300005618 | Ga0068864_100974645 | Ga0068864_1009746452 | 136 |
| 338 | 3300005718 | Ga0068866_10019938 | Ga0068866_100199383 | 136 |
| 339 | 3300005718 | Ga0068866_10224565 | Ga0068866_102245651 | 136 |
| 340 | 3300005718 | Ga0068866_10266656 | Ga0068866_102666562 | 136 |
| 341 | 3300005718 | Ga0068866_10486804 | Ga0068866_104868041 | 136 |
| 342 | 3300005719 | Ga0068861_100127387 | Ga0068861_1001273873 | 136 |
| 343 | 3300005719 | Ga0068861_100237458 | Ga0068861_1002374582 | 136 |
| 344 | 3300005834 | Ga0068851_10005216 | Ga0068851_100052165 | 136 |
| 345 | 3300005834 | Ga0068851_10098820 | Ga0068851_100988202 | 136 |
| 346 | 3300005834 | Ga0068851_10109140 | Ga0068851_101091402 | 136 |
| 347 | 3300005840 | Ga0068870_10003076 | Ga0068870_100030765 | 136 |
| 348 | 3300005840 | Ga0068870_10176439 | Ga0068870_101764392 | 136 |
| 349 | 3300005841 | Ga0068863_100025635 | Ga0068863_1000256357 | 136 |
| 350 | 3300005841 | Ga0068863_100078852 | Ga0068863_1000788523 | 136 |
| 351 | 3300005841 | Ga0068863_100124056 | Ga0068863_1001240563 | 136 |
| 352 | 3300005841 | Ga0068863_100432277 | Ga0068863_1004322772 | 136 |
| 353 | 3300005842 | Ga0068858_100006610 | Ga0068858_1000066104 | 136 |
| 354 | 3300005842 | Ga0068858_100015612 | Ga0068858_1000156125 | 136 |
| 355 | 3300005843 | Ga0068860_100078483 | Ga0068860_1000784832 | 136 |
| 356 | 3300005843 | Ga0068860_100133824 | Ga0068860_1001338244 | 136 |
| 357 | 3300005843 | Ga0068860_100238106 | Ga0068860_1002381064 | 136 |
| 358 | 3300005843 | Ga0068860_100311200 | Ga0068860_1003112002 | 136 |
| 359 | 3300005843 | Ga0068860_100934457 | Ga0068860_1009344572 | 136 |
| 360 | 3300005844 | Ga0068862_100041491 | Ga0068862_1000414914 | 136 |
| 361 | 3300005844 | Ga0068862_100094144 | Ga0068862_1000941443 | 136 |
| 362 | 3300005844 | Ga0068862_100218140 | Ga0068862_1002181402 | 136 |
| 363 | 3300006028 | Ga0070717_10001512 | Ga0070717_100015125 | 136 |
| 364 | 3300006028 | Ga0070717_10001792 | Ga0070717_1000179214 | 136 |
| 365 | 3300006028 | Ga0070717_10024162 | Ga0070717_100241626 | 136 |
| 366 | 3300006028 | Ga0070717_10027429 | Ga0070717_100274295 | 136 |
| 367 | 3300006028 | Ga0070717_10069253 | Ga0070717_100692534 | 136 |
| 368 | 3300006028 | Ga0070717_10084455 | Ga0070717_100844553 | 136 |
| 369 | 3300006028 | Ga0070717_10106763 | Ga0070717_101067632 | 136 |
| 370 | 3300006028 | Ga0070717_10143584 | Ga0070717_101435842 | 136 |
| 371 | 3300006028 | Ga0070717_10147400 | Ga0070717_101474003 | 136 |
| 372 | 3300006028 | Ga0070717_10155232 | Ga0070717_101552323 | 136 |
| 373 | 3300006028 | Ga0070717_10174302 | Ga0070717_101743023 | 136 |
| 374 | 3300006028 | Ga0070717_10225978 | Ga0070717_102259783 | 136 |
| 375 | 3300006028 | Ga0070717_10270703 | Ga0070717_102707032 | 136 |
| 376 | 3300006028 | Ga0070717_10284046 | Ga0070717_102840462 | 136 |
| 377 | 3300006028 | Ga0070717_10885821 | Ga0070717_108858211 | 136 |
| 378 | 3300006028 | Ga0070717_11110919 | Ga0070717_111109191 | 136 |
| 379 | 3300006028 | Ga0070717_11125772 | Ga0070717_111257721 | 136 |
| 380 | 3300006028 | Ga0070717_11158799 | Ga0070717_111587992 | 136 |
| 381 | 3300006028 | Ga0070717_11500681 | Ga0070717_115006812 | 136 |
| 382 | 3300006163 | Ga0070715_10001488 | Ga0070715_100014883 | 136 |
| 383 | 3300006163 | Ga0070715_10002372 | Ga0070715_100023723 | 136 |
| 384 | 3300006163 | Ga0070715_10053362 | Ga0070715_100533623 | 136 |
| 385 | 3300006173 | Ga0070716_100000165 | Ga0070716_1000001657 | 136 |
| 386 | 3300006173 | Ga0070716_100006958 | Ga0070716_1000069582 | 136 |
| 387 | 3300006173 | Ga0070716_100012077 | Ga0070716_1000120773 | 136 |
| 388 | 3300006173 | Ga0070716_100030314 | Ga0070716_1000303143 | 136 |
| 389 | 3300006173 | Ga0070716_100034500 | Ga0070716_1000345002 | 136 |
| 390 | 3300006173 | Ga0070716_100065842 | Ga0070716_1000658422 | 136 |
| 391 | 3300006173 | Ga0070716_100096122 | Ga0070716_1000961223 | 136 |
| 392 | 3300006173 | Ga0070716_100126878 | Ga0070716_1001268782 | 136 |
| 393 | 3300006173 | Ga0070716_100161379 | Ga0070716_1001613792 | 136 |
| 394 | 3300006173 | Ga0070716_100330826 | Ga0070716_1003308261 | 136 |
| 395 | 3300006173 | Ga0070716_100332352 | Ga0070716_1003323522 | 136 |
| 396 | 3300006173 | Ga0070716_100573682 | Ga0070716_1005736822 | 136 |
| 397 | 3300006173 | Ga0070716_100589073 | Ga0070716_1005890732 | 136 |
| 398 | 3300006173 | Ga0070716_100671512 | Ga0070716_1006715122 | 136 |
| 399 | 3300006173 | Ga0070716_100830313 | Ga0070716_1008303131 | 136 |
| 400 | 3300006175 | Ga0070712_100000512 | Ga0070712_10000051214 | 136 |
| 401 | 3300006175 | Ga0070712_100002724 | Ga0070712_1000027249 | 136 |
| 402 | 3300006175 | Ga0070712_100003444 | Ga0070712_1000034446 | 136 |
| 403 | 3300006175 | Ga0070712_100005055 | Ga0070712_1000050556 | 136 |
| 404 | 3300006175 | Ga0070712_100128370 | Ga0070712_1001283703 | 136 |
| 405 | 3300006175 | Ga0070712_100138688 | Ga0070712_1001386882 | 136 |
| 406 | 3300006175 | Ga0070712_100156315 | Ga0070712_1001563152 | 136 |
| 407 | 3300006175 | Ga0070712_100175004 | Ga0070712_1001750042 | 136 |
| 408 | 3300006175 | Ga0070712_100423199 | Ga0070712_1004231992 | 136 |
| 409 | 3300006175 | Ga0070712_100678739 | Ga0070712_1006787392 | 136 |
| 410 | 3300006175 | Ga0070712_101527072 | Ga0070712_1015270721 | 136 |
| 411 | 3300006237 | Ga0097621_100005593 | Ga0097621_1000055939 | 136 |
| 412 | 3300006237 | Ga0097621_100186732 | Ga0097621_1001867322 | 136 |
| 413 | 3300006237 | Ga0097621_100235117 | Ga0097621_1002351173 | 136 |
| 414 | 3300006237 | Ga0097621_100669637 | Ga0097621_1006696372 | 136 |
| 415 | 3300006237 | Ga0097621_101171811 | Ga0097621_1011718112 | 136 |
| 416 | 3300006237 | Ga0097621_102011981 | Ga0097621_1020119811 | 136 |
| 417 | 3300006358 | Ga0068871_100001005 | Ga0068871_1000010052 | 136 |
| 418 | 3300006358 | Ga0068871_100194171 | Ga0068871_1001941713 | 136 |
| 419 | 3300006358 | Ga0068871_100207314 | Ga0068871_1002073142 | 136 |
| 420 | 3300006358 | Ga0068871_100313566 | Ga0068871_1003135662 | 136 |
| 421 | 3300006358 | Ga0068871_100481107 | Ga0068871_1004811072 | 136 |
| 422 | 3300006358 | Ga0068871_100688815 | Ga0068871_1006888152 | 136 |
| 423 | 3300006852 | Ga0075433_10077924 | Ga0075433_100779242 | 136 |
| 424 | 3300006852 | Ga0075433_10404022 | Ga0075433_104040222 | 136 |
| 425 | 3300006871 | Ga0075434_100005454 | Ga0075434_10000545410 | 136 |
| 426 | 3300006871 | Ga0075434_100100731 | Ga0075434_1001007313 | 136 |
| 427 | 3300006871 | Ga0075434_100126340 | Ga0075434_1001263403 | 136 |
| 428 | 3300006881 | Ga0068865_100078921 | Ga0068865_1000789212 | 136 |
| 429 | 3300006881 | Ga0068865_100109618 | Ga0068865_1001096181 | 136 |
| 430 | 3300006881 | Ga0068865_100161534 | Ga0068865_1001615342 | 136 |
| 431 | 3300006881 | Ga0068865_100677285 | Ga0068865_1006772852 | 136 |
| 432 | 3300006914 | Ga0075436_100091462 | Ga0075436_1000914623 | 136 |
| 433 | 3300006914 | Ga0075436_100860353 | Ga0075436_1008603531 | 136 |
| 434 | 3300006931 | Ga0097620_100072279 | Ga0097620_1000722794 | 136 |
| 435 | 3300006931 | Ga0097620_100082514 | Ga0097620_1000825141 | 136 |
| 436 | 3300006931 | Ga0097620_100233856 | Ga0097620_1002338563 | 136 |
| 437 | 3300006931 | Ga0097620_100904536 | Ga0097620_1009045361 | 136 |
| 438 | 3300006931 | Ga0097620_102552525 | Ga0097620_1025525252 | 136 |
| 439 | 3300007076 | Ga0075435_101031404 | Ga0075435_1010314042 | 136 |
| 440 | 3300007076 | Ga0075435_101909289 | Ga0075435_1019092891 | 136 |
| 441 | 3300007788 | Ga0099795_10029274 | Ga0099795_100292742 | 136 |
| 442 | 3300007788 | Ga0099795_10068657 | Ga0099795_100686573 | 136 |
| 443 | 3300007788 | Ga0099795_10133261 | Ga0099795_101332612 | 136 |
| 444 | 3300007788 | Ga0099795_10290377 | Ga0099795_102903771 | 136 |
| 445 | 3300009092 | Ga0105250_10059622 | Ga0105250_100596222 | 136 |
| 446 | 3300009092 | Ga0105250_10090811 | Ga0105250_100908112 | 136 |
| 447 | 3300009093 | Ga0105240_10011052 | Ga0105240_1001105212 | 136 |
| 448 | 3300009093 | Ga0105240_10017920 | Ga0105240_100179209 | 136 |
| 449 | 3300009093 | Ga0105240_10057321 | Ga0105240_100573215 | 136 |
| 450 | 3300009093 | Ga0105240_10203049 | Ga0105240_102030493 | 136 |
| 451 | 3300009093 | Ga0105240_10203311 | Ga0105240_102033112 | 136 |
| 452 | 3300009093 | Ga0105240_10227639 | Ga0105240_102276393 | 136 |
| 453 | 3300009093 | Ga0105240_10280119 | Ga0105240_102801194 | 136 |
| 454 | 3300009093 | Ga0105240_10387689 | Ga0105240_103876893 | 136 |
| 455 | 3300009093 | Ga0105240_10425086 | Ga0105240_104250862 | 136 |
| 456 | 3300009093 | Ga0105240_10693976 | Ga0105240_106939762 | 136 |
| 457 | 3300009093 | Ga0105240_10741823 | Ga0105240_107418232 | 136 |
| 458 | 3300009093 | Ga0105240_10772516 | Ga0105240_107725162 | 136 |
| 459 | 3300009094 | Ga0111539_13422582 | Ga0111539_134225821 | 136 |
| 460 | 3300009098 | Ga0105245_10004851 | Ga0105245_100048515 | 136 |
| 461 | 3300009098 | Ga0105245_10009762 | Ga0105245_100097627 | 136 |
| 462 | 3300009098 | Ga0105245_10016455 | Ga0105245_100164557 | 136 |
| 463 | 3300009098 | Ga0105245_10020232 | Ga0105245_100202324 | 136 |
| 464 | 3300009098 | Ga0105245_10186384 | Ga0105245_101863842 | 136 |
| 465 | 3300009098 | Ga0105245_10351218 | Ga0105245_103512182 | 136 |
| 466 | 3300009101 | Ga0105247_10005153 | Ga0105247_1000515310 | 136 |
| 467 | 3300009101 | Ga0105247_10113834 | Ga0105247_101138343 | 136 |
| 468 | 3300009101 | Ga0105247_10117294 | Ga0105247_101172941 | 136 |
| 469 | 3300009101 | Ga0105247_10312901 | Ga0105247_103129012 | 136 |
| 470 | 3300009101 | Ga0105247_10718445 | Ga0105247_107184452 | 136 |
| 471 | 3300009147 | Ga0114129_10134956 | Ga0114129_101349564 | 136 |
| 472 | 3300009148 | Ga0105243_10010844 | Ga0105243_100108445 | 136 |
| 473 | 3300009148 | Ga0105243_10827306 | Ga0105243_108273061 | 136 |
| 474 | 3300009174 | Ga0105241_10014792 | Ga0105241_100147926 | 136 |
| 475 | 3300009174 | Ga0105241_10024356 | Ga0105241_100243564 | 136 |
| 476 | 3300009174 | Ga0105241_10052926 | Ga0105241_100529264 | 136 |
| 477 | 3300009174 | Ga0105241_10103390 | Ga0105241_101033902 | 136 |
| 478 | 3300009174 | Ga0105241_10169467 | Ga0105241_101694672 | 136 |
| 479 | 3300009174 | Ga0105241_10392461 | Ga0105241_103924611 | 136 |
| 480 | 3300009174 | Ga0105241_10921061 | Ga0105241_109210612 | 136 |
| 481 | 3300009174 | Ga0105241_10981569 | Ga0105241_109815691 | 136 |
| 482 | 3300009174 | Ga0105241_11112823 | Ga0105241_111128232 | 136 |
| 483 | 3300009174 | Ga0105241_11313187 | Ga0105241_113131872 | 136 |
| 484 | 3300009176 | Ga0105242_10014914 | Ga0105242_100149145 | 136 |
| 485 | 3300009176 | Ga0105242_10051360 | Ga0105242_100513603 | 136 |
| 486 | 3300009176 | Ga0105242_10085880 | Ga0105242_100858802 | 136 |
| 487 | 3300009176 | Ga0105242_10183599 | Ga0105242_101835994 | 136 |
| 488 | 3300009176 | Ga0105242_10302212 | Ga0105242_103022123 | 136 |
| 489 | 3300009176 | Ga0105242_11020491 | Ga0105242_110204912 | 136 |
| 490 | 3300009177 | Ga0105248_10006030 | Ga0105248_1000603011 | 136 |
| 491 | 3300009177 | Ga0105248_10022462 | Ga0105248_100224625 | 136 |
| 492 | 3300009177 | Ga0105248_10033924 | Ga0105248_100339244 | 136 |
| 493 | 3300009177 | Ga0105248_10040691 | Ga0105248_100406915 | 136 |
| 494 | 3300009177 | Ga0105248_10046669 | Ga0105248_100466695 | 136 |
| 495 | 3300009177 | Ga0105248_10099568 | Ga0105248_100995681 | 136 |
| 496 | 3300009177 | Ga0105248_10653666 | Ga0105248_106536662 | 136 |
| 497 | 3300009177 | Ga0105248_10960232 | Ga0105248_109602322 | 136 |
| 498 | 3300009545 | Ga0105237_10145036 | Ga0105237_101450362 | 136 |
| 499 | 3300009545 | Ga0105237_10185600 | Ga0105237_101856002 | 136 |
| 500 | 3300009545 | Ga0105237_10216712 | Ga0105237_102167122 | 136 |
| 501 | 3300009545 | Ga0105237_10238627 | Ga0105237_102386272 | 136 |
| 502 | 3300009545 | Ga0105237_10442818 | Ga0105237_104428183 | 136 |
| 503 | 3300009545 | Ga0105237_10486380 | Ga0105237_104863802 | 136 |
| 504 | 3300009545 | Ga0105237_10493746 | Ga0105237_104937462 | 136 |
| 505 | 3300009545 | Ga0105237_10574824 | Ga0105237_105748242 | 136 |
| 506 | 3300009545 | Ga0105237_10640727 | Ga0105237_106407272 | 136 |
| 507 | 3300009545 | Ga0105237_10826068 | Ga0105237_108260682 | 136 |
| 508 | 3300009545 | Ga0105237_10888205 | Ga0105237_108882051 | 136 |
| 509 | 3300009551 | Ga0105238_10069773 | Ga0105238_100697734 | 136 |
| 510 | 3300009551 | Ga0105238_10159725 | Ga0105238_101597253 | 136 |
| 511 | 3300009551 | Ga0105238_10160120 | Ga0105238_101601203 | 136 |
| 512 | 3300009551 | Ga0105238_10250500 | Ga0105238_102505002 | 136 |
| 513 | 3300009551 | Ga0105238_11537681 | Ga0105238_115376812 | 136 |
| 514 | 3300009551 | Ga0105238_12789853 | Ga0105238_127898531 | 136 |
| 515 | 3300009553 | Ga0105249_10006219 | Ga0105249_1000621912 | 136 |
| 516 | 3300009553 | Ga0105249_10089016 | Ga0105249_100890164 | 136 |
| 517 | 3300010159 | Ga0099796_10083568 | Ga0099796_100835682 | 136 |
| 518 | 3300010375 | Ga0105239_10015139 | Ga0105239_100151393 | 136 |
| 519 | 3300010375 | Ga0105239_10117996 | Ga0105239_101179962 | 136 |
| 520 | 3300010375 | Ga0105239_10121809 | Ga0105239_101218094 | 136 |
| 521 | 3300010375 | Ga0105239_10125781 | Ga0105239_101257815 | 136 |
| 522 | 3300010375 | Ga0105239_10146891 | Ga0105239_101468913 | 136 |
| 523 | 3300010375 | Ga0105239_10209637 | Ga0105239_102096373 | 136 |
| 524 | 3300010375 | Ga0105239_10283736 | Ga0105239_102837363 | 136 |
| 525 | 3300010375 | Ga0105239_10587043 | Ga0105239_105870431 | 136 |
| 526 | 3300010375 | Ga0105239_10715296 | Ga0105239_107152963 | 136 |
| 527 | 3300010375 | Ga0105239_10799726 | Ga0105239_107997262 | 136 |
| 528 | 3300010375 | Ga0105239_10920790 | Ga0105239_109207902 | 136 |
| 529 | 3300010375 | Ga0105239_11006269 | Ga0105239_110062692 | 136 |
| 530 | 3300011119 | Ga0105246_10011057 | Ga0105246_100110577 | 136 |
| 531 | 3300011119 | Ga0105246_10149635 | Ga0105246_101496352 | 136 |
| 532 | 3300013100 | Ga0157373_10018541 | Ga0157373_100185415 | 136 |
| 533 | 3300013100 | Ga0157373_10022240 | Ga0157373_100222404 | 136 |
| 534 | 3300013100 | Ga0157373_10124675 | Ga0157373_101246753 | 136 |
| 535 | 3300013100 | Ga0157373_10202892 | Ga0157373_102028922 | 136 |
| 536 | 3300013100 | Ga0157373_10331298 | Ga0157373_103312982 | 136 |
| 537 | 3300013102 | Ga0157371_10044943 | Ga0157371_100449433 | 136 |
| 538 | 3300013102 | Ga0157371_10153483 | Ga0157371_101534833 | 136 |
| 539 | 3300013104 | Ga0157370_10055091 | Ga0157370_100550914 | 136 |
| 540 | 3300013104 | Ga0157370_10058746 | Ga0157370_100587462 | 136 |
| 541 | 3300013104 | Ga0157370_10175265 | Ga0157370_101752652 | 136 |
| 542 | 3300013104 | Ga0157370_10183810 | Ga0157370_101838101 | 136 |
| 543 | 3300013104 | Ga0157370_10512389 | Ga0157370_105123893 | 136 |
| 544 | 3300013104 | Ga0157370_10541511 | Ga0157370_105415112 | 136 |
| 545 | 3300013105 | Ga0157369_10000707 | Ga0157369_1000070725 | 136 |
| 546 | 3300013105 | Ga0157369_10017834 | Ga0157369_100178343 | 136 |
| 547 | 3300013105 | Ga0157369_10056193 | Ga0157369_100561931 | 136 |
| 548 | 3300013105 | Ga0157369_10084664 | Ga0157369_100846642 | 136 |
| 549 | 3300013105 | Ga0157369_10103348 | Ga0157369_101033485 | 136 |
| 550 | 3300013105 | Ga0157369_10118530 | Ga0157369_101185302 | 136 |
| 551 | 3300013105 | Ga0157369_10174208 | Ga0157369_101742083 | 136 |
| 552 | 3300013105 | Ga0157369_10188711 | Ga0157369_101887113 | 136 |
| 553 | 3300013105 | Ga0157369_10229963 | Ga0157369_102299632 | 136 |
| 554 | 3300013105 | Ga0157369_10496976 | Ga0157369_104969762 | 136 |
| 555 | 3300013105 | Ga0157369_10511548 | Ga0157369_105115481 | 136 |
| 556 | 3300013296 | Ga0157374_10003832 | Ga0157374_100038328 | 136 |
| 557 | 3300013296 | Ga0157374_10010610 | Ga0157374_100106107 | 136 |
| 558 | 3300013296 | Ga0157374_10019807 | Ga0157374_100198071 | 136 |
| 559 | 3300013296 | Ga0157374_10024541 | Ga0157374_100245416 | 136 |
| 560 | 3300013296 | Ga0157374_10037327 | Ga0157374_100373275 | 136 |
| 561 | 3300013296 | Ga0157374_10049414 | Ga0157374_100494147 | 136 |
| 562 | 3300013296 | Ga0157374_10057314 | Ga0157374_100573145 | 136 |
| 563 | 3300013296 | Ga0157374_10545002 | Ga0157374_105450022 | 136 |
| 564 | 3300013296 | Ga0157374_10578746 | Ga0157374_105787461 | 136 |
| 565 | 3300013296 | Ga0157374_10598276 | Ga0157374_105982762 | 136 |
| 566 | 3300013297 | Ga0157378_10003236 | Ga0157378_100032365 | 136 |
| 567 | 3300013297 | Ga0157378_10040674 | Ga0157378_100406742 | 136 |
| 568 | 3300013297 | Ga0157378_10095198 | Ga0157378_100951983 | 136 |
| 569 | 3300013297 | Ga0157378_10097524 | Ga0157378_100975244 | 136 |
| 570 | 3300013297 | Ga0157378_10146829 | Ga0157378_101468294 | 136 |
| 571 | 3300013297 | Ga0157378_11531095 | Ga0157378_115310952 | 136 |
| 572 | 3300013297 | Ga0157378_12540754 | Ga0157378_125407541 | 136 |
| 573 | 3300013306 | Ga0163162_10002584 | Ga0163162_100025848 | 136 |
| 574 | 3300013306 | Ga0163162_10057165 | Ga0163162_100571655 | 136 |
| 575 | 3300013306 | Ga0163162_10087454 | Ga0163162_100874543 | 136 |
| 576 | 3300013306 | Ga0163162_10146213 | Ga0163162_101462133 | 136 |
| 577 | 3300013306 | Ga0163162_10173768 | Ga0163162_101737681 | 136 |
| 578 | 3300013306 | Ga0163162_12037148 | Ga0163162_120371482 | 136 |
| 579 | 3300013307 | Ga0157372_10024072 | Ga0157372_100240724 | 136 |
| 580 | 3300013307 | Ga0157372_10035556 | Ga0157372_100355564 | 136 |
| 581 | 3300013307 | Ga0157372_10071311 | Ga0157372_100713112 | 136 |
| 582 | 3300013307 | Ga0157372_10094877 | Ga0157372_100948773 | 136 |
| 583 | 3300013307 | Ga0157372_10135827 | Ga0157372_101358274 | 136 |
| 584 | 3300013307 | Ga0157372_10301875 | Ga0157372_103018752 | 136 |
| 585 | 3300013307 | Ga0157372_10426664 | Ga0157372_104266642 | 136 |
| 586 | 3300013307 | Ga0157372_12091759 | Ga0157372_120917591 | 136 |
| 587 | 3300013307 | Ga0157372_12165411 | Ga0157372_121654111 | 136 |
| 588 | 3300013308 | Ga0157375_10057643 | Ga0157375_100576437 | 136 |
| 589 | 3300013308 | Ga0157375_10059700 | Ga0157375_100597003 | 136 |
| 590 | 3300013308 | Ga0157375_10150332 | Ga0157375_101503322 | 136 |
| 591 | 3300013308 | Ga0157375_10890963 | Ga0157375_108909631 | 136 |
| 592 | 3300013308 | Ga0157375_11813944 | Ga0157375_118139441 | 136 |
| 593 | 3300014325 | Ga0163163_10004284 | Ga0163163_100042845 | 136 |
| 594 | 3300014325 | Ga0163163_10025301 | Ga0163163_100253014 | 136 |
| 595 | 3300014325 | Ga0163163_10066872 | Ga0163163_100668724 | 136 |
| 596 | 3300014325 | Ga0163163_10137382 | Ga0163163_101373822 | 136 |
| 597 | 3300014325 | Ga0163163_10158114 | Ga0163163_101581143 | 136 |
| 598 | 3300014325 | Ga0163163_10571754 | Ga0163163_105717543 | 136 |
| 599 | 3300014326 | Ga0157380_10097667 | Ga0157380_100976674 | 136 |
| 600 | 3300014497 | Ga0182008_10014485 | Ga0182008_100144854 | 136 |
| 601 | 3300014497 | Ga0182008_10105273 | Ga0182008_101052733 | 136 |
| 602 | 3300014745 | Ga0157377_10005240 | Ga0157377_100052405 | 136 |
| 603 | 3300014968 | Ga0157379_10004435 | Ga0157379_100044354 | 136 |
| 604 | 3300014968 | Ga0157379_10096867 | Ga0157379_100968674 | 136 |
| 605 | 3300014968 | Ga0157379_10100573 | Ga0157379_101005732 | 136 |
| 606 | 3300014968 | Ga0157379_10111829 | Ga0157379_101118293 | 136 |
| 607 | 3300014968 | Ga0157379_10488929 | Ga0157379_104889291 | 136 |
| 608 | 3300014968 | Ga0157379_10778526 | Ga0157379_107785261 | 136 |
| 609 | 3300014969 | Ga0157376_10014350 | Ga0157376_100143505 | 136 |
| 610 | 3300014969 | Ga0157376_10043385 | Ga0157376_100433852 | 136 |
| 611 | 3300014969 | Ga0157376_10093650 | Ga0157376_100936502 | 136 |
| 612 | 3300014969 | Ga0157376_10116574 | Ga0157376_101165742 | 136 |
| 613 | 3300014969 | Ga0157376_10145929 | Ga0157376_101459291 | 136 |
| 614 | 3300014969 | Ga0157376_10254571 | Ga0157376_102545712 | 136 |
| 615 | 3300014969 | Ga0157376_10277376 | Ga0157376_102773762 | 136 |
| 616 | 3300014969 | Ga0157376_10302623 | Ga0157376_103026233 | 136 |
| 617 | 3300014969 | Ga0157376_10490811 | Ga0157376_104908113 | 136 |
| 618 | 3300014969 | Ga0157376_10646919 | Ga0157376_106469192 | 136 |
| 619 | 3300015261 | Ga0182006_1032101 | Ga0182006_10321013 | 136 |
| 620 | 3300015261 | Ga0182006_1053815 | Ga0182006_10538152 | 136 |
| 621 | 3300015262 | Ga0182007_10001865 | Ga0182007_100018657 | 136 |
| 622 | 3300015262 | Ga0182007_10049641 | Ga0182007_100496412 | 136 |
| 623 | 3300015262 | Ga0182007_10077491 | Ga0182007_100774912 | 136 |
| 624 | 3300017792 | Ga0163161_10009823 | Ga0163161_100098238 | 136 |
| 625 | 3300017792 | Ga0163161_11275062 | Ga0163161_112750622 | 136 |
| 626 | 3300020070 | Ga0206356_10210281 | Ga0206356_102102811 | 136 |
| 627 | 3300020070 | Ga0206356_10311722 | Ga0206356_103117221 | 136 |
| 628 | 3300020070 | Ga0206356_10438923 | Ga0206356_104389231 | 136 |
| 629 | 3300020070 | Ga0206356_10612756 | Ga0206356_106127561 | 136 |
| 630 | 3300020076 | Ga0206355_1464592 | Ga0206355_14645921 | 136 |
| 631 | 3300020078 | Ga0206352_10191777 | Ga0206352_101917771 | 136 |
| 632 | 3300020078 | Ga0206352_10634928 | Ga0206352_106349283 | 136 |
| 633 | 3300020078 | Ga0206352_10695361 | Ga0206352_106953613 | 136 |
| 634 | 3300020080 | Ga0206350_10302303 | Ga0206350_103023031 | 136 |
| 635 | 3300020080 | Ga0206350_10697226 | Ga0206350_106972261 | 136 |
| 636 | 3300020080 | Ga0206350_11198039 | Ga0206350_111980391 | 136 |
| 637 | 3300020081 | Ga0206354_10056872 | Ga0206354_100568723 | 136 |
| 638 | 3300020081 | Ga0206354_11350274 | Ga0206354_113502742 | 136 |
| 639 | 3300020082 | Ga0206353_10355093 | Ga0206353_103550932 | 136 |
| 640 | 3300020610 | Ga0154015_1659564 | Ga0154015_16595642 | 136 |
| 641 | 3300021358 | Ga0213873_10080339 | Ga0213873_100803392 | 136 |
| 642 | 3300021358 | Ga0213873_10148211 | Ga0213873_101482111 | 136 |
| 643 | 3300021377 | Ga0213874_10077321 | Ga0213874_100773212 | 136 |
| 644 | 3300022467 | Ga0224712_10564322 | Ga0224712_105643221 | 136 |
| 645 | 3300022467 | Ga0224712_10606936 | Ga0224712_106069361 | 136 |
| 646 | 3300022730 | Ga0224570_100774 | Ga0224570_1007743 | 136 |
| 647 | 3300022732 | Ga0224569_100532 | Ga0224569_1005326 | 136 |
| 648 | 3300022732 | Ga0224569_101700 | Ga0224569_1017002 | 136 |
| 649 | 3300022734 | Ga0224571_103364 | Ga0224571_1033642 | 136 |
| 650 | 3300024225 | Ga0224572_1002657 | Ga0224572_10026573 | 136 |
| 651 | 3300024227 | Ga0228598_1000510 | Ga0228598_10005106 | 136 |
| 652 | 3300024227 | Ga0228598_1004675 | Ga0228598_10046754 | 136 |
| 653 | 3300024227 | Ga0228598_1007492 | Ga0228598_10074922 | 136 |
| 654 | 3300024227 | Ga0228598_1030081 | Ga0228598_10300813 | 136 |
| 655 | 3300025315 | Ga0207697_10087108 | Ga0207697_100871082 | 136 |
| 656 | 3300025321 | Ga0207656_10015304 | Ga0207656_100153042 | 136 |
| 657 | 3300025321 | Ga0207656_10082347 | Ga0207656_100823471 | 136 |
| 658 | 3300025321 | Ga0207656_10096892 | Ga0207656_100968922 | 136 |
| 659 | 3300025893 | Ga0207682_10163094 | Ga0207682_101630942 | 136 |
| 660 | 3300025898 | Ga0207692_10005710 | Ga0207692_100057105 | 136 |
| 661 | 3300025898 | Ga0207692_10042774 | Ga0207692_100427742 | 136 |
| 662 | 3300025898 | Ga0207692_10117150 | Ga0207692_101171502 | 136 |
| 663 | 3300025898 | Ga0207692_10123064 | Ga0207692_101230642 | 136 |
| 664 | 3300025898 | Ga0207692_10196084 | Ga0207692_101960842 | 136 |
| 665 | 3300025898 | Ga0207692_10220407 | Ga0207692_102204072 | 136 |
| 666 | 3300025898 | Ga0207692_10240395 | Ga0207692_102403953 | 136 |
| 667 | 3300025898 | Ga0207692_10349459 | Ga0207692_103494591 | 136 |
| 668 | 3300025898 | Ga0207692_10567827 | Ga0207692_105678271 | 136 |
| 669 | 3300025899 | Ga0207642_10112666 | Ga0207642_101126662 | 136 |
| 670 | 3300025899 | Ga0207642_10212168 | Ga0207642_102121682 | 136 |
| 671 | 3300025899 | Ga0207642_10285457 | Ga0207642_102854572 | 136 |
| 672 | 3300025901 | Ga0207688_10042678 | Ga0207688_100426783 | 136 |
| 673 | 3300025903 | Ga0207680_10011489 | Ga0207680_100114896 | 136 |
| 674 | 3300025903 | Ga0207680_10024741 | Ga0207680_100247413 | 136 |
| 675 | 3300025903 | Ga0207680_10303359 | Ga0207680_103033592 | 136 |
| 676 | 3300025904 | Ga0207647_10001878 | Ga0207647_100018787 | 136 |
| 677 | 3300025904 | Ga0207647_10003039 | Ga0207647_100030399 | 136 |
| 678 | 3300025904 | Ga0207647_10196899 | Ga0207647_101968992 | 136 |
| 679 | 3300025904 | Ga0207647_10268662 | Ga0207647_102686622 | 136 |
| 680 | 3300025905 | Ga0207685_10014444 | Ga0207685_100144443 | 136 |
| 681 | 3300025905 | Ga0207685_10172731 | Ga0207685_101727312 | 136 |
| 682 | 3300025905 | Ga0207685_10195996 | Ga0207685_101959962 | 136 |
| 683 | 3300025905 | Ga0207685_10264438 | Ga0207685_102644382 | 136 |
| 684 | 3300025906 | Ga0207699_10000600 | Ga0207699_100006006 | 136 |
| 685 | 3300025906 | Ga0207699_10011735 | Ga0207699_100117354 | 136 |
| 686 | 3300025906 | Ga0207699_10016494 | Ga0207699_100164945 | 136 |
| 687 | 3300025906 | Ga0207699_10021063 | Ga0207699_100210635 | 136 |
| 688 | 3300025906 | Ga0207699_10039071 | Ga0207699_100390712 | 136 |
| 689 | 3300025906 | Ga0207699_10070588 | Ga0207699_100705884 | 136 |
| 690 | 3300025906 | Ga0207699_10152092 | Ga0207699_101520923 | 136 |
| 691 | 3300025906 | Ga0207699_10163152 | Ga0207699_101631522 | 136 |
| 692 | 3300025906 | Ga0207699_10222492 | Ga0207699_102224921 | 136 |
| 693 | 3300025906 | Ga0207699_10268950 | Ga0207699_102689502 | 136 |
| 694 | 3300025906 | Ga0207699_10298153 | Ga0207699_102981531 | 136 |
| 695 | 3300025906 | Ga0207699_10301622 | Ga0207699_103016221 | 136 |
| 696 | 3300025906 | Ga0207699_10667079 | Ga0207699_106670792 | 136 |
| 697 | 3300025906 | Ga0207699_11222621 | Ga0207699_112226212 | 136 |
| 698 | 3300025907 | Ga0207645_10000371 | Ga0207645_1000037132 | 136 |
| 699 | 3300025907 | Ga0207645_10004258 | Ga0207645_100042588 | 136 |
| 700 | 3300025908 | Ga0207643_10000668 | Ga0207643_1000066817 | 136 |
| 701 | 3300025908 | Ga0207643_10252787 | Ga0207643_102527872 | 136 |
| 702 | 3300025909 | Ga0207705_10123716 | Ga0207705_101237162 | 136 |
| 703 | 3300025909 | Ga0207705_10493707 | Ga0207705_104937072 | 136 |
| 704 | 3300025910 | Ga0207684_10001112 | Ga0207684_1000111210 | 136 |
| 705 | 3300025910 | Ga0207684_10002188 | Ga0207684_1000218816 | 136 |
| 706 | 3300025910 | Ga0207684_10014160 | Ga0207684_100141604 | 136 |
| 707 | 3300025910 | Ga0207684_10039463 | Ga0207684_100394634 | 136 |
| 708 | 3300025910 | Ga0207684_10079990 | Ga0207684_100799903 | 136 |
| 709 | 3300025910 | Ga0207684_10144360 | Ga0207684_101443602 | 136 |
| 710 | 3300025910 | Ga0207684_10463773 | Ga0207684_104637732 | 136 |
| 711 | 3300025911 | Ga0207654_10015891 | Ga0207654_100158914 | 136 |
| 712 | 3300025911 | Ga0207654_10032488 | Ga0207654_100324882 | 136 |
| 713 | 3300025911 | Ga0207654_10074199 | Ga0207654_100741991 | 136 |
| 714 | 3300025911 | Ga0207654_10250040 | Ga0207654_102500402 | 136 |
| 715 | 3300025911 | Ga0207654_10533990 | Ga0207654_105339901 | 136 |
| 716 | 3300025911 | Ga0207654_10896892 | Ga0207654_108968921 | 136 |
| 717 | 3300025911 | Ga0207654_11181100 | Ga0207654_111811002 | 136 |
| 718 | 3300025912 | Ga0207707_10009572 | Ga0207707_100095725 | 136 |
| 719 | 3300025912 | Ga0207707_10032167 | Ga0207707_100321676 | 136 |
| 720 | 3300025912 | Ga0207707_10034370 | Ga0207707_100343703 | 136 |
| 721 | 3300025912 | Ga0207707_10187702 | Ga0207707_101877022 | 136 |
| 722 | 3300025912 | Ga0207707_10194395 | Ga0207707_101943952 | 136 |
| 723 | 3300025912 | Ga0207707_10283226 | Ga0207707_102832263 | 136 |
| 724 | 3300025912 | Ga0207707_10380984 | Ga0207707_103809842 | 136 |
| 725 | 3300025912 | Ga0207707_10735244 | Ga0207707_107352442 | 136 |
| 726 | 3300025912 | Ga0207707_10823231 | Ga0207707_108232312 | 136 |
| 727 | 3300025913 | Ga0207695_10007947 | Ga0207695_100079479 | 136 |
| 728 | 3300025913 | Ga0207695_10051286 | Ga0207695_100512866 | 136 |
| 729 | 3300025913 | Ga0207695_10062042 | Ga0207695_100620424 | 136 |
| 730 | 3300025913 | Ga0207695_10078217 | Ga0207695_100782172 | 136 |
| 731 | 3300025913 | Ga0207695_10129257 | Ga0207695_101292574 | 136 |
| 732 | 3300025913 | Ga0207695_10172154 | Ga0207695_101721543 | 136 |
| 733 | 3300025913 | Ga0207695_10190541 | Ga0207695_101905412 | 136 |
| 734 | 3300025913 | Ga0207695_10200176 | Ga0207695_102001762 | 136 |
| 735 | 3300025913 | Ga0207695_10508985 | Ga0207695_105089852 | 136 |
| 736 | 3300025914 | Ga0207671_10078488 | Ga0207671_100784883 | 136 |
| 737 | 3300025914 | Ga0207671_10125848 | Ga0207671_101258482 | 136 |
| 738 | 3300025914 | Ga0207671_10279119 | Ga0207671_102791192 | 136 |
| 739 | 3300025914 | Ga0207671_10298020 | Ga0207671_102980202 | 136 |
| 740 | 3300025914 | Ga0207671_10413562 | Ga0207671_104135622 | 136 |
| 741 | 3300025914 | Ga0207671_10421326 | Ga0207671_104213262 | 136 |
| 742 | 3300025914 | Ga0207671_10877717 | Ga0207671_108777172 | 136 |
| 743 | 3300025914 | Ga0207671_10975400 | Ga0207671_109754002 | 136 |
| 744 | 3300025914 | Ga0207671_11184555 | Ga0207671_111845552 | 136 |
| 745 | 3300025915 | Ga0207693_10000203 | Ga0207693_1000020314 | 136 |
| 746 | 3300025915 | Ga0207693_10000260 | Ga0207693_1000026058 | 136 |
| 747 | 3300025915 | Ga0207693_10000719 | Ga0207693_1000071926 | 136 |
| 748 | 3300025915 | Ga0207693_10001323 | Ga0207693_1000132322 | 136 |
| 749 | 3300025915 | Ga0207693_10002101 | Ga0207693_1000210111 | 136 |
| 750 | 3300025915 | Ga0207693_10006854 | Ga0207693_100068544 | 136 |
| 751 | 3300025915 | Ga0207693_10018421 | Ga0207693_100184211 | 136 |
| 752 | 3300025915 | Ga0207693_10164348 | Ga0207693_101643482 | 136 |
| 753 | 3300025915 | Ga0207693_10262763 | Ga0207693_102627631 | 136 |
| 754 | 3300025915 | Ga0207693_10287167 | Ga0207693_102871672 | 136 |
| 755 | 3300025915 | Ga0207693_10323422 | Ga0207693_103234222 | 136 |
| 756 | 3300025915 | Ga0207693_10393245 | Ga0207693_103932452 | 136 |
| 757 | 3300025915 | Ga0207693_10495128 | Ga0207693_104951282 | 136 |
| 758 | 3300025915 | Ga0207693_10674661 | Ga0207693_106746611 | 136 |
| 759 | 3300025915 | Ga0207693_10735207 | Ga0207693_107352072 | 136 |
| 760 | 3300025916 | Ga0207663_10000234 | Ga0207663_100002345 | 136 |
| 761 | 3300025916 | Ga0207663_10009111 | Ga0207663_100091114 | 136 |
| 762 | 3300025916 | Ga0207663_10027040 | Ga0207663_100270403 | 136 |
| 763 | 3300025916 | Ga0207663_10046178 | Ga0207663_100461783 | 136 |
| 764 | 3300025916 | Ga0207663_10058176 | Ga0207663_100581763 | 136 |
| 765 | 3300025916 | Ga0207663_10221098 | Ga0207663_102210982 | 136 |
| 766 | 3300025916 | Ga0207663_10314371 | Ga0207663_103143711 | 136 |
| 767 | 3300025916 | Ga0207663_10491669 | Ga0207663_104916692 | 136 |
| 768 | 3300025916 | Ga0207663_10616492 | Ga0207663_106164922 | 136 |
| 769 | 3300025916 | Ga0207663_10629776 | Ga0207663_106297762 | 136 |
| 770 | 3300025916 | Ga0207663_10709639 | Ga0207663_107096392 | 136 |
| 771 | 3300025916 | Ga0207663_10966252 | Ga0207663_109662521 | 136 |
| 772 | 3300025917 | Ga0207660_10005436 | Ga0207660_100054368 | 136 |
| 773 | 3300025917 | Ga0207660_10084603 | Ga0207660_100846032 | 136 |
| 774 | 3300025917 | Ga0207660_10158636 | Ga0207660_101586362 | 136 |
| 775 | 3300025917 | Ga0207660_10217538 | Ga0207660_102175382 | 136 |
| 776 | 3300025917 | Ga0207660_10375660 | Ga0207660_103756602 | 136 |
| 777 | 3300025917 | Ga0207660_10745639 | Ga0207660_107456391 | 136 |
| 778 | 3300025919 | Ga0207657_10001697 | Ga0207657_1000169711 | 136 |
| 779 | 3300025919 | Ga0207657_10001941 | Ga0207657_100019414 | 136 |
| 780 | 3300025919 | Ga0207657_10002583 | Ga0207657_1000258311 | 136 |
| 781 | 3300025919 | Ga0207657_10006727 | Ga0207657_100067274 | 136 |
| 782 | 3300025919 | Ga0207657_10152903 | Ga0207657_101529033 | 136 |
| 783 | 3300025919 | Ga0207657_10477825 | Ga0207657_104778252 | 136 |
| 784 | 3300025919 | Ga0207657_10637885 | Ga0207657_106378852 | 136 |
| 785 | 3300025920 | Ga0207649_10001595 | Ga0207649_1000159514 | 136 |
| 786 | 3300025920 | Ga0207649_10024357 | Ga0207649_100243573 | 136 |
| 787 | 3300025920 | Ga0207649_10026399 | Ga0207649_100263993 | 136 |
| 788 | 3300025921 | Ga0207652_10008095 | Ga0207652_100080958 | 136 |
| 789 | 3300025921 | Ga0207652_10111678 | Ga0207652_101116783 | 136 |
| 790 | 3300025921 | Ga0207652_10158582 | Ga0207652_101585821 | 136 |
| 791 | 3300025921 | Ga0207652_10165821 | Ga0207652_101658213 | 136 |
| 792 | 3300025921 | Ga0207652_10185006 | Ga0207652_101850061 | 136 |
| 793 | 3300025921 | Ga0207652_10208087 | Ga0207652_102080871 | 136 |
| 794 | 3300025921 | Ga0207652_10291838 | Ga0207652_102918382 | 136 |
| 795 | 3300025921 | Ga0207652_10356950 | Ga0207652_103569502 | 136 |
| 796 | 3300025921 | Ga0207652_10868872 | Ga0207652_108688722 | 136 |
| 797 | 3300025922 | Ga0207646_10002802 | Ga0207646_1000280214 | 136 |
| 798 | 3300025922 | Ga0207646_10003770 | Ga0207646_100037709 | 136 |
| 799 | 3300025922 | Ga0207646_10106496 | Ga0207646_101064964 | 136 |
| 800 | 3300025922 | Ga0207646_10172894 | Ga0207646_101728941 | 136 |
| 801 | 3300025922 | Ga0207646_10219502 | Ga0207646_102195022 | 136 |
| 802 | 3300025922 | Ga0207646_10961150 | Ga0207646_109611502 | 136 |
| 803 | 3300025923 | Ga0207681_10411228 | Ga0207681_104112282 | 136 |
| 804 | 3300025924 | Ga0207694_10047768 | Ga0207694_100477685 | 136 |
| 805 | 3300025924 | Ga0207694_10156697 | Ga0207694_101566973 | 136 |
| 806 | 3300025924 | Ga0207694_10234067 | Ga0207694_102340673 | 136 |
| 807 | 3300025924 | Ga0207694_10361321 | Ga0207694_103613212 | 136 |
| 808 | 3300025924 | Ga0207694_10817306 | Ga0207694_108173062 | 136 |
| 809 | 3300025924 | Ga0207694_11702598 | Ga0207694_117025981 | 136 |
| 810 | 3300025925 | Ga0207650_10000040 | Ga0207650_1000004088 | 136 |
| 811 | 3300025926 | Ga0207659_10060149 | Ga0207659_100601492 | 136 |
| 812 | 3300025926 | Ga0207659_10525363 | Ga0207659_105253631 | 136 |
| 813 | 3300025927 | Ga0207687_10003152 | Ga0207687_100031522 | 136 |
| 814 | 3300025927 | Ga0207687_10006117 | Ga0207687_100061174 | 136 |
| 815 | 3300025927 | Ga0207687_10009144 | Ga0207687_100091442 | 136 |
| 816 | 3300025927 | Ga0207687_10031507 | Ga0207687_100315073 | 136 |
| 817 | 3300025927 | Ga0207687_10575921 | Ga0207687_105759212 | 136 |
| 818 | 3300025927 | Ga0207687_10580749 | Ga0207687_105807491 | 136 |
| 819 | 3300025927 | Ga0207687_11208949 | Ga0207687_112089492 | 136 |
| 820 | 3300025928 | Ga0207700_10000163 | Ga0207700_1000016327 | 136 |
| 821 | 3300025928 | Ga0207700_10000928 | Ga0207700_100009286 | 136 |
| 822 | 3300025928 | Ga0207700_10001536 | Ga0207700_100015366 | 136 |
| 823 | 3300025928 | Ga0207700_10017211 | Ga0207700_100172112 | 136 |
| 824 | 3300025928 | Ga0207700_10076594 | Ga0207700_100765942 | 136 |
| 825 | 3300025928 | Ga0207700_10128542 | Ga0207700_101285423 | 136 |
| 826 | 3300025928 | Ga0207700_10130640 | Ga0207700_101306403 | 136 |
| 827 | 3300025928 | Ga0207700_10154978 | Ga0207700_101549784 | 136 |
| 828 | 3300025928 | Ga0207700_10234189 | Ga0207700_102341893 | 136 |
| 829 | 3300025928 | Ga0207700_10338117 | Ga0207700_103381172 | 136 |
| 830 | 3300025928 | Ga0207700_10372437 | Ga0207700_103724372 | 136 |
| 831 | 3300025928 | Ga0207700_10406223 | Ga0207700_104062232 | 136 |
| 832 | 3300025928 | Ga0207700_10415722 | Ga0207700_104157222 | 136 |
| 833 | 3300025928 | Ga0207700_10474508 | Ga0207700_104745081 | 136 |
| 834 | 3300025928 | Ga0207700_10727142 | Ga0207700_107271422 | 136 |
| 835 | 3300025928 | Ga0207700_10775914 | Ga0207700_107759142 | 136 |
| 836 | 3300025928 | Ga0207700_11120305 | Ga0207700_111203051 | 136 |
| 837 | 3300025928 | Ga0207700_11170893 | Ga0207700_111708932 | 136 |
| 838 | 3300025929 | Ga0207664_10000017 | Ga0207664_1000001723 | 136 |
| 839 | 3300025929 | Ga0207664_10021558 | Ga0207664_100215583 | 136 |
| 840 | 3300025929 | Ga0207664_10023722 | Ga0207664_100237223 | 136 |
| 841 | 3300025929 | Ga0207664_10088175 | Ga0207664_100881752 | 136 |
| 842 | 3300025929 | Ga0207664_10220311 | Ga0207664_102203112 | 136 |
| 843 | 3300025929 | Ga0207664_10702953 | Ga0207664_107029532 | 136 |
| 844 | 3300025929 | Ga0207664_10862307 | Ga0207664_108623072 | 136 |
| 845 | 3300025931 | Ga0207644_10061223 | Ga0207644_100612233 | 136 |
| 846 | 3300025931 | Ga0207644_10187542 | Ga0207644_101875421 | 136 |
| 847 | 3300025932 | Ga0207690_10007447 | Ga0207690_100074477 | 136 |
| 848 | 3300025932 | Ga0207690_10056237 | Ga0207690_100562374 | 136 |
| 849 | 3300025932 | Ga0207690_10152711 | Ga0207690_101527112 | 136 |
| 850 | 3300025932 | Ga0207690_10225428 | Ga0207690_102254282 | 136 |
| 851 | 3300025932 | Ga0207690_10346903 | Ga0207690_103469032 | 136 |
| 852 | 3300025933 | Ga0207706_10000141 | Ga0207706_1000014171 | 136 |
| 853 | 3300025933 | Ga0207706_10000897 | Ga0207706_100008975 | 136 |
| 854 | 3300025933 | Ga0207706_10089808 | Ga0207706_100898083 | 136 |
| 855 | 3300025933 | Ga0207706_10653037 | Ga0207706_106530372 | 136 |
| 856 | 3300025934 | Ga0207686_10007765 | Ga0207686_100077654 | 136 |
| 857 | 3300025934 | Ga0207686_10090253 | Ga0207686_100902533 | 136 |
| 858 | 3300025934 | Ga0207686_10157415 | Ga0207686_101574153 | 136 |
| 859 | 3300025934 | Ga0207686_10367499 | Ga0207686_103674991 | 136 |
| 860 | 3300025934 | Ga0207686_10672185 | Ga0207686_106721852 | 136 |
| 861 | 3300025935 | Ga0207709_10228426 | Ga0207709_102284262 | 136 |
| 862 | 3300025936 | Ga0207670_10011213 | Ga0207670_100112133 | 136 |
| 863 | 3300025938 | Ga0207704_10028369 | Ga0207704_100283694 | 136 |
| 864 | 3300025938 | Ga0207704_10272849 | Ga0207704_102728493 | 136 |
| 865 | 3300025938 | Ga0207704_11032289 | Ga0207704_110322892 | 136 |
| 866 | 3300025939 | Ga0207665_10000357 | Ga0207665_1000035727 | 136 |
| 867 | 3300025939 | Ga0207665_10011158 | Ga0207665_100111585 | 136 |
| 868 | 3300025939 | Ga0207665_10011331 | Ga0207665_100113313 | 136 |
| 869 | 3300025939 | Ga0207665_10011722 | Ga0207665_100117225 | 136 |
| 870 | 3300025939 | Ga0207665_10012249 | Ga0207665_100122498 | 136 |
| 871 | 3300025939 | Ga0207665_10026163 | Ga0207665_100261633 | 136 |
| 872 | 3300025939 | Ga0207665_10045668 | Ga0207665_100456683 | 136 |
| 873 | 3300025939 | Ga0207665_10137426 | Ga0207665_101374262 | 136 |
| 874 | 3300025939 | Ga0207665_10193781 | Ga0207665_101937813 | 136 |
| 875 | 3300025939 | Ga0207665_10196551 | Ga0207665_101965511 | 136 |
| 876 | 3300025939 | Ga0207665_10448598 | Ga0207665_104485981 | 136 |
| 877 | 3300025939 | Ga0207665_10449845 | Ga0207665_104498452 | 136 |
| 878 | 3300025939 | Ga0207665_10492134 | Ga0207665_104921341 | 136 |
| 879 | 3300025939 | Ga0207665_10619085 | Ga0207665_106190852 | 136 |
| 880 | 3300025939 | Ga0207665_10926786 | Ga0207665_109267861 | 136 |
| 881 | 3300025940 | Ga0207691_10000120 | Ga0207691_1000012059 | 136 |
| 882 | 3300025940 | Ga0207691_10181062 | Ga0207691_101810623 | 136 |
| 883 | 3300025941 | Ga0207711_10000977 | Ga0207711_1000097713 | 136 |
| 884 | 3300025941 | Ga0207711_10032693 | Ga0207711_100326935 | 136 |
| 885 | 3300025941 | Ga0207711_10035011 | Ga0207711_100350112 | 136 |
| 886 | 3300025942 | Ga0207689_10000695 | Ga0207689_100006953 | 136 |
| 887 | 3300025942 | Ga0207689_10005702 | Ga0207689_100057025 | 136 |
| 888 | 3300025942 | Ga0207689_10052617 | Ga0207689_100526173 | 136 |
| 889 | 3300025942 | Ga0207689_10128892 | Ga0207689_101288923 | 136 |
| 890 | 3300025944 | Ga0207661_10000294 | Ga0207661_100002943 | 136 |
| 891 | 3300025944 | Ga0207661_10105187 | Ga0207661_101051872 | 136 |
| 892 | 3300025944 | Ga0207661_10618286 | Ga0207661_106182862 | 136 |
| 893 | 3300025945 | Ga0207679_10001510 | Ga0207679_100015105 | 136 |
| 894 | 3300025945 | Ga0207679_10040950 | Ga0207679_100409502 | 136 |
| 895 | 3300025945 | Ga0207679_10086298 | Ga0207679_100862982 | 136 |
| 896 | 3300025949 | Ga0207667_10011908 | Ga0207667_100119082 | 136 |
| 897 | 3300025949 | Ga0207667_10022056 | Ga0207667_100220568 | 136 |
| 898 | 3300025949 | Ga0207667_10024637 | Ga0207667_100246379 | 136 |
| 899 | 3300025949 | Ga0207667_10042168 | Ga0207667_100421683 | 136 |
| 900 | 3300025949 | Ga0207667_10209440 | Ga0207667_102094403 | 136 |
| 901 | 3300025949 | Ga0207667_10466625 | Ga0207667_104666251 | 136 |
| 902 | 3300025949 | Ga0207667_10515822 | Ga0207667_105158222 | 136 |
| 903 | 3300025949 | Ga0207667_11353029 | Ga0207667_113530291 | 136 |
| 904 | 3300025960 | Ga0207651_10005407 | Ga0207651_100054072 | 136 |
| 905 | 3300025960 | Ga0207651_11234823 | Ga0207651_112348232 | 136 |
| 906 | 3300025960 | Ga0207651_11775657 | Ga0207651_117756571 | 136 |
| 907 | 3300025961 | Ga0207712_10007469 | Ga0207712_100074695 | 136 |
| 908 | 3300025961 | Ga0207712_10473848 | Ga0207712_104738481 | 136 |
| 909 | 3300025972 | Ga0207668_10045209 | Ga0207668_100452093 | 136 |
| 910 | 3300025981 | Ga0207640_10000001 | Ga0207640_10000001339 | 136 |
| 911 | 3300025981 | Ga0207640_10053109 | Ga0207640_100531094 | 136 |
| 912 | 3300025981 | Ga0207640_10078577 | Ga0207640_100785773 | 136 |
| 913 | 3300025981 | Ga0207640_10715885 | Ga0207640_107158852 | 136 |
| 914 | 3300025986 | Ga0207658_10046062 | Ga0207658_100460623 | 136 |
| 915 | 3300025986 | Ga0207658_10385906 | Ga0207658_103859061 | 136 |
| 916 | 3300026023 | Ga0207677_10145690 | Ga0207677_101456902 | 136 |
| 917 | 3300026023 | Ga0207677_10259758 | Ga0207677_102597583 | 136 |
| 918 | 3300026023 | Ga0207677_10333278 | Ga0207677_103332781 | 136 |
| 919 | 3300026023 | Ga0207677_10736755 | Ga0207677_107367552 | 136 |
| 920 | 3300026035 | Ga0207703_10008458 | Ga0207703_100084584 | 136 |
| 921 | 3300026035 | Ga0207703_10113799 | Ga0207703_101137993 | 136 |
| 922 | 3300026035 | Ga0207703_10114429 | Ga0207703_101144293 | 136 |
| 923 | 3300026035 | Ga0207703_10404408 | Ga0207703_104044082 | 136 |
| 924 | 3300026035 | Ga0207703_12268601 | Ga0207703_122686011 | 136 |
| 925 | 3300026041 | Ga0207639_10000058 | Ga0207639_1000005829 | 136 |
| 926 | 3300026041 | Ga0207639_10043552 | Ga0207639_100435524 | 136 |
| 927 | 3300026041 | Ga0207639_10133233 | Ga0207639_101332333 | 136 |
| 928 | 3300026041 | Ga0207639_10204915 | Ga0207639_102049151 | 136 |
| 929 | 3300026041 | Ga0207639_10228810 | Ga0207639_102288101 | 136 |
| 930 | 3300026041 | Ga0207639_10741627 | Ga0207639_107416271 | 136 |
| 931 | 3300026067 | Ga0207678_10000058 | Ga0207678_100000589 | 136 |
| 932 | 3300026067 | Ga0207678_10003304 | Ga0207678_100033043 | 136 |
| 933 | 3300026067 | Ga0207678_10071953 | Ga0207678_100719535 | 136 |
| 934 | 3300026067 | Ga0207678_10161249 | Ga0207678_101612493 | 136 |
| 935 | 3300026067 | Ga0207678_11745337 | Ga0207678_117453371 | 136 |
| 936 | 3300026075 | Ga0207708_10392881 | Ga0207708_103928812 | 136 |
| 937 | 3300026078 | Ga0207702_10002510 | Ga0207702_100025106 | 136 |
| 938 | 3300026078 | Ga0207702_10047336 | Ga0207702_100473364 | 136 |
| 939 | 3300026078 | Ga0207702_10233478 | Ga0207702_102334782 | 136 |
| 940 | 3300026078 | Ga0207702_10373211 | Ga0207702_103732113 | 136 |
| 941 | 3300026078 | Ga0207702_10436316 | Ga0207702_104363162 | 136 |
| 942 | 3300026078 | Ga0207702_10442580 | Ga0207702_104425802 | 136 |
| 943 | 3300026078 | Ga0207702_11316665 | Ga0207702_113166652 | 136 |
| 944 | 3300026078 | Ga0207702_11409470 | Ga0207702_114094702 | 136 |
| 945 | 3300026078 | Ga0207702_11434258 | Ga0207702_114342581 | 136 |
| 946 | 3300026078 | Ga0207702_12084793 | Ga0207702_120847931 | 136 |
| 947 | 3300026078 | Ga0207702_12523184 | Ga0207702_125231841 | 136 |
| 948 | 3300026088 | Ga0207641_10000009 | Ga0207641_10000009285 | 136 |
| 949 | 3300026088 | Ga0207641_10013093 | Ga0207641_100130937 | 136 |
| 950 | 3300026088 | Ga0207641_10245806 | Ga0207641_102458062 | 136 |
| 951 | 3300026088 | Ga0207641_10417081 | Ga0207641_104170812 | 136 |
| 952 | 3300026088 | Ga0207641_10459540 | Ga0207641_104595402 | 136 |
| 953 | 3300026089 | Ga0207648_10016140 | Ga0207648_100161404 | 136 |
| 954 | 3300026089 | Ga0207648_10032780 | Ga0207648_100327806 | 136 |
| 955 | 3300026089 | Ga0207648_10084326 | Ga0207648_100843263 | 136 |
| 956 | 3300026089 | Ga0207648_10963456 | Ga0207648_109634562 | 136 |
| 957 | 3300026095 | Ga0207676_10000153 | Ga0207676_1000015350 | 136 |
| 958 | 3300026095 | Ga0207676_10008783 | Ga0207676_100087834 | 136 |
| 959 | 3300026095 | Ga0207676_10963210 | Ga0207676_109632101 | 136 |
| 960 | 3300026116 | Ga0207674_10000010 | Ga0207674_10000010110 | 136 |
| 961 | 3300026116 | Ga0207674_10044614 | Ga0207674_100446141 | 136 |
| 962 | 3300026116 | Ga0207674_10307282 | Ga0207674_103072822 | 136 |
| 963 | 3300026116 | Ga0207674_10319795 | Ga0207674_103197953 | 136 |
| 964 | 3300026116 | Ga0207674_10593569 | Ga0207674_105935692 | 136 |
| 965 | 3300026118 | Ga0207675_100014445 | Ga0207675_1000144455 | 136 |
| 966 | 3300026118 | Ga0207675_100283510 | Ga0207675_1002835102 | 136 |
| 967 | 3300026121 | Ga0207683_10002699 | Ga0207683_100026998 | 136 |
| 968 | 3300026121 | Ga0207683_10082208 | Ga0207683_100822084 | 136 |
| 969 | 3300026142 | Ga0207698_10135314 | Ga0207698_101353142 | 136 |
| 970 | 3300026142 | Ga0207698_10266490 | Ga0207698_102664903 | 136 |
| 971 | 3300026142 | Ga0207698_10509647 | Ga0207698_105096472 | 136 |
| 972 | 3300026142 | Ga0207698_11972466 | Ga0207698_119724662 | 136 |
| 973 | 3300026142 | Ga0207698_12028741 | Ga0207698_120287412 | 136 |
| 974 | 3300027695 | Ga0209966_1010828 | Ga0209966_10108283 | 136 |
| 975 | 3300028016 | Ga0265354_1014282 | Ga0265354_10142821 | 136 |
| 976 | 3300028017 | Ga0265356_1000376 | Ga0265356_10003766 | 136 |
| 977 | 3300028379 | Ga0268266_10006583 | Ga0268266_100065838 | 136 |
| 978 | 3300028379 | Ga0268266_10012346 | Ga0268266_100123467 | 136 |
| 979 | 3300028379 | Ga0268266_10022853 | Ga0268266_100228534 | 136 |
| 980 | 3300028379 | Ga0268266_10045437 | Ga0268266_100454372 | 136 |
| 981 | 3300028379 | Ga0268266_10064482 | Ga0268266_100644823 | 136 |
| 982 | 3300028380 | Ga0268265_10012306 | Ga0268265_100123068 | 136 |
| 983 | 3300028380 | Ga0268265_10025236 | Ga0268265_100252365 | 136 |
| 984 | 3300028381 | Ga0268264_10240699 | Ga0268264_102406991 | 136 |
| 985 | 3300028381 | Ga0268264_10274447 | Ga0268264_102744471 | 136 |
| 986 | 3300028381 | Ga0268264_10454759 | Ga0268264_104547592 | 136 |
| 987 | 3300028381 | Ga0268264_11011710 | Ga0268264_110117102 | 136 |
| 988 | 3300028800 | Ga0265338_10001433 | Ga0265338_1000143336 | 136 |
| 989 | 3300028800 | Ga0265338_10030364 | Ga0265338_100303646 | 136 |
| 990 | 3300028800 | Ga0265338_10137732 | Ga0265338_101377322 | 136 |
| 991 | 3300028800 | Ga0265338_10143301 | Ga0265338_101433013 | 136 |
| 992 | 3300028800 | Ga0265338_10259064 | Ga0265338_102590642 | 136 |
| 993 | 3300028800 | Ga0265338_10575674 | Ga0265338_105756742 | 136 |
| 994 | 3300030760 | Ga0265762_1000311 | Ga0265762_10003112 | 136 |
| 995 | 3300030760 | Ga0265762_1000664 | Ga0265762_10006644 | 136 |
| 996 | 3300030760 | Ga0265762_1001754 | Ga0265762_10017544 | 136 |
| 997 | 3300030760 | Ga0265762_1009779 | Ga0265762_10097793 | 136 |
| 998 | 3300030760 | Ga0265762_1035242 | Ga0265762_10352422 | 136 |
| 999 | 3300030878 | Ga0265770_1006714 | Ga0265770_10067141 | 136 |
| 1000 | 3300030878 | Ga0265770_1030091 | Ga0265770_10300912 | 136 |
| 1001 | 3300030879 | Ga0265765_1018861 | Ga0265765_10188611 | 136 |
| 1002 | 3300031090 | Ga0265760_10000112 | Ga0265760_100001124 | 136 |
| 1003 | 3300031090 | Ga0265760_10000553 | Ga0265760_100005537 | 136 |
| 1004 | 3300031090 | Ga0265760_10005449 | Ga0265760_100054494 | 136 |
| 1005 | 3300031090 | Ga0265760_10018718 | Ga0265760_100187182 | 136 |
| 1006 | 3300031090 | Ga0265760_10022273 | Ga0265760_100222732 | 136 |
| 1007 | 3300031090 | Ga0265760_10053749 | Ga0265760_100537492 | 136 |
| 1008 | 3300031235 | Ga0265330_10034152 | Ga0265330_100341523 | 136 |
| 1009 | 3300031235 | Ga0265330_10200816 | Ga0265330_102008162 | 136 |
| 1010 | 3300031235 | Ga0265330_10318825 | Ga0265330_103188252 | 136 |
| 1011 | 3300031238 | Ga0265332_10051239 | Ga0265332_100512392 | 136 |
| 1012 | 3300031238 | Ga0265332_10404748 | Ga0265332_104047481 | 136 |
| 1013 | 3300031241 | Ga0265325_10006501 | Ga0265325_100065017 | 136 |
| 1014 | 3300031241 | Ga0265325_10020381 | Ga0265325_100203813 | 136 |
| 1015 | 3300031241 | Ga0265325_10021392 | Ga0265325_100213924 | 136 |
| 1016 | 3300031247 | Ga0265340_10016242 | Ga0265340_100162422 | 136 |
| 1017 | 3300031247 | Ga0265340_10021295 | Ga0265340_100212954 | 136 |
| 1018 | 3300031247 | Ga0265340_10041436 | Ga0265340_100414363 | 136 |
| 1019 | 3300031247 | Ga0265340_10058212 | Ga0265340_100582124 | 136 |
| 1020 | 3300031249 | Ga0265339_10043867 | Ga0265339_100438672 | 136 |
| 1021 | 3300031249 | Ga0265339_10070799 | Ga0265339_100707992 | 136 |
| 1022 | 3300031249 | Ga0265339_10080145 | Ga0265339_100801452 | 136 |
| 1023 | 3300031250 | Ga0265331_10237334 | Ga0265331_102373342 | 136 |
| 1024 | 3300031251 | Ga0265327_10098207 | Ga0265327_100982072 | 136 |
| 1025 | 3300031344 | Ga0265316_10000706 | Ga0265316_100007066 | 136 |
| 1026 | 3300031344 | Ga0265316_10105530 | Ga0265316_101055303 | 136 |
| 1027 | 3300031344 | Ga0265316_10732373 | Ga0265316_107323732 | 136 |
| 1028 | 3300031344 | Ga0265316_11119459 | Ga0265316_111194591 | 136 |
| 1029 | 3300031548 | Ga0307408_100090522 | Ga0307408_1000905222 | 136 |
| 1030 | 3300031595 | Ga0265313_10019555 | Ga0265313_100195554 | 136 |
| 1031 | 3300031711 | Ga0265314_10001717 | Ga0265314_1000171710 | 136 |
| 1032 | 3300031711 | Ga0265314_10021063 | Ga0265314_100210632 | 136 |
| 1033 | 3300031711 | Ga0265314_10164347 | Ga0265314_101643472 | 136 |
| 1034 | 3300031711 | Ga0265314_10173096 | Ga0265314_101730962 | 136 |
| 1035 | 3300031712 | Ga0265342_10324743 | Ga0265342_103247432 | 136 |
| 1036 | 3300031995 | Ga0307409_101604950 | Ga0307409_1016049501 | 136 |
| 1037 | 3300033180 | Ga0307510_10020741 | Ga0307510_100207412 | 136 |
| 1038 | 3300033180 | Ga0307510_10105447 | Ga0307510_101054473 | 136 |
| 1039 | 3300033547 | Ga0316212_1002277 | Ga0316212_10022774 | 136 |
| 1040 | 3300034820 | Ga0373959_0137685 | Ga0373959_0137685_10_420 | 136 |
| 1041 | 3300034957 | Ga0373938_0221381 | Ga0373938_0221381_51_461 | 136 |
| 1042 | 3300035083 | Ga0373926_0072512 | Ga0373926_0072512_570_980 | 136 |
| 1043 | 3300035085 | Ga0373929_0079412 | Ga0373929_0079412_287_697 | 136 |
| 1044 | 3300035086 | Ga0373934_0065120 | Ga0373934_0065120_884_1294 | 136 |
| 1045 | 3300035089 | Ga0373944_0041686 | Ga0373944_0041686_71_481 | 136 |
| 1046 | 3300035111 | Ga0373923_0065269 | Ga0373923_0065269_466_876 | 136 |
| 1047 | 3300035111 | Ga0373923_0596110 | Ga0373923_0596110_45_455 | 136 |
| 1048 | 3300035113 | Ga0373936_0000589 | Ga0373936_0000589_12045_12455 | 136 |
| 1049 | 3300035113 | Ga0373936_0047620 | Ga0373936_0047620_1070_1573 | 136 |
| 1050 | 3300035113 | Ga0373936_0052483 | Ga0373936_0052483_775_1188 | 136 |
| 1051 | 3300035115 | Ga0373941_0031269 | Ga0373941_0031269_824_1234 | 136 |
| 1052 | 3300035116 | Ga0373945_0000849 | Ga0373945_0000849_857_1267 | 136 |
| 1053 | 3300035116 | Ga0373945_0068189 | Ga0373945_0068189_136_549 | 136 |
| 1054 | 3300035116 | Ga0373945_0165952 | Ga0373945_0165952_158_568 | 136 |
| 1055 | 3300035116 | Ga0373945_0307140 | Ga0373945_0307140_158_661 | 136 |
| 1056 | 3300035117 | Ga0373953_0013504 | Ga0373953_0013504_165_575 | 136 |
| 1057 | 3300035119 | Ga0373956_0051924 | Ga0373956_0051924_525_935 | 136 |
| 1058 | 3300035119 | Ga0373956_0106449 | Ga0373956_0106449_332_742 | 136 |
| 1059 | 3300035119 | Ga0373956_0312409 | Ga0373956_0312409_321_731 | 136 |
| 1060 | 3300035120 | Ga0373957_0035087 | Ga0373957_0035087_669_1079 | 136 |
| 1061 | 3300035120 | Ga0373957_0099863 | Ga0373957_0099863_195_605 | 136 |
| 1062 | 3300035170 | Ga0373943_0000002 | Ga0373943_0000002_33687_34097 | 136 |
| 1063 | 3300035170 | Ga0373943_0008395 | Ga0373943_0008395_1023_1433 | 136 |
| 1064 | 3300035171 | Ga0373946_0067918 | Ga0373946_0067918_156_569 | 136 |
| 1065 | 3300035172 | Ga0373955_0031012 | Ga0373955_0031012_1266_1676 | 136 |
| 1066 | 3300035172 | Ga0373955_0506853 | Ga0373955_0506853_176_589 | 136 |
| 1067 | 3300035172 | Ga0373955_0765020 | Ga0373955_0765020_43_453 | 136 |
| 1068 | 3300035207 | Ga0373942_0380450 | Ga0373942_0380450_46_456 | 136 |
| 1069 | 3300035242 | Ga0373962_0052640 | Ga0373962_0052640_329_739 | 136 |
| 1070 | 3300035410 | Ga0373924_0000068 | Ga0373924_0000068_21516_21926 | 136 |
| 1071 | 3300035410 | Ga0373924_0013747 | Ga0373924_0013747_317_727 | 136 |
| 1072 | 3300035410 | Ga0373924_0049930 | Ga0373924_0049930_1255_1665 | 136 |
| 1073 | 3300035410 | Ga0373924_0093919 | Ga0373924_0093919_769_1179 | 136 |
| 1074 | 3300035410 | Ga0373924_0110977 | Ga0373924_0110977_656_1066 | 136 |
| 1075 | 3300035691 | Ga0373931_0015086 | Ga0373931_0015086_744_1154 | 136 |
| 1076 | 3300035691 | Ga0373931_0065961 | Ga0373931_0065961_222_632 | 136 |
| 1077 | 3300035691 | Ga0373931_0219192 | Ga0373931_0219192_688_1104 | 136 |
| 1078 | 3300035691 | Ga0373931_0413978 | Ga0373931_0413978_355_765 | 136 |
| 1079 | 3300035691 | Ga0373931_0513186 | Ga0373931_0513186_35_448 | 136 |
| 1080 | 3300035692 | Ga0373935_0001922 | Ga0373935_0001922_5701_6111 | 136 |
| 1081 | 3300035692 | Ga0373935_0044182 | Ga0373935_0044182_459_872 | 136 |
| 1082 | 3300035692 | Ga0373935_0062312 | Ga0373935_0062312_118_528 | 136 |
| 1083 | 3300035692 | Ga0373935_0088998 | Ga0373935_0088998_762_1175 | 136 |
| 1084 | 3300035692 | Ga0373935_0154531 | Ga0373935_0154531_992_1402 | 136 |
| 1085 | 3300035692 | Ga0373935_0441896 | Ga0373935_0441896_278_781 | 136 |
| 1086 | 3300035695 | Ga0373927_0000021 | Ga0373927_0000021_34856_35266 | 136 |
| 1087 | 3300035695 | Ga0373927_0004851 | Ga0373927_0004851_4311_4721 | 136 |
| 1088 | 3300035695 | Ga0373927_0132432 | Ga0373927_0132432_1013_1423 | 136 |
| 1089 | 3300035724 | Ga0373933_0044565 | Ga0373933_0044565_588_998 | 136 |
| 1090 | 3300035724 | Ga0373933_0114449 | Ga0373933_0114449_359_769 | 136 |
| 1091 | 3300035724 | Ga0373933_0269322 | Ga0373933_0269322_190_600 | 136 |
| 1092 | 3300035724 | Ga0373933_0288608 | Ga0373933_0288608_581_991 | 136 |
| 1093 | 3300035724 | Ga0373933_0736590 | Ga0373933_0736590_160_570 | 136 |
| 1094 | 3300035725 | Ga0373947_0002466 | Ga0373947_0002466_6846_7256 | 136 |
| 1095 | 3300035725 | Ga0373947_0037855 | Ga0373947_0037855_188_598 | 136 |
| 1096 | 3300035725 | Ga0373947_0114539 | Ga0373947_0114539_651_1061 | 136 |
| 1097 | 3300035725 | Ga0373947_0119751 | Ga0373947_0119751_1165_1575 | 136 |
| 1098 | 3300035725 | Ga0373947_0176034 | Ga0373947_0176034_335_745 | 136 |
| 1099 | 3300035725 | Ga0373947_0471783 | Ga0373947_0471783_351_764 | 136 |
| 1100 | 3300035725 | Ga0373947_0848632 | Ga0373947_0848632_56_469 | 136 |
| 1101 | 3300036401 | Ga0373937_0042488 | Ga0373937_0042488_3337_3747 | 136 |
| 1102 | 3300036401 | Ga0373937_0086605 | Ga0373937_0086605_444_857 | 136 |
| 1103 | 3300036401 | Ga0373937_0105084 | Ga0373937_0105084_831_1241 | 136 |
| 1104 | 3300036401 | Ga0373937_0244543 | Ga0373937_0244543_156_566 | 136 |
| 1105 | 3300036401 | Ga0373937_0965987 | Ga0373937_0965987_68_478 | 136 |
| 1106 | 3300036401 | Ga0373937_1327605 | Ga0373937_1327605_129_539 | 136 |
| 1107 | 3300037068 | Ga0373925_0004097 | Ga0373925_0004097_2981_3391 | 136 |
| 1108 | 3300037068 | Ga0373925_0004660 | Ga0373925_0004660_2094_2504 | 136 |
| 1109 | 3300037068 | Ga0373925_0025607 | Ga0373925_0025607_3787_4200 | 136 |
| 1110 | 3300037068 | Ga0373925_0039398 | Ga0373925_0039398_150_560 | 136 |
| 1111 | 3300037068 | Ga0373925_0043648 | Ga0373925_0043648_374_784 | 136 |
| 1112 | 3300037068 | Ga0373925_0627372 | Ga0373925_0627372_163_576 | 136 |
| 1113 | 3300037068 | Ga0373925_1104428 | Ga0373925_1104428_92_502 | 136 |
| 1114 | 3300037068 | Ga0373925_1478035 | Ga0373925_1478035_134_544 | 136 |
| 1115 | 3300037068 | Ga0373925_1625014 | Ga0373925_1625014_47_460 | 136 |
| 1116 | 3300037466 | Ga0395898_0234003 | Ga0395898_0234003_1070_1480 | 136 |
| 1117 | 3300037471 | Ga0395905_0979428 | Ga0395905_0979428_211_621 | 136 |
| 1118 | 3300037853 | Ga0436364_0856169 | Ga0436364_0856169_1315_1731 | 136 |
| 1119 | 3300038443 | Ga0395901_0214172 | Ga0395901_0214172_1482_1892 | 136 |
| 1120 | 3300038996 | Ga0242420_029312 | Ga0242420_029312_530_940 | 136 |
| 1121 | 3300039437 | Ga0436365_1421008 | Ga0436365_1421008_778_1188 | 136 |
| 1122 | 3300039438 | Ga0436360_0525893 | Ga0436360_0525893_632_1042 | 136 |
| 1123 | 3300039438 | Ga0436360_0727080 | Ga0436360_0727080_92_502 | 136 |
| 1124 | 3300039447 | Ga0436361_0936610 | Ga0436361_0936610_106_516 | 136 |
| 1125 | 3300039450 | Ga0436363_0654277 | Ga0436363_0654277_2604_3020 | 136 |
| 1126 | 3300039450 | Ga0436363_0682772 | Ga0436363_0682772_2270_2680 | 136 |
| 1127 | 3300039450 | Ga0436363_0957099 | Ga0436363_0957099_239_649 | 136 |
| 1128 | 3300039450 | Ga0436363_1305165 | Ga0436363_1305165_710_1135 | 136 |
| 1129 | 3300039453 | Ga0436362_0212779 | Ga0436362_0212779_530_943 | 136 |
| 1130 | 3300039453 | Ga0436362_0857316 | Ga0436362_0857316_2807_3217 | 136 |
| 1131 | 3300039453 | Ga0436362_1069201 | Ga0436362_1069201_252_662 | 136 |
| 1132 | 3300039453 | Ga0436362_1157553 | Ga0436362_1157553_47_457 | 136 |
| 1133 | 3300042876 | Ga0451577_0642420 | Ga0451577_0642420_85_495 | 136 |
| 1134 | 3300044673 | Ga0453683_0137055 | Ga0453683_0137055_706_1116 | 136 |
| 1135 | 3300044694 | Ga0466963_0002948 | Ga0466963_0002948_6628_7038 | 136 |
| 1136 | 3300044712 | Ga0453684_1999474 | Ga0453684_1999474_99_509 | 136 |
| 1137 | 3300044842 | Ga0466957_0150619 | Ga0466957_0150619_540_950 | 136 |
| 1138 | 3300045049 | Ga0466959_0276036 | Ga0466959_0276036_264_674 | 136 |
| 1139 | 3300045051 | Ga0451576_0027604 | Ga0451576_0027604_3606_4016 | 136 |
| 1140 | 3300045836 | Ga0466958_0223860 | Ga0466958_0223860_724_1134 | 136 |
| 1141 | 3300045836 | Ga0466958_1068782 | Ga0466958_1068782_76_486 | 136 |
| 1142 | 3300045976 | Ga0466967_0006861 | Ga0466967_0006861_657_1067 | 136 |
| 1143 | 3300045976 | Ga0466967_0203797 | Ga0466967_0203797_421_834 | 136 |
| 1144 | 3300045976 | Ga0466967_0250375 | Ga0466967_0250375_759_1169 | 136 |
| 1145 | 3300045976 | Ga0466967_0271668 | Ga0466967_0271668_749_1159 | 136 |
| 1146 | 3300046454 | Ga0495592_0100581 | Ga0495592_0100581_1604_2017 | 136 |
| 1147 | 3300046455 | Ga0495603_0003176 | Ga0495603_0003176_2142_2555 | 136 |
| 1148 | 3300046455 | Ga0495603_0036976 | Ga0495603_0036976_993_1406 | 136 |
| 1149 | 3300046457 | Ga0495590_0391819 | Ga0495590_0391819_96_506 | 136 |
| 1150 | 3300046459 | Ga0495629_0006749 | Ga0495629_0006749_7693_8106 | 136 |
| 1151 | 3300046459 | Ga0495629_0008385 | Ga0495629_0008385_3567_3980 | 136 |
| 1152 | 3300046459 | Ga0495629_0011889 | Ga0495629_0011889_5785_6195 | 136 |
| 1153 | 3300046462 | Ga0495651_0068984 | Ga0495651_0068984_1453_1866 | 136 |
| 1154 | 3300046462 | Ga0495651_0100433 | Ga0495651_0100433_415_828 | 136 |
| 1155 | 3300046462 | Ga0495651_0232111 | Ga0495651_0232111_327_737 | 136 |
| 1156 | 3300046463 | Ga0495653_0010025 | Ga0495653_0010025_4948_5361 | 136 |
| 1157 | 3300046463 | Ga0495653_0446137 | Ga0495653_0446137_255_665 | 136 |
| 1158 | 3300046471 | Ga0495650_0000009 | Ga0495650_0000009_386666_387079 | 136 |
| 1159 | 3300046471 | Ga0495650_0003359 | Ga0495650_0003359_1945_2358 | 136 |
| 1160 | 3300046472 | Ga0495580_0000563 | Ga0495580_0000563_5578_5991 | 136 |
| 1161 | 3300046472 | Ga0495580_0001106 | Ga0495580_0001106_9836_10246 | 136 |
| 1162 | 3300046472 | Ga0495580_0001748 | Ga0495580_0001748_1964_2377 | 136 |
| 1163 | 3300046472 | Ga0495580_0013714 | Ga0495580_0013714_2760_3176 | 136 |
| 1164 | 3300046472 | Ga0495580_0018608 | Ga0495580_0018608_1151_1561 | 136 |
| 1165 | 3300046472 | Ga0495580_0047537 | Ga0495580_0047537_2484_2897 | 136 |
| 1166 | 3300046472 | Ga0495580_0053405 | Ga0495580_0053405_1568_1978 | 136 |
| 1167 | 3300046472 | Ga0495580_0081309 | Ga0495580_0081309_1498_1908 | 136 |
| 1168 | 3300046472 | Ga0495580_0112833 | Ga0495580_0112833_52_462 | 136 |
| 1169 | 3300046472 | Ga0495580_0142393 | Ga0495580_0142393_770_1180 | 136 |
| 1170 | 3300046472 | Ga0495580_0147585 | Ga0495580_0147585_312_722 | 136 |
| 1171 | 3300046472 | Ga0495580_0170471 | Ga0495580_0170471_164_577 | 136 |
| 1172 | 3300046472 | Ga0495580_0185593 | Ga0495580_0185593_655_1065 | 136 |
| 1173 | 3300046472 | Ga0495580_0254121 | Ga0495580_0254121_360_770 | 136 |
| 1174 | 3300046472 | Ga0495580_0371882 | Ga0495580_0371882_367_780 | 136 |
| 1175 | 3300046472 | Ga0495580_0483342 | Ga0495580_0483342_340_750 | 136 |
| 1176 | 3300046473 | Ga0495582_0001590 | Ga0495582_0001590_7747_8160 | 136 |
| 1177 | 3300046473 | Ga0495582_0014685 | Ga0495582_0014685_3838_4248 | 136 |
| 1178 | 3300046473 | Ga0495582_0057323 | Ga0495582_0057323_93_503 | 136 |
| 1179 | 3300046473 | Ga0495582_0080426 | Ga0495582_0080426_391_801 | 136 |
| 1180 | 3300046473 | Ga0495582_0475200 | Ga0495582_0475200_54_467 | 136 |
| 1181 | 3300046475 | Ga0495639_0016680 | Ga0495639_0016680_2624_3037 | 136 |
| 1182 | 3300046475 | Ga0495639_0055433 | Ga0495639_0055433_496_906 | 136 |
| 1183 | 3300046476 | Ga0495662_0002003 | Ga0495662_0002003_3108_3521 | 136 |
| 1184 | 3300046477 | Ga0495664_0003430 | Ga0495664_0003430_2959_3372 | 136 |
| 1185 | 3300046477 | Ga0495664_0012639 | Ga0495664_0012639_3944_4354 | 136 |
| 1186 | 3300046477 | Ga0495664_0088960 | Ga0495664_0088960_1315_1728 | 136 |
| 1187 | 3300046499 | Ga0495594_0000239 | Ga0495594_0000239_7263_7676 | 136 |
| 1188 | 3300046499 | Ga0495594_0001215 | Ga0495594_0001215_8510_8923 | 136 |
| 1189 | 3300046499 | Ga0495594_0001953 | Ga0495594_0001953_8429_8842 | 136 |
| 1190 | 3300046499 | Ga0495594_0054356 | Ga0495594_0054356_61_471 | 136 |
| 1191 | 3300046499 | Ga0495594_0058561 | Ga0495594_0058561_1238_1651 | 136 |
| 1192 | 3300046506 | Ga0495583_0017801 | Ga0495583_0017801_1998_2411 | 136 |
| 1193 | 3300046506 | Ga0495583_0068635 | Ga0495583_0068635_250_663 | 136 |
| 1194 | 3300046507 | Ga0495606_0092760 | Ga0495606_0092760_540_953 | 136 |
| 1195 | 3300046507 | Ga0495606_0156825 | Ga0495606_0156825_676_1089 | 136 |
| 1196 | 3300046507 | Ga0495606_0191197 | Ga0495606_0191197_638_1051 | 136 |
| 1197 | 3300046511 | Ga0495608_0272050 | Ga0495608_0272050_239_652 | 136 |
| 1198 | 3300046513 | Ga0495616_0274619 | Ga0495616_0274619_46_459 | 136 |
| 1199 | 3300046514 | Ga0495618_0117408 | Ga0495618_0117408_1071_1484 | 136 |
| 1200 | 3300046516 | Ga0495628_0001498 | Ga0495628_0001498_6482_6895 | 136 |
| 1201 | 3300046516 | Ga0495628_0105147 | Ga0495628_0105147_948_1358 | 136 |
| 1202 | 3300046516 | Ga0495628_0439843 | Ga0495628_0439843_413_823 | 136 |
| 1203 | 3300046517 | Ga0495630_0034429 | Ga0495630_0034429_2254_2664 | 136 |
| 1204 | 3300046517 | Ga0495630_0250199 | Ga0495630_0250199_74_484 | 136 |
| 1205 | 3300046517 | Ga0495630_0267091 | Ga0495630_0267091_868_1281 | 136 |
| 1206 | 3300046519 | Ga0495632_0315876 | Ga0495632_0315876_96_509 | 136 |
| 1207 | 3300046523 | Ga0495644_0000290 | Ga0495644_0000290_2186_2599 | 136 |
| 1208 | 3300046524 | Ga0495648_0254472 | Ga0495648_0254472_208_621 | 136 |
| 1209 | 3300046526 | Ga0495666_0000987 | Ga0495666_0000987_8086_8499 | 136 |
| 1210 | 3300046528 | Ga0495642_0054436 | Ga0495642_0054436_1214_1627 | 136 |
| 1211 | 3300046528 | Ga0495642_0259879 | Ga0495642_0259879_336_749 | 136 |
| 1212 | 3300046529 | Ga0495652_0003983 | Ga0495652_0003983_6660_7073 | 136 |
| 1213 | 3300046529 | Ga0495652_0093786 | Ga0495652_0093786_1766_2176 | 136 |
| 1214 | 3300046529 | Ga0495652_0154130 | Ga0495652_0154130_609_1022 | 136 |
| 1215 | 3300046529 | Ga0495652_0895144 | Ga0495652_0895144_139_549 | 136 |
| 1216 | 3300046531 | Ga0495665_0001222 | Ga0495665_0001222_7069_7482 | 136 |
| 1217 | 3300046531 | Ga0495665_0079395 | Ga0495665_0079395_1180_1590 | 136 |
| 1218 | 3300046531 | Ga0495665_0181929 | Ga0495665_0181929_206_616 | 136 |
| 1219 | 3300046531 | Ga0495665_0222318 | Ga0495665_0222318_197_610 | 136 |
| 1220 | 3300046533 | Ga0495640_0004227 | Ga0495640_0004227_2162_2575 | 136 |
| 1221 | 3300046535 | Ga0495586_0001012 | Ga0495586_0001012_12897_13310 | 136 |
| 1222 | 3300046535 | Ga0495586_0050652 | Ga0495586_0050652_38_541 | 136 |
| 1223 | 3300046536 | Ga0495587_0138502 | Ga0495587_0138502_277_690 | 136 |
| 1224 | 3300046538 | Ga0495609_0023923 | Ga0495609_0023923_1450_1863 | 136 |
| 1225 | 3300046543 | Ga0495645_0004045 | Ga0495645_0004045_5578_5991 | 136 |
| 1226 | 3300046543 | Ga0495645_0180992 | Ga0495645_0180992_116_529 | 136 |
| 1227 | 3300046543 | Ga0495645_0675006 | Ga0495645_0675006_65_475 | 136 |
| 1228 | 3300046543 | Ga0495645_0790021 | Ga0495645_0790021_89_502 | 136 |
| 1229 | 3300046557 | Ga0495622_0103638 | Ga0495622_0103638_875_1288 | 136 |
| 1230 | 3300046558 | Ga0495633_0024953 | Ga0495633_0024953_1364_1777 | 136 |
| 1231 | 3300046559 | Ga0495667_0005674 | Ga0495667_0005674_2783_3196 | 136 |
| 1232 | 3300046559 | Ga0495667_0407871 | Ga0495667_0407871_121_534 | 136 |
| 1233 | 3300046559 | Ga0495667_0528035 | Ga0495667_0528035_46_456 | 136 |
| 1234 | 3300046616 | Ga0495668_0143043 | Ga0495668_0143043_544_957 | 136 |
| 1235 | 3300046616 | Ga0495668_0328252 | Ga0495668_0328252_321_734 | 136 |
| 1236 | 3300046616 | Ga0495668_0444382 | Ga0495668_0444382_255_668 | 136 |
| 1237 | 3300046642 | Ga0495634_0001395 | Ga0495634_0001395_3144_3557 | 136 |
| 1238 | 3300046642 | Ga0495634_0267213 | Ga0495634_0267213_437_847 | 136 |
| 1239 | 3300046648 | Ga0495611_0031459 | Ga0495611_0031459_568_981 | 136 |
| 1240 | 3300046660 | Ga0495625_0000174 | Ga0495625_0000174_57879_58307 | 136 |
| 1241 | 3300046660 | Ga0495625_0051081 | Ga0495625_0051081_1319_1732 | 136 |
| 1242 | 3300046660 | Ga0495625_0082604 | Ga0495625_0082604_1246_1659 | 136 |
| 1243 | 3300046660 | Ga0495625_0107056 | Ga0495625_0107056_332_745 | 136 |
| 1244 | 3300046660 | Ga0495625_0373775 | Ga0495625_0373775_181_594 | 136 |
| 1245 | 3300046663 | Ga0495635_0003625 | Ga0495635_0003625_4307_4720 | 136 |
| 1246 | 3300046663 | Ga0495635_0171085 | Ga0495635_0171085_65_475 | 136 |
| 1247 | 3300046663 | Ga0495635_0466388 | Ga0495635_0466388_405_818 | 136 |
| 1248 | 3300046675 | Ga0495657_0072194 | Ga0495657_0072194_1293_1703 | 136 |
| 1249 | 3300046675 | Ga0495657_0164998 | Ga0495657_0164998_890_1303 | 136 |
| 1250 | 3300046678 | Ga0495599_0010918 | Ga0495599_0010918_2618_3031 | 136 |
| 1251 | 3300046678 | Ga0495599_0485170 | Ga0495599_0485170_207_617 | 136 |
| 1252 | 3300046679 | Ga0495623_0044332 | Ga0495623_0044332_1138_1548 | 136 |
| 1253 | 3300046679 | Ga0495623_0538859 | Ga0495623_0538859_19_429 | 136 |
| 1254 | 3300046679 | Ga0495623_0551408 | Ga0495623_0551408_175_588 | 136 |
| 1255 | 3300046680 | Ga0495646_0001575 | Ga0495646_0001575_8909_9322 | 136 |
| 1256 | 3300046680 | Ga0495646_0170319 | Ga0495646_0170319_162_575 | 136 |
| 1257 | 3300046680 | Ga0495646_0443667 | Ga0495646_0443667_245_658 | 136 |
| 1258 | 3300046684 | Ga0495669_0008466 | Ga0495669_0008466_433_846 | 136 |
| 1259 | 3300046684 | Ga0495669_0089066 | Ga0495669_0089066_725_1135 | 136 |
| 1260 | 3300046689 | Ga0495613_0001438 | Ga0495613_0001438_9092_9505 | 136 |
| 1261 | 3300046689 | Ga0495613_1126122 | Ga0495613_1126122_10_420 | 136 |
| 1262 | 3300046690 | Ga0495624_0014189 | Ga0495624_0014189_2652_3065 | 136 |
| 1263 | 3300046690 | Ga0495624_0147020 | Ga0495624_0147020_357_767 | 136 |
| 1264 | 3300046690 | Ga0495624_0308226 | Ga0495624_0308226_206_616 | 136 |
| 1265 | 3300046690 | Ga0495624_0412238 | Ga0495624_0412238_200_610 | 136 |
| 1266 | 3300046690 | Ga0495624_0537790 | Ga0495624_0537790_253_663 | 136 |
| 1267 | 3300046809 | Ga0495600_0004609 | Ga0495600_0004609_3887_4300 | 136 |
| 1268 | 3300046809 | Ga0495600_0125257 | Ga0495600_0125257_702_1115 | 136 |
| 1269 | 3300047315 | Ga0495581_0000697 | Ga0495581_0000697_5312_5725 | 136 |
| 1270 | 3300047315 | Ga0495581_0025866 | Ga0495581_0025866_1047_1460 | 136 |
| 1271 | 3300047315 | Ga0495581_0531185 | Ga0495581_0531185_46_549 | 136 |
| 1272 | 3300047317 | Ga0495604_0037535 | Ga0495604_0037535_47_457 | 136 |
| 1273 | 3300047318 | Ga0495636_0102648 | Ga0495636_0102648_17_430 | 136 |
| 1274 | 3300047319 | Ga0495674_0011347 | Ga0495674_0011347_3983_4396 | 136 |
| 1275 | 3300047319 | Ga0495674_0073736 | Ga0495674_0073736_2331_2744 | 136 |
| 1276 | 3300047319 | Ga0495674_0203153 | Ga0495674_0203153_150_563 | 136 |
| 1277 | 3300047319 | Ga0495674_0668975 | Ga0495674_0668975_391_801 | 136 |
| 1278 | 3300047320 | Ga0495672_0004082 | Ga0495672_0004082_2369_2797 | 136 |
| 1279 | 3300047320 | Ga0495672_0145954 | Ga0495672_0145954_774_1187 | 136 |
| 1280 | 3300047320 | Ga0495672_0290943 | Ga0495672_0290943_70_483 | 136 |
| 1281 | 3300047321 | Ga0495676_0000317 | Ga0495676_0000317_22114_22527 | 136 |
| 1282 | 3300047321 | Ga0495676_0747485 | Ga0495676_0747485_69_479 | 136 |
| 1283 | 3300047322 | Ga0495680_0008074 | Ga0495680_0008074_7719_8132 | 136 |
| 1284 | 3300047322 | Ga0495680_0756055 | Ga0495680_0756055_202_612 | 136 |
| 1285 | 3300047323 | Ga0495683_0236034 | Ga0495683_0236034_45_458 | 136 |
| 1286 | 3300047444 | Ga0495675_0002311 | Ga0495675_0002311_4150_4563 | 136 |
| 1287 | 3300047444 | Ga0495675_0112728 | Ga0495675_0112728_821_1231 | 136 |
| 1288 | 3300047445 | Ga0495677_0042322 | Ga0495677_0042322_33_446 | 136 |
| 1289 | 3300047469 | Ga0495673_0054735 | Ga0495673_0054735_144_557 | 136 |
| 1290 | 3300047469 | Ga0495673_0097231 | Ga0495673_0097231_704_1117 | 136 |
| 1291 | 3300047471 | Ga0495684_0454239 | Ga0495684_0454239_224_637 | 136 |
| 1292 | 3300047471 | Ga0495684_0508018 | Ga0495684_0508018_221_631 | 136 |
| 1293 | 3300047472 | Ga0495686_0000087 | Ga0495686_0000087_108530_108952 | 136 |
| 1294 | 3300047472 | Ga0495686_0002533 | Ga0495686_0002533_12638_13051 | 136 |
| 1295 | 3300047472 | Ga0495686_0035701 | Ga0495686_0035701_1510_1929 | 136 |
| 1296 | 3300047472 | Ga0495686_0081466 | Ga0495686_0081466_411_833 | 136 |
| 1297 | 3300047673 | Ga0495593_0018843 | Ga0495593_0018843_1586_1999 | 136 |
| 1298 | 3300048088 | Ga0495602_0148731 | Ga0495602_0148731_804_1214 | 136 |
| 1299 | 3300048088 | Ga0495602_0446062 | Ga0495602_0446062_360_770 | 136 |
| 1300 | 3300048088 | Ga0495602_0464006 | Ga0495602_0464006_22_432 | 136 |
| 1301 | 3300048088 | Ga0495602_0472318 | Ga0495602_0472318_361_771 | 136 |
| 1302 | 3300048089 | Ga0495614_0000365 | Ga0495614_0000365_9605_10018 | 136 |
| 1303 | 3300048089 | Ga0495614_0060575 | Ga0495614_0060575_1092_1505 | 136 |
| 1304 | 3300048903 | Ga0496100_0103946 | Ga0496100_0103946_389_799 | 136 |
| 1305 | 3300048903 | Ga0496100_0288884 | Ga0496100_0288884_691_1101 | 136 |
| 1306 | 3300048903 | Ga0496100_0838500 | Ga0496100_0838500_48_458 | 136 |
| 1307 | 3300048904 | Ga0496101_0086554 | Ga0496101_0086554_25_435 | 136 |
| 1308 | 3300048904 | Ga0496101_0258323 | Ga0496101_0258323_695_1105 | 136 |
| 1309 | 3300048904 | Ga0496101_0457649 | Ga0496101_0457649_22_432 | 136 |
| 1310 | 3300048904 | Ga0496101_0812690 | Ga0496101_0812690_235_645 | 136 |
| 1311 | 3300048905 | Ga0496102_0001500 | Ga0496102_0001500_1841_2251 | 136 |
| 1312 | 3300048905 | Ga0496102_0041202 | Ga0496102_0041202_243_653 | 136 |
| 1313 | 3300048905 | Ga0496102_0112371 | Ga0496102_0112371_2022_2432 | 136 |
| 1314 | 3300048905 | Ga0496102_0327497 | Ga0496102_0327497_198_608 | 136 |
| 1315 | 3300048905 | Ga0496102_0463468 | Ga0496102_0463468_441_851 | 136 |
| 1316 | 3300048905 | Ga0496102_0821426 | Ga0496102_0821426_246_656 | 136 |
| 1317 | 3300048906 | Ga0496103_0010834 | Ga0496103_0010834_3855_4265 | 136 |
| 1318 | 3300048906 | Ga0496103_0108522 | Ga0496103_0108522_508_918 | 136 |
| 1319 | 3300048906 | Ga0496103_0186427 | Ga0496103_0186427_760_1170 | 136 |
| 1320 | 3300048907 | Ga0496104_0002436 | Ga0496104_0002436_15016_15438 | 136 |
| 1321 | 3300048907 | Ga0496104_0022220 | Ga0496104_0022220_4731_5141 | 136 |
| 1322 | 3300048907 | Ga0496104_0023786 | Ga0496104_0023786_4598_5008 | 136 |
| 1323 | 3300048907 | Ga0496104_0023902 | Ga0496104_0023902_3834_4247 | 136 |
| 1324 | 3300048907 | Ga0496104_0115202 | Ga0496104_0115202_2088_2498 | 136 |
| 1325 | 3300048907 | Ga0496104_0296989 | Ga0496104_0296989_112_531 | 136 |
| 1326 | 3300048907 | Ga0496104_0433274 | Ga0496104_0433274_227_679 | 136 |
| 1327 | 3300048907 | Ga0496104_0567751 | Ga0496104_0567751_276_686 | 136 |
| 1328 | 3300048907 | Ga0496104_0779242 | Ga0496104_0779242_137_550 | 136 |
| 1329 | 3300048907 | Ga0496104_1441986 | Ga0496104_1441986_15_425 | 136 |
| 1330 | 3300048908 | Ga0496105_0098109 | Ga0496105_0098109_1197_1607 | 136 |
| 1331 | 3300048908 | Ga0496105_0213099 | Ga0496105_0213099_76_486 | 136 |
| 1332 | 3300048909 | Ga0496106_0031172 | Ga0496106_0031172_477_887 | 136 |
| 1333 | 3300048909 | Ga0496106_0090342 | Ga0496106_0090342_892_1302 | 136 |
| 1334 | 3300048909 | Ga0496106_0179820 | Ga0496106_0179820_1061_1471 | 136 |
| 1335 | 3300048909 | Ga0496106_0266849 | Ga0496106_0266849_54_464 | 136 |
| 1336 | 3300048910 | Ga0496107_0189850 | Ga0496107_0189850_1060_1470 | 136 |
| 1337 | 3300048910 | Ga0496107_0206222 | Ga0496107_0206222_415_825 | 136 |
| 1338 | 3300048910 | Ga0496107_0269813 | Ga0496107_0269813_468_878 | 136 |
| 1339 | 3300048911 | Ga0496108_0000422 | Ga0496108_0000422_11779_12231 | 136 |
| 1340 | 3300048911 | Ga0496108_0151919 | Ga0496108_0151919_1029_1439 | 136 |
| 1341 | 3300048911 | Ga0496108_1167986 | Ga0496108_1167986_99_509 | 136 |
| 1342 | 3300048911 | Ga0496108_1218765 | Ga0496108_1218765_193_606 | 136 |
| 1343 | 3300048912 | Ga0496109_0001507 | Ga0496109_0001507_6017_6469 | 136 |
| 1344 | 3300048912 | Ga0496109_0218740 | Ga0496109_0218740_441_851 | 136 |
| 1345 | 3300048912 | Ga0496109_0539880 | Ga0496109_0539880_460_870 | 136 |
| 1346 | 3300048912 | Ga0496109_0982305 | Ga0496109_0982305_181_591 | 136 |
| 1347 | 3300048913 | Ga0496110_0014240 | Ga0496110_0014240_3345_3755 | 136 |
| 1348 | 3300048913 | Ga0496110_0054816 | Ga0496110_0054816_1103_1513 | 136 |
| 1349 | 3300048914 | Ga0496111_0008180 | Ga0496111_0008180_6038_6448 | 136 |
| 1350 | 3300048914 | Ga0496111_0019854 | Ga0496111_0019854_2984_3394 | 136 |
| 1351 | 3300048914 | Ga0496111_0308824 | Ga0496111_0308824_382_792 | 136 |
| 1352 | 3300048915 | Ga0496112_0001888 | Ga0496112_0001888_3167_3619 | 136 |
| 1353 | 3300048915 | Ga0496112_0008075 | Ga0496112_0008075_2815_3225 | 136 |
| 1354 | 3300048915 | Ga0496112_0013759 | Ga0496112_0013759_6765_7175 | 136 |
| 1355 | 3300048915 | Ga0496112_0015992 | Ga0496112_0015992_5122_5532 | 136 |
| 1356 | 3300048915 | Ga0496112_0021039 | Ga0496112_0021039_870_1280 | 136 |
| 1357 | 3300048915 | Ga0496112_0068332 | Ga0496112_0068332_2099_2509 | 136 |
| 1358 | 3300048915 | Ga0496112_0982343 | Ga0496112_0982343_33_443 | 136 |
| 1359 | 3300048916 | Ga0496113_0001069 | Ga0496113_0001069_14379_14789 | 136 |
| 1360 | 3300048916 | Ga0496113_0023620 | Ga0496113_0023620_2323_2733 | 136 |
| 1361 | 3300048916 | Ga0496113_0064705 | Ga0496113_0064705_511_921 | 136 |
| 1362 | 3300048916 | Ga0496113_0119797 | Ga0496113_0119797_1597_2007 | 136 |
| 1363 | 3300048916 | Ga0496113_0438773 | Ga0496113_0438773_17_427 | 136 |
| 1364 | 3300048917 | Ga0496114_1613234 | Ga0496114_1613234_16_426 | 136 |
| 1365 | 3300048918 | Ga0496115_0004078 | Ga0496115_0004078_10110_10520 | 136 |
| 1366 | 3300048918 | Ga0496115_0021623 | Ga0496115_0021623_1796_2206 | 136 |
| 1367 | 3300048918 | Ga0496115_0065184 | Ga0496115_0065184_436_849 | 136 |
| 1368 | 3300048918 | Ga0496115_0281670 | Ga0496115_0281670_497_916 | 136 |
| 1369 | 3300048918 | Ga0496115_0926645 | Ga0496115_0926645_42_452 | 136 |
| 1370 | 3300048929 | Ga0496126_0000139 | Ga0496126_0000139_82277_82687 | 136 |
| 1371 | 3300048929 | Ga0496126_0003176 | Ga0496126_0003176_8882_9295 | 136 |
| 1372 | 3300048929 | Ga0496126_0197453 | Ga0496126_0197453_1020_1433 | 136 |
| 1373 | 3300049460 | Ga0495682_0039331 | Ga0495682_0039331_252_665 | 136 |
| 1374 | 3300049515 | Ga0501292_006508 | Ga0501292_006508_1127_1615 | 136 |
| 1375 | 3300049519 | Ga0501296_025900 | Ga0501296_025900_157_645 | 136 |
| 1376 | 3300049520 | Ga0501297_012034 | Ga0501297_012034_565_975 | 136 |
| 1377 | 3300049520 | Ga0501297_027267 | Ga0501297_027267_122_532 | 136 |
| 1378 | 3300049521 | Ga0501298_005110 | Ga0501298_005110_543_953 | 136 |
| 1379 | 3300049522 | Ga0501299_018295 | Ga0501299_018295_440_850 | 136 |
| 1380 | 3300049568 | Ga0501031_0036477 | Ga0501031_0036477_1213_1626 | 136 |
| 1381 | 3300049569 | Ga0501032_0000638 | Ga0501032_0000638_20149_20562 | 136 |
| 1382 | 3300049570 | Ga0501033_0007918 | Ga0501033_0007918_783_1196 | 136 |
| 1383 | 3300049570 | Ga0501033_0235156 | Ga0501033_0235156_847_1260 | 136 |
| 1384 | 3300049571 | Ga0501034_0002797 | Ga0501034_0002797_14971_15384 | 136 |
| 1385 | 3300049572 | Ga0501036_0001803 | Ga0501036_0001803_8359_8772 | 136 |
| 1386 | 3300049573 | Ga0501037_0020105 | Ga0501037_0020105_1470_1883 | 136 |
| 1387 | 3300049573 | Ga0501037_0159778 | Ga0501037_0159778_1181_1594 | 136 |
| 1388 | 3300049574 | Ga0501038_0000571 | Ga0501038_0000571_8227_8640 | 136 |
| 1389 | 3300049579 | Ga0501043_0002729 | Ga0501043_0002729_13067_13480 | 136 |
| 1390 | 3300049580 | Ga0501046_0001246 | Ga0501046_0001246_21561_21974 | 136 |
| 1391 | 3300049581 | Ga0501047_0002082 | Ga0501047_0002082_10337_10750 | 136 |
| 1392 | 3300049589 | Ga0501073_0005596 | Ga0501073_0005596_1022_1435 | 136 |
| 1393 | 3300049589 | Ga0501073_0206060 | Ga0501073_0206060_680_1090 | 136 |
| 1394 | 3300049589 | Ga0501073_0269169 | Ga0501073_0269169_146_559 | 136 |
| 1395 | 3300049593 | Ga0501077_0097755 | Ga0501077_0097755_1247_1657 | 136 |
| 1396 | 3300049669 | Ga0501235_213456 | Ga0501235_213456_11_499 | 136 |
| 1397 | 3300049742 | Ga0501080_0023122 | Ga0501080_0023122_1423_1836 | 136 |
| 1398 | 3300049742 | Ga0501080_0515185 | Ga0501080_0515185_593_1006 | 136 |
| 1399 | 3300049744 | Ga0501083_0206279 | Ga0501083_0206279_318_728 | 136 |
| 1400 | 3300049774 | Ga0501278_008949 | Ga0501278_008949_139_627 | 136 |
| 1401 | 3300049822 | Ga0501035_0008138 | Ga0501035_0008138_2035_2448 | 136 |
| 1402 | 3300049823 | Ga0501044_0015327 | Ga0501044_0015327_4515_4928 | 136 |
| 1403 | 3300049824 | Ga0501045_0313341 | Ga0501045_0313341_635_1048 | 136 |
| 1404 | 3300050510 | nmdc:mga06r32_308023_c1 | nmdc:mga06r32_308023_c1_462_872 | 136 |
| 1405 | 3300050512 | nmdc:mga0n895_46183_c1 | nmdc:mga0n895_46183_c1_1724_2134 | 136 |
| 1406 | 3300050512 | nmdc:mga0n895_473906_c1 | nmdc:mga0n895_473906_c1_642_1052 | 136 |
| 1407 | 3300050512 | nmdc:mga0n895_5110_c1 | nmdc:mga0n895_5110_c1_2749_3159 | 136 |
| 1408 | 3300050513 | nmdc:mga0rr50_1772902_c1 | nmdc:mga0rr50_1772902_c1_77_487 | 136 |
| 1409 | 3300050514 | nmdc:mga08x19_129199_c1 | nmdc:mga08x19_129199_c1_311_721 | 136 |
| 1410 | 3300050514 | nmdc:mga08x19_197730_c1 | nmdc:mga08x19_197730_c1_755_1165 | 136 |
| 1411 | 3300050515 | nmdc:mga0a205_553460_c1 | nmdc:mga0a205_553460_c1_424_834 | 136 |
| 1412 | 3300050515 | nmdc:mga0a205_94531_c1 | nmdc:mga0a205_94531_c1_711_1121 | 136 |
| 1413 | 3300053077 | Ga0495601_0012731 | Ga0495601_0012731_162_572 | 136 |
| 1414 | 3300053077 | Ga0495601_0067495 | Ga0495601_0067495_1501_1914 | 136 |
| 1415 | 3300053085 | Ga0495619_0804954 | Ga0495619_0804954_87_590 | 136 |
| 1416 | 3300053085 | Ga0495619_0934441 | Ga0495619_0934441_84_497 | 136 |
| 1417 | 3300053087 | Ga0500643_039654 | Ga0500643_039654_680_1093 | 136 |
| 1418 | 3300053093 | Ga0500651_0000010 | Ga0500651_0000010_252157_252570 | 136 |
| 1419 | 3300053119 | Ga0500595_000007 | Ga0500595_000007_266239_266652 | 136 |
| 1420 | 3300053119 | Ga0500595_023685 | Ga0500595_023685_1621_2034 | 136 |
| 1421 | 3300054114 | Ga0501084_0296196 | Ga0501084_0296196_730_1140 | 136 |
| 1422 | 3300055283 | Ga0500661_001206 | Ga0500661_001206_1859_2284 | 136 |
| 1423 | 3300059490 | Ga0587066_098490 | Ga0587066_098490_164_574 | 136 |
| 1424 | 3300059490 | Ga0587066_109753 | Ga0587066_109753_126_536 | 136 |
| 1425 | 3300059492 | Ga0587073_0062006 | Ga0587073_0062006_375_785 | 136 |
| 1426 | 3300059492 | Ga0587073_0095743 | Ga0587073_0095743_279_689 | 136 |
| 1427 | 3300059492 | Ga0587073_0305330 | Ga0587073_0305330_72_485 | 136 |
| 1428 | 3300059503 | Ga0587080_050009 | Ga0587080_050009_356_766 | 136 |
| 1429 | 3300059504 | Ga0587082_070565 | Ga0587082_070565_186_596 | 136 |
| 1430 | 3300059505 | Ga0587083_0084930 | Ga0587083_0084930_53_463 | 136 |
| 1431 | 3300059510 | Ga0587090_065221 | Ga0587090_065221_165_575 | 136 |
| 1432 | 3300059511 | Ga0587091_069249 | Ga0587091_069249_284_694 | 136 |
| 1433 | 3300059512 | Ga0587092_134761 | Ga0587092_134761_76_486 | 136 |
| 1434 | 3300059513 | Ga0587094_105529 | Ga0587094_105529_83_493 | 136 |
| 1435 | 3300059623 | Ga0587101_098024 | Ga0587101_098024_18_428 | 136 |
| 1436 | 3300059640 | Ga0587067_158215 | Ga0587067_158215_74_484 | 136 |
| 1437 | 3300059644 | Ga0587075_050988 | Ga0587075_050988_170_580 | 136 |
| 1438 | 3300059645 | Ga0587076_033672 | Ga0587076_033672_313_723 | 136 |
| 1439 | 3300059655 | Ga0587114_036932 | Ga0587114_036932_284_694 | 136 |
| 1440 | 3300060344 | Ga0587071_134932 | Ga0587071_134932_104_514 | 136 |
| 1441 | 3300060346 | Ga0587111_0213486 | Ga0587111_0213486_69_479 | 136 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3i2b-assembly3.cif.gz_I | the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase | 0.9511 | 2 | 135 |
| 1b66-assembly1.cif.gz_A | 6-pyruvoyl tetrahydropterin synthase | 0.9479 | 2 | 135 |
| 2dtt-assembly1.cif.gz_A | crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin | 0.9406 | 2 | 133 |
| 2g64-assembly1.cif.gz_A | structure of caenorhabditis elegans 6-pyruvoyl tetrahydropterin synthase | 0.9342 | 2 | 135 |
| 3i2b-assembly3.cif.gz_I | the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase | 0.931 | 2 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q1ZXI0_1_135_3.30.479.10 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.9478 | 2 | 135 | 3.30.479.10 |
| 2g64A00 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.9342 | 2 | 135 | 3.30.479.10 |
| 2g64A00 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.9146 | 2 | 135 | 3.30.479.10 |
| af_Q1ZXI0_1_135_3.30.479.10 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.9142 | 2 | 135 | 3.30.479.10 |
| 4ntmA00 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.909 | 1 | 134 | 3.30.479.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C7N2I5-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9767 | 3 | 133 |
GO:0003874
GO:0006729 GO:0046872 GO:0070497 |
| AF-A0A1F2SIV9-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9763 | 1 | 134 |
GO:0003874
GO:0006729 GO:0046872 GO:0070497 |
| AF-A0A522AXJ6-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9759 | 2 | 136 |
GO:0003874
GO:0006729 GO:0046872 GO:0070497 |
| AF-A0A1H4JCJ5-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9757 | 1 | 135 |
GO:0046872
GO:0070497 |
| AF-A0A7X3UJW7-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9754 | 3 | 135 |
GO:0003874
GO:0006729 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar