F493953

General Info

Members Datasets Scaffolds Average Seq Length
1437 410 2874 203

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100093467|Ga0070667_1000934673
Length 227
Sequence MPFGAARARDVHAGRRRLGILSVAHHVLTPPVTEAQVRALAVDDTVTLQGTLFGIRDATLIHMFDRGRTTRFDLAGHAVIHTAPNVKPVTRSAAHPAGYAPVCVGTTTSDRMERFTRPLMTGHGVRIIVGKGGLREDSLAAFREFGGVYLAIIGGTAALETTWVEAIEDVDLDDLNPESLWRFRVRDFGPLLVAMDSRGASLYDDVRRAAADRRARILASLGVAGPR

Samples

Sample ID Description Type Environment
1 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
210 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
211 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
212 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
213 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
214 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
215 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
216 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
217 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
218 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
219 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
220 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
221 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
222 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
223 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
224 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
225 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
226 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
229 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
230 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
231 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
232 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
235 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
236 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
237 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
238 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
239 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
240 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
241 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
242 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
243 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
244 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
245 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
246 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
247 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
249 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
250 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
251 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
252 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
253 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
254 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
255 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
256 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
257 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
258 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
259 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
260 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
261 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
262 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
263 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
267 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
268 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
269 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
270 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
271 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
272 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
273 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
274 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
275 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
276 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
277 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
278 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
279 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
280 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
281 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
282 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
283 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
284 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
285 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
286 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
287 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
288 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
289 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
290 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
291 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
292 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
293 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
294 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
295 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
296 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
297 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
298 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
299 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
300 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
301 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
302 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
303 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
304 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
305 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
306 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
307 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
308 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
309 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
310 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
311 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
312 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
313 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
314 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
315 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
316 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
317 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
318 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
319 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
320 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
321 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
322 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
323 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
324 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
325 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
326 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
327 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
328 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
329 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
330 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
331 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
332 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
333 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
334 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
335 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
336 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
337 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
338 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
339 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
340 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
341 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
342 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
343 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
344 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
345 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
346 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
347 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
348 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
349 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
350 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
351 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
352 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
353 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
354 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
355 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
356 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
357 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
371 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
372 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
373 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
374 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
375 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
376 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
377 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
378 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
379 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
380 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
381 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
382 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
383 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
384 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
385 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
386 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
387 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
388 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
391 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
392 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
393 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
394 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
395 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
396 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
397 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
398 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
399 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
400 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
401 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
402 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
403 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
404 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
405 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
406 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
407 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
408 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
409 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
410 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.21
Isolates 0.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 2.99
Rhizosphere 96.17
Stem 0
Stem Tuber 0
Unclassified 0.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_100093467 3300005367 Bacteria 2590
2 Ga0065712_10178788 3300005290 Bacteria 1204
3 Ga0065707_10083980 3300005295 Bacteria 7866
4 Ga0065707_10194999 3300005295 Bacteria 1340
5 Ga0070658_10014434 3300005327 Bacteria 6339
6 Ga0070658_10038108 3300005327 Bacteria 3877
7 Ga0070658_10140960 3300005327 Bacteria 2014
8 Ga0070658_10360130 3300005327 Bacteria 1246
9 Ga0070676_10005772 3300005328 Bacteria 6599
10 Ga0070676_10024104 3300005328 Bacteria 3424
11 Ga0070676_10402513 3300005328 Bacteria 953
12 Ga0070683_100031728 3300005329 Bacteria 4807
13 Ga0070683_100109436 3300005329 Bacteria 2606
14 Ga0070683_100193413 3300005329 Bacteria 1932
15 Ga0070670_100003426 3300005331 Bacteria 13164
16 Ga0070670_100022180 3300005331 Bacteria 5464
17 Ga0070670_100027426 3300005331 Bacteria 4899
18 Ga0070670_100161062 3300005331 Bacteria 1944
19 Ga0070677_10001447 3300005333 Bacteria 7517
20 Ga0070677_10065705 3300005333 Bacteria 1510
21 Ga0068869_100000112 3300005334 Bacteria 38783
22 Ga0068869_100001018 3300005334 Bacteria 16298
23 Ga0068869_100053817 3300005334 Bacteria 2928
24 Ga0068869_100064339 3300005334 Bacteria 2697
25 Ga0068869_100096094 3300005334 Bacteria 2236
26 Ga0068869_100134484 3300005334 Bacteria 1904
27 Ga0068869_100381715 3300005334 Bacteria 1155
28 Ga0068869_100479924 3300005334 Bacteria 1035
29 Ga0070666_10000781 3300005335 Bacteria 19261
30 Ga0070666_10006653 3300005335 Bacteria 7107
31 Ga0070666_10053681 3300005335 Bacteria 2719
32 Ga0070680_100070820 3300005336 Bacteria 2864
33 Ga0070680_100089741 3300005336 Bacteria 2543
34 Ga0070680_100108601 3300005336 Bacteria 2308
35 Ga0070680_100111562 3300005336 Bacteria 2277
36 Ga0070680_100119566 3300005336 Bacteria 2198
37 Ga0070680_100605503 3300005336 Bacteria 940
38 Ga0070682_100109918 3300005337 Bacteria 1835
39 Ga0068868_100001147 3300005338 Bacteria 18142
40 Ga0068868_100001733 3300005338 Bacteria 14946
41 Ga0068868_100021318 3300005338 Bacteria 4880
42 Ga0068868_100034707 3300005338 Bacteria 3896
43 Ga0068868_100056350 3300005338 Bacteria 3103
44 Ga0068868_100089555 3300005338 Bacteria 2477
45 Ga0068868_100125939 3300005338 Bacteria 2093
46 Ga0068868_100280896 3300005338 Bacteria 1409
47 Ga0070660_100087014 3300005339 Bacteria 2459
48 Ga0070660_100092315 3300005339 Bacteria 2389
49 Ga0070660_100115152 3300005339 Bacteria 2143
50 Ga0070660_100196619 3300005339 Bacteria 1635
51 Ga0070660_100553673 3300005339 Bacteria 960
52 Ga0070689_100002351 3300005340 Bacteria 12312
53 Ga0070689_100005181 3300005340 Bacteria 8873
54 Ga0070689_100012648 3300005340 Bacteria 6087
55 Ga0070689_100019120 3300005340 Bacteria 5059
56 Ga0070689_100040811 3300005340 Bacteria 3559
57 Ga0070689_100075722 3300005340 Bacteria 2635
58 Ga0070689_100106179 3300005340 Bacteria 2228
59 Ga0070689_100176371 3300005340 Bacteria 1734
60 Ga0070689_100208658 3300005340 Bacteria 1598
61 Ga0070689_100434987 3300005340 Bacteria 1114
62 Ga0070691_10165159 3300005341 Bacteria 1144
63 Ga0070691_10196368 3300005341 Bacteria 1058
64 Ga0070687_100017060 3300005343 Bacteria 3330
65 Ga0070687_100028587 3300005343 Bacteria 2706
66 Ga0070661_100001174 3300005344 Bacteria 18486
67 Ga0070661_100013097 3300005344 Bacteria 5818
68 Ga0070661_100074882 3300005344 Bacteria 2494
69 Ga0070661_100102290 3300005344 Bacteria 2132
70 Ga0070661_100136577 3300005344 Bacteria 1845
71 Ga0070661_100143694 3300005344 Bacteria 1799
72 Ga0070661_100381240 3300005344 Bacteria 1111
73 Ga0070692_10001272 3300005345 Bacteria 9007
74 Ga0070692_10013414 3300005345 Bacteria 3819
75 Ga0070692_10089620 3300005345 Bacteria 1670
76 Ga0070692_10147536 3300005345 Bacteria 1337
77 Ga0070692_10179610 3300005345 Bacteria 1226
78 Ga0070692_10211235 3300005345 Bacteria 1142
79 Ga0070668_100001871 3300005347 Bacteria 15367
80 Ga0070668_100014438 3300005347 Bacteria 5903
81 Ga0070668_100038797 3300005347 Bacteria 3642
82 Ga0070668_100051416 3300005347 Bacteria 3175
83 Ga0070668_100351491 3300005347 Bacteria 1248
84 Ga0070669_100001240 3300005353 Bacteria 18488
85 Ga0070669_100140437 3300005353 Bacteria 1862
86 Ga0070669_100227792 3300005353 Bacteria 1476
87 Ga0070669_100381275 3300005353 Bacteria 1150
88 Ga0070669_100447214 3300005353 Bacteria 1064
89 Ga0070669_100483876 3300005353 Bacteria 1025
90 Ga0070675_100001111 3300005354 Bacteria 19381
91 Ga0070675_100012372 3300005354 Bacteria 6688
92 Ga0070675_100014606 3300005354 Bacteria 6192
93 Ga0070675_100037285 3300005354 Bacteria 3959
94 Ga0070675_100189574 3300005354 Bacteria 1781
95 Ga0070671_100001989 3300005355 Bacteria 15693
96 Ga0070671_100003908 3300005355 Bacteria 11719
97 Ga0070671_100011511 3300005355 Bacteria 7112
98 Ga0070671_100397957 3300005355 Bacteria 1178
99 Ga0070671_100423469 3300005355 Bacteria 1140
100 Ga0070671_100512902 3300005355 Bacteria 1032
101 Ga0070671_100531676 3300005355 Bacteria 1013
102 Ga0070674_100030572 3300005356 Bacteria 3561
103 Ga0070674_100074164 3300005356 Bacteria 2414
104 Ga0070674_100180123 3300005356 Bacteria 1618
105 Ga0070673_100002058 3300005364 Bacteria 12129
106 Ga0070673_100002508 3300005364 Bacteria 11199
107 Ga0070673_100005751 3300005364 Bacteria 7978
108 Ga0070673_100015173 3300005364 Bacteria 5400
109 Ga0070673_100153331 3300005364 Bacteria 1953
110 Ga0070673_100369311 3300005364 Bacteria 1277
111 Ga0070688_100000963 3300005365 Bacteria 14416
112 Ga0070688_100040776 3300005365 Bacteria 2847
113 Ga0070688_100082289 3300005365 Bacteria 2086
114 Ga0070688_100125793 3300005365 Bacteria 1723
115 Ga0070688_100174182 3300005365 Bacteria 1487
116 Ga0070688_100248659 3300005365 Bacteria 1265
117 Ga0070688_100338582 3300005365 Bacteria 1098
118 Ga0070659_100032339 3300005366 Bacteria 4056
119 Ga0070659_100058443 3300005366 Bacteria 3043
120 Ga0070659_100099926 3300005366 Bacteria 2334
121 Ga0070659_100117836 3300005366 Bacteria 2148
122 Ga0070659_100125007 3300005366 Bacteria 2086
123 Ga0070659_100426486 3300005366 Bacteria 1122
124 Ga0070667_100002249 3300005367 Bacteria 16991
125 Ga0070667_100007540 3300005367 Bacteria 9025
126 Ga0070667_100073320 3300005367 Bacteria 2918
127 Ga0070667_100121562 3300005367 Bacteria 2271
128 Ga0070667_100590390 3300005367 Bacteria 1023
129 Ga0070667_100648478 3300005367 Bacteria 975
130 Ga0070709_10061920 3300005434 Bacteria 2384
131 Ga0070709_10082586 3300005434 Bacteria 2099
132 Ga0070709_10464747 3300005434 Bacteria 955
133 Ga0070714_100063207 3300005435 Bacteria 3182
134 Ga0070714_100091132 3300005435 Bacteria 2671
135 Ga0070714_100242325 3300005435 Bacteria 1664
136 Ga0070714_100691097 3300005435 Bacteria 984
137 Ga0070714_100718799 3300005435 Bacteria 964
138 Ga0070714_101107393 3300005435 Bacteria 772
139 Ga0070713_100000532 3300005436 Bacteria 24168
140 Ga0070713_100068189 3300005436 Bacteria 2997
141 Ga0070713_100091700 3300005436 Bacteria 2614
142 Ga0070713_100142727 3300005436 Bacteria 2123
143 Ga0070713_100344792 3300005436 Bacteria 1381
144 Ga0070710_10003737 3300005437 Bacteria 7193
145 Ga0070710_10230774 3300005437 Bacteria 1181
146 Ga0070710_10246945 3300005437 Bacteria 1146
147 Ga0070701_10090202 3300005438 Bacteria 1678
148 Ga0070701_10142578 3300005438 Bacteria 1372
149 Ga0070701_10167381 3300005438 Bacteria 1277
150 Ga0070711_100002284 3300005439 Bacteria 10871
151 Ga0070711_100027487 3300005439 Bacteria 3736
152 Ga0070711_100166348 3300005439 Bacteria 1677
153 Ga0070711_100361101 3300005439 Bacteria 1170
154 Ga0070711_100386653 3300005439 Bacteria 1133
155 Ga0070711_100469007 3300005439 Bacteria 1033
156 Ga0070705_100001907 3300005440 Bacteria 10710
157 Ga0070705_100114162 3300005440 Bacteria 1732
158 Ga0070705_100127630 3300005440 Bacteria 1654
159 Ga0070700_100020549 3300005441 Bacteria 3826
160 Ga0070700_100656816 3300005441 Bacteria 829
161 Ga0070694_100000367 3300005444 Bacteria 24183
162 Ga0070694_100013195 3300005444 Bacteria 5157
163 Ga0070694_100022121 3300005444 Bacteria 4072
164 Ga0070694_100307303 3300005444 Bacteria 1217
165 Ga0070694_100432535 3300005444 Bacteria 1036
166 Ga0070708_101007694 3300005445 Bacteria 781
167 Ga0070663_100006987 3300005455 Bacteria 6837
168 Ga0070663_100047959 3300005455 Bacteria 3027
169 Ga0070663_100072322 3300005455 Bacteria 2511
170 Ga0070663_100089418 3300005455 Bacteria 2279
171 Ga0070663_100483303 3300005455 Bacteria 1026
172 Ga0070678_100002115 3300005456 Bacteria 10765
173 Ga0070678_100006182 3300005456 Bacteria 6999
174 Ga0070678_100117824 3300005456 Bacteria 2089
175 Ga0070678_100128027 3300005456 Bacteria 2013
176 Ga0070678_100527282 3300005456 Bacteria 1046
177 Ga0070662_100041469 3300005457 Bacteria 3284
178 Ga0070662_100061921 3300005457 Bacteria 2733
179 Ga0070662_100128034 3300005457 Bacteria 1954
180 Ga0070662_100803316 3300005457 Bacteria 800
181 Ga0070681_10012333 3300005458 Bacteria 8474
182 Ga0070681_10058584 3300005458 Bacteria 3831
183 Ga0070681_10067846 3300005458 Bacteria 3534
184 Ga0070681_10737154 3300005458 Bacteria 902
185 Ga0070681_11063443 3300005458 Bacteria 730
186 Ga0068867_100007281 3300005459 Bacteria 7829
187 Ga0068867_100031780 3300005459 Bacteria 3814
188 Ga0068867_100164179 3300005459 Bacteria 1754
189 Ga0068867_100170624 3300005459 Bacteria 1723
190 Ga0068867_100219033 3300005459 Bacteria 1533
191 Ga0068867_100424919 3300005459 Bacteria 1126
192 Ga0068867_100471975 3300005459 Bacteria 1073
193 Ga0070685_10000757 3300005466 Bacteria 17554
194 Ga0070685_10010061 3300005466 Bacteria 4906
195 Ga0070706_100053220 3300005467 Bacteria 3736
196 Ga0070706_100229901 3300005467 Bacteria 1731
197 Ga0070707_100008673 3300005468 Bacteria 9431
198 Ga0070707_100152544 3300005468 Bacteria 2250
199 Ga0070698_100012657 3300005471 Bacteria 8932
200 Ga0070698_100169109 3300005471 Bacteria 2127
201 Ga0070698_100360361 3300005471 Bacteria 1386
202 Ga0070698_100776526 3300005471 Bacteria 902
203 Ga0070698_100836757 3300005471 Bacteria 865
204 Ga0070698_101235737 3300005471 Bacteria 697
205 Ga0070699_100021481 3300005518 Bacteria 5566
206 Ga0070679_100047855 3300005530 Bacteria 4261
207 Ga0070679_100080787 3300005530 Bacteria 3241
208 Ga0070679_100090207 3300005530 Bacteria 3053
209 Ga0070679_100311868 3300005530 Bacteria 1523
210 Ga0070679_101000200 3300005530 Bacteria 780
211 Ga0070684_100015948 3300005535 Bacteria 6135
212 Ga0070684_100032306 3300005535 Bacteria 4460
213 Ga0070684_100305989 3300005535 Bacteria 1459
214 Ga0070684_100399753 3300005535 Bacteria 1266
215 Ga0070697_100015481 3300005536 Bacteria 5987
216 Ga0070697_100195886 3300005536 Bacteria 1716
217 Ga0070697_100771699 3300005536 Bacteria 850
218 Ga0068853_100004975 3300005539 Bacteria 10358
219 Ga0068853_100009004 3300005539 Bacteria 8039
220 Ga0068853_100023153 3300005539 Bacteria 5197
221 Ga0068853_100055592 3300005539 Bacteria 3412
222 Ga0068853_100097508 3300005539 Bacteria 2595
223 Ga0068853_100355467 3300005539 Bacteria 1363
224 Ga0070672_100004036 3300005543 Bacteria 9578
225 Ga0070672_100022023 3300005543 Bacteria 4674
226 Ga0070672_100088654 3300005543 Bacteria 2491
227 Ga0070672_100166074 3300005543 Bacteria 1833
228 Ga0070686_100000664 3300005544 Bacteria 20136
229 Ga0070686_100027252 3300005544 Bacteria 3457
230 Ga0070686_100202081 3300005544 Bacteria 1425
231 Ga0070686_100243739 3300005544 Bacteria 1310
232 Ga0070686_100313804 3300005544 Bacteria 1167
233 Ga0070695_100027197 3300005545 Bacteria 3543
234 Ga0070695_100030108 3300005545 Bacteria 3377
235 Ga0070695_100330631 3300005545 Bacteria 1136
236 Ga0070695_100550091 3300005545 Bacteria 900
237 Ga0070695_101009433 3300005545 Bacteria 677
238 Ga0070696_100000082 3300005546 Bacteria 47144
239 Ga0070696_100025207 3300005546 Bacteria 4042
240 Ga0070696_100031584 3300005546 Bacteria 3630
241 Ga0070696_100053284 3300005546 Bacteria 2816
242 Ga0070696_100154884 3300005546 Bacteria 1685
243 Ga0070696_100260802 3300005546 Bacteria 1314
244 Ga0070696_100373860 3300005546 Bacteria 1109
245 Ga0070696_100749430 3300005546 Bacteria 800
246 Ga0070693_100000114 3300005547 Bacteria 35958
247 Ga0070693_100000865 3300005547 Bacteria 13507
248 Ga0070693_100001090 3300005547 Bacteria 12181
249 Ga0070693_100124512 3300005547 Bacteria 1603
250 Ga0070693_100143356 3300005547 Bacteria 1506
251 Ga0070693_100525855 3300005547 Bacteria 843
252 Ga0070693_100766040 3300005547 Bacteria 712
253 Ga0070665_100004099 3300005548 Bacteria 15326
254 Ga0070665_100014838 3300005548 Bacteria 7819
255 Ga0070665_100092643 3300005548 Bacteria 3026
256 Ga0070665_100132351 3300005548 Bacteria 2496
257 Ga0070704_100000018 3300005549 Bacteria 54668
258 Ga0070704_100000804 3300005549 Bacteria 15566
259 Ga0070704_100019690 3300005549 Bacteria 4340
260 Ga0070704_100049634 3300005549 Bacteria 2945
261 Ga0070704_100178553 3300005549 Bacteria 1696
262 Ga0070704_100278118 3300005549 Bacteria 1385
263 Ga0068855_100000606 3300005563 Bacteria 43933
264 Ga0068855_100013117 3300005563 Bacteria 9994
265 Ga0068855_100034412 3300005563 Bacteria 6043
266 Ga0068855_100062259 3300005563 Bacteria 4356
267 Ga0068855_100065347 3300005563 Bacteria 4241
268 Ga0068855_100080350 3300005563 Bacteria 3781
269 Ga0068855_100128475 3300005563 Bacteria 2896
270 Ga0068855_100140646 3300005563 Bacteria 2752
271 Ga0068855_100362795 3300005563 Bacteria 1594
272 Ga0068855_100648125 3300005563 Bacteria 1134
273 Ga0068855_100774007 3300005563 Bacteria 1022
274 Ga0070664_100002050 3300005564 Bacteria 16137
275 Ga0070664_100003666 3300005564 Bacteria 12371
276 Ga0070664_100011554 3300005564 Bacteria 7164
277 Ga0070664_100037097 3300005564 Bacteria 4095
278 Ga0070664_100079186 3300005564 Bacteria 2828
279 Ga0070664_100225260 3300005564 Bacteria 1679
280 Ga0070664_100232889 3300005564 Bacteria 1651
281 Ga0070664_100472651 3300005564 Bacteria 1153
282 Ga0070664_100594986 3300005564 Bacteria 1025
283 Ga0068857_100002436 3300005577 Bacteria 15187
284 Ga0068857_100022316 3300005577 Bacteria 5568
285 Ga0068857_100065835 3300005577 Bacteria 3223
286 Ga0068857_100235191 3300005577 Bacteria 1676
287 Ga0068857_100842970 3300005577 Bacteria 877
288 Ga0068857_100878560 3300005577 Bacteria 859
289 Ga0068854_100014836 3300005578 Bacteria 5144
290 Ga0068854_100062130 3300005578 Bacteria 2707
291 Ga0068854_100086270 3300005578 Bacteria 2326
292 Ga0068854_100089888 3300005578 Bacteria 2283
293 Ga0068854_100102892 3300005578 Bacteria 2143
294 Ga0068854_100258581 3300005578 Bacteria 1393
295 Ga0068854_100601558 3300005578 Bacteria 939
296 Ga0068856_100001525 3300005614 Bacteria 24270
297 Ga0068856_100008201 3300005614 Bacteria 10186
298 Ga0068856_100008271 3300005614 Bacteria 10142
299 Ga0068856_100027541 3300005614 Bacteria 5544
300 Ga0068856_100225844 3300005614 Bacteria 1888
301 Ga0068856_100726125 3300005614 Bacteria 1014
302 Ga0070702_100000345 3300005615 Bacteria 16164
303 Ga0070702_100001358 3300005615 Bacteria 9970
304 Ga0070702_100007759 3300005615 Bacteria 5156
305 Ga0070702_100033148 3300005615 Bacteria 2838
306 Ga0070702_100077189 3300005615 Bacteria 1985
307 Ga0070702_100177671 3300005615 Bacteria 1390
308 Ga0070702_100224513 3300005615 Bacteria 1258
309 Ga0070702_100248854 3300005615 Bacteria 1204
310 Ga0068852_100003212 3300005616 Bacteria 11414
311 Ga0068852_100017095 3300005616 Bacteria 5682
312 Ga0068852_100017275 3300005616 Bacteria 5656
313 Ga0068852_100017306 3300005616 Bacteria 5651
314 Ga0068852_100057315 3300005616 Bacteria 3370
315 Ga0068852_100070112 3300005616 Bacteria 3074
316 Ga0068852_100098599 3300005616 Bacteria 2632
317 Ga0068852_100506752 3300005616 Bacteria 1202
318 Ga0068859_100001261 3300005617 Bacteria 25857
319 Ga0068859_100003443 3300005617 Bacteria 16087
320 Ga0068859_100004359 3300005617 Bacteria 14441
321 Ga0068859_100025159 3300005617 Bacteria 5974
322 Ga0068859_100146661 3300005617 Bacteria 2435
323 Ga0068859_100211036 3300005617 Bacteria 2028
324 Ga0068859_100527985 3300005617 Bacteria 1275
325 Ga0068859_100605326 3300005617 Bacteria 1189
326 Ga0068864_100002301 3300005618 Bacteria 15798
327 Ga0068864_100003329 3300005618 Bacteria 13279
328 Ga0068864_100005882 3300005618 Bacteria 10052
329 Ga0068864_100139973 3300005618 Bacteria 2182
330 Ga0068866_10000156 3300005718 Bacteria 31375
331 Ga0068866_10001559 3300005718 Bacteria 9746
332 Ga0068866_10387332 3300005718 Bacteria 898
333 Ga0068861_100005694 3300005719 Bacteria 8445
334 Ga0068861_100139689 3300005719 Bacteria 1976
335 Ga0068861_100220552 3300005719 Bacteria 1602
336 Ga0068861_100289238 3300005719 Bacteria 1414
337 Ga0068851_10000414 3300005834 Bacteria 19144
338 Ga0068851_10002960 3300005834 Bacteria 7510
339 Ga0068851_10005874 3300005834 Bacteria 5589
340 Ga0068851_10007372 3300005834 Bacteria 5047
341 Ga0068851_10008358 3300005834 Bacteria 4783
342 Ga0068851_10078576 3300005834 Bacteria 1719
343 Ga0068851_10143644 3300005834 Bacteria 1300
344 Ga0068870_10007432 3300005840 Bacteria 4882
345 Ga0068870_10008779 3300005840 Bacteria 4559
346 Ga0068870_10019968 3300005840 Bacteria 3256
347 Ga0068870_10033888 3300005840 Bacteria 2610
348 Ga0068863_100003709 3300005841 Bacteria 15112
349 Ga0068863_100004215 3300005841 Bacteria 14202
350 Ga0068863_100017847 3300005841 Bacteria 6790
351 Ga0068863_100624766 3300005841 Bacteria 1067
352 Ga0068858_100003266 3300005842 Bacteria 16159
353 Ga0068858_100005937 3300005842 Bacteria 11925
354 Ga0068858_100006737 3300005842 Bacteria 11178
355 Ga0068858_100045084 3300005842 Bacteria 4086
356 Ga0068858_100052098 3300005842 Bacteria 3786
357 Ga0068858_100216015 3300005842 Bacteria 1815
358 Ga0068860_100003163 3300005843 Bacteria 16989
359 Ga0068860_100024839 3300005843 Bacteria 5786
360 Ga0068860_100042384 3300005843 Bacteria 4347
361 Ga0068860_100205096 3300005843 Bacteria 1912
362 Ga0068860_100221680 3300005843 Bacteria 1837
363 Ga0068860_100384044 3300005843 Unclassified 1387
364 Ga0068860_100578076 3300005843 Bacteria 1127
365 Ga0068860_100716665 3300005843 Bacteria 1011
366 Ga0068862_100002561 3300005844 Bacteria 16062
367 Ga0068862_100003677 3300005844 Bacteria 13117
368 Ga0068862_100004741 3300005844 Bacteria 11445
369 Ga0068862_100211566 3300005844 Bacteria 1752
370 Ga0068862_100572451 3300005844 Bacteria 1081
371 Ga0081455_10276846 3300005937 Bacteria 1214
372 Ga0070717_10196409 3300006028 Bacteria 1765
373 Ga0070717_11119302 3300006028 Bacteria 717
374 Ga0075364_10118616 3300006051 Bacteria 1770
375 Ga0075432_10165643 3300006058 Bacteria 857
376 Ga0070716_100026870 3300006173 Bacteria 3085
377 Ga0070716_100209919 3300006173 Bacteria 1300
378 Ga0070716_100271330 3300006173 Bacteria 1166
379 Ga0070712_100060565 3300006175 Bacteria 2670
380 Ga0070712_100356366 3300006175 Bacteria 1199
381 Ga0075369_10100281 3300006186 Bacteria 1299
382 Ga0075366_10008007 3300006195 Bacteria 5855
383 Ga0075366_10071203 3300006195 Bacteria 2071
384 Ga0075366_10237630 3300006195 Bacteria 1110
385 Ga0097621_100013103 3300006237 Bacteria 6166
386 Ga0097621_100055281 3300006237 Bacteria 3241
387 Ga0097621_100101737 3300006237 Bacteria 2418
388 Ga0097621_100202487 3300006237 Bacteria 1724
389 Ga0097621_100287620 3300006237 Bacteria 1448
390 Ga0097621_100447749 3300006237 Bacteria 1163
391 Ga0097621_100699760 3300006237 Bacteria 933
392 Ga0068871_100002592 3300006358 Bacteria 12334
393 Ga0068871_100009430 3300006358 Bacteria 7073
394 Ga0068871_100014850 3300006358 Bacteria 5818
395 Ga0068871_100037389 3300006358 Bacteria 3871
396 Ga0068871_100040098 3300006358 Bacteria 3750
397 Ga0068871_100138201 3300006358 Bacteria 2070
398 Ga0068871_100253297 3300006358 Bacteria 1534
399 Ga0068871_101100215 3300006358 Bacteria 743
400 Ga0075428_100001234 3300006844 Bacteria 27338
401 Ga0075428_100001971 3300006844 Bacteria 22113
402 Ga0075428_100013306 3300006844 Bacteria 9153
403 Ga0075428_100031432 3300006844 Bacteria 5868
404 Ga0075428_100059383 3300006844 Bacteria 4188
405 Ga0075428_100065717 3300006844 Bacteria 3972
406 Ga0075428_100531338 3300006844 Bacteria 1258
407 Ga0075428_100699371 3300006844 Bacteria 1080
408 Ga0075430_100020906 3300006846 Bacteria 5564
409 Ga0075430_100047470 3300006846 Bacteria 3626
410 Ga0075431_100017432 3300006847 Bacteria 7297
411 Ga0075431_100034266 3300006847 Bacteria 5231
412 Ga0075431_100115301 3300006847 Bacteria 2773
413 Ga0075431_100155468 3300006847 Bacteria 2353
414 Ga0075431_100791989 3300006847 Bacteria 921
415 Ga0075433_10001083 3300006852 Bacteria 19628
416 Ga0075433_10219515 3300006852 Bacteria 1689
417 Ga0075433_10533571 3300006852 Bacteria 1032
418 Ga0075433_10833808 3300006852 Bacteria 805
419 Ga0075434_100002085 3300006871 Bacteria 17375
420 Ga0075434_100108968 3300006871 Bacteria 2780
421 Ga0075434_100283171 3300006871 Bacteria 1677
422 Ga0075434_100578873 3300006871 Bacteria 1142
423 Ga0075434_100761898 3300006871 Bacteria 985
424 Ga0075429_100000646 3300006880 Bacteria 26951
425 Ga0075429_100005055 3300006880 Bacteria 11348
426 Ga0075429_100094683 3300006880 Bacteria 2604
427 Ga0075429_100266168 3300006880 Bacteria 1501
428 Ga0075429_100600041 3300006880 Bacteria 965
429 Ga0068865_100033903 3300006881 Bacteria 3421
430 Ga0068865_100460791 3300006881 Bacteria 1053
431 Ga0075436_100001595 3300006914 Bacteria 15494
432 Ga0075436_100260505 3300006914 Bacteria 1237
433 Ga0075436_100567597 3300006914 Bacteria 834
434 Ga0097620_100001261 3300006931 Bacteria 25857
435 Ga0097620_100003443 3300006931 Bacteria 16087
436 Ga0097620_100004359 3300006931 Bacteria 14441
437 Ga0097620_100025159 3300006931 Bacteria 5974
438 Ga0097620_100146660 3300006931 Bacteria 2435
439 Ga0097620_100211046 3300006931 Bacteria 2028
440 Ga0097620_100528015 3300006931 Bacteria 1275
441 Ga0097620_100605298 3300006931 Bacteria 1189
442 Ga0075435_100000518 3300007076 Bacteria 23614
443 Ga0075435_100065367 3300007076 Bacteria 2957
444 Ga0075435_100189423 3300007076 Bacteria 1741
445 Ga0075435_100189661 3300007076 Bacteria 1740
446 Ga0075435_100309960 3300007076 Bacteria 1350
447 Ga0075435_100319606 3300007076 Bacteria 1329
448 Ga0099794_10110673 3300007265 Bacteria 1376
449 Ga0105240_10008612 3300009093 Bacteria 14575
450 Ga0105240_10014011 3300009093 Bacteria 10969
451 Ga0105240_10040958 3300009093 Bacteria 5918
452 Ga0105240_10066520 3300009093 Bacteria 4470
453 Ga0105240_10066535 3300009093 Bacteria 4469
454 Ga0105240_10116333 3300009093 Bacteria 3226
455 Ga0105240_10132589 3300009093 Bacteria 2987
456 Ga0105240_10277029 3300009093 Bacteria 1929
457 Ga0105240_10364780 3300009093 Bacteria 1635
458 Ga0105240_10417616 3300009093 Bacteria 1508
459 Ga0105240_10482582 3300009093 Bacteria 1381
460 Ga0105240_11659948 3300009093 Bacteria 668
461 Ga0111539_10000774 3300009094 Bacteria 41587
462 Ga0111539_10005040 3300009094 Bacteria 17161
463 Ga0111539_10017431 3300009094 Bacteria 8892
464 Ga0111539_10039067 3300009094 Bacteria 5723
465 Ga0111539_10067195 3300009094 Bacteria 4233
466 Ga0111539_10417318 3300009094 Bacteria 1563
467 Ga0111539_11881017 3300009094 Bacteria 694
468 Ga0105245_10006058 3300009098 Bacteria 10630
469 Ga0105245_10007204 3300009098 Bacteria 9746
470 Ga0105245_10007876 3300009098 Bacteria 9319
471 Ga0105245_10047855 3300009098 Bacteria 3824
472 Ga0105245_10140852 3300009098 Bacteria 2271
473 Ga0105245_10208665 3300009098 Unclassified 1879
474 Ga0105245_10297629 3300009098 Bacteria 1582
475 Ga0105245_10639282 3300009098 Bacteria 1093
476 Ga0105245_11757723 3300009098 Bacteria 673
477 Ga0105247_10010547 3300009101 Bacteria 5583
478 Ga0105247_10019165 3300009101 Bacteria 4108
479 Ga0114129_10005474 3300009147 Bacteria 17950
480 Ga0114129_10007730 3300009147 Bacteria 15296
481 Ga0114129_10018550 3300009147 Bacteria 9906
482 Ga0114129_10030790 3300009147 Bacteria 7589
483 Ga0114129_10486007 3300009147 Bacteria 1615
484 Ga0114129_10958532 3300009147 Bacteria 1080
485 Ga0114129_11037820 3300009147 Bacteria 1030
486 Ga0105243_10015832 3300009148 Bacteria 5705
487 Ga0105243_10880219 3300009148 Bacteria 889
488 Ga0105241_10002670 3300009174 Bacteria 13363
489 Ga0105241_10006168 3300009174 Bacteria 8842
490 Ga0105241_10023884 3300009174 Bacteria 4538
491 Ga0105241_10128356 3300009174 Bacteria 2050
492 Ga0105242_10000987 3300009176 Bacteria 22250
493 Ga0105242_10016016 3300009176 Bacteria 5824
494 Ga0105242_10021309 3300009176 Bacteria 5086
495 Ga0105242_10040648 3300009176 Bacteria 3748
496 Ga0105242_10133272 3300009176 Bacteria 2147
497 Ga0105242_10413250 3300009176 Unclassified 1262
498 Ga0105242_10449957 3300009176 Bacteria 1214
499 Ga0105248_10004325 3300009177 Bacteria 15709
500 Ga0105248_10011080 3300009177 Bacteria 9946
501 Ga0105248_10013584 3300009177 Bacteria 8966
502 Ga0105248_10067838 3300009177 Bacteria 4005
503 Ga0105248_10119999 3300009177 Bacteria 2966
504 Ga0105248_10181138 3300009177 Bacteria 2374
505 Ga0105248_10187396 3300009177 Bacteria 2332
506 Ga0105248_10188774 3300009177 Bacteria 2322
507 Ga0105248_10370568 3300009177 Bacteria 1612
508 Ga0105248_10996811 3300009177 Bacteria 946
509 Ga0105237_10164714 3300009545 Bacteria 2216
510 Ga0105237_10211874 3300009545 Bacteria 1937
511 Ga0105237_10216965 3300009545 Bacteria 1913
512 Ga0105237_10455648 3300009545 Bacteria 1285
513 Ga0105237_11252961 3300009545 Bacteria 748
514 Ga0105238_10015625 3300009551 Bacteria 7683
515 Ga0105238_10023086 3300009551 Bacteria 6343
516 Ga0105238_10049631 3300009551 Bacteria 4225
517 Ga0105238_10309126 3300009551 Bacteria 1565
518 Ga0105238_11303173 3300009551 Bacteria 752
519 Ga0105238_11367125 3300009551 Bacteria 735
520 Ga0105249_10010758 3300009553 Bacteria 8039
521 Ga0105249_10029721 3300009553 Bacteria 4936
522 Ga0105249_10091854 3300009553 Bacteria 2841
523 Ga0105249_10392996 3300009553 Bacteria 1415
524 Ga0105239_10041116 3300010375 Bacteria 5066
525 Ga0105239_10094935 3300010375 Bacteria 3294
526 Ga0105239_10208471 3300010375 Bacteria 2190
527 Ga0105239_10333982 3300010375 Bacteria 1710
528 Ga0105239_10560594 3300010375 Bacteria 1301
529 Ga0105239_10593861 3300010375 Bacteria 1263
530 Ga0105239_11277425 3300010375 Bacteria 847
531 Ga0105246_10233155 3300011119 Bacteria 1451
532 Ga0105246_10513311 3300011119 Bacteria 1020
533 Ga0105246_10752314 3300011119 Bacteria 860
534 Ga0157373_10002284 3300013100 Bacteria 14527
535 Ga0157373_10007697 3300013100 Bacteria 8008
536 Ga0157373_10034188 3300013100 Bacteria 3651
537 Ga0157373_10627521 3300013100 Bacteria 784
538 Ga0157373_10867168 3300013100 Bacteria 668
539 Ga0157371_10015449 3300013102 Bacteria 5725
540 Ga0157371_10043194 3300013102 Bacteria 3211
541 Ga0157371_10149399 3300013102 Bacteria 1666
542 Ga0157371_10328964 3300013102 Bacteria 1110
543 Ga0157371_10536500 3300013102 Bacteria 866
544 Ga0157370_10002793 3300013104 Bacteria 20861
545 Ga0157370_10014687 3300013104 Bacteria 7998
546 Ga0157370_10017912 3300013104 Bacteria 7134
547 Ga0157370_10018482 3300013104 Bacteria 7008
548 Ga0157370_10028106 3300013104 Bacteria 5537
549 Ga0157370_10111213 3300013104 Bacteria 2561
550 Ga0157370_10142480 3300013104 Bacteria 2233
551 Ga0157370_10181862 3300013104 Bacteria 1954
552 Ga0157370_10583087 3300013104 Bacteria 1024
553 Ga0157369_10002637 3300013105 Bacteria 21445
554 Ga0157369_10022671 3300013105 Bacteria 7003
555 Ga0157369_10034018 3300013105 Bacteria 5597
556 Ga0157369_10181577 3300013105 Bacteria 2214
557 Ga0157369_10429558 3300013105 Bacteria 1369
558 Ga0157374_10006420 3300013296 Bacteria 9985
559 Ga0157374_10020984 3300013296 Bacteria 5804
560 Ga0157374_10097737 3300013296 Bacteria 2810
561 Ga0157374_10138612 3300013296 Bacteria 2360
562 Ga0157374_10293159 3300013296 Bacteria 1608
563 Ga0157374_10354786 3300013296 Unclassified 1458
564 Ga0157378_10005252 3300013297 Bacteria 11376
565 Ga0157378_10017496 3300013297 Bacteria 6291
566 Ga0157378_10076771 3300013297 Bacteria 3011
567 Ga0157378_10236750 3300013297 Bacteria 1742
568 Ga0157378_10301848 3300013297 Bacteria 1550
569 Ga0157378_10360434 3300013297 Bacteria 1423
570 Ga0157378_10828629 3300013297 Bacteria 952
571 Ga0157378_10846289 3300013297 Bacteria 943
572 Ga0157378_11611615 3300013297 Bacteria 695
573 Ga0163162_10020845 3300013306 Bacteria 6444
574 Ga0163162_10021297 3300013306 Bacteria 6382
575 Ga0163162_10037009 3300013306 Bacteria 4868
576 Ga0163162_10159622 3300013306 Bacteria 2376
577 Ga0163162_10309936 3300013306 Bacteria 1711
578 Ga0163162_10954677 3300013306 Bacteria 968
579 Ga0163162_11451875 3300013306 Bacteria 781
580 Ga0163162_11704155 3300013306 Bacteria 720
581 Ga0157372_10006805 3300013307 Bacteria 12156
582 Ga0157372_10034017 3300013307 Bacteria 5599
583 Ga0157372_10041534 3300013307 Bacteria 5086
584 Ga0157372_10198895 3300013307 Bacteria 2321
585 Ga0157372_10399548 3300013307 Bacteria 1601
586 Ga0157372_10437042 3300013307 Bacteria 1525
587 Ga0157372_10511908 3300013307 Bacteria 1399
588 Ga0157375_10007328 3300013308 Bacteria 9654
589 Ga0157375_10022802 3300013308 Bacteria 5766
590 Ga0157375_10086890 3300013308 Bacteria 3179
591 Ga0157375_10100280 3300013308 Bacteria 2976
592 Ga0157375_10157878 3300013308 Bacteria 2408
593 Ga0157375_10305397 3300013308 Bacteria 1755
594 Ga0157375_10335587 3300013308 Bacteria 1677
595 Ga0163163_10002992 3300014325 Bacteria 14295
596 Ga0163163_10005262 3300014325 Bacteria 11161
597 Ga0163163_10032655 3300014325 Bacteria 5029
598 Ga0163163_10080669 3300014325 Bacteria 3254
599 Ga0157380_10010274 3300014326 Bacteria 6728
600 Ga0157380_10063883 3300014326 Bacteria 2953
601 Ga0157380_10134795 3300014326 Bacteria 2112
602 Ga0157380_10152487 3300014326 Bacteria 1999
603 Ga0157380_10432889 3300014326 Bacteria 1258
604 Ga0157377_10012524 3300014745 Bacteria 4268
605 Ga0157377_10071731 3300014745 Bacteria 2003
606 Ga0157377_10072701 3300014745 Bacteria 1991
607 Ga0157377_10092645 3300014745 Bacteria 1787
608 Ga0157377_10389196 3300014745 Bacteria 946
609 Ga0157377_10558250 3300014745 Bacteria 810
610 Ga0157379_10000105 3300014968 Bacteria 57976
611 Ga0157379_10016263 3300014968 Bacteria 6546
612 Ga0157379_10024244 3300014968 Bacteria 5386
613 Ga0157379_10205723 3300014968 Bacteria 1780
614 Ga0157379_10336061 3300014968 Bacteria 1381
615 Ga0157376_10006355 3300014969 Bacteria 8347
616 Ga0157376_10006926 3300014969 Bacteria 8035
617 Ga0157376_10049249 3300014969 Bacteria 3489
618 Ga0157376_10140848 3300014969 Bacteria 2163
619 Ga0157376_10145754 3300014969 Bacteria 2129
620 Ga0157376_10184306 3300014969 Bacteria 1910
621 Ga0157376_10412824 3300014969 Unclassified 1308
622 Ga0163161_10042900 3300017792 Bacteria 3255
623 Ga0163161_10289378 3300017792 Bacteria 1287
624 Ga0206356_11509169 3300020070 Bacteria 2096
625 Ga0206350_11148392 3300020080 Bacteria 767
626 Ga0206354_11656380 3300020081 Bacteria 2171
627 Ga0207697_10000256 3300025315 Bacteria 29344
628 Ga0207656_10007476 3300025321 Bacteria 3980
629 Ga0207656_10009807 3300025321 Bacteria 3563
630 Ga0207656_10015547 3300025321 Bacteria 2947
631 Ga0207656_10019475 3300025321 Bacteria 2685
632 Ga0207656_10046358 3300025321 Bacteria 1864
633 Ga0207656_10124429 3300025321 Bacteria 1203
634 Ga0207656_10200425 3300025321 Bacteria 964
635 Ga0207682_10002842 3300025893 Bacteria 7635
636 Ga0207682_10005384 3300025893 Bacteria 5215
637 Ga0207682_10097781 3300025893 Bacteria 1280
638 Ga0207692_10032187 3300025898 Bacteria 2518
639 Ga0207692_10076217 3300025898 Bacteria 1781
640 Ga0207692_10096554 3300025898 Bacteria 1614
641 Ga0207642_10008230 3300025899 Bacteria 3566
642 Ga0207642_10244003 3300025899 Bacteria 1016
643 Ga0207710_10032395 3300025900 Bacteria 2289
644 Ga0207710_10169801 3300025900 Bacteria 1066
645 Ga0207688_10005533 3300025901 Bacteria 6869
646 Ga0207688_10006223 3300025901 Bacteria 6492
647 Ga0207688_10420421 3300025901 Bacteria 830
648 Ga0207680_10029585 3300025903 Bacteria 3079
649 Ga0207680_10044368 3300025903 Bacteria 2614
650 Ga0207680_10048962 3300025903 Bacteria 2513
651 Ga0207680_10069449 3300025903 Bacteria 2177
652 Ga0207680_10442616 3300025903 Bacteria 922
653 Ga0207699_10084760 3300025906 Bacteria 1974
654 Ga0207699_10407630 3300025906 Bacteria 969
655 Ga0207699_10522030 3300025906 Bacteria 859
656 Ga0207699_10565788 3300025906 Bacteria 825
657 Ga0207645_10010186 3300025907 Bacteria 6461
658 Ga0207645_10013074 3300025907 Bacteria 5608
659 Ga0207645_10019122 3300025907 Bacteria 4498
660 Ga0207645_10055652 3300025907 Bacteria 2526
661 Ga0207645_10136577 3300025907 Bacteria 1597
662 Ga0207645_10343766 3300025907 Bacteria 998
663 Ga0207643_10001448 3300025908 Bacteria 13631
664 Ga0207643_10007881 3300025908 Bacteria 5714
665 Ga0207643_10009215 3300025908 Bacteria 5301
666 Ga0207643_10009375 3300025908 Bacteria 5260
667 Ga0207643_10017417 3300025908 Bacteria 3929
668 Ga0207643_10075375 3300025908 Bacteria 1947
669 Ga0207705_10023007 3300025909 Bacteria 4444
670 Ga0207705_10086194 3300025909 Bacteria 2295
671 Ga0207705_10129278 3300025909 Bacteria 1879
672 Ga0207705_10137196 3300025909 Bacteria 1824
673 Ga0207705_10230098 3300025909 Bacteria 1410
674 Ga0207705_10250269 3300025909 Bacteria 1351
675 Ga0207705_10319081 3300025909 Bacteria 1194
676 Ga0207705_10532475 3300025909 Bacteria 913
677 Ga0207684_10138581 3300025910 Bacteria 2090
678 Ga0207654_10080976 3300025911 Bacteria 1954
679 Ga0207654_10104777 3300025911 Bacteria 1749
680 Ga0207707_10015189 3300025912 Bacteria 6705
681 Ga0207707_10043905 3300025912 Bacteria 3897
682 Ga0207707_10047373 3300025912 Bacteria 3743
683 Ga0207707_10161571 3300025912 Bacteria 1958
684 Ga0207707_10277052 3300025912 Bacteria 1453
685 Ga0207695_10010633 3300025913 Bacteria 11243
686 Ga0207695_10023085 3300025913 Bacteria 7040
687 Ga0207695_10033838 3300025913 Bacteria 5567
688 Ga0207695_10094270 3300025913 Bacteria 3001
689 Ga0207695_10150608 3300025913 Bacteria 2266
690 Ga0207695_10272866 3300025913 Bacteria 1586
691 Ga0207671_10032257 3300025914 Bacteria 3899
692 Ga0207693_10001367 3300025915 Bacteria 21621
693 Ga0207663_10010775 3300025916 Bacteria 4881
694 Ga0207663_10027523 3300025916 Bacteria 3315
695 Ga0207663_10269327 3300025916 Bacteria 1261
696 Ga0207663_10586080 3300025916 Bacteria 875
697 Ga0207663_10620844 3300025916 Bacteria 851
698 Ga0207663_10751583 3300025916 Bacteria 774
699 Ga0207660_10042880 3300025917 Bacteria 3178
700 Ga0207660_10131393 3300025917 Bacteria 1906
701 Ga0207660_10140607 3300025917 Bacteria 1845
702 Ga0207660_10149468 3300025917 Bacteria 1793
703 Ga0207660_10157527 3300025917 Bacteria 1749
704 Ga0207660_10415667 3300025917 Bacteria 1084
705 Ga0207662_10016036 3300025918 Bacteria 4223
706 Ga0207662_10047420 3300025918 Bacteria 2544
707 Ga0207662_10151903 3300025918 Bacteria 1473
708 Ga0207657_10003293 3300025919 Bacteria 17264
709 Ga0207657_10003870 3300025919 Bacteria 15890
710 Ga0207657_10007023 3300025919 Bacteria 11584
711 Ga0207657_10042029 3300025919 Bacteria 4037
712 Ga0207657_10233606 3300025919 Bacteria 1470
713 Ga0207657_10415470 3300025919 Bacteria 1058
714 Ga0207649_10040380 3300025920 Bacteria 2836
715 Ga0207649_10064787 3300025920 Bacteria 2311
716 Ga0207649_10124226 3300025920 Bacteria 1744
717 Ga0207649_10144528 3300025920 Bacteria 1631
718 Ga0207649_10233096 3300025920 Bacteria 1317
719 Ga0207649_10760076 3300025920 Bacteria 755
720 Ga0207652_10012986 3300025921 Bacteria 6740
721 Ga0207652_10022147 3300025921 Bacteria 5252
722 Ga0207652_10024979 3300025921 Bacteria 4962
723 Ga0207652_10319457 3300025921 Bacteria 1402
724 Ga0207652_10413741 3300025921 Bacteria 1216
725 Ga0207646_10025617 3300025922 Bacteria 5394
726 Ga0207681_10043526 3300025923 Bacteria 3005
727 Ga0207681_10045180 3300025923 Bacteria 2956
728 Ga0207681_10111670 3300025923 Bacteria 1989
729 Ga0207681_10154186 3300025923 Bacteria 1724
730 Ga0207681_10254202 3300025923 Bacteria 1373
731 Ga0207681_10758652 3300025923 Bacteria 809
732 Ga0207694_10021737 3300025924 Bacteria 4862
733 Ga0207694_10080457 3300025924 Bacteria 2557
734 Ga0207694_10148664 3300025924 Bacteria 1887
735 Ga0207694_10178677 3300025924 Bacteria 1720
736 Ga0207694_10190944 3300025924 Bacteria 1664
737 Ga0207694_10425835 3300025924 Bacteria 1106
738 Ga0207650_10007945 3300025925 Bacteria 7231
739 Ga0207650_10140064 3300025925 Bacteria 1901
740 Ga0207650_10160179 3300025925 Bacteria 1783
741 Ga0207659_10012442 3300025926 Bacteria 5415
742 Ga0207659_10019119 3300025926 Bacteria 4502
743 Ga0207659_10020571 3300025926 Bacteria 4365
744 Ga0207659_10023776 3300025926 Bacteria 4095
745 Ga0207659_10387841 3300025926 Bacteria 1166
746 Ga0207687_10001346 3300025927 Bacteria 16808
747 Ga0207687_10003693 3300025927 Bacteria 10301
748 Ga0207687_10005336 3300025927 Bacteria 8509
749 Ga0207687_10088085 3300025927 Bacteria 2257
750 Ga0207687_10185750 3300025927 Unclassified 1614
751 Ga0207687_10312283 3300025927 Bacteria 1270
752 Ga0207700_10000077 3300025928 Bacteria 60197
753 Ga0207700_10059548 3300025928 Bacteria 2889
754 Ga0207700_10090091 3300025928 Bacteria 2419
755 Ga0207700_10127034 3300025928 Bacteria 2076
756 Ga0207700_10130902 3300025928 Bacteria 2048
757 Ga0207700_10317891 3300025928 Bacteria 1348
758 Ga0207700_11005961 3300025928 Unclassified 746
759 Ga0207664_10026358 3300025929 Bacteria 4393
760 Ga0207664_10070855 3300025929 Bacteria 2806
761 Ga0207664_10092028 3300025929 Bacteria 2488
762 Ga0207664_10093335 3300025929 Bacteria 2472
763 Ga0207644_10003624 3300025931 Bacteria 10015
764 Ga0207644_10065514 3300025931 Bacteria 2642
765 Ga0207690_10005362 3300025932 Bacteria 7557
766 Ga0207690_10022730 3300025932 Bacteria 3904
767 Ga0207690_10268783 3300025932 Bacteria 1324
768 Ga0207706_10000040 3300025933 Bacteria 132285
769 Ga0207706_10002930 3300025933 Bacteria 16489
770 Ga0207706_10003835 3300025933 Bacteria 14324
771 Ga0207706_10022219 3300025933 Bacteria 5693
772 Ga0207706_10127874 3300025933 Bacteria 2234
773 Ga0207706_10135844 3300025933 Bacteria 2163
774 Ga0207686_10000526 3300025934 Bacteria 24864
775 Ga0207686_10003451 3300025934 Bacteria 8490
776 Ga0207686_10411193 3300025934 Bacteria 1033
777 Ga0207709_10000759 3300025935 Bacteria 25445
778 Ga0207709_10048888 3300025935 Bacteria 2579
779 Ga0207709_10360597 3300025935 Bacteria 1100
780 Ga0207709_10569622 3300025935 Bacteria 893
781 Ga0207670_10010027 3300025936 Bacteria 5437
782 Ga0207670_10013797 3300025936 Bacteria 4777
783 Ga0207670_10018511 3300025936 Bacteria 4235
784 Ga0207670_10184573 3300025936 Bacteria 1573
785 Ga0207670_10268213 3300025936 Bacteria 1326
786 Ga0207670_10356559 3300025936 Unclassified 1159
787 Ga0207669_10017712 3300025937 Bacteria 3662
788 Ga0207669_10031481 3300025937 Bacteria 2964
789 Ga0207669_10074860 3300025937 Bacteria 2143
790 Ga0207669_10130389 3300025937 Bacteria 1726
791 Ga0207669_10337772 3300025937 Bacteria 1159
792 Ga0207669_10361973 3300025937 Bacteria 1124
793 Ga0207704_10002200 3300025938 Bacteria 8738
794 Ga0207704_10047334 3300025938 Bacteria 2569
795 Ga0207704_10094915 3300025938 Bacteria 1971
796 Ga0207704_10360591 3300025938 Bacteria 1135
797 Ga0207665_10004914 3300025939 Bacteria 8910
798 Ga0207665_10011300 3300025939 Bacteria 5861
799 Ga0207665_10062527 3300025939 Bacteria 2526
800 Ga0207665_10244265 3300025939 Bacteria 1324
801 Ga0207665_10518411 3300025939 Bacteria 923
802 Ga0207691_10000370 3300025940 Bacteria 45317
803 Ga0207691_10011403 3300025940 Bacteria 8530
804 Ga0207691_10036227 3300025940 Bacteria 4571
805 Ga0207691_10047739 3300025940 Bacteria 3928
806 Ga0207691_10048750 3300025940 Bacteria 3882
807 Ga0207691_10085870 3300025940 Bacteria 2824
808 Ga0207691_10095465 3300025940 Bacteria 2660
809 Ga0207711_10000688 3300025941 Bacteria 33317
810 Ga0207711_10066962 3300025941 Bacteria 3107
811 Ga0207711_10077264 3300025941 Bacteria 2902
812 Ga0207711_10320755 3300025941 Bacteria 1432
813 Ga0207711_11010661 3300025941 Bacteria 771
814 Ga0207689_10000147 3300025942 Bacteria 60540
815 Ga0207689_10001752 3300025942 Bacteria 20489
816 Ga0207689_10016440 3300025942 Bacteria 6263
817 Ga0207689_10021698 3300025942 Bacteria 5400
818 Ga0207689_10036784 3300025942 Bacteria 4064
819 Ga0207689_10055392 3300025942 Bacteria 3264
820 Ga0207689_10347218 3300025942 Bacteria 1233
821 Ga0207689_10377598 3300025942 Bacteria 1180
822 Ga0207689_10405341 3300025942 Bacteria 1137
823 Ga0207689_10432649 3300025942 Bacteria 1099
824 Ga0207689_10456677 3300025942 Bacteria 1068
825 Ga0207661_10044744 3300025944 Bacteria 3501
826 Ga0207661_10064899 3300025944 Bacteria 2962
827 Ga0207661_10115709 3300025944 Bacteria 2275
828 Ga0207661_10144802 3300025944 Bacteria 2049
829 Ga0207661_10258476 3300025944 Bacteria 1550
830 Ga0207661_10374723 3300025944 Bacteria 1287
831 Ga0207679_10005740 3300025945 Bacteria 7788
832 Ga0207679_10030015 3300025945 Bacteria 3792
833 Ga0207679_10032874 3300025945 Bacteria 3646
834 Ga0207679_10047269 3300025945 Bacteria 3125
835 Ga0207679_10051080 3300025945 Bacteria 3025
836 Ga0207679_10076154 3300025945 Bacteria 2548
837 Ga0207679_10149043 3300025945 Bacteria 1901
838 Ga0207679_10220925 3300025945 Bacteria 1594
839 Ga0207667_10013239 3300025949 Bacteria 9458
840 Ga0207667_10029425 3300025949 Bacteria 5957
841 Ga0207667_10052595 3300025949 Bacteria 4288
842 Ga0207667_10080894 3300025949 Bacteria 3365
843 Ga0207667_10115181 3300025949 Bacteria 2771
844 Ga0207667_10193261 3300025949 Bacteria 2088
845 Ga0207667_10210126 3300025949 Bacteria 1994
846 Ga0207667_10245062 3300025949 Bacteria 1834
847 Ga0207667_10528917 3300025949 Bacteria 1194
848 Ga0207667_10571005 3300025949 Bacteria 1142
849 Ga0207667_10716324 3300025949 Bacteria 1002
850 Ga0207651_10001025 3300025960 Bacteria 12337
851 Ga0207651_10011092 3300025960 Bacteria 5027
852 Ga0207651_10020006 3300025960 Bacteria 4027
853 Ga0207651_10031965 3300025960 Bacteria 3373
854 Ga0207651_10033278 3300025960 Bacteria 3323
855 Ga0207651_10102892 3300025960 Bacteria 2124
856 Ga0207651_10181505 3300025960 Bacteria 1670
857 Ga0207651_10274636 3300025960 Bacteria 1390
858 Ga0207651_10611609 3300025960 Bacteria 953
859 Ga0207712_10139102 3300025961 Bacteria 1861
860 Ga0207712_10236885 3300025961 Bacteria 1468
861 Ga0207668_10002552 3300025972 Bacteria 10637
862 Ga0207668_10004397 3300025972 Bacteria 8281
863 Ga0207668_10028255 3300025972 Bacteria 3665
864 Ga0207668_10040151 3300025972 Bacteria 3156
865 Ga0207668_10075957 3300025972 Bacteria 2417
866 Ga0207668_10330219 3300025972 Bacteria 1268
867 Ga0207640_10003047 3300025981 Bacteria 9024
868 Ga0207640_10008110 3300025981 Bacteria 5813
869 Ga0207640_10048660 3300025981 Bacteria 2742
870 Ga0207640_10080144 3300025981 Bacteria 2228
871 Ga0207640_10144008 3300025981 Bacteria 1741
872 Ga0207640_10166911 3300025981 Bacteria 1636
873 Ga0207640_10223273 3300025981 Bacteria 1444
874 Ga0207640_10338339 3300025981 Bacteria 1204
875 Ga0207640_10423644 3300025981 Bacteria 1090
876 Ga0207658_10006790 3300025986 Bacteria 7793
877 Ga0207658_10035841 3300025986 Bacteria 3555
878 Ga0207658_10052543 3300025986 Bacteria 3007
879 Ga0207658_10053190 3300025986 Bacteria 2991
880 Ga0207658_10101609 3300025986 Bacteria 2253
881 Ga0207658_10498635 3300025986 Bacteria 1084
882 Ga0207677_10000775 3300026023 Bacteria 18357
883 Ga0207677_10000943 3300026023 Bacteria 16236
884 Ga0207677_10008381 3300026023 Bacteria 5770
885 Ga0207677_10009318 3300026023 Bacteria 5522
886 Ga0207677_10039064 3300026023 Bacteria 3117
887 Ga0207677_10171885 3300026023 Bacteria 1695
888 Ga0207703_10000792 3300026035 Bacteria 31130
889 Ga0207703_10026479 3300026035 Bacteria 4565
890 Ga0207703_10044778 3300026035 Bacteria 3558
891 Ga0207703_10045458 3300026035 Bacteria 3532
892 Ga0207639_10011455 3300026041 Bacteria 6161
893 Ga0207639_10029564 3300026041 Bacteria 4013
894 Ga0207639_10157951 3300026041 Bacteria 1907
895 Ga0207639_10326392 3300026041 Bacteria 1364
896 Ga0207639_10486212 3300026041 Bacteria 1126
897 Ga0207678_10003163 3300026067 Bacteria 14885
898 Ga0207678_10009058 3300026067 Bacteria 8761
899 Ga0207678_10099367 3300026067 Bacteria 2485
900 Ga0207678_10106957 3300026067 Bacteria 2386
901 Ga0207678_10148089 3300026067 Bacteria 2004
902 Ga0207678_10539374 3300026067 Bacteria 1020
903 Ga0207708_10002021 3300026075 Bacteria 14952
904 Ga0207708_10011646 3300026075 Bacteria 6554
905 Ga0207708_10123054 3300026075 Bacteria 2022
906 Ga0207708_10157358 3300026075 Bacteria 1793
907 Ga0207708_10266309 3300026075 Bacteria 1384
908 Ga0207708_10805706 3300026075 Bacteria 809
909 Ga0207702_10003520 3300026078 Bacteria 14271
910 Ga0207702_10008140 3300026078 Bacteria 8869
911 Ga0207702_10018251 3300026078 Bacteria 5803
912 Ga0207702_10134123 3300026078 Bacteria 2232
913 Ga0207702_10138441 3300026078 Bacteria 2199
914 Ga0207702_10211225 3300026078 Bacteria 1804
915 Ga0207702_10620001 3300026078 Bacteria 1062
916 Ga0207641_10002392 3300026088 Bacteria 17307
917 Ga0207641_10020355 3300026088 Bacteria 5449
918 Ga0207641_10027385 3300026088 Bacteria 4706
919 Ga0207641_10265543 3300026088 Bacteria 1608
920 Ga0207641_10502768 3300026088 Bacteria 1177
921 Ga0207641_10651734 3300026088 Bacteria 1034
922 Ga0207641_10723690 3300026088 Bacteria 981
923 Ga0207648_10003996 3300026089 Bacteria 15301
924 Ga0207648_10010242 3300026089 Bacteria 8907
925 Ga0207648_10010615 3300026089 Bacteria 8708
926 Ga0207648_10011907 3300026089 Bacteria 8169
927 Ga0207648_10027011 3300026089 Bacteria 5098
928 Ga0207648_10048028 3300026089 Bacteria 3738
929 Ga0207648_10466753 3300026089 Bacteria 1151
930 Ga0207648_10541652 3300026089 Bacteria 1068
931 Ga0207676_10001352 3300026095 Bacteria 18224
932 Ga0207676_10002124 3300026095 Bacteria 14347
933 Ga0207676_10039003 3300026095 Bacteria 3630
934 Ga0207676_10443211 3300026095 Bacteria 1223
935 Ga0207676_10571190 3300026095 Bacteria 1083
936 Ga0207674_10000155 3300026116 Bacteria 80715
937 Ga0207674_10004319 3300026116 Bacteria 17132
938 Ga0207674_10004526 3300026116 Bacteria 16694
939 Ga0207674_10005346 3300026116 Bacteria 15270
940 Ga0207674_10027058 3300026116 Bacteria 6076
941 Ga0207674_10046493 3300026116 Bacteria 4456
942 Ga0207675_100001483 3300026118 Bacteria 23563
943 Ga0207675_100009355 3300026118 Bacteria 9185
944 Ga0207675_100018793 3300026118 Bacteria 6449
945 Ga0207675_100285558 3300026118 Bacteria 1604
946 Ga0207683_10000835 3300026121 Bacteria 28207
947 Ga0207683_10001468 3300026121 Bacteria 21255
948 Ga0207683_10005518 3300026121 Bacteria 10841
949 Ga0207683_10049170 3300026121 Bacteria 3691
950 Ga0207683_10089562 3300026121 Bacteria 2739
951 Ga0207683_10110224 3300026121 Bacteria 2464
952 Ga0207683_10305041 3300026121 Bacteria 1457
953 Ga0207683_10479983 3300026121 Bacteria 1147
954 Ga0207683_10543609 3300026121 Bacteria 1074
955 Ga0207698_10001850 3300026142 Bacteria 12355
956 Ga0207698_10008545 3300026142 Bacteria 6485
957 Ga0207698_10017560 3300026142 Bacteria 4858
958 Ga0207698_10053299 3300026142 Bacteria 3104
959 Ga0207698_10225500 3300026142 Bacteria 1697
960 Ga0207698_10430267 3300026142 Bacteria 1269
961 Ga0207698_10634854 3300026142 Bacteria 1056
962 Ga0207698_10794776 3300026142 Bacteria 948
963 Ga0209969_1005985 3300027360 Bacteria 1710
964 Ga0209967_1036793 3300027364 Bacteria 740
965 Ga0209981_1009088 3300027378 Bacteria 1356
966 Ga0209996_1001493 3300027395 Bacteria 2834
967 Ga0210000_1003267 3300027462 Bacteria 2333
968 Ga0209999_1013578 3300027543 Bacteria 1477
969 Ga0209970_1023512 3300027614 Bacteria 1049
970 Ga0209983_1033444 3300027665 Bacteria 1100
971 Ga0209971_1003038 3300027682 Bacteria 4012
972 Ga0209971_1004641 3300027682 Bacteria 3259
973 Ga0209971_1050083 3300027682 Bacteria 1009
974 Ga0209966_1023402 3300027695 Bacteria 1214
975 Ga0209974_10005559 3300027876 Bacteria 4428
976 Ga0209974_10027526 3300027876 Bacteria 1881
977 Ga0209974_10040131 3300027876 Bacteria 1557
978 Ga0209974_10046698 3300027876 Bacteria 1448
979 Ga0209974_10091372 3300027876 Bacteria 1056
980 Ga0209974_10137614 3300027876 Bacteria 874
981 Ga0207428_10003647 3300027907 Bacteria 14845
982 Ga0207428_10003844 3300027907 Bacteria 14403
983 Ga0207428_10008834 3300027907 Bacteria 9084
984 Ga0207428_10404711 3300027907 Bacteria 999
985 Ga0268266_10009699 3300028379 Bacteria 8461
986 Ga0268266_10026477 3300028379 Bacteria 4934
987 Ga0268266_10224895 3300028379 Bacteria 1726
988 Ga0268265_10005233 3300028380 Bacteria 8885
989 Ga0268265_10009101 3300028380 Bacteria 6713
990 Ga0268265_10413007 3300028380 Bacteria 1251
991 Ga0268264_10001853 3300028381 Bacteria 19220
992 Ga0268264_10003678 3300028381 Bacteria 13160
993 Ga0268264_10005166 3300028381 Bacteria 11062
994 Ga0268264_10028217 3300028381 Bacteria 4589
995 Ga0268264_10063608 3300028381 Bacteria 3102
996 Ga0268264_10111646 3300028381 Bacteria 2395
997 Ga0268264_10176613 3300028381 Bacteria 1936
998 Ga0268264_10302967 3300028381 Unclassified 1505
999 Ga0268264_10610776 3300028381 Bacteria 1076
1000 Ga0268264_10657506 3300028381 Bacteria 1038
1001 Ga0265318_10006150 3300028577 Bacteria 5557
1002 Ga0265338_10000205 3300028800 Bacteria 111060
1003 Ga0265338_10493096 3300028800 Bacteria 863
1004 Ga0265330_10013365 3300031235 Bacteria 3828
1005 Ga0265332_10001524 3300031238 Bacteria 12848
1006 Ga0265328_10008480 3300031239 Bacteria 4234
1007 Ga0265320_10005671 3300031240 Bacteria 7971
1008 Ga0265329_10008728 3300031242 Bacteria 3825
1009 Ga0265340_10170499 3300031247 Bacteria 986
1010 Ga0265339_10020973 3300031249 Bacteria 3811
1011 Ga0265331_10004058 3300031250 Bacteria 9215
1012 Ga0265316_10252884 3300031344 Bacteria 1293
1013 Ga0307509_10342013 3300031507 Bacteria 1223
1014 Ga0307408_100070540 3300031548 Bacteria 2580
1015 Ga0307408_100095765 3300031548 Bacteria 2250
1016 Ga0307408_100202630 3300031548 Bacteria 1607
1017 Ga0307408_100287239 3300031548 Bacteria 1372
1018 Ga0265313_10105230 3300031595 Bacteria 1247
1019 Ga0316575_10007567 3300031665 Bacteria 3933
1020 Ga0316575_10013572 3300031665 Bacteria 3045
1021 Ga0316579_10015628 3300031691 Bacteria 3300
1022 Ga0265314_10000523 3300031711 Bacteria 49565
1023 Ga0265314_10028854 3300031711 Bacteria 4130
1024 Ga0265314_10203014 3300031711 Bacteria 1170
1025 Ga0316578_10027051 3300031728 Bacteria 3239
1026 Ga0307405_10092247 3300031731 Bacteria 2009
1027 Ga0307405_10388270 3300031731 Bacteria 1089
1028 Ga0307405_10397919 3300031731 Bacteria 1077
1029 Ga0316577_10456534 3300031733 Bacteria 726
1030 Ga0307410_10026095 3300031852 Bacteria 3673
1031 Ga0307410_10306588 3300031852 Bacteria 1255
1032 Ga0307407_10082527 3300031903 Bacteria 1948
1033 Ga0307412_10133151 3300031911 Bacteria 1809
1034 Ga0307409_100019259 3300031995 Bacteria 4615
1035 Ga0307416_100111464 3300032002 Bacteria 2412
1036 Ga0307416_100162867 3300032002 Bacteria 2064
1037 Ga0307416_100426414 3300032002 Bacteria 1372
1038 Ga0307416_100441703 3300032002 Bacteria 1351
1039 Ga0307416_100560308 3300032002 Bacteria 1217
1040 Ga0307416_100792094 3300032002 Bacteria 1043
1041 Ga0307416_100836646 3300032002 Bacteria 1018
1042 Ga0307416_101111248 3300032002 Bacteria 895
1043 Ga0307414_10117923 3300032004 Bacteria 2035
1044 Ga0307411_10220116 3300032005 Bacteria 1472
1045 Ga0307411_10442380 3300032005 Bacteria 1085
1046 Ga0316583_10002043 3300032133 Bacteria 6915
1047 Ga0316583_10007626 3300032133 Bacteria 3898
1048 Ga0373948_0042598 3300034817 Bacteria 954
1049 Ga0373958_0027371 3300034819 Bacteria 1098
1050 Ga0373926_0001895 3300035083 Bacteria 6528
1051 Ga0373928_0036168 3300035084 Bacteria 1115
1052 Ga0373928_0044293 3300035084 Bacteria 1032
1053 Ga0373934_0001111 3300035086 Bacteria 9745
1054 Ga0373940_0011091 3300035088 Bacteria 2133
1055 Ga0373944_0060701 3300035089 Bacteria 1212
1056 Ga0373949_0002059 3300035090 Bacteria 5326
1057 Ga0373951_0015686 3300035091 Bacteria 1708
1058 Ga0373952_0004072 3300035092 Bacteria 2640
1059 Ga0373923_0002023 3300035111 Bacteria 6102
1060 Ga0373923_0044384 3300035111 Bacteria 1843
1061 Ga0373923_0212438 3300035111 Bacteria 897
1062 Ga0373932_0000353 3300035112 Bacteria 14116
1063 Ga0373936_0004291 3300035113 Bacteria 5386
1064 Ga0373936_0024243 3300035113 Bacteria 2368
1065 Ga0373936_0027365 3300035113 Bacteria 2236
1066 Ga0373939_0191840 3300035114 Bacteria 768
1067 Ga0373941_0005481 3300035115 Bacteria 2991
1068 Ga0373945_0054667 3300035116 Bacteria 1476
1069 Ga0373945_0099598 3300035116 Bacteria 1136
1070 Ga0373953_0038516 3300035117 Bacteria 1891
1071 Ga0373953_0068221 3300035117 Bacteria 1463
1072 Ga0373954_0001903 3300035118 Bacteria 8631
1073 Ga0373954_0077896 3300035118 Bacteria 1581
1074 Ga0373954_0179572 3300035118 Bacteria 1038
1075 Ga0373956_0000003 3300035119 Bacteria 81669
1076 Ga0373956_0018475 3300035119 Bacteria 2954
1077 Ga0373956_0125624 3300035119 Bacteria 1199
1078 Ga0373957_0000503 3300035120 Bacteria 9800
1079 Ga0373957_0000705 3300035120 Bacteria 8668
1080 Ga0373960_0106223 3300035121 Bacteria 916
1081 Ga0373943_0098025 3300035170 Bacteria 1528
1082 Ga0373943_0135811 3300035170 Bacteria 1321
1083 Ga0373946_0044859 3300035171 Bacteria 1827
1084 Ga0373946_0045195 3300035171 Bacteria 1821
1085 Ga0373946_0180161 3300035171 Bacteria 1002
1086 Ga0373955_0006271 3300035172 Bacteria 5412
1087 Ga0373955_0029187 3300035172 Bacteria 2866
1088 Ga0373961_0023599 3300035241 Bacteria 1656
1089 Ga0373961_0199153 3300035241 Bacteria 706
1090 Ga0316574_0006816 3300035398 Bacteria 6207
1091 Ga0373924_0023371 3300035410 Bacteria 2424
1092 Ga0373931_0000189 3300035691 Bacteria 26663
1093 Ga0373931_0002113 3300035691 Bacteria 8752
1094 Ga0373931_0072032 3300035691 Bacteria 1889
1095 Ga0373931_0214241 3300035691 Bacteria 1157
1096 Ga0373931_0375657 3300035691 Bacteria 895
1097 Ga0373935_0009296 3300035692 Bacteria 5884
1098 Ga0373935_0010264 3300035692 Bacteria 5614
1099 Ga0373935_0030664 3300035692 Bacteria 3333
1100 Ga0373935_0100798 3300035692 Bacteria 1903
1101 Ga0373927_0005725 3300035695 Bacteria 8535
1102 Ga0373927_0012203 3300035695 Bacteria 5716
1103 Ga0373927_0035076 3300035695 Bacteria 3261
1104 Ga0373927_0037647 3300035695 Bacteria 3143
1105 Ga0373927_0077542 3300035695 Bacteria 2152
1106 Ga0373927_0091617 3300035695 Bacteria 1974
1107 Ga0373927_0285975 3300035695 Bacteria 1085
1108 Ga0373933_0001377 3300035724 Bacteria 14295
1109 Ga0373933_0008929 3300035724 Bacteria 5466
1110 Ga0373933_0056292 3300035724 Bacteria 2360
1111 Ga0373933_0086885 3300035724 Bacteria 1925
1112 Ga0373933_0358622 3300035724 Bacteria 948
1113 Ga0373947_0008089 3300035725 Bacteria 6063
1114 Ga0373947_0011831 3300035725 Bacteria 5000
1115 Ga0373947_0030266 3300035725 Bacteria 3180
1116 Ga0373947_0043287 3300035725 Bacteria 2689
1117 Ga0373947_0517738 3300035725 Bacteria 811
1118 Ga0373937_0000196 3300036401 Bacteria 59256
1119 Ga0373937_0016104 3300036401 Bacteria 6633
1120 Ga0373937_0051921 3300036401 Bacteria 3758
1121 Ga0373937_0054655 3300036401 Bacteria 3664
1122 Ga0373937_0083876 3300036401 Bacteria 2948
1123 Ga0373937_0120496 3300036401 Bacteria 2445
1124 Ga0373937_0307820 3300036401 Bacteria 1498
1125 Ga0373937_0360328 3300036401 Bacteria 1378
1126 Ga0373937_0976311 3300036401 Bacteria 796
1127 Ga0316582_0087826 3300036647 Bacteria 2041
1128 Ga0316584_0253485 3300036712 Bacteria 1285
1129 Ga0373925_0009358 3300037068 Bacteria 7133
1130 Ga0373925_0016826 3300037068 Bacteria 5295
1131 Ga0373925_0038994 3300037068 Bacteria 3514
1132 Ga0373925_0249423 3300037068 Bacteria 1423
1133 Ga0373925_0364911 3300037068 Bacteria 1174
1134 Ga0373925_0369711 3300037068 Bacteria 1166
1135 Ga0373925_0443678 3300037068 Bacteria 1062
1136 Ga0395899_0087910 3300037312 Bacteria 2255
1137 Ga0395900_0063994 3300037418 Bacteria 3781
1138 Ga0395900_0241751 3300037418 Bacteria 1811
1139 Ga0395900_0587317 3300037418 Bacteria 1055
1140 Ga0395898_0259504 3300037466 Bacteria 1657
1141 Ga0395898_0619272 3300037466 Bacteria 1025
1142 Ga0395905_0033982 3300037471 Bacteria 4790
1143 Ga0395905_0044633 3300037471 Bacteria 4159
1144 Ga0395905_0785085 3300037471 Bacteria 855
1145 Ga0316581_0003974 3300037588 Bacteria 3730
1146 Ga0436364_0903780 3300037853 Bacteria 2115
1147 Ga0395901_0187973 3300038443 Bacteria 2166
1148 Ga0395901_0277990 3300038443 Bacteria 1740
1149 Ga0395901_0454159 3300038443 Bacteria 1310
1150 Ga0436365_1647464 3300039437 Bacteria 933
1151 Ga0436361_0654481 3300039447 Bacteria 3460
1152 Ga0451853_1357136 3300041512 Bacteria 1818
1153 Ga0439441_001308 3300042001 Bacteria 3208
1154 Ga0439441_002712 3300042001 Bacteria 2522
1155 Ga0439441_007744 3300042001 Bacteria 1740
1156 Ga0450889_008562 3300042144 Bacteria 1041
1157 Ga0450889_022230 3300042144 Bacteria 710
1158 Ga0439446_0020970 3300042156 Bacteria 1844
1159 Ga0439434_0068694 3300042435 Bacteria 1114
1160 Ga0439444_0000069 3300042437 Bacteria 7681
1161 Ga0439444_0053464 3300042437 Bacteria 826
1162 Ga0439459_0113245 3300042438 Bacteria 676
1163 Ga0439460_0003429 3300042461 Bacteria 3831
1164 Ga0451577_0057283 3300042876 Bacteria 3474
1165 Ga0453683_0316156 3300044673 Bacteria 1000
1166 Ga0466966_0137583 3300044684 Bacteria 1493
1167 Ga0466966_0319425 3300044684 Bacteria 933
1168 Ga0466961_0532039 3300044693 Bacteria 708
1169 Ga0466963_0267933 3300044694 Bacteria 1200
1170 Ga0466957_0016315 3300044842 Bacteria 4344
1171 Ga0466959_0062530 3300045049 Bacteria 2705
1172 Ga0451576_0001669 3300045051 Bacteria 36837
1173 Ga0451576_0013254 3300045051 Bacteria 9225
1174 Ga0451576_0028297 3300045051 Bacteria 6006
1175 Ga0451576_0625217 3300045051 Bacteria 1132
1176 Ga0451576_0967112 3300045051 Bacteria 893
1177 Ga0466967_0523825 3300045976 Bacteria 1165
1178 Ga0495592_0034105 3300046454 Bacteria 3838
1179 Ga0495603_0004721 3300046455 Bacteria 8138
1180 Ga0495603_0056387 3300046455 Bacteria 2326
1181 Ga0495629_0009703 3300046459 Bacteria 7030
1182 Ga0495651_0002396 3300046462 Bacteria 14471
1183 Ga0495653_0037223 3300046463 Bacteria 3825
1184 Ga0495580_0007442 3300046472 Bacteria 8802
1185 Ga0495580_0024507 3300046472 Bacteria 4415
1186 Ga0495580_0108410 3300046472 Bacteria 1928
1187 Ga0495580_0230864 3300046472 Bacteria 1270
1188 Ga0495582_0005635 3300046473 Bacteria 6970
1189 Ga0495582_0038435 3300046473 Bacteria 2633
1190 Ga0495639_0032116 3300046475 Bacteria 2340
1191 Ga0495662_0014512 3300046476 Bacteria 3831
1192 Ga0495664_0011950 3300046477 Bacteria 4905
1193 Ga0495664_0087857 3300046477 Bacteria 1868
1194 Ga0495594_0021678 3300046499 Bacteria 3431
1195 Ga0495594_0067416 3300046499 Bacteria 1986
1196 Ga0495608_0003916 3300046511 Bacteria 10705
1197 Ga0495608_0344129 3300046511 Bacteria 918
1198 Ga0495628_0068116 3300046516 Bacteria 2778
1199 Ga0495628_0225255 3300046516 Bacteria 1407
1200 Ga0495630_0074869 3300046517 Bacteria 2551
1201 Ga0495630_0093813 3300046517 Bacteria 2269
1202 Ga0495666_0186169 3300046526 Bacteria 958
1203 Ga0495666_0205549 3300046526 Bacteria 904
1204 Ga0495652_0076191 3300046529 Bacteria 2783
1205 Ga0495665_0059742 3300046531 Bacteria 2013
1206 Ga0495640_0118116 3300046533 Bacteria 1726
1207 Ga0495587_0009004 3300046536 Bacteria 6408
1208 Ga0495587_0059783 3300046536 Bacteria 2236
1209 Ga0495621_0018344 3300046539 Bacteria 2272
1210 Ga0495621_0025372 3300046539 Bacteria 1991
1211 Ga0495621_0086541 3300046539 Bacteria 1176
1212 Ga0495621_0173495 3300046539 Bacteria 858
1213 Ga0495645_0000843 3300046543 Bacteria 20844
1214 Ga0495633_0278549 3300046558 Bacteria 761
1215 Ga0495667_0016218 3300046559 Bacteria 5031
1216 Ga0495667_0187967 3300046559 Bacteria 1324
1217 Ga0495656_0099792 3300046615 Bacteria 1341
1218 Ga0495656_0454730 3300046615 Bacteria 675
1219 Ga0495635_0013003 3300046663 Bacteria 5827
1220 Ga0495635_0048842 3300046663 Bacteria 2917
1221 Ga0495659_0005933 3300046664 Bacteria 3863
1222 Ga0495659_0232638 3300046664 Bacteria 764
1223 Ga0495588_0035971 3300046674 Bacteria 2511
1224 Ga0495657_0009256 3300046675 Bacteria 7477
1225 Ga0495657_0058075 3300046675 Bacteria 2570
1226 Ga0495599_0058960 3300046678 Bacteria 2401
1227 Ga0495646_0060796 3300046680 Bacteria 2252
1228 Ga0495647_0003740 3300046681 Bacteria 4887
1229 Ga0495647_0019369 3300046681 Bacteria 2432
1230 Ga0495658_0002492 3300046683 Bacteria 9260
1231 Ga0495658_0044103 3300046683 Bacteria 2497
1232 Ga0495669_0100423 3300046684 Bacteria 1343
1233 Ga0495613_0005063 3300046689 Bacteria 9883
1234 Ga0495613_0293249 3300046689 Bacteria 1127
1235 Ga0495600_0060612 3300046809 Bacteria 2471
1236 Ga0495581_0007173 3300047315 Bacteria 6453
1237 Ga0495604_0582701 3300047317 Bacteria 719
1238 Ga0495676_0080400 3300047321 Bacteria 2475
1239 Ga0495680_0034302 3300047322 Bacteria 4100
1240 Ga0495680_0068608 3300047322 Bacteria 2708
1241 Ga0495675_0051556 3300047444 Bacteria 2613
1242 Ga0495684_0105936 3300047471 Bacteria 2124
1243 Ga0495684_0275609 3300047471 Bacteria 1215
1244 Ga0496100_0083276 3300048903 Bacteria 2165
1245 Ga0496100_0122485 3300048903 Bacteria 1821
1246 Ga0496100_0394353 3300048903 Bacteria 1053
1247 Ga0496101_0065579 3300048904 Bacteria 2647
1248 Ga0496101_0069572 3300048904 Bacteria 2576
1249 Ga0496102_0006530 3300048905 Bacteria 9953
1250 Ga0496102_0040318 3300048905 Bacteria 4224
1251 Ga0496102_0201996 3300048905 Bacteria 1874
1252 Ga0496102_0519336 3300048905 Bacteria 1113
1253 Ga0496103_0040268 3300048906 Bacteria 2872
1254 Ga0496103_0061293 3300048906 Bacteria 2339
1255 Ga0496103_0126041 3300048906 Bacteria 1633
1256 Ga0496104_0000879 3300048907 Bacteria 25857
1257 Ga0496104_0031781 3300048907 Bacteria 4911
1258 Ga0496104_0072907 3300048907 Bacteria 3266
1259 Ga0496104_1218678 3300048907 Bacteria 656
1260 Ga0496105_0005045 3300048908 Bacteria 9998
1261 Ga0496105_0018938 3300048908 Bacteria 5546
1262 Ga0496105_0488962 3300048908 Bacteria 967
1263 Ga0496106_0030705 3300048909 Bacteria 4005
1264 Ga0496106_0068439 3300048909 Bacteria 2708
1265 Ga0496106_0126796 3300048909 Bacteria 1999
1266 Ga0496106_0691393 3300048909 Bacteria 813
1267 Ga0496107_0037885 3300048910 Bacteria 3461
1268 Ga0496107_0047326 3300048910 Bacteria 3097
1269 Ga0496107_0069780 3300048910 Bacteria 2551
1270 Ga0496108_0004216 3300048911 Bacteria 11579
1271 Ga0496108_0116731 3300048911 Bacteria 2286
1272 Ga0496108_0310621 3300048911 Bacteria 1374
1273 Ga0496108_0788380 3300048911 Bacteria 820
1274 Ga0496108_1150111 3300048911 Bacteria 658
1275 Ga0496109_0025981 3300048912 Bacteria 5219
1276 Ga0496109_0027609 3300048912 Bacteria 5070
1277 Ga0496109_0030203 3300048912 Bacteria 4858
1278 Ga0496109_0262773 3300048912 Bacteria 1626
1279 Ga0496110_0005609 3300048913 Bacteria 9850
1280 Ga0496110_0194782 3300048913 Bacteria 1840
1281 Ga0496110_0389082 3300048913 Bacteria 1271
1282 Ga0496111_0146607 3300048914 Bacteria 1750
1283 Ga0496112_0000314 3300048915 Bacteria 31297
1284 Ga0496112_0298235 3300048915 Bacteria 1557
1285 Ga0496114_0031961 3300048917 Bacteria 4330
1286 Ga0496115_0045186 3300048918 Bacteria 3515
1287 Ga0501295_046898 3300049518 Bacteria 914
1288 Ga0501298_003796 3300049521 Bacteria 2357
1289 Ga0501298_031969 3300049521 Bacteria 1037
1290 Ga0501033_0054406 3300049570 Bacteria 2961
1291 Ga0501034_0165551 3300049571 Bacteria 2180
1292 Ga0501036_0054000 3300049572 Bacteria 3402
1293 Ga0501036_0100103 3300049572 Bacteria 2451
1294 Ga0501036_0178168 3300049572 Bacteria 1790
1295 Ga0501036_0331661 3300049572 Bacteria 1271
1296 Ga0501036_0524471 3300049572 Bacteria 985
1297 Ga0501037_0123189 3300049573 Bacteria 1863
1298 Ga0501037_0193058 3300049573 Bacteria 1441
1299 Ga0501038_0110214 3300049574 Bacteria 2281
1300 Ga0501038_0155169 3300049574 Bacteria 1865
1301 Ga0501039_0015287 3300049575 Bacteria 5875
1302 Ga0501039_0055916 3300049575 Bacteria 3057
1303 Ga0501039_0399640 3300049575 Bacteria 1079
1304 Ga0501040_0037286 3300049576 Bacteria 3302
1305 Ga0501040_0052272 3300049576 Bacteria 2796
1306 Ga0501040_0139657 3300049576 Bacteria 1706
1307 Ga0501041_0002333 3300049577 Bacteria 10736
1308 Ga0501041_0039360 3300049577 Bacteria 2869
1309 Ga0501041_0109630 3300049577 Bacteria 1712
1310 Ga0501042_0256363 3300049578 Bacteria 1262
1311 Ga0501042_0381789 3300049578 Bacteria 1020
1312 Ga0501043_0153462 3300049579 Bacteria 1801
1313 Ga0501046_0135088 3300049580 Bacteria 1869
1314 Ga0501047_0028972 3300049581 Bacteria 5340
1315 Ga0501047_0095287 3300049581 Bacteria 2855
1316 Ga0501048_0014213 3300049582 Bacteria 5897
1317 Ga0501048_0091466 3300049582 Bacteria 2146
1318 Ga0501048_0446782 3300049582 Bacteria 926
1319 Ga0501067_0010133 3300049583 Bacteria 5213
1320 Ga0501067_0060791 3300049583 Bacteria 2091
1321 Ga0501067_0470343 3300049583 Bacteria 702
1322 Ga0501068_0025551 3300049584 Bacteria 3474
1323 Ga0501068_0455307 3300049584 Bacteria 828
1324 Ga0501068_0576577 3300049584 Bacteria 732
1325 Ga0501069_0000753 3300049585 Bacteria 15120
1326 Ga0501069_0080733 3300049585 Bacteria 1832
1327 Ga0501070_0000609 3300049586 Bacteria 32789
1328 Ga0501070_0133247 3300049586 Bacteria 2052
1329 Ga0501071_0007544 3300049587 Bacteria 7158
1330 Ga0501071_0097495 3300049587 Bacteria 2165
1331 Ga0501071_0432782 3300049587 Bacteria 1006
1332 Ga0501072_0009227 3300049588 Bacteria 7497
1333 Ga0501072_0225547 3300049588 Bacteria 1493
1334 Ga0501072_0251394 3300049588 Bacteria 1408
1335 Ga0501073_0007998 3300049589 Bacteria 7851
1336 Ga0501073_0065401 3300049589 Bacteria 2536
1337 Ga0501074_0000574 3300049590 Bacteria 22747
1338 Ga0501074_0574965 3300049590 Bacteria 797
1339 Ga0501075_0003488 3300049591 Bacteria 10514
1340 Ga0501075_0010485 3300049591 Bacteria 6513
1341 Ga0501075_0593978 3300049591 Bacteria 844
1342 Ga0501075_0635415 3300049591 Bacteria 814
1343 Ga0501076_0001452 3300049592 Bacteria 15936
1344 Ga0501076_0031573 3300049592 Bacteria 4132
1345 Ga0501076_0317489 3300049592 Bacteria 1278
1346 Ga0501076_0411425 3300049592 Bacteria 1112
1347 Ga0501076_0429787 3300049592 Bacteria 1087
1348 Ga0501077_0010732 3300049593 Bacteria 5705
1349 Ga0501209_066387 3300049656 Bacteria 1018
1350 Ga0501216_034078 3300049660 Bacteria 952
1351 Ga0501225_0115974 3300049705 Bacteria 793
1352 Ga0501079_0009186 3300049741 Bacteria 7487
1353 Ga0501079_0019525 3300049741 Bacteria 5177
1354 Ga0501079_0029172 3300049741 Bacteria 4234
1355 Ga0501079_0130213 3300049741 Bacteria 1958
1356 Ga0501079_0225774 3300049741 Bacteria 1463
1357 Ga0501079_0240284 3300049741 Bacteria 1415
1358 Ga0501079_0574302 3300049741 Bacteria 887
1359 Ga0501080_0007015 3300049742 Bacteria 10174
1360 Ga0501080_0083668 3300049742 Bacteria 2964
1361 Ga0501080_0517465 3300049742 Bacteria 1065
1362 Ga0501080_0607428 3300049742 Archaea 970
1363 Ga0501081_0028107 3300049743 Bacteria 3793
1364 Ga0501081_0091868 3300049743 Bacteria 2135
1365 Ga0501081_0176034 3300049743 Bacteria 1546
1366 Ga0501081_0447023 3300049743 Bacteria 960
1367 Ga0501083_0005518 3300049744 Bacteria 8962
1368 Ga0501083_0025387 3300049744 Bacteria 4102
1369 Ga0501035_0169812 3300049822 Bacteria 1885
1370 Ga0501044_0081965 3300049823 Bacteria 3265
1371 Ga0501045_0000845 3300049824 Bacteria 19872
1372 nmdc:mga00v17_201760_c1 3300050491 Bacteria 1286
1373 nmdc:mga0k408_68449_c1 3300050493 Bacteria 2071
1374 nmdc:mga05p37_204420_c1 3300050507 Bacteria 2390
1375 nmdc:mga05p37_3076_c1 3300050507 Bacteria 19372
1376 nmdc:mga05p37_33475_c1 3300050507 Bacteria 6294
1377 nmdc:mga05p37_5061_c2 3300050507 Bacteria 9847
1378 nmdc:mga05p37_561374_c1 3300050507 Bacteria 1297
1379 nmdc:mga05p37_621730_c1 3300050507 Bacteria 1215
1380 nmdc:mga05p37_68154_c1 3300050507 Bacteria 4376
1381 nmdc:mga09592_10948_c1 3300050508 Bacteria 7379
1382 nmdc:mga09592_1195_c1 3300050508 Bacteria 20776
1383 nmdc:mga09592_199635_c1 3300050508 Bacteria 1732
1384 nmdc:mga09592_231564_c1 3300050508 Bacteria 1601
1385 nmdc:mga09592_23644_c1 3300050508 Bacteria 5076
1386 nmdc:mga09592_315_c1 3300050508 Bacteria 35276
1387 nmdc:mga09592_83931_c1 3300050508 Bacteria 2716
1388 nmdc:mga0qj67_139300_c1 3300050509 Bacteria 1967
1389 nmdc:mga0qj67_177679_c1 3300050509 Bacteria 1729
1390 nmdc:mga0qj67_447269_c1 3300050509 Bacteria 1041
1391 nmdc:mga0qj67_7055_c1 3300050509 Bacteria 8287
1392 nmdc:mga0qj67_8051_c1 3300050509 Bacteria 7800
1393 nmdc:mga0qj67_949080_c1 3300050509 Unclassified 676
1394 nmdc:mga06r32_144826_c1 3300050510 Bacteria 2353
1395 nmdc:mga06r32_24820_c1 3300050510 Bacteria 5571
1396 nmdc:mga06r32_268303_c1 3300050510 Bacteria 1694
1397 nmdc:mga06r32_9941_c1 3300050510 Bacteria 8586
1398 nmdc:mga08y16_1041986_c1 3300050511 Bacteria 796
1399 nmdc:mga08y16_147_c1 3300050511 Bacteria 61021
1400 nmdc:mga08y16_179606_c1 3300050511 Bacteria 2198
1401 nmdc:mga08y16_410_c1 3300050511 Bacteria 39418
1402 nmdc:mga08y16_8218_c1 3300050511 Bacteria 10916
1403 nmdc:mga0n895_132373_c1 3300050512 Bacteria 2519
1404 nmdc:mga0n895_33034_c1 3300050512 Bacteria 4971
1405 nmdc:mga0n895_545126_c1 3300050512 Bacteria 1166
1406 nmdc:mga0n895_545893_c1 3300050512 Bacteria 1165
1407 nmdc:mga0n895_716733_c1 3300050512 Bacteria 995
1408 nmdc:mga0n895_817715_c1 3300050512 Bacteria 921
1409 nmdc:mga0rr50_157618_c1 3300050513 Bacteria 1840
1410 nmdc:mga0rr50_207428_c1 3300050513 Bacteria 1613
1411 nmdc:mga0rr50_305243_c1 3300050513 Bacteria 1332
1412 nmdc:mga0rr50_7963_c1 3300050513 Bacteria 6578
1413 nmdc:mga08x19_10442_c1 3300050514 Bacteria 5575
1414 nmdc:mga08x19_43108_c1 3300050514 Bacteria 2878
1415 nmdc:mga08x19_568283_c1 3300050514 Bacteria 803
1416 nmdc:mga08x19_957_c1 3300050514 Bacteria 18098
1417 nmdc:mga0a205_198116_c1 3300050515 Bacteria 1899
1418 nmdc:mga0a205_47270_c1 3300050515 Bacteria 4151
1419 nmdc:mga0a205_8535_c1 3300050515 Bacteria 9315
1420 Ga0495601_0052864 3300053077 Bacteria 2566
1421 Ga0495601_0230078 3300053077 Bacteria 1211
1422 Ga0495612_0038841 3300053078 Bacteria 1935
1423 Ga0495595_0007322 3300053084 Bacteria 4517
1424 Ga0495595_0111138 3300053084 Bacteria 1329
1425 Ga0495595_0217219 3300053084 Bacteria 954
1426 Ga0495619_0027961 3300053085 Bacteria 3636
1427 Ga0495619_0037733 3300053085 Bacteria 3151
1428 Ga0495619_0115541 3300053085 Bacteria 1836
1429 Ga0500641_0059229 3300053096 Bacteria 1592
1430 Ga0501084_0003771 3300054114 Bacteria 12318
1431 Ga0501084_0477314 3300054114 Bacteria 1054
1432 Ga0501084_0718347 3300054114 Bacteria 842
1433 Ga0501082_0004597 3300060353 Bacteria 12054
1434 Ga0501082_0017352 3300060353 Bacteria 6201
1435 Ga0501082_0459563 3300060353 Bacteria 1112
1436 Ga0530510_0004384 3300061734 Bacteria 9767
1437 2723876941 2721755763 Bacteria 4464185
1438 Ga0070667_100093467
1439 Ga0065712_10178788
1440 Ga0065707_10083980
1441 Ga0065707_10194999
1442 Ga0070658_10014434
1443 Ga0070658_10038108
1444 Ga0070658_10140960
1445 Ga0070658_10360130
1446 Ga0070676_10005772
1447 Ga0070676_10024104
1448 Ga0070676_10402513
1449 Ga0070683_100031728
1450 Ga0070683_100109436
1451 Ga0070683_100193413
1452 Ga0070670_100003426
1453 Ga0070670_100022180
1454 Ga0070670_100027426
1455 Ga0070670_100161062
1456 Ga0070677_10001447
1457 Ga0070677_10065705
1458 Ga0068869_100000112
1459 Ga0068869_100001018
1460 Ga0068869_100053817
1461 Ga0068869_100064339
1462 Ga0068869_100096094
1463 Ga0068869_100134484
1464 Ga0068869_100381715
1465 Ga0068869_100479924
1466 Ga0070666_10000781
1467 Ga0070666_10006653
1468 Ga0070666_10053681
1469 Ga0070680_100070820
1470 Ga0070680_100089741
1471 Ga0070680_100108601
1472 Ga0070680_100111562
1473 Ga0070680_100119566
1474 Ga0070680_100605503
1475 Ga0070682_100109918
1476 Ga0068868_100001147
1477 Ga0068868_100001733
1478 Ga0068868_100021318
1479 Ga0068868_100034707
1480 Ga0068868_100056350
1481 Ga0068868_100089555
1482 Ga0068868_100125939
1483 Ga0068868_100280896
1484 Ga0070660_100087014
1485 Ga0070660_100092315
1486 Ga0070660_100115152
1487 Ga0070660_100196619
1488 Ga0070660_100553673
1489 Ga0070689_100002351
1490 Ga0070689_100005181
1491 Ga0070689_100012648
1492 Ga0070689_100019120
1493 Ga0070689_100040811
1494 Ga0070689_100075722
1495 Ga0070689_100106179
1496 Ga0070689_100176371
1497 Ga0070689_100208658
1498 Ga0070689_100434987
1499 Ga0070691_10165159
1500 Ga0070691_10196368
1501 Ga0070687_100017060
1502 Ga0070687_100028587
1503 Ga0070661_100001174
1504 Ga0070661_100013097
1505 Ga0070661_100074882
1506 Ga0070661_100102290
1507 Ga0070661_100136577
1508 Ga0070661_100143694
1509 Ga0070661_100381240
1510 Ga0070692_10001272
1511 Ga0070692_10013414
1512 Ga0070692_10089620
1513 Ga0070692_10147536
1514 Ga0070692_10179610
1515 Ga0070692_10211235
1516 Ga0070668_100001871
1517 Ga0070668_100014438
1518 Ga0070668_100038797
1519 Ga0070668_100051416
1520 Ga0070668_100351491
1521 Ga0070669_100001240
1522 Ga0070669_100140437
1523 Ga0070669_100227792
1524 Ga0070669_100381275
1525 Ga0070669_100447214
1526 Ga0070669_100483876
1527 Ga0070675_100001111
1528 Ga0070675_100012372
1529 Ga0070675_100014606
1530 Ga0070675_100037285
1531 Ga0070675_100189574
1532 Ga0070671_100001989
1533 Ga0070671_100003908
1534 Ga0070671_100011511
1535 Ga0070671_100397957
1536 Ga0070671_100423469
1537 Ga0070671_100512902
1538 Ga0070671_100531676
1539 Ga0070674_100030572
1540 Ga0070674_100074164
1541 Ga0070674_100180123
1542 Ga0070673_100002058
1543 Ga0070673_100002508
1544 Ga0070673_100005751
1545 Ga0070673_100015173
1546 Ga0070673_100153331
1547 Ga0070673_100369311
1548 Ga0070688_100000963
1549 Ga0070688_100040776
1550 Ga0070688_100082289
1551 Ga0070688_100125793
1552 Ga0070688_100174182
1553 Ga0070688_100248659
1554 Ga0070688_100338582
1555 Ga0070659_100032339
1556 Ga0070659_100058443
1557 Ga0070659_100099926
1558 Ga0070659_100117836
1559 Ga0070659_100125007
1560 Ga0070659_100426486
1561 Ga0070667_100002249
1562 Ga0070667_100007540
1563 Ga0070667_100073320
1564 Ga0070667_100121562
1565 Ga0070667_100590390
1566 Ga0070667_100648478
1567 Ga0070709_10061920
1568 Ga0070709_10082586
1569 Ga0070709_10464747
1570 Ga0070714_100063207
1571 Ga0070714_100091132
1572 Ga0070714_100242325
1573 Ga0070714_100691097
1574 Ga0070714_100718799
1575 Ga0070714_101107393
1576 Ga0070713_100000532
1577 Ga0070713_100068189
1578 Ga0070713_100091700
1579 Ga0070713_100142727
1580 Ga0070713_100344792
1581 Ga0070710_10003737
1582 Ga0070710_10230774
1583 Ga0070710_10246945
1584 Ga0070701_10090202
1585 Ga0070701_10142578
1586 Ga0070701_10167381
1587 Ga0070711_100002284
1588 Ga0070711_100027487
1589 Ga0070711_100166348
1590 Ga0070711_100361101
1591 Ga0070711_100386653
1592 Ga0070711_100469007
1593 Ga0070705_100001907
1594 Ga0070705_100114162
1595 Ga0070705_100127630
1596 Ga0070700_100020549
1597 Ga0070700_100656816
1598 Ga0070694_100000367
1599 Ga0070694_100013195
1600 Ga0070694_100022121
1601 Ga0070694_100307303
1602 Ga0070694_100432535
1603 Ga0070708_101007694
1604 Ga0070663_100006987
1605 Ga0070663_100047959
1606 Ga0070663_100072322
1607 Ga0070663_100089418
1608 Ga0070663_100483303
1609 Ga0070678_100002115
1610 Ga0070678_100006182
1611 Ga0070678_100117824
1612 Ga0070678_100128027
1613 Ga0070678_100527282
1614 Ga0070662_100041469
1615 Ga0070662_100061921
1616 Ga0070662_100128034
1617 Ga0070662_100803316
1618 Ga0070681_10012333
1619 Ga0070681_10058584
1620 Ga0070681_10067846
1621 Ga0070681_10737154
1622 Ga0070681_11063443
1623 Ga0068867_100007281
1624 Ga0068867_100031780
1625 Ga0068867_100164179
1626 Ga0068867_100170624
1627 Ga0068867_100219033
1628 Ga0068867_100424919
1629 Ga0068867_100471975
1630 Ga0070685_10000757
1631 Ga0070685_10010061
1632 Ga0070706_100053220
1633 Ga0070706_100229901
1634 Ga0070707_100008673
1635 Ga0070707_100152544
1636 Ga0070698_100012657
1637 Ga0070698_100169109
1638 Ga0070698_100360361
1639 Ga0070698_100776526
1640 Ga0070698_100836757
1641 Ga0070698_101235737
1642 Ga0070699_100021481
1643 Ga0070679_100047855
1644 Ga0070679_100080787
1645 Ga0070679_100090207
1646 Ga0070679_100311868
1647 Ga0070679_101000200
1648 Ga0070684_100015948
1649 Ga0070684_100032306
1650 Ga0070684_100305989
1651 Ga0070684_100399753
1652 Ga0070697_100015481
1653 Ga0070697_100195886
1654 Ga0070697_100771699
1655 Ga0068853_100004975
1656 Ga0068853_100009004
1657 Ga0068853_100023153
1658 Ga0068853_100055592
1659 Ga0068853_100097508
1660 Ga0068853_100355467
1661 Ga0070672_100004036
1662 Ga0070672_100022023
1663 Ga0070672_100088654
1664 Ga0070672_100166074
1665 Ga0070686_100000664
1666 Ga0070686_100027252
1667 Ga0070686_100202081
1668 Ga0070686_100243739
1669 Ga0070686_100313804
1670 Ga0070695_100027197
1671 Ga0070695_100030108
1672 Ga0070695_100330631
1673 Ga0070695_100550091
1674 Ga0070695_101009433
1675 Ga0070696_100000082
1676 Ga0070696_100025207
1677 Ga0070696_100031584
1678 Ga0070696_100053284
1679 Ga0070696_100154884
1680 Ga0070696_100260802
1681 Ga0070696_100373860
1682 Ga0070696_100749430
1683 Ga0070693_100000114
1684 Ga0070693_100000865
1685 Ga0070693_100001090
1686 Ga0070693_100124512
1687 Ga0070693_100143356
1688 Ga0070693_100525855
1689 Ga0070693_100766040
1690 Ga0070665_100004099
1691 Ga0070665_100014838
1692 Ga0070665_100092643
1693 Ga0070665_100132351
1694 Ga0070704_100000018
1695 Ga0070704_100000804
1696 Ga0070704_100019690
1697 Ga0070704_100049634
1698 Ga0070704_100178553
1699 Ga0070704_100278118
1700 Ga0068855_100000606
1701 Ga0068855_100013117
1702 Ga0068855_100034412
1703 Ga0068855_100062259
1704 Ga0068855_100065347
1705 Ga0068855_100080350
1706 Ga0068855_100128475
1707 Ga0068855_100140646
1708 Ga0068855_100362795
1709 Ga0068855_100648125
1710 Ga0068855_100774007
1711 Ga0070664_100002050
1712 Ga0070664_100003666
1713 Ga0070664_100011554
1714 Ga0070664_100037097
1715 Ga0070664_100079186
1716 Ga0070664_100225260
1717 Ga0070664_100232889
1718 Ga0070664_100472651
1719 Ga0070664_100594986
1720 Ga0068857_100002436
1721 Ga0068857_100022316
1722 Ga0068857_100065835
1723 Ga0068857_100235191
1724 Ga0068857_100842970
1725 Ga0068857_100878560
1726 Ga0068854_100014836
1727 Ga0068854_100062130
1728 Ga0068854_100086270
1729 Ga0068854_100089888
1730 Ga0068854_100102892
1731 Ga0068854_100258581
1732 Ga0068854_100601558
1733 Ga0068856_100001525
1734 Ga0068856_100008201
1735 Ga0068856_100008271
1736 Ga0068856_100027541
1737 Ga0068856_100225844
1738 Ga0068856_100726125
1739 Ga0070702_100000345
1740 Ga0070702_100001358
1741 Ga0070702_100007759
1742 Ga0070702_100033148
1743 Ga0070702_100077189
1744 Ga0070702_100177671
1745 Ga0070702_100224513
1746 Ga0070702_100248854
1747 Ga0068852_100003212
1748 Ga0068852_100017095
1749 Ga0068852_100017275
1750 Ga0068852_100017306
1751 Ga0068852_100057315
1752 Ga0068852_100070112
1753 Ga0068852_100098599
1754 Ga0068852_100506752
1755 Ga0068859_100001261
1756 Ga0068859_100003443
1757 Ga0068859_100004359
1758 Ga0068859_100025159
1759 Ga0068859_100146661
1760 Ga0068859_100211036
1761 Ga0068859_100527985
1762 Ga0068859_100605326
1763 Ga0068864_100002301
1764 Ga0068864_100003329
1765 Ga0068864_100005882
1766 Ga0068864_100139973
1767 Ga0068866_10000156
1768 Ga0068866_10001559
1769 Ga0068866_10387332
1770 Ga0068861_100005694
1771 Ga0068861_100139689
1772 Ga0068861_100220552
1773 Ga0068861_100289238
1774 Ga0068851_10000414
1775 Ga0068851_10002960
1776 Ga0068851_10005874
1777 Ga0068851_10007372
1778 Ga0068851_10008358
1779 Ga0068851_10078576
1780 Ga0068851_10143644
1781 Ga0068870_10007432
1782 Ga0068870_10008779
1783 Ga0068870_10019968
1784 Ga0068870_10033888
1785 Ga0068863_100003709
1786 Ga0068863_100004215
1787 Ga0068863_100017847
1788 Ga0068863_100624766
1789 Ga0068858_100003266
1790 Ga0068858_100005937
1791 Ga0068858_100006737
1792 Ga0068858_100045084
1793 Ga0068858_100052098
1794 Ga0068858_100216015
1795 Ga0068860_100003163
1796 Ga0068860_100024839
1797 Ga0068860_100042384
1798 Ga0068860_100205096
1799 Ga0068860_100221680
1800 Ga0068860_100384044
1801 Ga0068860_100578076
1802 Ga0068860_100716665
1803 Ga0068862_100002561
1804 Ga0068862_100003677
1805 Ga0068862_100004741
1806 Ga0068862_100211566
1807 Ga0068862_100572451
1808 Ga0081455_10276846
1809 Ga0070717_10196409
1810 Ga0070717_11119302
1811 Ga0075364_10118616
1812 Ga0075432_10165643
1813 Ga0070716_100026870
1814 Ga0070716_100209919
1815 Ga0070716_100271330
1816 Ga0070712_100060565
1817 Ga0070712_100356366
1818 Ga0075369_10100281
1819 Ga0075366_10008007
1820 Ga0075366_10071203
1821 Ga0075366_10237630
1822 Ga0097621_100013103
1823 Ga0097621_100055281
1824 Ga0097621_100101737
1825 Ga0097621_100202487
1826 Ga0097621_100287620
1827 Ga0097621_100447749
1828 Ga0097621_100699760
1829 Ga0068871_100002592
1830 Ga0068871_100009430
1831 Ga0068871_100014850
1832 Ga0068871_100037389
1833 Ga0068871_100040098
1834 Ga0068871_100138201
1835 Ga0068871_100253297
1836 Ga0068871_101100215
1837 Ga0075428_100001234
1838 Ga0075428_100001971
1839 Ga0075428_100013306
1840 Ga0075428_100031432
1841 Ga0075428_100059383
1842 Ga0075428_100065717
1843 Ga0075428_100531338
1844 Ga0075428_100699371
1845 Ga0075430_100020906
1846 Ga0075430_100047470
1847 Ga0075431_100017432
1848 Ga0075431_100034266
1849 Ga0075431_100115301
1850 Ga0075431_100155468
1851 Ga0075431_100791989
1852 Ga0075433_10001083
1853 Ga0075433_10219515
1854 Ga0075433_10533571
1855 Ga0075433_10833808
1856 Ga0075434_100002085
1857 Ga0075434_100108968
1858 Ga0075434_100283171
1859 Ga0075434_100578873
1860 Ga0075434_100761898
1861 Ga0075429_100000646
1862 Ga0075429_100005055
1863 Ga0075429_100094683
1864 Ga0075429_100266168
1865 Ga0075429_100600041
1866 Ga0068865_100033903
1867 Ga0068865_100460791
1868 Ga0075436_100001595
1869 Ga0075436_100260505
1870 Ga0075436_100567597
1871 Ga0097620_100001261
1872 Ga0097620_100003443
1873 Ga0097620_100004359
1874 Ga0097620_100025159
1875 Ga0097620_100146660
1876 Ga0097620_100211046
1877 Ga0097620_100528015
1878 Ga0097620_100605298
1879 Ga0075435_100000518
1880 Ga0075435_100065367
1881 Ga0075435_100189423
1882 Ga0075435_100189661
1883 Ga0075435_100309960
1884 Ga0075435_100319606
1885 Ga0099794_10110673
1886 Ga0105240_10008612
1887 Ga0105240_10014011
1888 Ga0105240_10040958
1889 Ga0105240_10066520
1890 Ga0105240_10066535
1891 Ga0105240_10116333
1892 Ga0105240_10132589
1893 Ga0105240_10277029
1894 Ga0105240_10364780
1895 Ga0105240_10417616
1896 Ga0105240_10482582
1897 Ga0105240_11659948
1898 Ga0111539_10000774
1899 Ga0111539_10005040
1900 Ga0111539_10017431
1901 Ga0111539_10039067
1902 Ga0111539_10067195
1903 Ga0111539_10417318
1904 Ga0111539_11881017
1905 Ga0105245_10006058
1906 Ga0105245_10007204
1907 Ga0105245_10007876
1908 Ga0105245_10047855
1909 Ga0105245_10140852
1910 Ga0105245_10208665
1911 Ga0105245_10297629
1912 Ga0105245_10639282
1913 Ga0105245_11757723
1914 Ga0105247_10010547
1915 Ga0105247_10019165
1916 Ga0114129_10005474
1917 Ga0114129_10007730
1918 Ga0114129_10018550
1919 Ga0114129_10030790
1920 Ga0114129_10486007
1921 Ga0114129_10958532
1922 Ga0114129_11037820
1923 Ga0105243_10015832
1924 Ga0105243_10880219
1925 Ga0105241_10002670
1926 Ga0105241_10006168
1927 Ga0105241_10023884
1928 Ga0105241_10128356
1929 Ga0105242_10000987
1930 Ga0105242_10016016
1931 Ga0105242_10021309
1932 Ga0105242_10040648
1933 Ga0105242_10133272
1934 Ga0105242_10413250
1935 Ga0105242_10449957
1936 Ga0105248_10004325
1937 Ga0105248_10011080
1938 Ga0105248_10013584
1939 Ga0105248_10067838
1940 Ga0105248_10119999
1941 Ga0105248_10181138
1942 Ga0105248_10187396
1943 Ga0105248_10188774
1944 Ga0105248_10370568
1945 Ga0105248_10996811
1946 Ga0105237_10164714
1947 Ga0105237_10211874
1948 Ga0105237_10216965
1949 Ga0105237_10455648
1950 Ga0105237_11252961
1951 Ga0105238_10015625
1952 Ga0105238_10023086
1953 Ga0105238_10049631
1954 Ga0105238_10309126
1955 Ga0105238_11303173
1956 Ga0105238_11367125
1957 Ga0105249_10010758
1958 Ga0105249_10029721
1959 Ga0105249_10091854
1960 Ga0105249_10392996
1961 Ga0105239_10041116
1962 Ga0105239_10094935
1963 Ga0105239_10208471
1964 Ga0105239_10333982
1965 Ga0105239_10560594
1966 Ga0105239_10593861
1967 Ga0105239_11277425
1968 Ga0105246_10233155
1969 Ga0105246_10513311
1970 Ga0105246_10752314
1971 Ga0157373_10002284
1972 Ga0157373_10007697
1973 Ga0157373_10034188
1974 Ga0157373_10627521
1975 Ga0157373_10867168
1976 Ga0157371_10015449
1977 Ga0157371_10043194
1978 Ga0157371_10149399
1979 Ga0157371_10328964
1980 Ga0157371_10536500
1981 Ga0157370_10002793
1982 Ga0157370_10014687
1983 Ga0157370_10017912
1984 Ga0157370_10018482
1985 Ga0157370_10028106
1986 Ga0157370_10111213
1987 Ga0157370_10142480
1988 Ga0157370_10181862
1989 Ga0157370_10583087
1990 Ga0157369_10002637
1991 Ga0157369_10022671
1992 Ga0157369_10034018
1993 Ga0157369_10181577
1994 Ga0157369_10429558
1995 Ga0157374_10006420
1996 Ga0157374_10020984
1997 Ga0157374_10097737
1998 Ga0157374_10138612
1999 Ga0157374_10293159
2000 Ga0157374_10354786
2001 Ga0157378_10005252
2002 Ga0157378_10017496
2003 Ga0157378_10076771
2004 Ga0157378_10236750
2005 Ga0157378_10301848
2006 Ga0157378_10360434
2007 Ga0157378_10828629
2008 Ga0157378_10846289
2009 Ga0157378_11611615
2010 Ga0163162_10020845
2011 Ga0163162_10021297
2012 Ga0163162_10037009
2013 Ga0163162_10159622
2014 Ga0163162_10309936
2015 Ga0163162_10954677
2016 Ga0163162_11451875
2017 Ga0163162_11704155
2018 Ga0157372_10006805
2019 Ga0157372_10034017
2020 Ga0157372_10041534
2021 Ga0157372_10198895
2022 Ga0157372_10399548
2023 Ga0157372_10437042
2024 Ga0157372_10511908
2025 Ga0157375_10007328
2026 Ga0157375_10022802
2027 Ga0157375_10086890
2028 Ga0157375_10100280
2029 Ga0157375_10157878
2030 Ga0157375_10305397
2031 Ga0157375_10335587
2032 Ga0163163_10002992
2033 Ga0163163_10005262
2034 Ga0163163_10032655
2035 Ga0163163_10080669
2036 Ga0157380_10010274
2037 Ga0157380_10063883
2038 Ga0157380_10134795
2039 Ga0157380_10152487
2040 Ga0157380_10432889
2041 Ga0157377_10012524
2042 Ga0157377_10071731
2043 Ga0157377_10072701
2044 Ga0157377_10092645
2045 Ga0157377_10389196
2046 Ga0157377_10558250
2047 Ga0157379_10000105
2048 Ga0157379_10016263
2049 Ga0157379_10024244
2050 Ga0157379_10205723
2051 Ga0157379_10336061
2052 Ga0157376_10006355
2053 Ga0157376_10006926
2054 Ga0157376_10049249
2055 Ga0157376_10140848
2056 Ga0157376_10145754
2057 Ga0157376_10184306
2058 Ga0157376_10412824
2059 Ga0163161_10042900
2060 Ga0163161_10289378
2061 Ga0206356_11509169
2062 Ga0206350_11148392
2063 Ga0206354_11656380
2064 Ga0207697_10000256
2065 Ga0207656_10007476
2066 Ga0207656_10009807
2067 Ga0207656_10015547
2068 Ga0207656_10019475
2069 Ga0207656_10046358
2070 Ga0207656_10124429
2071 Ga0207656_10200425
2072 Ga0207682_10002842
2073 Ga0207682_10005384
2074 Ga0207682_10097781
2075 Ga0207692_10032187
2076 Ga0207692_10076217
2077 Ga0207692_10096554
2078 Ga0207642_10008230
2079 Ga0207642_10244003
2080 Ga0207710_10032395
2081 Ga0207710_10169801
2082 Ga0207688_10005533
2083 Ga0207688_10006223
2084 Ga0207688_10420421
2085 Ga0207680_10029585
2086 Ga0207680_10044368
2087 Ga0207680_10048962
2088 Ga0207680_10069449
2089 Ga0207680_10442616
2090 Ga0207699_10084760
2091 Ga0207699_10407630
2092 Ga0207699_10522030
2093 Ga0207699_10565788
2094 Ga0207645_10010186
2095 Ga0207645_10013074
2096 Ga0207645_10019122
2097 Ga0207645_10055652
2098 Ga0207645_10136577
2099 Ga0207645_10343766
2100 Ga0207643_10001448
2101 Ga0207643_10007881
2102 Ga0207643_10009215
2103 Ga0207643_10009375
2104 Ga0207643_10017417
2105 Ga0207643_10075375
2106 Ga0207705_10023007
2107 Ga0207705_10086194
2108 Ga0207705_10129278
2109 Ga0207705_10137196
2110 Ga0207705_10230098
2111 Ga0207705_10250269
2112 Ga0207705_10319081
2113 Ga0207705_10532475
2114 Ga0207684_10138581
2115 Ga0207654_10080976
2116 Ga0207654_10104777
2117 Ga0207707_10015189
2118 Ga0207707_10043905
2119 Ga0207707_10047373
2120 Ga0207707_10161571
2121 Ga0207707_10277052
2122 Ga0207695_10010633
2123 Ga0207695_10023085
2124 Ga0207695_10033838
2125 Ga0207695_10094270
2126 Ga0207695_10150608
2127 Ga0207695_10272866
2128 Ga0207671_10032257
2129 Ga0207693_10001367
2130 Ga0207663_10010775
2131 Ga0207663_10027523
2132 Ga0207663_10269327
2133 Ga0207663_10586080
2134 Ga0207663_10620844
2135 Ga0207663_10751583
2136 Ga0207660_10042880
2137 Ga0207660_10131393
2138 Ga0207660_10140607
2139 Ga0207660_10149468
2140 Ga0207660_10157527
2141 Ga0207660_10415667
2142 Ga0207662_10016036
2143 Ga0207662_10047420
2144 Ga0207662_10151903
2145 Ga0207657_10003293
2146 Ga0207657_10003870
2147 Ga0207657_10007023
2148 Ga0207657_10042029
2149 Ga0207657_10233606
2150 Ga0207657_10415470
2151 Ga0207649_10040380
2152 Ga0207649_10064787
2153 Ga0207649_10124226
2154 Ga0207649_10144528
2155 Ga0207649_10233096
2156 Ga0207649_10760076
2157 Ga0207652_10012986
2158 Ga0207652_10022147
2159 Ga0207652_10024979
2160 Ga0207652_10319457
2161 Ga0207652_10413741
2162 Ga0207646_10025617
2163 Ga0207681_10043526
2164 Ga0207681_10045180
2165 Ga0207681_10111670
2166 Ga0207681_10154186
2167 Ga0207681_10254202
2168 Ga0207681_10758652
2169 Ga0207694_10021737
2170 Ga0207694_10080457
2171 Ga0207694_10148664
2172 Ga0207694_10178677
2173 Ga0207694_10190944
2174 Ga0207694_10425835
2175 Ga0207650_10007945
2176 Ga0207650_10140064
2177 Ga0207650_10160179
2178 Ga0207659_10012442
2179 Ga0207659_10019119
2180 Ga0207659_10020571
2181 Ga0207659_10023776
2182 Ga0207659_10387841
2183 Ga0207687_10001346
2184 Ga0207687_10003693
2185 Ga0207687_10005336
2186 Ga0207687_10088085
2187 Ga0207687_10185750
2188 Ga0207687_10312283
2189 Ga0207700_10000077
2190 Ga0207700_10059548
2191 Ga0207700_10090091
2192 Ga0207700_10127034
2193 Ga0207700_10130902
2194 Ga0207700_10317891
2195 Ga0207700_11005961
2196 Ga0207664_10026358
2197 Ga0207664_10070855
2198 Ga0207664_10092028
2199 Ga0207664_10093335
2200 Ga0207644_10003624
2201 Ga0207644_10065514
2202 Ga0207690_10005362
2203 Ga0207690_10022730
2204 Ga0207690_10268783
2205 Ga0207706_10000040
2206 Ga0207706_10002930
2207 Ga0207706_10003835
2208 Ga0207706_10022219
2209 Ga0207706_10127874
2210 Ga0207706_10135844
2211 Ga0207686_10000526
2212 Ga0207686_10003451
2213 Ga0207686_10411193
2214 Ga0207709_10000759
2215 Ga0207709_10048888
2216 Ga0207709_10360597
2217 Ga0207709_10569622
2218 Ga0207670_10010027
2219 Ga0207670_10013797
2220 Ga0207670_10018511
2221 Ga0207670_10184573
2222 Ga0207670_10268213
2223 Ga0207670_10356559
2224 Ga0207669_10017712
2225 Ga0207669_10031481
2226 Ga0207669_10074860
2227 Ga0207669_10130389
2228 Ga0207669_10337772
2229 Ga0207669_10361973
2230 Ga0207704_10002200
2231 Ga0207704_10047334
2232 Ga0207704_10094915
2233 Ga0207704_10360591
2234 Ga0207665_10004914
2235 Ga0207665_10011300
2236 Ga0207665_10062527
2237 Ga0207665_10244265
2238 Ga0207665_10518411
2239 Ga0207691_10000370
2240 Ga0207691_10011403
2241 Ga0207691_10036227
2242 Ga0207691_10047739
2243 Ga0207691_10048750
2244 Ga0207691_10085870
2245 Ga0207691_10095465
2246 Ga0207711_10000688
2247 Ga0207711_10066962
2248 Ga0207711_10077264
2249 Ga0207711_10320755
2250 Ga0207711_11010661
2251 Ga0207689_10000147
2252 Ga0207689_10001752
2253 Ga0207689_10016440
2254 Ga0207689_10021698
2255 Ga0207689_10036784
2256 Ga0207689_10055392
2257 Ga0207689_10347218
2258 Ga0207689_10377598
2259 Ga0207689_10405341
2260 Ga0207689_10432649
2261 Ga0207689_10456677
2262 Ga0207661_10044744
2263 Ga0207661_10064899
2264 Ga0207661_10115709
2265 Ga0207661_10144802
2266 Ga0207661_10258476
2267 Ga0207661_10374723
2268 Ga0207679_10005740
2269 Ga0207679_10030015
2270 Ga0207679_10032874
2271 Ga0207679_10047269
2272 Ga0207679_10051080
2273 Ga0207679_10076154
2274 Ga0207679_10149043
2275 Ga0207679_10220925
2276 Ga0207667_10013239
2277 Ga0207667_10029425
2278 Ga0207667_10052595
2279 Ga0207667_10080894
2280 Ga0207667_10115181
2281 Ga0207667_10193261
2282 Ga0207667_10210126
2283 Ga0207667_10245062
2284 Ga0207667_10528917
2285 Ga0207667_10571005
2286 Ga0207667_10716324
2287 Ga0207651_10001025
2288 Ga0207651_10011092
2289 Ga0207651_10020006
2290 Ga0207651_10031965
2291 Ga0207651_10033278
2292 Ga0207651_10102892
2293 Ga0207651_10181505
2294 Ga0207651_10274636
2295 Ga0207651_10611609
2296 Ga0207712_10139102
2297 Ga0207712_10236885
2298 Ga0207668_10002552
2299 Ga0207668_10004397
2300 Ga0207668_10028255
2301 Ga0207668_10040151
2302 Ga0207668_10075957
2303 Ga0207668_10330219
2304 Ga0207640_10003047
2305 Ga0207640_10008110
2306 Ga0207640_10048660
2307 Ga0207640_10080144
2308 Ga0207640_10144008
2309 Ga0207640_10166911
2310 Ga0207640_10223273
2311 Ga0207640_10338339
2312 Ga0207640_10423644
2313 Ga0207658_10006790
2314 Ga0207658_10035841
2315 Ga0207658_10052543
2316 Ga0207658_10053190
2317 Ga0207658_10101609
2318 Ga0207658_10498635
2319 Ga0207677_10000775
2320 Ga0207677_10000943
2321 Ga0207677_10008381
2322 Ga0207677_10009318
2323 Ga0207677_10039064
2324 Ga0207677_10171885
2325 Ga0207703_10000792
2326 Ga0207703_10026479
2327 Ga0207703_10044778
2328 Ga0207703_10045458
2329 Ga0207639_10011455
2330 Ga0207639_10029564
2331 Ga0207639_10157951
2332 Ga0207639_10326392
2333 Ga0207639_10486212
2334 Ga0207678_10003163
2335 Ga0207678_10009058
2336 Ga0207678_10099367
2337 Ga0207678_10106957
2338 Ga0207678_10148089
2339 Ga0207678_10539374
2340 Ga0207708_10002021
2341 Ga0207708_10011646
2342 Ga0207708_10123054
2343 Ga0207708_10157358
2344 Ga0207708_10266309
2345 Ga0207708_10805706
2346 Ga0207702_10003520
2347 Ga0207702_10008140
2348 Ga0207702_10018251
2349 Ga0207702_10134123
2350 Ga0207702_10138441
2351 Ga0207702_10211225
2352 Ga0207702_10620001
2353 Ga0207641_10002392
2354 Ga0207641_10020355
2355 Ga0207641_10027385
2356 Ga0207641_10265543
2357 Ga0207641_10502768
2358 Ga0207641_10651734
2359 Ga0207641_10723690
2360 Ga0207648_10003996
2361 Ga0207648_10010242
2362 Ga0207648_10010615
2363 Ga0207648_10011907
2364 Ga0207648_10027011
2365 Ga0207648_10048028
2366 Ga0207648_10466753
2367 Ga0207648_10541652
2368 Ga0207676_10001352
2369 Ga0207676_10002124
2370 Ga0207676_10039003
2371 Ga0207676_10443211
2372 Ga0207676_10571190
2373 Ga0207674_10000155
2374 Ga0207674_10004319
2375 Ga0207674_10004526
2376 Ga0207674_10005346
2377 Ga0207674_10027058
2378 Ga0207674_10046493
2379 Ga0207675_100001483
2380 Ga0207675_100009355
2381 Ga0207675_100018793
2382 Ga0207675_100285558
2383 Ga0207683_10000835
2384 Ga0207683_10001468
2385 Ga0207683_10005518
2386 Ga0207683_10049170
2387 Ga0207683_10089562
2388 Ga0207683_10110224
2389 Ga0207683_10305041
2390 Ga0207683_10479983
2391 Ga0207683_10543609
2392 Ga0207698_10001850
2393 Ga0207698_10008545
2394 Ga0207698_10017560
2395 Ga0207698_10053299
2396 Ga0207698_10225500
2397 Ga0207698_10430267
2398 Ga0207698_10634854
2399 Ga0207698_10794776
2400 Ga0209969_1005985
2401 Ga0209967_1036793
2402 Ga0209981_1009088
2403 Ga0209996_1001493
2404 Ga0210000_1003267
2405 Ga0209999_1013578
2406 Ga0209970_1023512
2407 Ga0209983_1033444
2408 Ga0209971_1003038
2409 Ga0209971_1004641
2410 Ga0209971_1050083
2411 Ga0209966_1023402
2412 Ga0209974_10005559
2413 Ga0209974_10027526
2414 Ga0209974_10040131
2415 Ga0209974_10046698
2416 Ga0209974_10091372
2417 Ga0209974_10137614
2418 Ga0207428_10003647
2419 Ga0207428_10003844
2420 Ga0207428_10008834
2421 Ga0207428_10404711
2422 Ga0268266_10009699
2423 Ga0268266_10026477
2424 Ga0268266_10224895
2425 Ga0268265_10005233
2426 Ga0268265_10009101
2427 Ga0268265_10413007
2428 Ga0268264_10001853
2429 Ga0268264_10003678
2430 Ga0268264_10005166
2431 Ga0268264_10028217
2432 Ga0268264_10063608
2433 Ga0268264_10111646
2434 Ga0268264_10176613
2435 Ga0268264_10302967
2436 Ga0268264_10610776
2437 Ga0268264_10657506
2438 Ga0265318_10006150
2439 Ga0265338_10000205
2440 Ga0265338_10493096
2441 Ga0265330_10013365
2442 Ga0265332_10001524
2443 Ga0265328_10008480
2444 Ga0265320_10005671
2445 Ga0265329_10008728
2446 Ga0265340_10170499
2447 Ga0265339_10020973
2448 Ga0265331_10004058
2449 Ga0265316_10252884
2450 Ga0307509_10342013
2451 Ga0307408_100070540
2452 Ga0307408_100095765
2453 Ga0307408_100202630
2454 Ga0307408_100287239
2455 Ga0265313_10105230
2456 Ga0316575_10007567
2457 Ga0316575_10013572
2458 Ga0316579_10015628
2459 Ga0265314_10000523
2460 Ga0265314_10028854
2461 Ga0265314_10203014
2462 Ga0316578_10027051
2463 Ga0307405_10092247
2464 Ga0307405_10388270
2465 Ga0307405_10397919
2466 Ga0316577_10456534
2467 Ga0307410_10026095
2468 Ga0307410_10306588
2469 Ga0307407_10082527
2470 Ga0307412_10133151
2471 Ga0307409_100019259
2472 Ga0307416_100111464
2473 Ga0307416_100162867
2474 Ga0307416_100426414
2475 Ga0307416_100441703
2476 Ga0307416_100560308
2477 Ga0307416_100792094
2478 Ga0307416_100836646
2479 Ga0307416_101111248
2480 Ga0307414_10117923
2481 Ga0307411_10220116
2482 Ga0307411_10442380
2483 Ga0316583_10002043
2484 Ga0316583_10007626
2485 Ga0373948_0042598
2486 Ga0373958_0027371
2487 Ga0373926_0001895
2488 Ga0373928_0036168
2489 Ga0373928_0044293
2490 Ga0373934_0001111
2491 Ga0373940_0011091
2492 Ga0373944_0060701
2493 Ga0373949_0002059
2494 Ga0373951_0015686
2495 Ga0373952_0004072
2496 Ga0373923_0002023
2497 Ga0373923_0044384
2498 Ga0373923_0212438
2499 Ga0373932_0000353
2500 Ga0373936_0004291
2501 Ga0373936_0024243
2502 Ga0373936_0027365
2503 Ga0373939_0191840
2504 Ga0373941_0005481
2505 Ga0373945_0054667
2506 Ga0373945_0099598
2507 Ga0373953_0038516
2508 Ga0373953_0068221
2509 Ga0373954_0001903
2510 Ga0373954_0077896
2511 Ga0373954_0179572
2512 Ga0373956_0000003
2513 Ga0373956_0018475
2514 Ga0373956_0125624
2515 Ga0373957_0000503
2516 Ga0373957_0000705
2517 Ga0373960_0106223
2518 Ga0373943_0098025
2519 Ga0373943_0135811
2520 Ga0373946_0044859
2521 Ga0373946_0045195
2522 Ga0373946_0180161
2523 Ga0373955_0006271
2524 Ga0373955_0029187
2525 Ga0373961_0023599
2526 Ga0373961_0199153
2527 Ga0316574_0006816
2528 Ga0373924_0023371
2529 Ga0373931_0000189
2530 Ga0373931_0002113
2531 Ga0373931_0072032
2532 Ga0373931_0214241
2533 Ga0373931_0375657
2534 Ga0373935_0009296
2535 Ga0373935_0010264
2536 Ga0373935_0030664
2537 Ga0373935_0100798
2538 Ga0373927_0005725
2539 Ga0373927_0012203
2540 Ga0373927_0035076
2541 Ga0373927_0037647
2542 Ga0373927_0077542
2543 Ga0373927_0091617
2544 Ga0373927_0285975
2545 Ga0373933_0001377
2546 Ga0373933_0008929
2547 Ga0373933_0056292
2548 Ga0373933_0086885
2549 Ga0373933_0358622
2550 Ga0373947_0008089
2551 Ga0373947_0011831
2552 Ga0373947_0030266
2553 Ga0373947_0043287
2554 Ga0373947_0517738
2555 Ga0373937_0000196
2556 Ga0373937_0016104
2557 Ga0373937_0051921
2558 Ga0373937_0054655
2559 Ga0373937_0083876
2560 Ga0373937_0120496
2561 Ga0373937_0307820
2562 Ga0373937_0360328
2563 Ga0373937_0976311
2564 Ga0316582_0087826
2565 Ga0316584_0253485
2566 Ga0373925_0009358
2567 Ga0373925_0016826
2568 Ga0373925_0038994
2569 Ga0373925_0249423
2570 Ga0373925_0364911
2571 Ga0373925_0369711
2572 Ga0373925_0443678
2573 Ga0395899_0087910
2574 Ga0395900_0063994
2575 Ga0395900_0241751
2576 Ga0395900_0587317
2577 Ga0395898_0259504
2578 Ga0395898_0619272
2579 Ga0395905_0033982
2580 Ga0395905_0044633
2581 Ga0395905_0785085
2582 Ga0316581_0003974
2583 Ga0436364_0903780
2584 Ga0395901_0187973
2585 Ga0395901_0277990
2586 Ga0395901_0454159
2587 Ga0436365_1647464
2588 Ga0436361_0654481
2589 Ga0451853_1357136
2590 Ga0439441_001308
2591 Ga0439441_002712
2592 Ga0439441_007744
2593 Ga0450889_008562
2594 Ga0450889_022230
2595 Ga0439446_0020970
2596 Ga0439434_0068694
2597 Ga0439444_0000069
2598 Ga0439444_0053464
2599 Ga0439459_0113245
2600 Ga0439460_0003429
2601 Ga0451577_0057283
2602 Ga0453683_0316156
2603 Ga0466966_0137583
2604 Ga0466966_0319425
2605 Ga0466961_0532039
2606 Ga0466963_0267933
2607 Ga0466957_0016315
2608 Ga0466959_0062530
2609 Ga0451576_0001669
2610 Ga0451576_0013254
2611 Ga0451576_0028297
2612 Ga0451576_0625217
2613 Ga0451576_0967112
2614 Ga0466967_0523825
2615 Ga0495592_0034105
2616 Ga0495603_0004721
2617 Ga0495603_0056387
2618 Ga0495629_0009703
2619 Ga0495651_0002396
2620 Ga0495653_0037223
2621 Ga0495580_0007442
2622 Ga0495580_0024507
2623 Ga0495580_0108410
2624 Ga0495580_0230864
2625 Ga0495582_0005635
2626 Ga0495582_0038435
2627 Ga0495639_0032116
2628 Ga0495662_0014512
2629 Ga0495664_0011950
2630 Ga0495664_0087857
2631 Ga0495594_0021678
2632 Ga0495594_0067416
2633 Ga0495608_0003916
2634 Ga0495608_0344129
2635 Ga0495628_0068116
2636 Ga0495628_0225255
2637 Ga0495630_0074869
2638 Ga0495630_0093813
2639 Ga0495666_0186169
2640 Ga0495666_0205549
2641 Ga0495652_0076191
2642 Ga0495665_0059742
2643 Ga0495640_0118116
2644 Ga0495587_0009004
2645 Ga0495587_0059783
2646 Ga0495621_0018344
2647 Ga0495621_0025372
2648 Ga0495621_0086541
2649 Ga0495621_0173495
2650 Ga0495645_0000843
2651 Ga0495633_0278549
2652 Ga0495667_0016218
2653 Ga0495667_0187967
2654 Ga0495656_0099792
2655 Ga0495656_0454730
2656 Ga0495635_0013003
2657 Ga0495635_0048842
2658 Ga0495659_0005933
2659 Ga0495659_0232638
2660 Ga0495588_0035971
2661 Ga0495657_0009256
2662 Ga0495657_0058075
2663 Ga0495599_0058960
2664 Ga0495646_0060796
2665 Ga0495647_0003740
2666 Ga0495647_0019369
2667 Ga0495658_0002492
2668 Ga0495658_0044103
2669 Ga0495669_0100423
2670 Ga0495613_0005063
2671 Ga0495613_0293249
2672 Ga0495600_0060612
2673 Ga0495581_0007173
2674 Ga0495604_0582701
2675 Ga0495676_0080400
2676 Ga0495680_0034302
2677 Ga0495680_0068608
2678 Ga0495675_0051556
2679 Ga0495684_0105936
2680 Ga0495684_0275609
2681 Ga0496100_0083276
2682 Ga0496100_0122485
2683 Ga0496100_0394353
2684 Ga0496101_0065579
2685 Ga0496101_0069572
2686 Ga0496102_0006530
2687 Ga0496102_0040318
2688 Ga0496102_0201996
2689 Ga0496102_0519336
2690 Ga0496103_0040268
2691 Ga0496103_0061293
2692 Ga0496103_0126041
2693 Ga0496104_0000879
2694 Ga0496104_0031781
2695 Ga0496104_0072907
2696 Ga0496104_1218678
2697 Ga0496105_0005045
2698 Ga0496105_0018938
2699 Ga0496105_0488962
2700 Ga0496106_0030705
2701 Ga0496106_0068439
2702 Ga0496106_0126796
2703 Ga0496106_0691393
2704 Ga0496107_0037885
2705 Ga0496107_0047326
2706 Ga0496107_0069780
2707 Ga0496108_0004216
2708 Ga0496108_0116731
2709 Ga0496108_0310621
2710 Ga0496108_0788380
2711 Ga0496108_1150111
2712 Ga0496109_0025981
2713 Ga0496109_0027609
2714 Ga0496109_0030203
2715 Ga0496109_0262773
2716 Ga0496110_0005609
2717 Ga0496110_0194782
2718 Ga0496110_0389082
2719 Ga0496111_0146607
2720 Ga0496112_0000314
2721 Ga0496112_0298235
2722 Ga0496114_0031961
2723 Ga0496115_0045186
2724 Ga0501295_046898
2725 Ga0501298_003796
2726 Ga0501298_031969
2727 Ga0501033_0054406
2728 Ga0501034_0165551
2729 Ga0501036_0054000
2730 Ga0501036_0100103
2731 Ga0501036_0178168
2732 Ga0501036_0331661
2733 Ga0501036_0524471
2734 Ga0501037_0123189
2735 Ga0501037_0193058
2736 Ga0501038_0110214
2737 Ga0501038_0155169
2738 Ga0501039_0015287
2739 Ga0501039_0055916
2740 Ga0501039_0399640
2741 Ga0501040_0037286
2742 Ga0501040_0052272
2743 Ga0501040_0139657
2744 Ga0501041_0002333
2745 Ga0501041_0039360
2746 Ga0501041_0109630
2747 Ga0501042_0256363
2748 Ga0501042_0381789
2749 Ga0501043_0153462
2750 Ga0501046_0135088
2751 Ga0501047_0028972
2752 Ga0501047_0095287
2753 Ga0501048_0014213
2754 Ga0501048_0091466
2755 Ga0501048_0446782
2756 Ga0501067_0010133
2757 Ga0501067_0060791
2758 Ga0501067_0470343
2759 Ga0501068_0025551
2760 Ga0501068_0455307
2761 Ga0501068_0576577
2762 Ga0501069_0000753
2763 Ga0501069_0080733
2764 Ga0501070_0000609
2765 Ga0501070_0133247
2766 Ga0501071_0007544
2767 Ga0501071_0097495
2768 Ga0501071_0432782
2769 Ga0501072_0009227
2770 Ga0501072_0225547
2771 Ga0501072_0251394
2772 Ga0501073_0007998
2773 Ga0501073_0065401
2774 Ga0501074_0000574
2775 Ga0501074_0574965
2776 Ga0501075_0003488
2777 Ga0501075_0010485
2778 Ga0501075_0593978
2779 Ga0501075_0635415
2780 Ga0501076_0001452
2781 Ga0501076_0031573
2782 Ga0501076_0317489
2783 Ga0501076_0411425
2784 Ga0501076_0429787
2785 Ga0501077_0010732
2786 Ga0501209_066387
2787 Ga0501216_034078
2788 Ga0501225_0115974
2789 Ga0501079_0009186
2790 Ga0501079_0019525
2791 Ga0501079_0029172
2792 Ga0501079_0130213
2793 Ga0501079_0225774
2794 Ga0501079_0240284
2795 Ga0501079_0574302
2796 Ga0501080_0007015
2797 Ga0501080_0083668
2798 Ga0501080_0517465
2799 Ga0501080_0607428
2800 Ga0501081_0028107
2801 Ga0501081_0091868
2802 Ga0501081_0176034
2803 Ga0501081_0447023
2804 Ga0501083_0005518
2805 Ga0501083_0025387
2806 Ga0501035_0169812
2807 Ga0501044_0081965
2808 Ga0501045_0000845
2809 nmdc:mga00v17_201760_c1
2810 nmdc:mga0k408_68449_c1
2811 nmdc:mga05p37_204420_c1
2812 nmdc:mga05p37_3076_c1
2813 nmdc:mga05p37_33475_c1
2814 nmdc:mga05p37_5061_c2
2815 nmdc:mga05p37_561374_c1
2816 nmdc:mga05p37_621730_c1
2817 nmdc:mga05p37_68154_c1
2818 nmdc:mga09592_10948_c1
2819 nmdc:mga09592_1195_c1
2820 nmdc:mga09592_199635_c1
2821 nmdc:mga09592_231564_c1
2822 nmdc:mga09592_23644_c1
2823 nmdc:mga09592_315_c1
2824 nmdc:mga09592_83931_c1
2825 nmdc:mga0qj67_139300_c1
2826 nmdc:mga0qj67_177679_c1
2827 nmdc:mga0qj67_447269_c1
2828 nmdc:mga0qj67_7055_c1
2829 nmdc:mga0qj67_8051_c1
2830 nmdc:mga0qj67_949080_c1
2831 nmdc:mga06r32_144826_c1
2832 nmdc:mga06r32_24820_c1
2833 nmdc:mga06r32_268303_c1
2834 nmdc:mga06r32_9941_c1
2835 nmdc:mga08y16_1041986_c1
2836 nmdc:mga08y16_147_c1
2837 nmdc:mga08y16_179606_c1
2838 nmdc:mga08y16_410_c1
2839 nmdc:mga08y16_8218_c1
2840 nmdc:mga0n895_132373_c1
2841 nmdc:mga0n895_33034_c1
2842 nmdc:mga0n895_545126_c1
2843 nmdc:mga0n895_545893_c1
2844 nmdc:mga0n895_716733_c1
2845 nmdc:mga0n895_817715_c1
2846 nmdc:mga0rr50_157618_c1
2847 nmdc:mga0rr50_207428_c1
2848 nmdc:mga0rr50_305243_c1
2849 nmdc:mga0rr50_7963_c1
2850 nmdc:mga08x19_10442_c1
2851 nmdc:mga08x19_43108_c1
2852 nmdc:mga08x19_568283_c1
2853 nmdc:mga08x19_957_c1
2854 nmdc:mga0a205_198116_c1
2855 nmdc:mga0a205_47270_c1
2856 nmdc:mga0a205_8535_c1
2857 Ga0495601_0052864
2858 Ga0495601_0230078
2859 Ga0495612_0038841
2860 Ga0495595_0007322
2861 Ga0495595_0111138
2862 Ga0495595_0217219
2863 Ga0495619_0027961
2864 Ga0495619_0037733
2865 Ga0495619_0115541
2866 Ga0500641_0059229
2867 Ga0501084_0003771
2868 Ga0501084_0477314
2869 Ga0501084_0718347
2870 Ga0501082_0004597
2871 Ga0501082_0017352
2872 Ga0501082_0459563
2873 Ga0530510_0004384
2874 2723876941

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05683

Fumerase_C

Fumarase C-terminus

11

206

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dni-assembly2.cif.gz_B crystal structure of methanocaldococcus jannaschii fumarate hydratase beta subunit 0.8784 3 181
7xky-assembly1.cif.gz_B crystal structure of methanocaldococcus jannaschii two-subunit fumarate hydratase apo-protein complex 0.8672 5 195
5dni-assembly2.cif.gz_B crystal structure of methanocaldococcus jannaschii fumarate hydratase beta subunit 0.8646 3 181
2isb-assembly1.cif.gz_A crystal structure of fumarase of fum-1 (np_069927.1) from archaeoglobus fulgidus at 1.66 a resolution 0.8594 1 181
7xky-assembly1.cif.gz_B crystal structure of methanocaldococcus jannaschii two-subunit fumarate hydratase apo-protein complex 0.8546 5 195
ID Description Score Start End Superfamily
af_P0AC35_1_176_3.20.130.10 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.924 3 180 3.20.130.10
af_P0AC35_1_176_3.20.130.10 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.9041 3 180 3.20.130.10
1vpjA00 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.8822 3 181 3.20.130.10
5dniA00 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.877 3 181 3.20.130.10
1vpjA00 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.8677 3 181 3.20.130.10
ID Description Score Start End GO Terms
AF-A0A259BUR2-F1-model_v4 L(+)-tartrate dehydratase subunit beta (EC 4.2.1.32) 0.9772 1 171 GO:0016836
AF-A0A495TTR3-F1-model_v4 L(+)-tartrate dehydratase beta subunit 0.9743 2 203 GO:0016836
AF-A0A1F4ET13-F1-model_v4 Fumarate hydrolyase 0.9676 1 202 GO:0016836
AF-A0A537FVR7-F1-model_v4 L(+)-tartrate dehydratase subunit beta (EC 4.2.1.32) 0.9671 35 202 GO:0016836
AF-A0A536YJ41-F1-model_v4 Fumarate hydrolyase 0.9659 1 149 GO:0016836

Map