F493943

General Info

Members Datasets Scaffolds Average Seq Length
1435 661 1146 341

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2946006987|2946012478
Length 393
Sequence GLPAMQAPRYFSHTEAMPSQASQLPQQARSTIIVDAGRHKPPRIVCGNYMNILIVGPSWVGDMVMAQTLFQCLKQRHPDCQIDVLAPEWSRPILERMPEVHAALSFPLGHGALELATRRRIGKSMVGQYDQAILLPNSLKSALVPYFAGIPKRTGWRGEFRYVLLNDVRTLDKARYPLMIERFMALAYEPGAELPTPYPRPSLQIDPVSRDAALAKFGLALDRPVLALCPGAEFGESKRWPSEHYAKVAEMKIREGWQVWLFGSKKDHPVGEDIRQRLIPGLREEAVNLSGDTSLAEAIDLLSCADSVVSNDSGLMHVAAALNRPLVAVYGSTSPGFTPPLADKVEVVRLGLECSPCFERTCRFGHYNCMRQLLPQPVNEALQRLQGSAVEVR

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
4 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
5 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
6 2511231004 Pseudomonas sp. GM102 Isolate Nodule
7 2511231006 Pseudomonas sp. GM17 Isolate Nodule
8 2511231007 Pseudomonas sp. GM18 Isolate Nodule
9 2511231010 Pseudomonas sp. GM25 Isolate Nodule
10 2511231011 Pseudomonas sp. GM30 Isolate Nodule
11 2511231012 Pseudomonas sp. GM33 Isolate Nodule
12 2511231014 Pseudomonas sp. GM48 Isolate Nodule
13 2511231015 Pseudomonas sp. GM49 Isolate Nodule
14 2511231016 Pseudomonas sp. GM50 Isolate Nodule
15 2511231017 Pseudomonas sp. GM55 Isolate Nodule
16 2511231018 Pseudomonas sp. GM60 Isolate Nodule
17 2511231019 Pseudomonas sp. GM67 Isolate Nodule
18 2511231020 Pseudomonas sp. GM74 Isolate Nodule
19 2511231021 Pseudomonas sp. GM78 Isolate Nodule
20 2511231022 Pseudomonas sp. GM79 Isolate Nodule
21 2511231023 Pseudomonas sp. GM80 Isolate Nodule
22 2511231024 Pseudomonas sp. GM84 Isolate Nodule
23 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
24 2511231031 Pseudomonas sp. GM16 Isolate Nodule
25 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
26 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
27 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
28 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
29 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
30 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
31 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
32 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
33 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
34 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
35 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
36 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
37 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
38 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
39 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
40 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
41 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
42 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
43 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
44 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
45 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
46 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
47 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
48 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
49 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
50 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
51 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
52 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
53 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
54 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
55 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
56 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
57 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
58 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
59 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
60 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
61 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
62 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
63 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
64 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
65 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
66 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
67 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
68 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
69 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
70 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
71 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
72 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
73 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
74 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
75 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
76 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
77 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
78 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
79 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
80 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
81 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
82 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
83 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
84 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
85 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
86 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
87 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
88 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
89 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
90 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
91 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
92 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
93 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
94 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
95 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
96 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
97 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
98 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
99 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
100 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
101 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
102 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
103 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
104 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
105 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
106 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
107 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
108 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
109 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
110 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
111 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
112 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
113 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
114 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
115 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
116 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
117 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
118 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
119 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
120 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
121 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
122 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
123 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
124 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
125 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
126 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
127 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
128 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
129 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
130 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
131 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
132 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
133 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
134 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
135 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
136 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
137 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
138 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
139 2765235841 Pseudomonas putida AA7 Isolate Unclassified
140 2773857670 Pseudomonas sp. 478 Isolate Unclassified
141 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
142 2773857673 Pseudomonas sp. 443 Isolate Unclassified
143 2784132063 Pseudomonas sp. 424 Isolate Unclassified
144 2784132072 Pseudomonas sp. 460 Isolate Unclassified
145 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
146 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
147 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
148 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
149 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
150 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
151 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
152 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
153 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
154 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
155 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
156 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
157 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
158 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
159 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
160 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
161 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
162 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
163 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
164 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
165 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
166 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
167 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
168 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
169 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
170 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
171 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
172 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
173 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
174 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
175 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
176 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
177 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
178 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
179 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
180 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
181 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
182 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
183 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
184 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
185 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
186 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
187 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
188 2865014394 Pantoea sp. R-71966 Isolate Unclassified
189 2876601092 Pantoea endophytica 596 Isolate Unclassified
190 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
191 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
192 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
193 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
194 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
195 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
196 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
197 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
198 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
199 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
200 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
201 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
202 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
203 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
204 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
205 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
206 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
207 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
208 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
209 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
210 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
211 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
212 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
213 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
214 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
215 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
216 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
217 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
218 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
219 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
220 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
221 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
222 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
223 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
224 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
225 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
226 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
227 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
228 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
229 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
230 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
231 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
232 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
233 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
234 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
235 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
236 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
237 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
238 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
239 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
240 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
241 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
242 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
243 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
244 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
245 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
246 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
247 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
248 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
249 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
250 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
251 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
252 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
253 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
254 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
255 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
256 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
257 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
258 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
259 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
260 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
261 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
262 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
263 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
264 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
265 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
266 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
267 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
268 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
269 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
270 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
271 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
272 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
273 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
274 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
275 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
276 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
277 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
278 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
279 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
280 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
281 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
282 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
283 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
284 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
285 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
286 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
287 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
288 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
289 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
290 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
291 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
292 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
293 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
294 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
295 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
296 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
297 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
298 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
299 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
300 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
301 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
302 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
303 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
304 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
305 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
306 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
307 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
308 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
309 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
310 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
311 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
312 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
313 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
314 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
315 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
316 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
317 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
318 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
319 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
320 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
321 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
322 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
323 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
324 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
325 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
326 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
327 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
328 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
329 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
330 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
331 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
332 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
333 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
334 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
335 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
336 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
337 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
338 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
339 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
340 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
341 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
342 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
343 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
344 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
345 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
346 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
347 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
348 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
349 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
350 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
351 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
352 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
353 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
354 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
355 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
356 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
357 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
358 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
359 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
360 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
361 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
362 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
363 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
364 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
365 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
366 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
367 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
368 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
369 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
370 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
371 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
372 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
373 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
374 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
375 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
376 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
377 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
378 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
379 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
380 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
381 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
382 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
383 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
384 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
385 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
386 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
387 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
417 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
418 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
419 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
420 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
422 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
423 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
424 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
425 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
426 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
427 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
428 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
429 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
430 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
432 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
433 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
434 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
435 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
436 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
437 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
438 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
439 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
440 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
441 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
442 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
443 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
444 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
445 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
446 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
447 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
448 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
449 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
450 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
451 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
452 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
453 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
454 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
455 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
456 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
457 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
458 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
459 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
460 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
461 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
462 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
463 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
464 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
465 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
466 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
467 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
468 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
469 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
470 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
471 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
472 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
473 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
474 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
475 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
476 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
477 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
478 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
479 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
480 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
481 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
482 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
483 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
484 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
485 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
486 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
487 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
488 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
489 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
490 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
491 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
492 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
493 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
494 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
495 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
496 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
497 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
498 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
499 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
500 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
501 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
502 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
503 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
504 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
505 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
506 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
507 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
508 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
509 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
510 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
511 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
512 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
513 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
514 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
515 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
516 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
517 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
518 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
519 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
520 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
521 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
522 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
523 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
524 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
525 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
526 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
527 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
528 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
529 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
530 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
531 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
532 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
533 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
534 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
535 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
536 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
537 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
538 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
539 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
540 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
541 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
542 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
543 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
544 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
545 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
546 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
547 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
548 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
549 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
550 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
551 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
552 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
553 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
554 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
555 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
556 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
557 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
558 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
559 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
560 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
561 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
562 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
563 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
564 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
565 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
566 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
567 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
568 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
569 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
570 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
571 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
572 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
573 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
574 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
575 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
576 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
577 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
578 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
579 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
580 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
581 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
582 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
583 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
584 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
585 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
586 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
587 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
588 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
589 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
590 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
591 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
592 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
593 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
594 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
595 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
596 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
597 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
598 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
599 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
600 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
601 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
602 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
603 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
604 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
605 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
606 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
607 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
608 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
609 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
610 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
611 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
612 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
613 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
614 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
615 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
616 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
617 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
618 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
619 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
620 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
621 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
622 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
623 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
624 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
625 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
626 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
627 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
628 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
629 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
630 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
631 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
632 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
633 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
634 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
635 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
636 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
637 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
638 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
639 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
640 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
641 8052494512 Pseudomonas putida LD6 Isolate Unclassified
642 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
643 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
644 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
645 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
646 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
647 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
648 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
649 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
650 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
651 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
652 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
653 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
654 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
655 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
656 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
657 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
658 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
659 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
660 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
661 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.86
Metatranscriptomes 0
Isolates 20.14

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 6.97
Nodule 1.88
Rhizoplane 5.78
Rhizosphere 70.52
Stem 0
Stem Tuber 0
Unclassified 14.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_87 2124908027 Bacteria 56496
2 SwRhRL2b_contig_3164853 2162886007 Bacteria 3761
3 JGI24739J22299_10000283 3300001989 Bacteria 17041
4 JGI25162J39368_1000179 3300002737 Bacteria 68307
5 JGI25163J39215_1000534 3300002771 Bacteria 11173
6 JGI25163J39215_1001084 3300002771 Bacteria 5649
7 JGI25164J39214_1000145 3300002772 Bacteria 68307
8 JGI25164J39214_1000148 3300002772 Bacteria 67382
9 JGI25152J39213_1000946 3300002773 Bacteria 14243
10 JGI25159J45721_1003749 3300002987 Bacteria 5261
11 JGI25165J46597_1000266 3300003214 Bacteria 68307
12 JGI25165J46597_1000268 3300003214 Bacteria 67382
13 rootH2_10021225 3300003320 Bacteria 18419
14 Ga0055538_1000037 3300003751 Bacteria 190238
15 Ga0055539_1000048 3300003752 Bacteria 190238
16 Ga0055533_1000059 3300003756 Bacteria 190238
17 Ga0055532_1000096 3300003758 Bacteria 98889
18 Ga0055525_1000189 3300003759 Bacteria 75207
19 Ga0055535_1006573 3300003761 Bacteria 2330
20 Ga0055526_1000099 3300003771 Bacteria 78133
21 Ga0055526_1002548 3300003771 Bacteria 12240
22 Ga0055537_1000344 3300003773 Bacteria 31620
23 Ga0055524_1016089 3300003775 Bacteria 2699
24 Ga0055536_1002223 3300003781 Bacteria 11047
25 Ga0055534_1000310 3300003784 Bacteria 32619
26 Ga0055528_1000124 3300003790 Bacteria 61627
27 Ga0055530_10000374 3300003791 Bacteria 40490
28 Ga0055530_10000913 3300003791 Bacteria 24257
29 Ga0055530_10006069 3300003791 Bacteria 5520
30 Ga0055530_10008702 3300003791 Bacteria 4018
31 Ga0055540_1000337 3300003792 Bacteria 40512
32 Ga0055540_1000646 3300003792 Bacteria 24561
33 Ga0055540_1000657 3300003792 Bacteria 24257
34 Ga0055531_10000375 3300003794 Bacteria 43113
35 Ga0055541_1000035 3300003841 Bacteria 190238
36 Ga0058692_1000131 3300003856 Bacteria 47329
37 Ga0058692_1000281 3300003856 Bacteria 27035
38 Ga0058692_1001416 3300003856 Bacteria 8838
39 Ga0058692_1008935 3300003856 Bacteria 2561
40 Ga0065165_1000050 3300005262 Bacteria 195237
41 Ga0065714_10004524 3300005288 Bacteria 5029
42 Ga0065714_10005755 3300005288 Bacteria 4455
43 Ga0065714_10066037 3300005288 Bacteria 7777
44 Ga0065714_10066740 3300005288 Bacteria 6379
45 Ga0065714_10073326 3300005288 Bacteria 3206
46 Ga0065704_10000791 3300005289 Bacteria 18680
47 Ga0065704_10000868 3300005289 Bacteria 11408
48 Ga0065704_10002090 3300005289 Bacteria 8761
49 Ga0065704_10074337 3300005289 Bacteria 6347
50 Ga0065712_10067752 3300005290 Bacteria 56880
51 Ga0065712_10073947 3300005290 Bacteria 4231
52 Ga0070658_10058489 3300005327 Bacteria 3138
53 Ga0070658_10063672 3300005327 Bacteria 3007
54 Ga0070658_10199837 3300005327 Unclassified 1686
55 Ga0070676_10027595 3300005328 Bacteria 3220
56 Ga0070670_100001434 3300005331 Bacteria 19186
57 Ga0070670_100053124 3300005331 Bacteria 3479
58 Ga0070677_10006624 3300005333 Bacteria 3850
59 Ga0068869_100000941 3300005334 Bacteria 16837
60 Ga0068869_100006964 3300005334 Bacteria 7195
61 Ga0068869_100104364 3300005334 Bacteria 2148
62 Ga0070680_100153328 3300005336 Bacteria 1935
63 Ga0070689_100100915 3300005340 Bacteria 2284
64 Ga0070661_100000078 3300005344 Bacteria 77449
65 Ga0070692_10041465 3300005345 Bacteria 2359
66 Ga0070669_100001899 3300005353 Bacteria 15087
67 Ga0070669_100008275 3300005353 Bacteria 7425
68 Ga0070709_10165943 3300005434 Bacteria 1539
69 Ga0070713_100007989 3300005436 Bacteria 7480
70 Ga0070701_10014899 3300005438 Bacteria 3575
71 Ga0070700_100029645 3300005441 Bacteria 3264
72 Ga0070708_100243191 3300005445 Bacteria 1690
73 Ga0070662_100003322 3300005457 Bacteria 10033
74 Ga0070662_100003973 3300005457 Bacteria 9269
75 Ga0070681_10001782 3300005458 Bacteria 19331
76 Ga0068867_100202484 3300005459 Bacteria 1590
77 Ga0068853_100000210 3300005539 Bacteria 41425
78 Ga0068853_100304903 3300005539 Bacteria 1473
79 Ga0068853_100475370 3300005539 Bacteria 1178
80 Ga0070696_100170801 3300005546 Bacteria 1607
81 Ga0070693_100121690 3300005547 Bacteria 1619
82 Ga0070665_100015950 3300005548 Bacteria 7540
83 Ga0070665_100106199 3300005548 Bacteria 2810
84 Ga0070665_100303402 3300005548 Bacteria 1600
85 Ga0070704_100037856 3300005549 Bacteria 3299
86 Ga0070704_100219684 3300005549 Bacteria 1544
87 Ga0068855_100014676 3300005563 Bacteria 9436
88 Ga0070664_100007381 3300005564 Bacteria 8868
89 Ga0070664_100011338 3300005564 Bacteria 7233
90 Ga0068854_100002209 3300005578 Bacteria 11976
91 Ga0068852_100001905 3300005616 Bacteria 14201
92 Ga0068859_100113150 3300005617 Bacteria 2778
93 Ga0068864_100255152 3300005618 Bacteria 1629
94 Ga0068864_100418448 3300005618 Bacteria 1276
95 Ga0068851_10000004 3300005834 Bacteria 269685
96 Ga0068870_10117614 3300005840 Bacteria 1526
97 Ga0068863_100010515 3300005841 Bacteria 8990
98 Ga0068860_100032694 3300005843 Bacteria 4998
99 Ga0068862_100137182 3300005844 Bacteria 2169
100 Ga0075365_10003065 3300006038 Bacteria 8483
101 Ga0075364_10010083 3300006051 Bacteria 5696
102 Ga0075364_10023585 3300006051 Bacteria 3896
103 Ga0075432_10001130 3300006058 Bacteria 8534
104 Ga0075432_10001732 3300006058 Bacteria 7180
105 Ga0075432_10011064 3300006058 Bacteria 3065
106 Ga0075432_10020977 3300006058 Bacteria 2234
107 Ga0075362_10075464 3300006177 Bacteria 1546
108 Ga0075369_10014439 3300006186 Bacteria 3155
109 Ga0075369_10042950 3300006186 Bacteria 1939
110 Ga0075366_10009881 3300006195 Bacteria 5339
111 Ga0075370_10056625 3300006353 Bacteria 2228
112 Ga0075434_100123079 3300006871 Bacteria 2610
113 Ga0075436_100113931 3300006914 Bacteria 1888
114 Ga0097620_100113148 3300006931 Bacteria 2778
115 Ga0079104_1000059 3300006946 Bacteria 162642
116 Ga0079104_1000638 3300006946 Bacteria 34050
117 Ga0079104_1000654 3300006946 Bacteria 33184
118 Ga0079104_1002562 3300006946 Bacteria 9569
119 Ga0105251_10000234 3300009011 Bacteria 55844
120 Ga0105251_10000382 3300009011 Bacteria 43597
121 Ga0105251_10001125 3300009011 Bacteria 23280
122 Ga0105251_10002054 3300009011 Bacteria 16284
123 Ga0105251_10002764 3300009011 Bacteria 13388
124 Ga0105251_10003159 3300009011 Bacteria 12208
125 Ga0105251_10003211 3300009011 Bacteria 12053
126 Ga0105251_10003431 3300009011 Bacteria 11494
127 Ga0105251_10004126 3300009011 Bacteria 10143
128 Ga0105251_10009375 3300009011 Bacteria 5784
129 Ga0105251_10014752 3300009011 Bacteria 4303
130 Ga0105251_10019039 3300009011 Bacteria 3636
131 Ga0105251_10027643 3300009011 Bacteria 2873
132 Ga0105251_10030370 3300009011 Bacteria 2715
133 Ga0105251_10076430 3300009011 Bacteria 1554
134 Ga0105244_10000133 3300009036 Bacteria 76114
135 Ga0105244_10001762 3300009036 Bacteria 17014
136 Ga0105244_10002167 3300009036 Bacteria 15053
137 Ga0105244_10002241 3300009036 Bacteria 14729
138 Ga0105244_10004326 3300009036 Bacteria 9821
139 Ga0105244_10007567 3300009036 Bacteria 6897
140 Ga0105244_10008580 3300009036 Bacteria 6374
141 Ga0105244_10044122 3300009036 Bacteria 2298
142 Ga0105244_10053818 3300009036 Bacteria 2044
143 Ga0105244_10069739 3300009036 Bacteria 1755
144 Ga0105244_10069843 3300009036 Bacteria 1753
145 Ga0105244_10134819 3300009036 Bacteria 1190
146 Ga0105244_10151729 3300009036 Bacteria 1110
147 Ga0105250_10000012 3300009092 Bacteria 274899
148 Ga0105250_10000423 3300009092 Bacteria 30845
149 Ga0105250_10000998 3300009092 Bacteria 16453
150 Ga0105250_10002533 3300009092 Bacteria 9139
151 Ga0105250_10002789 3300009092 Bacteria 8571
152 Ga0105250_10005320 3300009092 Bacteria 5778
153 Ga0105250_10005591 3300009092 Bacteria 5621
154 Ga0105240_10060469 3300009093 Bacteria 4723
155 Ga0105240_10206981 3300009093 Bacteria 2295
156 Ga0105247_10033382 3300009101 Bacteria 3130
157 Ga0105243_10001058 3300009148 Bacteria 25181
158 Ga0105243_10012296 3300009148 Bacteria 6474
159 Ga0105243_10019081 3300009148 Bacteria 5200
160 Ga0105243_10025896 3300009148 Bacteria 4487
161 Ga0105243_10042061 3300009148 Bacteria 3576
162 Ga0105242_10004878 3300009176 Bacteria 10384
163 Ga0105248_10075602 3300009177 Bacteria 3785
164 Ga0105237_10007904 3300009545 Bacteria 11590
165 Ga0105237_10062200 3300009545 Bacteria 3732
166 Ga0105238_10060609 3300009551 Bacteria 3788
167 Ga0105239_10362815 3300010375 Bacteria 1636
168 Ga0105246_10001990 3300011119 Bacteria 12333
169 Ga0105246_10003929 3300011119 Bacteria 9005
170 Ga0105246_10005406 3300011119 Bacteria 7779
171 Ga0105246_10008920 3300011119 Bacteria 6171
172 Ga0105246_10012531 3300011119 Bacteria 5295
173 Ga0157345_1000037 3300012498 Bacteria 32065
174 Ga0157373_10000185 3300013100 Bacteria 51301
175 Ga0157373_10014952 3300013100 Bacteria 5681
176 Ga0157373_10020174 3300013100 Bacteria 4848
177 Ga0157373_10049869 3300013100 Bacteria 2982
178 Ga0157373_10074594 3300013100 Bacteria 2393
179 Ga0157373_10106827 3300013100 Bacteria 1968
180 Ga0157371_10000489 3300013102 Bacteria 48208
181 Ga0157371_10000839 3300013102 Bacteria 35135
182 Ga0157371_10002513 3300013102 Bacteria 17424
183 Ga0157371_10004811 3300013102 Bacteria 11616
184 Ga0157371_10007341 3300013102 Bacteria 8937
185 Ga0157371_10047507 3300013102 Bacteria 3052
186 Ga0157371_10075888 3300013102 Bacteria 2380
187 Ga0157370_10000388 3300013104 Bacteria 55229
188 Ga0157370_10002299 3300013104 Bacteria 23148
189 Ga0157370_10108139 3300013104 Bacteria 2601
190 Ga0157370_10372650 3300013104 Bacteria 1315
191 Ga0157369_10000184 3300013105 Bacteria 86626
192 Ga0157369_10000904 3300013105 Bacteria 37886
193 Ga0157369_10001610 3300013105 Bacteria 27627
194 Ga0157369_10002373 3300013105 Bacteria 22629
195 Ga0157369_10008368 3300013105 Bacteria 11864
196 Ga0157369_10018752 3300013105 Bacteria 7756
197 Ga0157369_10054958 3300013105 Bacteria 4298
198 Ga0157369_10307531 3300013105 Bacteria 1648
199 Ga0157369_10338878 3300013105 Bacteria 1562
200 Ga0157378_10212251 3300013297 Bacteria 1836
201 Ga0163162_10016283 3300013306 Bacteria 7268
202 Ga0163162_10023835 3300013306 Bacteria 6040
203 Ga0163162_10034257 3300013306 Bacteria 5053
204 Ga0163162_10065492 3300013306 Bacteria 3681
205 Ga0157372_10000947 3300013307 Bacteria 31672
206 Ga0157372_10006103 3300013307 Bacteria 12802
207 Ga0157372_10014317 3300013307 Bacteria 8481
208 Ga0157372_10018013 3300013307 Bacteria 7591
209 Ga0157372_10023417 3300013307 Bacteria 6694
210 Ga0157372_10031002 3300013307 Bacteria 5853
211 Ga0157372_10046612 3300013307 Bacteria 4812
212 Ga0157372_10092373 3300013307 Bacteria 3443
213 Ga0157372_10099561 3300013307 Bacteria 3316
214 Ga0157372_10408475 3300013307 Bacteria 1582
215 Ga0157372_10464345 3300013307 Bacteria 1475
216 Ga0157375_10001804 3300013308 Bacteria 18354
217 Ga0157375_10008927 3300013308 Bacteria 8771
218 Ga0182008_10000659 3300014497 Bacteria 25061
219 Ga0182008_10002039 3300014497 Bacteria 12961
220 Ga0182008_10016896 3300014497 Bacteria 3785
221 Ga0182008_10027479 3300014497 Bacteria 2882
222 Ga0182008_10045926 3300014497 Bacteria 2172
223 Ga0182008_10063521 3300014497 Bacteria 1819
224 Ga0182008_10147453 3300014497 Bacteria 1179
225 Ga0157379_10079473 3300014968 Bacteria 2937
226 Ga0182006_1003547 3300015261 Bacteria 7954
227 Ga0182006_1003616 3300015261 Bacteria 7855
228 Ga0182006_1004404 3300015261 Bacteria 6958
229 Ga0182006_1008803 3300015261 Bacteria 4563
230 Ga0182006_1009409 3300015261 Bacteria 4380
231 Ga0182006_1016247 3300015261 Bacteria 3176
232 Ga0182007_10003862 3300015262 Bacteria 6958
233 Ga0182007_10074231 3300015262 Bacteria 1114
234 Ga0182005_1009339 3300015265 Bacteria 2854
235 Ga0182005_1027290 3300015265 Bacteria 1557
236 Ga0163161_10005035 3300017792 Bacteria 9192
237 Ga0163161_10013791 3300017792 Bacteria 5628
238 Ga0163161_10019911 3300017792 Bacteria 4706
239 Ga0163161_10033284 3300017792 Bacteria 3683
240 Ga0163161_10049299 3300017792 Bacteria 3043
241 Ga0163161_10064469 3300017792 Bacteria 2672
242 Ga0213872_10017516 3300021361 Bacteria 3309
243 Ga0209760_100181 3300025207 Bacteria 33125
244 Ga0209760_100215 3300025207 Bacteria 25872
245 Ga0209784_100028 3300025224 Bacteria 357464
246 Ga0209566_100028 3300025225 Bacteria 357464
247 Ga0209674_100047 3300025226 Bacteria 357464
248 Ga0209147_100031 3300025229 Bacteria 357464
249 Ga0209563_100050 3300025230 Bacteria 357464
250 Ga0207427_100014 3300025231 Bacteria 561361
251 Ga0207427_100016 3300025231 Bacteria 538697
252 Ga0209437_100011 3300025233 Bacteria 818520
253 Ga0209437_100016 3300025233 Bacteria 710118
254 Ga0209437_100188 3300025233 Bacteria 125530
255 Ga0209258_100150 3300025242 Bacteria 161813
256 Ga0207425_1001464 3300025245 Bacteria 9837
257 Ga0209646_1000165 3300025246 Bacteria 88117
258 Ga0209677_100029 3300025253 Bacteria 357464
259 Ga0209233_1000019 3300025261 Bacteria 818520
260 Ga0209233_1000036 3300025261 Bacteria 561361
261 Ga0209233_1011905 3300025261 Bacteria 2545
262 Ga0209565_1000006 3300025263 Bacteria 897294
263 Ga0209673_1000004 3300025273 Bacteria 896155
264 Ga0209130_1000065 3300025284 Bacteria 195251
265 Ga0209675_1000006 3300025291 Bacteria 732267
266 Ga0209675_1002284 3300025291 Bacteria 9970
267 Ga0209676_1000025 3300025292 Bacteria 577569
268 Ga0209676_1000032 3300025292 Bacteria 469558
269 Ga0209676_1000326 3300025292 Bacteria 91787
270 Ga0209676_1001232 3300025292 Bacteria 27033
271 Ga0209676_1001980 3300025292 Bacteria 16312
272 Ga0209676_1005752 3300025292 Bacteria 6354
273 Ga0209025_1009169 3300025294 Bacteria 6951
274 Ga0209564_1000006 3300025295 Bacteria 1100927
275 Ga0209564_1000064 3300025295 Bacteria 316431
276 Ga0209758_1008908 3300025297 Bacteria 6366
277 Ga0209050_1000025 3300025298 Bacteria 528225
278 Ga0209050_1000028 3300025298 Bacteria 477133
279 Ga0209050_1001079 3300025298 Bacteria 33360
280 Ga0209050_1001508 3300025298 Bacteria 24613
281 Ga0209256_1000365 3300025299 Bacteria 72787
282 Ga0207426_1048573 3300025302 Bacteria 1274
283 Ga0209051_1000026 3300025303 Bacteria 413311
284 Ga0209051_1000080 3300025303 Bacteria 199694
285 Ga0209051_1000334 3300025303 Bacteria 70713
286 Ga0209257_1000034 3300025304 Bacteria 662719
287 Ga0207697_10002307 3300025315 Bacteria 9941
288 Ga0207656_10000007 3300025321 Bacteria 289154
289 Ga0207696_1000020 3300025711 Bacteria 434998
290 Ga0207696_1000040 3300025711 Bacteria 318695
291 Ga0207696_1000057 3300025711 Bacteria 249404
292 Ga0207696_1000064 3300025711 Bacteria 238379
293 Ga0207696_1000229 3300025711 Bacteria 79025
294 Ga0207696_1000237 3300025711 Bacteria 76707
295 Ga0207696_1000364 3300025711 Bacteria 45010
296 Ga0207696_1007021 3300025711 Bacteria 4457
297 Ga0207696_1007799 3300025711 Bacteria 4151
298 Ga0207696_1007856 3300025711 Bacteria 4135
299 Ga0207655_1000014 3300025728 Bacteria 607124
300 Ga0207655_1000178 3300025728 Bacteria 113749
301 Ga0207655_1000565 3300025728 Bacteria 45949
302 Ga0207655_1000922 3300025728 Bacteria 30542
303 Ga0207655_1001696 3300025728 Bacteria 19388
304 Ga0207655_1001818 3300025728 Bacteria 18454
305 Ga0207655_1002188 3300025728 Bacteria 16227
306 Ga0207655_1003594 3300025728 Bacteria 11465
307 Ga0207655_1003980 3300025728 Bacteria 10681
308 Ga0207655_1004144 3300025728 Bacteria 10411
309 Ga0207655_1005312 3300025728 Bacteria 8813
310 Ga0207655_1006369 3300025728 Bacteria 7834
311 Ga0207655_1010564 3300025728 Bacteria 5584
312 Ga0207655_1011154 3300025728 Bacteria 5375
313 Ga0207655_1012256 3300025728 Bacteria 5027
314 Ga0207655_1013504 3300025728 Bacteria 4686
315 Ga0207655_1013668 3300025728 Bacteria 4643
316 Ga0207655_1015717 3300025728 Bacteria 4188
317 Ga0207655_1017326 3300025728 Bacteria 3891
318 Ga0207655_1021257 3300025728 Bacteria 3299
319 Ga0207655_1024286 3300025728 Bacteria 2975
320 Ga0207713_1000031 3300025735 Bacteria 283971
321 Ga0207713_1000214 3300025735 Bacteria 78447
322 Ga0207713_1001119 3300025735 Bacteria 22843
323 Ga0207713_1001809 3300025735 Bacteria 16343
324 Ga0207713_1001942 3300025735 Bacteria 15635
325 Ga0207713_1002040 3300025735 Bacteria 15118
326 Ga0207713_1003061 3300025735 Bacteria 11628
327 Ga0207713_1003833 3300025735 Bacteria 10057
328 Ga0207713_1005577 3300025735 Bacteria 7836
329 Ga0207713_1008147 3300025735 Bacteria 6074
330 Ga0207713_1010113 3300025735 Bacteria 5248
331 Ga0207713_1012460 3300025735 Bacteria 4542
332 Ga0207713_1012859 3300025735 Bacteria 4445
333 Ga0207713_1032120 3300025735 Bacteria 2310
334 Ga0207713_1044489 3300025735 Bacteria 1823
335 Ga0207713_1057203 3300025735 Bacteria 1508
336 Ga0207713_1080833 3300025735 Bacteria 1170
337 Ga0207682_10002219 3300025893 Bacteria 8762
338 Ga0207710_10066201 3300025900 Bacteria 1648
339 Ga0207688_10003663 3300025901 Bacteria 8392
340 Ga0207645_10002351 3300025907 Bacteria 14920
341 Ga0207643_10003373 3300025908 Bacteria 8605
342 Ga0207707_10032892 3300025912 Bacteria 4539
343 Ga0207695_10168322 3300025913 Bacteria 2118
344 Ga0207695_10216939 3300025913 Bacteria 1822
345 Ga0207671_10000015 3300025914 Bacteria 439607
346 Ga0207649_10000001 3300025920 Bacteria 537851
347 Ga0207646_10038514 3300025922 Bacteria 4306
348 Ga0207681_10000480 3300025923 Bacteria 27941
349 Ga0207681_10007538 3300025923 Bacteria 6668
350 Ga0207694_10299831 3300025924 Bacteria 1323
351 Ga0207650_10000868 3300025925 Bacteria 22902
352 Ga0207650_10001058 3300025925 Bacteria 20465
353 Ga0207650_10290855 3300025925 Bacteria 1332
354 Ga0207644_10045469 3300025931 Bacteria 3123
355 Ga0207706_10000624 3300025933 Bacteria 37622
356 Ga0207706_10001654 3300025933 Bacteria 22047
357 Ga0207706_10006689 3300025933 Bacteria 10660
358 Ga0207706_10028059 3300025933 Bacteria 5029
359 Ga0207686_10001543 3300025934 Bacteria 12987
360 Ga0207709_10000022 3300025935 Bacteria 383573
361 Ga0207709_10000578 3300025935 Bacteria 30734
362 Ga0207709_10000971 3300025935 Bacteria 21405
363 Ga0207709_10006325 3300025935 Bacteria 6648
364 Ga0207709_10019161 3300025935 Bacteria 3843
365 Ga0207709_10042529 3300025935 Bacteria 2734
366 Ga0207670_10153665 3300025936 Bacteria 1710
367 Ga0207711_10085114 3300025941 Bacteria 2769
368 Ga0207689_10002241 3300025942 Bacteria 18109
369 Ga0207689_10012499 3300025942 Bacteria 7253
370 Ga0207679_10000011 3300025945 Bacteria 346112
371 Ga0207679_10023183 3300025945 Bacteria 4240
372 Ga0207668_10023520 3300025972 Bacteria 3962
373 Ga0207640_10010884 3300025981 Bacteria 5132
374 Ga0207640_10026265 3300025981 Bacteria 3533
375 Ga0207658_10215061 3300025986 Bacteria 1613
376 Ga0207648_10022390 3300026089 Bacteria 5676
377 Ga0207676_10075039 3300026095 Bacteria 2726
378 Ga0207674_10014799 3300026116 Bacteria 8604
379 Ga0207675_100003679 3300026118 Bacteria 14945
380 Ga0207683_10019040 3300026121 Bacteria 5860
381 Ga0209281_1000026 3300027111 Bacteria 465877
382 Ga0209281_1000033 3300027111 Bacteria 383539
383 Ga0209389_1000095 3300027296 Bacteria 80518
384 Ga0209371_1000029 3300027312 Bacteria 424797
385 Ga0209371_1000154 3300027312 Bacteria 108161
386 Ga0209371_1000217 3300027312 Bacteria 77949
387 Ga0209371_1000238 3300027312 Bacteria 69012
388 Ga0209371_1000263 3300027312 Bacteria 62259
389 Ga0209371_1000380 3300027312 Bacteria 47577
390 Ga0209371_1000974 3300027312 Bacteria 22150
391 Ga0209371_1001489 3300027312 Bacteria 15604
392 Ga0209981_1003651 3300027378 Bacteria 1999
393 Ga0209968_1006407 3300027526 Bacteria 1772
394 Ga0209982_1002108 3300027552 Bacteria 2764
395 Ga0209983_1007848 3300027665 Bacteria 2184
396 Ga0209971_1033319 3300027682 Bacteria 1238
397 Ga0207428_10016444 3300027907 Bacteria 6364
398 Ga0207428_10033095 3300027907 Bacteria 4248
399 Ga0207428_10033756 3300027907 Bacteria 4198
400 Ga0268266_10012441 3300028379 Bacteria 7356
401 Ga0268266_10198194 3300028379 Bacteria 1836
402 Ga0268265_10172449 3300028380 Bacteria 1850
403 Ga0307515_10272168 3300028794 Bacteria 1413
404 Ga0268256_1000173 3300030500 Bacteria 77949
405 Ga0268256_1000198 3300030500 Bacteria 68968
406 Ga0268256_1000252 3300030500 Bacteria 56701
407 Ga0268256_1000428 3300030500 Bacteria 37773
408 Ga0268256_1000467 3300030500 Bacteria 35131
409 Ga0268256_1000825 3300030500 Bacteria 22150
410 Ga0268256_1000899 3300030500 Bacteria 20493
411 Ga0307511_10000164 3300030521 Bacteria 64605
412 Ga0307511_10051523 3300030521 Bacteria 3298
413 Ga0307511_10111468 3300030521 Bacteria 1739
414 Ga0316177_1019129 3300030731 Bacteria 3673
415 Ga0316177_1021354 3300030731 Bacteria 2427
416 Ga0316178_1078135 3300030735 Bacteria 17093
417 Ga0316180_1053175 3300030736 Bacteria 3511
418 Ga0316183_1189911 3300030742 Bacteria 2360
419 Ga0316181_1110847 3300030744 Bacteria 2277
420 Ga0316182_1125834 3300030745 Bacteria 4111
421 Ga0265325_10025196 3300031241 Bacteria 3231
422 Ga0265331_10060977 3300031250 Bacteria 1781
423 Ga0265327_10000295 3300031251 Bacteria 96706
424 Ga0265327_10000596 3300031251 Bacteria 60242
425 Ga0265327_10001761 3300031251 Bacteria 25608
426 Ga0265327_10012657 3300031251 Bacteria 5672
427 Ga0265327_10016338 3300031251 Bacteria 4718
428 Ga0265327_10026921 3300031251 Bacteria 3321
429 Ga0265316_10062654 3300031344 Bacteria 2886
430 Ga0307509_10144094 3300031507 Bacteria 2311
431 Ga0307408_100000002 3300031548 Bacteria 827227
432 Ga0307408_100009618 3300031548 Bacteria 6376
433 Ga0307408_100028041 3300031548 Bacteria 3887
434 Ga0307408_100034742 3300031548 Bacteria 3533
435 Ga0307408_100135172 3300031548 Bacteria 1928
436 Ga0316575_10015788 3300031665 Bacteria 2850
437 Ga0316576_10133941 3300031727 Bacteria 1865
438 Ga0307516_10064967 3300031730 Bacteria 3526
439 Ga0307516_10179758 3300031730 Unclassified 1850
440 Ga0307413_10016707 3300031824 Bacteria 3800
441 Ga0307413_10096802 3300031824 Bacteria 1938
442 Ga0307413_10097219 3300031824 Bacteria 1935
443 Ga0307406_10009702 3300031901 Bacteria 5411
444 Ga0307407_10150306 3300031903 Bacteria 1512
445 Ga0307412_10008578 3300031911 Bacteria 5841
446 Ga0307412_10043006 3300031911 Bacteria 2939
447 Ga0307412_10057077 3300031911 Bacteria 2604
448 Ga0307412_10066900 3300031911 Bacteria 2437
449 Ga0307414_10025242 3300032004 Bacteria 3803
450 Ga0307414_10044524 3300032004 Bacteria 3032
451 Ga0307411_10262024 3300032005 Bacteria 1366
452 Ga0307507_10039851 3300033179 Bacteria 4732
453 Ga0307510_10003578 3300033180 Bacteria 18148
454 Ga0373927_0025120 3300035695 Bacteria 3895
455 Ga0373937_0229089 3300036401 Bacteria 1750
456 Ga0316584_0034968 3300036712 Bacteria 3726
457 Ga0395899_0000141 3300037312 Bacteria 109773
458 Ga0237819_01318 3300038705 Bacteria 6640
459 Ga0400484_10432 3300038725 Bacteria 2867
460 Ga0400490_18098 3300038726 Bacteria 2234
461 Ga0400490_57155 3300038726 Bacteria 7313
462 Ga0400488_41548 3300038741 Bacteria 1256
463 Ga0400488_58081 3300038741 Bacteria 2391
464 Ga0400483_006042 3300039062 Bacteria 2897
465 Ga0400483_097611 3300039062 Bacteria 1616
466 Ga0400483_146382 3300039062 Bacteria 1941
467 Ga0400483_157778 3300039062 Bacteria 1720
468 Ga0400483_169174 3300039062 Bacteria 2416
469 Ga0400483_197009 3300039062 Bacteria 1851
470 Ga0400483_262975 3300039062 Bacteria 1789
471 Ga0400489_04156 3300039093 Bacteria 1382
472 Ga0400487_61984 3300039110 Bacteria 36791
473 Ga0436361_0752100 3300039447 Bacteria 25229
474 Ga0439436_0000131 3300041404 Bacteria 17079
475 Ga0439438_000621 3300041405 Bacteria 15979
476 Ga0439438_001072 3300041405 Bacteria 12221
477 Ga0439438_001956 3300041405 Bacteria 8999
478 Ga0439438_004256 3300041405 Bacteria 5550
479 Ga0439438_009079 3300041405 Bacteria 3242
480 Ga0439438_012486 3300041405 Bacteria 2603
481 Ga0439438_014007 3300041405 Bacteria 2397
482 Ga0439447_000763 3300041407 Bacteria 11929
483 Ga0439447_003290 3300041407 Bacteria 5748
484 Ga0439447_003365 3300041407 Bacteria 5686
485 Ga0439447_003530 3300041407 Bacteria 5548
486 Ga0439447_004430 3300041407 Bacteria 4830
487 Ga0439466_0000015 3300041411 Bacteria 114576
488 Ga0439466_0001219 3300041411 Bacteria 10013
489 Ga0439466_0001604 3300041411 Bacteria 8821
490 Ga0439466_0002254 3300041411 Bacteria 7557
491 Ga0439466_0006665 3300041411 Bacteria 4383
492 Ga0439466_0013355 3300041411 Bacteria 3007
493 Ga0439431_0005050 3300041997 Bacteria 2909
494 Ga0439431_0010457 3300041997 Bacteria 2106
495 Ga0439432_000649 3300042006 Bacteria 13007
496 Ga0439432_000657 3300042006 Bacteria 12954
497 Ga0439432_001927 3300042006 Bacteria 7839
498 Ga0439432_002690 3300042006 Bacteria 6654
499 Ga0439432_004987 3300042006 Bacteria 4804
500 Ga0439432_011302 3300042006 Bacteria 3078
501 Ga0439432_044885 3300042006 Bacteria 1391
502 Ga0439451_001273 3300042009 Bacteria 4976
503 Ga0439452_000050 3300042010 Bacteria 121019
504 Ga0439452_000992 3300042010 Bacteria 12691
505 Ga0439452_002987 3300042010 Bacteria 6010
506 Ga0439452_003025 3300042010 Bacteria 5980
507 Ga0439452_004088 3300042010 Bacteria 4962
508 Ga0439452_004161 3300042010 Bacteria 4909
509 Ga0439452_021262 3300042010 Bacteria 1693
510 Ga0439456_000329 3300042013 Bacteria 10749
511 Ga0439456_007851 3300042013 Bacteria 2196
512 Ga0439456_027872 3300042013 Bacteria 1204
513 Ga0439463_000057 3300042016 Bacteria 23866
514 Ga0439463_001831 3300042016 Bacteria 5519
515 Ga0439463_002391 3300042016 Bacteria 4781
516 Ga0439463_005866 3300042016 Bacteria 3049
517 Ga0450911_000012 3300042115 Bacteria 129546
518 Ga0450911_001365 3300042115 Bacteria 5726
519 Ga0450920_000648 3300042122 Bacteria 5535
520 Ga0450922_001330 3300042124 Bacteria 2439
521 Ga0450923_002136 3300042125 Bacteria 2777
522 Ga0450890_000220 3300042127 Bacteria 8570
523 Ga0450902_002922 3300042137 Bacteria 2460
524 Ga0450903_000913 3300042138 Bacteria 5669
525 Ga0450903_003513 3300042138 Bacteria 2709
526 Ga0450903_004340 3300042138 Bacteria 2424
527 Ga0450904_000331 3300042139 Bacteria 9989
528 Ga0450904_003232 3300042139 Bacteria 1790
529 Ga0450905_000840 3300042142 Bacteria 3823
530 Ga0450905_009907 3300042142 Bacteria 1314
531 Ga0450906_004745 3300042145 Bacteria 2830
532 Ga0450907_000033 3300042146 Bacteria 63179
533 Ga0450907_000627 3300042146 Bacteria 9351
534 Ga0450907_000768 3300042146 Bacteria 8074
535 Ga0450907_001477 3300042146 Bacteria 5064
536 Ga0439446_0000393 3300042156 Bacteria 8465
537 Ga0439446_0002527 3300042156 Bacteria 4401
538 Ga0439446_0013723 3300042156 Bacteria 2228
539 Ga0450909_000503 3300042185 Bacteria 5106
540 Ga0439434_0001949 3300042435 Bacteria 5970
541 Ga0439434_0003864 3300042435 Bacteria 4377
542 Ga0439435_0030403 3300042436 Bacteria 1464
543 Ga0439464_0000082 3300042439 Bacteria 13705
544 Ga0439464_0005345 3300042439 Bacteria 3316
545 Ga0439464_0007003 3300042439 Bacteria 2945
546 Ga0439464_0008678 3300042439 Bacteria 2664
547 Ga0439460_0002525 3300042461 Bacteria 4418
548 Ga0439460_0004133 3300042461 Bacteria 3529
549 Ga0439460_0005262 3300042461 Bacteria 3170
550 Ga0450916_001163 3300042530 Bacteria 2586
551 Ga0451577_0009523 3300042876 Bacteria 9348
552 Ga0451577_0016674 3300042876 Bacteria 6794
553 Ga0451577_0037145 3300042876 Bacteria 4385
554 Ga0451577_0037150 3300042876 Bacteria 4385
555 Ga0451577_0166491 3300042876 Bacteria 1986
556 Ga0451577_0409305 3300042876 Bacteria 1231
557 Ga0439440_0005495 3300042993 Bacteria 2519
558 Ga0453683_0013014 3300044673 Bacteria 5439
559 Ga0453684_0001452 3300044712 Bacteria 67372
560 Ga0453684_0003292 3300044712 Bacteria 36816
561 Ga0453684_0009242 3300044712 Bacteria 17313
562 Ga0453684_0010860 3300044712 Bacteria 15430
563 Ga0453684_0058382 3300044712 Bacteria 4984
564 Ga0453684_0145089 3300044712 Bacteria 2829
565 Ga0453684_0355220 3300044712 Bacteria 1651
566 Ga0451576_0001019 3300045051 Bacteria 51865
567 Ga0451576_0001188 3300045051 Bacteria 46552
568 Ga0451576_0002786 3300045051 Bacteria 25232
569 Ga0451576_0016196 3300045051 Bacteria 8236
570 Ga0451576_0036754 3300045051 Bacteria 5190
571 Ga0451576_0056353 3300045051 Bacteria 4110
572 Ga0451576_0056742 3300045051 Bacteria 4094
573 Ga0451576_0072821 3300045051 Bacteria 3575
574 Ga0451576_0093842 3300045051 Bacteria 3120
575 Ga0495617_001444 3300046452 Bacteria 10436
576 Ga0495617_002703 3300046452 Bacteria 6877
577 Ga0495617_004110 3300046452 Bacteria 5337
578 Ga0495617_011992 3300046452 Bacteria 2956
579 Ga0495617_025525 3300046452 Bacteria 1991
580 Ga0495617_027405 3300046452 Bacteria 1917
581 Ga0495617_028626 3300046452 Bacteria 1872
582 Ga0495617_032981 3300046452 Bacteria 1739
583 Ga0495617_043503 3300046452 Bacteria 1499
584 Ga0495627_000529 3300046453 Bacteria 31618
585 Ga0495627_000662 3300046453 Bacteria 26550
586 Ga0495627_000811 3300046453 Bacteria 22857
587 Ga0495627_003516 3300046453 Bacteria 6866
588 Ga0495627_007045 3300046453 Bacteria 4356
589 Ga0495627_007204 3300046453 Bacteria 4290
590 Ga0495603_0047656 3300046455 Bacteria 2551
591 Ga0495590_0001425 3300046457 Bacteria 10330
592 Ga0495590_0002060 3300046457 Bacteria 8435
593 Ga0495590_0005466 3300046457 Bacteria 5037
594 Ga0495590_0023022 3300046457 Bacteria 2201
595 Ga0495590_0054257 3300046457 Bacteria 1400
596 Ga0495591_000067 3300046458 Bacteria 117988
597 Ga0495591_000692 3300046458 Bacteria 24631
598 Ga0495591_002059 3300046458 Bacteria 11640
599 Ga0495591_004466 3300046458 Bacteria 6847
600 Ga0495591_005222 3300046458 Bacteria 6079
601 Ga0495591_005356 3300046458 Bacteria 5961
602 Ga0495591_006073 3300046458 Bacteria 5429
603 Ga0495591_011302 3300046458 Bacteria 3389
604 Ga0495591_017834 3300046458 Bacteria 2424
605 Ga0495591_021518 3300046458 Bacteria 2101
606 Ga0495591_023084 3300046458 Bacteria 2000
607 Ga0495591_036932 3300046458 Bacteria 1418
608 Ga0495591_043397 3300046458 Bacteria 1265
609 Ga0495629_0019909 3300046459 Bacteria 4789
610 Ga0495629_0062007 3300046459 Bacteria 2613
611 Ga0495638_0001662 3300046460 Bacteria 19666
612 Ga0495638_0006393 3300046460 Bacteria 8578
613 Ga0495638_0010178 3300046460 Bacteria 6548
614 Ga0495638_0015540 3300046460 Bacteria 5111
615 Ga0495638_0034196 3300046460 Bacteria 3246
616 Ga0495638_0047796 3300046460 Bacteria 2681
617 Ga0495653_0015624 3300046463 Bacteria 6188
618 Ga0495653_0017528 3300046463 Bacteria 5823
619 Ga0495650_0007116 3300046471 Bacteria 6797
620 Ga0495650_0007745 3300046471 Bacteria 6394
621 Ga0495650_0014187 3300046471 Bacteria 4162
622 Ga0495650_0020905 3300046471 Bacteria 3179
623 Ga0495650_0034337 3300046471 Bacteria 2246
624 Ga0495650_0059124 3300046471 Bacteria 1544
625 Ga0495650_0075593 3300046471 Bacteria 1310
626 Ga0495650_0087797 3300046471 Bacteria 1188
627 Ga0495582_0008697 3300046473 Bacteria 5598
628 Ga0495605_0000062 3300046474 Bacteria 143176
629 Ga0495605_0000646 3300046474 Bacteria 26667
630 Ga0495605_0001077 3300046474 Bacteria 18170
631 Ga0495605_0001339 3300046474 Bacteria 16304
632 Ga0495605_0001375 3300046474 Bacteria 15999
633 Ga0495605_0008266 3300046474 Bacteria 5885
634 Ga0495605_0021556 3300046474 Bacteria 3411
635 Ga0495605_0022366 3300046474 Bacteria 3340
636 Ga0495605_0025019 3300046474 Bacteria 3115
637 Ga0495605_0061667 3300046474 Bacteria 1793
638 Ga0495639_0001422 3300046475 Bacteria 10699
639 Ga0495584_0002039 3300046491 Bacteria 11608
640 Ga0495584_0002652 3300046491 Bacteria 10067
641 Ga0495584_0002719 3300046491 Bacteria 9917
642 Ga0495584_0005198 3300046491 Bacteria 6909
643 Ga0495584_0005232 3300046491 Bacteria 6881
644 Ga0495584_0015118 3300046491 Bacteria 3933
645 Ga0495584_0027740 3300046491 Bacteria 2869
646 Ga0495584_0034216 3300046491 Bacteria 2571
647 Ga0495584_0034587 3300046491 Bacteria 2555
648 Ga0495584_0047460 3300046491 Bacteria 2165
649 Ga0495584_0082895 3300046491 Bacteria 1614
650 Ga0495585_0002838 3300046492 Bacteria 12065
651 Ga0495585_0009515 3300046492 Bacteria 5822
652 Ga0495585_0012233 3300046492 Bacteria 5056
653 Ga0495585_0012938 3300046492 Bacteria 4903
654 Ga0495585_0013874 3300046492 Bacteria 4708
655 Ga0495585_0015956 3300046492 Bacteria 4356
656 Ga0495585_0026159 3300046492 Bacteria 3334
657 Ga0495585_0033012 3300046492 Bacteria 2932
658 Ga0495594_0014149 3300046499 Bacteria 4177
659 Ga0495594_0078005 3300046499 Bacteria 1848
660 Ga0495596_0003856 3300046500 Bacteria 7446
661 Ga0495596_0008288 3300046500 Bacteria 4632
662 Ga0495596_0048218 3300046500 Bacteria 1670
663 Ga0495607_0000535 3300046501 Bacteria 37269
664 Ga0495607_0001879 3300046501 Bacteria 17817
665 Ga0495607_0002217 3300046501 Bacteria 16098
666 Ga0495607_0003678 3300046501 Bacteria 11635
667 Ga0495607_0005538 3300046501 Bacteria 9009
668 Ga0495607_0007499 3300046501 Bacteria 7538
669 Ga0495607_0008397 3300046501 Bacteria 7061
670 Ga0495607_0009044 3300046501 Bacteria 6774
671 Ga0495607_0011846 3300046501 Bacteria 5780
672 Ga0495607_0013924 3300046501 Bacteria 5252
673 Ga0495607_0029106 3300046501 Bacteria 3402
674 Ga0495607_0044418 3300046501 Bacteria 2620
675 Ga0495607_0085165 3300046501 Bacteria 1727
676 Ga0495583_0000015 3300046506 Bacteria 316392
677 Ga0495583_0000437 3300046506 Bacteria 62701
678 Ga0495583_0000821 3300046506 Bacteria 38030
679 Ga0495583_0001665 3300046506 Bacteria 21527
680 Ga0495583_0001917 3300046506 Bacteria 19233
681 Ga0495583_0002771 3300046506 Bacteria 14454
682 Ga0495583_0006370 3300046506 Bacteria 7736
683 Ga0495583_0007496 3300046506 Bacteria 6833
684 Ga0495583_0026835 3300046506 Bacteria 2849
685 Ga0495583_0031423 3300046506 Bacteria 2574
686 Ga0495583_0049841 3300046506 Bacteria 1915
687 Ga0495606_0000214 3300046507 Bacteria 103149
688 Ga0495606_0000352 3300046507 Bacteria 78743
689 Ga0495606_0000892 3300046507 Bacteria 44530
690 Ga0495606_0004861 3300046507 Bacteria 13172
691 Ga0495606_0010283 3300046507 Bacteria 7788
692 Ga0495606_0015322 3300046507 Bacteria 5914
693 Ga0495606_0016259 3300046507 Bacteria 5681
694 Ga0495606_0016825 3300046507 Bacteria 5556
695 Ga0495606_0023314 3300046507 Bacteria 4488
696 Ga0495606_0056751 3300046507 Bacteria 2525
697 Ga0495610_0011015 3300046512 Bacteria 5564
698 Ga0495610_0022749 3300046512 Bacteria 3421
699 Ga0495610_0031606 3300046512 Bacteria 2760
700 Ga0495610_0043963 3300046512 Bacteria 2221
701 Ga0495610_0048111 3300046512 Bacteria 2094
702 Ga0495610_0114325 3300046512 Bacteria 1191
703 Ga0495616_0005056 3300046513 Bacteria 8205
704 Ga0495616_0009212 3300046513 Bacteria 5789
705 Ga0495616_0010936 3300046513 Bacteria 5225
706 Ga0495616_0012671 3300046513 Bacteria 4776
707 Ga0495616_0014779 3300046513 Bacteria 4359
708 Ga0495616_0025945 3300046513 Bacteria 3124
709 Ga0495616_0089734 3300046513 Bacteria 1457
710 Ga0495620_0000033 3300046515 Bacteria 118157
711 Ga0495620_0000050 3300046515 Bacteria 105651
712 Ga0495620_0001299 3300046515 Bacteria 15205
713 Ga0495620_0001883 3300046515 Bacteria 12333
714 Ga0495620_0004967 3300046515 Bacteria 7453
715 Ga0495620_0023181 3300046515 Bacteria 2974
716 Ga0495620_0031026 3300046515 Bacteria 2452
717 Ga0495620_0075995 3300046515 Bacteria 1366
718 Ga0495631_0001124 3300046518 Bacteria 16576
719 Ga0495631_0002205 3300046518 Bacteria 11203
720 Ga0495631_0006680 3300046518 Bacteria 5930
721 Ga0495631_0009569 3300046518 Bacteria 4836
722 Ga0495631_0010499 3300046518 Bacteria 4579
723 Ga0495631_0034746 3300046518 Bacteria 2258
724 Ga0495632_0005948 3300046519 Bacteria 7949
725 Ga0495632_0007571 3300046519 Bacteria 6799
726 Ga0495632_0009381 3300046519 Bacteria 5905
727 Ga0495632_0009519 3300046519 Bacteria 5849
728 Ga0495632_0009791 3300046519 Bacteria 5739
729 Ga0495632_0028616 3300046519 Bacteria 2907
730 Ga0495632_0043489 3300046519 Bacteria 2244
731 Ga0495632_0063062 3300046519 Bacteria 1795
732 Ga0495632_0065967 3300046519 Bacteria 1747
733 Ga0495632_0086625 3300046519 Bacteria 1489
734 Ga0495637_0000020 3300046520 Bacteria 181611
735 Ga0495637_0001280 3300046520 Bacteria 15160
736 Ga0495637_0001968 3300046520 Bacteria 11609
737 Ga0495637_0002004 3300046520 Bacteria 11488
738 Ga0495637_0006757 3300046520 Bacteria 5739
739 Ga0495637_0010653 3300046520 Bacteria 4439
740 Ga0495637_0011044 3300046520 Bacteria 4349
741 Ga0495637_0015762 3300046520 Bacteria 3541
742 Ga0495637_0023979 3300046520 Bacteria 2762
743 Ga0495637_0039117 3300046520 Bacteria 2049
744 Ga0495637_0061987 3300046520 Bacteria 1531
745 Ga0495643_0000320 3300046522 Bacteria 66010
746 Ga0495643_0001218 3300046522 Bacteria 24887
747 Ga0495643_0001318 3300046522 Bacteria 23490
748 Ga0495643_0002020 3300046522 Bacteria 16923
749 Ga0495643_0016340 3300046522 Bacteria 4359
750 Ga0495643_0020842 3300046522 Bacteria 3771
751 Ga0495643_0065242 3300046522 Bacteria 1922
752 Ga0495643_0124807 3300046522 Bacteria 1297
753 Ga0495643_0157628 3300046522 Bacteria 1119
754 Ga0495644_0001177 3300046523 Bacteria 10727
755 Ga0495644_0001379 3300046523 Bacteria 9926
756 Ga0495644_0003842 3300046523 Bacteria 5912
757 Ga0495644_0007880 3300046523 Bacteria 4102
758 Ga0495644_0013095 3300046523 Bacteria 3187
759 Ga0495648_0000680 3300046524 Bacteria 36300
760 Ga0495648_0001594 3300046524 Bacteria 22104
761 Ga0495648_0003112 3300046524 Bacteria 14798
762 Ga0495648_0005817 3300046524 Bacteria 10157
763 Ga0495648_0013129 3300046524 Bacteria 6141
764 Ga0495648_0015038 3300046524 Bacteria 5635
765 Ga0495648_0031170 3300046524 Bacteria 3514
766 Ga0495648_0032899 3300046524 Bacteria 3394
767 Ga0495648_0045049 3300046524 Bacteria 2747
768 Ga0495648_0050273 3300046524 Bacteria 2548
769 Ga0495648_0072444 3300046524 Bacteria 1993
770 Ga0495648_0104973 3300046524 Bacteria 1550
771 Ga0495663_0017191 3300046525 Bacteria 2050
772 Ga0495666_0008728 3300046526 Bacteria 5076
773 Ga0495666_0010084 3300046526 Bacteria 4712
774 Ga0495642_0001037 3300046528 Bacteria 12902
775 Ga0495642_0003526 3300046528 Bacteria 6166
776 Ga0495642_0020919 3300046528 Bacteria 2572
777 Ga0495642_0023176 3300046528 Bacteria 2450
778 Ga0495642_0095925 3300046528 Bacteria 1259
779 Ga0495654_0000064 3300046530 Bacteria 127799
780 Ga0495654_0001141 3300046530 Bacteria 19059
781 Ga0495654_0001487 3300046530 Bacteria 16035
782 Ga0495654_0003927 3300046530 Bacteria 8978
783 Ga0495654_0005161 3300046530 Bacteria 7619
784 Ga0495654_0005820 3300046530 Bacteria 7103
785 Ga0495654_0008569 3300046530 Bacteria 5637
786 Ga0495654_0013529 3300046530 Bacteria 4365
787 Ga0495654_0029406 3300046530 Bacteria 2802
788 Ga0495654_0034179 3300046530 Bacteria 2567
789 Ga0495654_0041770 3300046530 Bacteria 2279
790 Ga0495654_0051032 3300046530 Bacteria 2019
791 Ga0495654_0118054 3300046530 Bacteria 1203
792 Ga0495586_0007783 3300046535 Bacteria 5713
793 Ga0495587_0028138 3300046536 Bacteria 3420
794 Ga0495609_0000143 3300046538 Bacteria 74412
795 Ga0495609_0000372 3300046538 Bacteria 38530
796 Ga0495609_0000425 3300046538 Bacteria 35226
797 Ga0495609_0000461 3300046538 Bacteria 33185
798 Ga0495609_0002211 3300046538 Bacteria 12184
799 Ga0495609_0006713 3300046538 Bacteria 5835
800 Ga0495609_0029798 3300046538 Bacteria 2483
801 Ga0495609_0090785 3300046538 Bacteria 1328
802 Ga0495597_0001312 3300046542 Bacteria 18248
803 Ga0495597_0007155 3300046542 Bacteria 5697
804 Ga0495597_0009711 3300046542 Bacteria 4740
805 Ga0495597_0016104 3300046542 Bacteria 3534
806 Ga0495597_0023291 3300046542 Bacteria 2865
807 Ga0495597_0047648 3300046542 Bacteria 1897
808 Ga0495622_0003131 3300046557 Bacteria 7835
809 Ga0495622_0003486 3300046557 Bacteria 7411
810 Ga0495622_0003697 3300046557 Bacteria 7161
811 Ga0495622_0025516 3300046557 Bacteria 2760
812 Ga0495633_0000084 3300046558 Bacteria 124972
813 Ga0495633_0005836 3300046558 Bacteria 7415
814 Ga0495633_0008307 3300046558 Bacteria 5865
815 Ga0495633_0013790 3300046558 Bacteria 4245
816 Ga0495633_0025737 3300046558 Bacteria 2895
817 Ga0495633_0026655 3300046558 Bacteria 2834
818 Ga0495656_0002718 3300046615 Bacteria 5907
819 Ga0495656_0116758 3300046615 Bacteria 1255
820 Ga0495668_0000158 3300046616 Bacteria 103075
821 Ga0495668_0008501 3300046616 Bacteria 6397
822 Ga0495668_0020927 3300046616 Bacteria 3757
823 Ga0495668_0034303 3300046616 Bacteria 2848
824 Ga0495668_0046035 3300046616 Bacteria 2424
825 Ga0495668_0052916 3300046616 Bacteria 2246
826 Ga0495634_0025576 3300046642 Bacteria 4127
827 Ga0495611_0000910 3300046648 Bacteria 16008
828 Ga0495611_0002011 3300046648 Bacteria 9617
829 Ga0495611_0003785 3300046648 Bacteria 6603
830 Ga0495611_0004851 3300046648 Bacteria 5779
831 Ga0495625_0000133 3300046660 Bacteria 115381
832 Ga0495625_0004179 3300046660 Bacteria 13758
833 Ga0495625_0005141 3300046660 Bacteria 12076
834 Ga0495625_0033171 3300046660 Bacteria 3821
835 Ga0495625_0039024 3300046660 Bacteria 3470
836 Ga0495625_0068636 3300046660 Bacteria 2491
837 Ga0495625_0084031 3300046660 Bacteria 2211
838 Ga0495635_0003150 3300046663 Bacteria 11355
839 Ga0495635_0020517 3300046663 Bacteria 4603
840 Ga0495659_0000761 3300046664 Bacteria 11573
841 Ga0495659_0000898 3300046664 Bacteria 10597
842 Ga0495659_0156989 3300046664 Bacteria 916
843 Ga0495661_0000027 3300046665 Bacteria 184297
844 Ga0495661_0000065 3300046665 Bacteria 129298
845 Ga0495661_0000370 3300046665 Bacteria 48701
846 Ga0495661_0000542 3300046665 Bacteria 39039
847 Ga0495661_0002713 3300046665 Bacteria 13493
848 Ga0495661_0013885 3300046665 Bacteria 5403
849 Ga0495661_0021626 3300046665 Bacteria 4190
850 Ga0495661_0042821 3300046665 Bacteria 2788
851 Ga0495661_0057874 3300046665 Bacteria 2312
852 Ga0495588_0005887 3300046674 Bacteria 5494
853 Ga0495623_0113346 3300046679 Bacteria 1640
854 Ga0495646_0024969 3300046680 Bacteria 3760
855 Ga0495646_0029258 3300046680 Bacteria 3444
856 Ga0495646_0088129 3300046680 Bacteria 1797
857 Ga0495669_0005394 3300046684 Bacteria 5332
858 Ga0495613_0239131 3300046689 Bacteria 1270
859 Ga0495613_0265691 3300046689 Bacteria 1194
860 Ga0495624_0010987 3300046690 Bacteria 6235
861 Ga0495670_0006616 3300046691 Bacteria 5699
862 Ga0495670_0018417 3300046691 Bacteria 3437
863 Ga0495671_0001993 3300046692 Bacteria 13125
864 Ga0495671_0003627 3300046692 Bacteria 9406
865 Ga0495671_0006339 3300046692 Bacteria 6840
866 Ga0495671_0008302 3300046692 Bacteria 5848
867 Ga0495671_0010036 3300046692 Bacteria 5266
868 Ga0495671_0011636 3300046692 Bacteria 4829
869 Ga0495671_0013883 3300046692 Bacteria 4345
870 Ga0495671_0022710 3300046692 Bacteria 3284
871 Ga0495671_0028826 3300046692 Bacteria 2855
872 Ga0495671_0037978 3300046692 Bacteria 2434
873 Ga0495671_0086428 3300046692 Bacteria 1536
874 Ga0495649_0001797 3300046694 Bacteria 15774
875 Ga0495649_0005095 3300046694 Bacteria 8437
876 Ga0495649_0006735 3300046694 Bacteria 7119
877 Ga0495649_0007572 3300046694 Bacteria 6606
878 Ga0495649_0008280 3300046694 Bacteria 6264
879 Ga0495649_0015022 3300046694 Bacteria 4419
880 Ga0495649_0021138 3300046694 Bacteria 3648
881 Ga0495649_0028112 3300046694 Bacteria 3116
882 Ga0495649_0049769 3300046694 Bacteria 2275
883 Ga0495649_0053183 3300046694 Bacteria 2192
884 Ga0495649_0154499 3300046694 Bacteria 1204
885 Ga0495589_0000779 3300046794 Bacteria 20247
886 Ga0495589_0001384 3300046794 Bacteria 14107
887 Ga0495589_0012119 3300046794 Bacteria 4470
888 Ga0495589_0028800 3300046794 Bacteria 2801
889 Ga0495660_0000797 3300046810 Bacteria 23640
890 Ga0495660_0002243 3300046810 Bacteria 12441
891 Ga0495660_0002803 3300046810 Bacteria 10979
892 Ga0495660_0012424 3300046810 Bacteria 4943
893 Ga0495660_0013851 3300046810 Bacteria 4675
894 Ga0495660_0015751 3300046810 Bacteria 4365
895 Ga0495660_0029987 3300046810 Bacteria 3065
896 Ga0495660_0035194 3300046810 Bacteria 2799
897 Ga0495660_0037361 3300046810 Bacteria 2704
898 Ga0495660_0042749 3300046810 Bacteria 2502
899 Ga0495660_0044958 3300046810 Bacteria 2426
900 Ga0495660_0058841 3300046810 Bacteria 2068
901 Ga0495660_0075573 3300046810 Bacteria 1777
902 Ga0495581_0016399 3300047315 Bacteria 4308
903 Ga0495581_0155197 3300047315 Bacteria 1338
904 Ga0495604_0014396 3300047317 Bacteria 6310
905 Ga0495604_0027098 3300047317 Bacteria 4559
906 Ga0495604_0065044 3300047317 Bacteria 2777
907 Ga0495636_0004780 3300047318 Bacteria 5308
908 Ga0495636_0005482 3300047318 Bacteria 4985
909 Ga0495636_0037720 3300047318 Bacteria 1996
910 Ga0495636_0184589 3300047318 Bacteria 947
911 Ga0495672_0000128 3300047320 Bacteria 116418
912 Ga0495672_0000763 3300047320 Bacteria 35066
913 Ga0495672_0006798 3300047320 Bacteria 8751
914 Ga0495672_0007247 3300047320 Bacteria 8366
915 Ga0495672_0026817 3300047320 Bacteria 3670
916 Ga0495672_0027912 3300047320 Bacteria 3579
917 Ga0495672_0028178 3300047320 Bacteria 3557
918 Ga0495672_0028690 3300047320 Bacteria 3515
919 Ga0495672_0029496 3300047320 Bacteria 3454
920 Ga0495672_0035435 3300047320 Bacteria 3073
921 Ga0495672_0042520 3300047320 Bacteria 2739
922 Ga0495672_0046286 3300047320 Bacteria 2595
923 Ga0495672_0053732 3300047320 Bacteria 2358
924 Ga0495672_0060169 3300047320 Bacteria 2195
925 Ga0495672_0163391 3300047320 Bacteria 1142
926 Ga0495676_0000181 3300047321 Bacteria 49744
927 Ga0495676_0023384 3300047321 Bacteria 5364
928 Ga0495676_0025400 3300047321 Bacteria 5115
929 Ga0495680_0045474 3300047322 Bacteria 3466
930 Ga0495680_0059666 3300047322 Bacteria 2944
931 Ga0495683_0000044 3300047323 Bacteria 133747
932 Ga0495683_0000109 3300047323 Bacteria 84488
933 Ga0495683_0004098 3300047323 Bacteria 8343
934 Ga0495683_0006364 3300047323 Bacteria 6452
935 Ga0495683_0007390 3300047323 Bacteria 5949
936 Ga0495687_000331 3300047443 Bacteria 60618
937 Ga0495687_011346 3300047443 Bacteria 4801
938 Ga0495687_020451 3300047443 Bacteria 3224
939 Ga0495687_053447 3300047443 Bacteria 1700
940 Ga0495687_054471 3300047443 Bacteria 1678
941 Ga0495675_0030981 3300047444 Bacteria 3413
942 Ga0495677_0009717 3300047445 Bacteria 3545
943 Ga0495677_0012445 3300047445 Bacteria 3103
944 Ga0495677_0015976 3300047445 Bacteria 2724
945 Ga0495679_000132 3300047446 Bacteria 66186
946 Ga0495679_001170 3300047446 Bacteria 15609
947 Ga0495679_002986 3300047446 Bacteria 8337
948 Ga0495679_003149 3300047446 Bacteria 8067
949 Ga0495679_008146 3300047446 Bacteria 4288
950 Ga0495679_010711 3300047446 Bacteria 3582
951 Ga0495679_019486 3300047446 Bacteria 2383
952 Ga0495685_000016 3300047447 Bacteria 76154
953 Ga0495685_030254 3300047447 Bacteria 1862
954 Ga0495673_0001604 3300047469 Bacteria 17602
955 Ga0495673_0002244 3300047469 Bacteria 13877
956 Ga0495673_0002585 3300047469 Bacteria 12600
957 Ga0495673_0002792 3300047469 Bacteria 11930
958 Ga0495673_0003031 3300047469 Bacteria 11314
959 Ga0495673_0008758 3300047469 Bacteria 5653
960 Ga0495673_0011692 3300047469 Bacteria 4703
961 Ga0495673_0020978 3300047469 Bacteria 3238
962 Ga0495673_0021947 3300047469 Bacteria 3138
963 Ga0495673_0022877 3300047469 Bacteria 3054
964 Ga0495673_0045595 3300047469 Bacteria 1948
965 Ga0495681_0001925 3300047470 Bacteria 15221
966 Ga0495681_0004457 3300047470 Bacteria 9553
967 Ga0495681_0005164 3300047470 Bacteria 8786
968 Ga0495681_0009885 3300047470 Bacteria 5830
969 Ga0495681_0010214 3300047470 Bacteria 5699
970 Ga0495681_0010408 3300047470 Bacteria 5631
971 Ga0495681_0032244 3300047470 Bacteria 2640
972 Ga0495681_0049286 3300047470 Bacteria 1991
973 Ga0495681_0056762 3300047470 Bacteria 1821
974 Ga0495681_0086147 3300047470 Bacteria 1394
975 Ga0495686_0003355 3300047472 Bacteria 13956
976 Ga0495686_0011265 3300047472 Bacteria 6304
977 Ga0495686_0013640 3300047472 Bacteria 5632
978 Ga0495686_0036498 3300047472 Bacteria 3154
979 Ga0495686_0080318 3300047472 Bacteria 1993
980 Ga0495593_0056273 3300047673 Bacteria 2068
981 Ga0495593_0097531 3300047673 Bacteria 1509
982 Ga0495615_0000731 3300048090 Bacteria 4598
983 Ga0495626_0000218 3300048091 Bacteria 68820
984 Ga0495626_0002818 3300048091 Bacteria 11625
985 Ga0495626_0002988 3300048091 Bacteria 11209
986 Ga0495626_0004767 3300048091 Bacteria 8192
987 Ga0495626_0006156 3300048091 Bacteria 6865
988 Ga0495626_0007037 3300048091 Bacteria 6317
989 Ga0495626_0008455 3300048091 Bacteria 5641
990 Ga0495626_0011117 3300048091 Bacteria 4772
991 Ga0495626_0011321 3300048091 Bacteria 4722
992 Ga0496100_0015558 3300048903 Bacteria 4445
993 Ga0496101_0000081 3300048904 Bacteria 105727
994 Ga0496102_0000695 3300048905 Bacteria 33460
995 Ga0496102_0019211 3300048905 Bacteria 6017
996 Ga0496102_0038450 3300048905 Bacteria 4318
997 Ga0496102_0524852 3300048905 Bacteria 1106
998 Ga0496105_0002929 3300048908 Bacteria 12529
999 Ga0496108_0213602 3300048911 Bacteria 1675
1000 Ga0496111_0101712 3300048914 Bacteria 2112
1001 Ga0496112_0088735 3300048915 Bacteria 3060
1002 Ga0496114_0028589 3300048917 Bacteria 4576
1003 Ga0496116_0000209 3300048919 Bacteria 111028
1004 Ga0496116_0000567 3300048919 Bacteria 49501
1005 Ga0496116_0000699 3300048919 Bacteria 43452
1006 Ga0496116_0004900 3300048919 Bacteria 12620
1007 Ga0496116_0005627 3300048919 Bacteria 11541
1008 Ga0496116_0029132 3300048919 Bacteria 3986
1009 Ga0496116_0038984 3300048919 Bacteria 3290
1010 Ga0496116_0051608 3300048919 Bacteria 2730
1011 Ga0496116_0060918 3300048919 Bacteria 2445
1012 Ga0496116_0100577 3300048919 Bacteria 1728
1013 Ga0496117_0000435 3300048920 Bacteria 69463
1014 Ga0496117_0000970 3300048920 Bacteria 43943
1015 Ga0496117_0001156 3300048920 Bacteria 39730
1016 Ga0496117_0002590 3300048920 Bacteria 22495
1017 Ga0496117_0005390 3300048920 Bacteria 13467
1018 Ga0496117_0005662 3300048920 Bacteria 13025
1019 Ga0496117_0015316 3300048920 Bacteria 6544
1020 Ga0496117_0060409 3300048920 Bacteria 2612
1021 Ga0496117_0064469 3300048920 Bacteria 2497
1022 Ga0496118_0000512 3300048921 Bacteria 63837
1023 Ga0496118_0003741 3300048921 Bacteria 18811
1024 Ga0496118_0007001 3300048921 Bacteria 12150
1025 Ga0496118_0013161 3300048921 Bacteria 7850
1026 Ga0496118_0020934 3300048921 Bacteria 5782
1027 Ga0496118_0024987 3300048921 Bacteria 5139
1028 Ga0496118_0029278 3300048921 Bacteria 4621
1029 Ga0496118_0060883 3300048921 Bacteria 2800
1030 Ga0496118_0066163 3300048921 Bacteria 2639
1031 Ga0496118_0075942 3300048921 Bacteria 2392
1032 Ga0496118_0196226 3300048921 Bacteria 1201
1033 Ga0496118_0241542 3300048921 Bacteria 1033
1034 Ga0496118_0260629 3300048921 Bacteria 978
1035 Ga0496119_0000071 3300048922 Bacteria 153652
1036 Ga0496119_0000259 3300048922 Bacteria 75018
1037 Ga0496119_0000294 3300048922 Bacteria 69996
1038 Ga0496119_0002360 3300048922 Bacteria 20785
1039 Ga0496119_0009669 3300048922 Bacteria 8215
1040 Ga0496119_0061053 3300048922 Bacteria 2253
1041 Ga0496120_0000314 3300048923 Bacteria 80307
1042 Ga0496120_0001138 3300048923 Bacteria 34316
1043 Ga0496120_0002336 3300048923 Bacteria 19506
1044 Ga0496120_0004232 3300048923 Bacteria 12245
1045 Ga0496120_0008049 3300048923 Bacteria 7752
1046 Ga0496121_0000244 3300048924 Bacteria 116655
1047 Ga0496121_0001560 3300048924 Bacteria 38266
1048 Ga0496121_0001800 3300048924 Bacteria 34643
1049 Ga0496121_0002238 3300048924 Bacteria 30164
1050 Ga0496121_0003426 3300048924 Bacteria 22673
1051 Ga0496121_0038220 3300048924 Bacteria 4255
1052 Ga0496121_0055901 3300048924 Bacteria 3283
1053 Ga0496121_0094317 3300048924 Bacteria 2328
1054 Ga0496122_0001196 3300048925 Bacteria 44299
1055 Ga0496122_0002157 3300048925 Bacteria 28836
1056 Ga0496122_0004121 3300048925 Bacteria 18382
1057 Ga0496122_0007468 3300048925 Bacteria 12131
1058 Ga0496122_0010986 3300048925 Bacteria 9253
1059 Ga0496122_0024555 3300048925 Bacteria 5270
1060 Ga0496122_0035282 3300048925 Bacteria 4072
1061 Ga0496122_0039381 3300048925 Bacteria 3769
1062 Ga0496122_0092381 3300048925 Bacteria 2057
1063 Ga0496123_0000594 3300048926 Bacteria 61368
1064 Ga0496123_0001464 3300048926 Bacteria 32764
1065 Ga0496123_0003391 3300048926 Bacteria 17973
1066 Ga0496123_0010203 3300048926 Bacteria 8335
1067 Ga0496123_0012145 3300048926 Bacteria 7374
1068 Ga0496123_0017829 3300048926 Bacteria 5686
1069 Ga0496123_0053420 3300048926 Bacteria 2670
1070 Ga0496123_0054141 3300048926 Bacteria 2644
1071 Ga0496123_0071073 3300048926 Bacteria 2173
1072 Ga0496124_0000161 3300048927 Bacteria 136651
1073 Ga0496124_0000295 3300048927 Bacteria 92650
1074 Ga0496124_0001266 3300048927 Bacteria 38461
1075 Ga0496124_0007812 3300048927 Bacteria 11295
1076 Ga0496124_0009885 3300048927 Bacteria 9755
1077 Ga0496124_0013081 3300048927 Bacteria 8127
1078 Ga0496124_0015318 3300048927 Bacteria 7359
1079 Ga0496124_0016208 3300048927 Bacteria 7100
1080 Ga0496124_0020818 3300048927 Bacteria 6052
1081 Ga0496124_0022890 3300048927 Bacteria 5720
1082 Ga0496124_0044724 3300048927 Bacteria 3798
1083 Ga0496124_0077773 3300048927 Bacteria 2735
1084 Ga0496124_0116447 3300048927 Bacteria 2142
1085 Ga0496124_0203665 3300048927 Bacteria 1502
1086 Ga0496124_0304772 3300048927 Bacteria 1148
1087 Ga0496125_0002359 3300048928 Bacteria 24739
1088 Ga0496125_0005700 3300048928 Bacteria 13731
1089 Ga0496125_0006235 3300048928 Bacteria 12966
1090 Ga0496125_0022792 3300048928 Bacteria 5804
1091 Ga0496125_0087678 3300048928 Bacteria 2349
1092 Ga0496125_0109531 3300048928 Bacteria 2005
1093 Ga0496126_0037383 3300048929 Bacteria 4531
1094 Ga0496126_0070636 3300048929 Bacteria 3110
1095 Ga0496126_0096546 3300048929 Bacteria 2591
1096 Ga0496126_0120094 3300048929 Bacteria 2280
1097 Ga0496126_0223009 3300048929 Bacteria 1582
1098 Ga0495678_000017 3300049459 Bacteria 282592
1099 Ga0495678_002208 3300049459 Bacteria 13647
1100 Ga0495678_002786 3300049459 Bacteria 11404
1101 Ga0495678_004463 3300049459 Bacteria 8083
1102 Ga0495678_004822 3300049459 Bacteria 7664
1103 Ga0495678_012743 3300049459 Bacteria 3973
1104 Ga0495678_015697 3300049459 Bacteria 3478
1105 Ga0495678_023028 3300049459 Bacteria 2715
1106 Ga0495678_029026 3300049459 Bacteria 2327
1107 Ga0495678_030736 3300049459 Bacteria 2244
1108 Ga0495682_0000235 3300049460 Bacteria 43660
1109 Ga0495682_0000375 3300049460 Bacteria 32322
1110 Ga0495682_0000415 3300049460 Bacteria 30301
1111 Ga0495682_0013192 3300049460 Bacteria 3151
1112 Ga0495682_0021880 3300049460 Bacteria 2394
1113 Ga0501034_0000165 3300049571 Bacteria 123084
1114 Ga0501034_0024789 3300049571 Bacteria 6103
1115 Ga0501034_0149114 3300049571 Bacteria 2315
1116 Ga0501038_0048395 3300049574 Bacteria 3679
1117 Ga0501046_0175747 3300049580 Bacteria 1604
1118 Ga0501047_0117809 3300049581 Bacteria 2537
1119 Ga0501069_0236787 3300049585 Bacteria 1063
1120 Ga0501073_0005354 3300049589 Bacteria 9622
1121 Ga0501079_0026598 3300049741 Bacteria 4435
1122 Ga0501080_0028302 3300049742 Bacteria 5212
1123 Ga0501080_0326500 3300049742 Bacteria 1388
1124 Ga0501083_0001601 3300049744 Bacteria 15480
1125 Ga0501241_000551 3300049758 Bacteria 8051
1126 Ga0501035_0262069 3300049822 Bacteria 1465
1127 Ga0501044_0323781 3300049823 Bacteria 1465
1128 Ga0501226_000002 3300049853 Bacteria 426935
1129 nmdc:mga00v17_28587_c1 3300050491 Bacteria 3266
1130 nmdc:mga0yw44_177781_c1 3300050492 Bacteria 1400
1131 nmdc:mga0yw44_9256_c1 3300050492 Bacteria 4962
1132 nmdc:mga0k408_125741_c1 3300050493 Bacteria 1521
1133 nmdc:mga06z11_32886_c1 3300050494 Bacteria 2533
1134 nmdc:mga07m45_27529_c1 3300050496 Bacteria 3133
1135 Ga0500646_0002822 3300053090 Bacteria 4466
1136 Ga0500572_002322 3300053111 Bacteria 4603
1137 Ga0500607_044538 3300053121 Bacteria 2386
1138 Ga0500659_0005122 3300053135 Bacteria 7376
1139 Ga0500568_0024923 3300053139 Bacteria 2528
1140 Ga0500573_0082124 3300053140 Bacteria 1830
1141 Ga0500604_0009938 3300053151 Bacteria 2539
1142 Ga0500622_0000002 3300053156 Bacteria 646442
1143 Ga0500634_0015157 3300053161 Bacteria 4087
1144 Ga0500636_0000320 3300053177 Bacteria 26563
1145 Ga0500625_009789 3300053729 Bacteria 4288
1146 Ga0501084_0286847 3300054114 Bacteria 1390

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048921 Ga0496118_0075942 Ga0496118_0075942_1419_2324 281
2 3300048921 Ga0496118_0260629 Ga0496118_0260629_41_946 281
3 3300046664 Ga0495659_0156989 Ga0495659_0156989_31_903 282
4 3300048927 Ga0496124_0116447 Ga0496124_0116447_31_945 282
5 3300046522 Ga0495643_0157628 Ga0495643_0157628_19_939 283
6 3300046525 Ga0495663_0017191 Ga0495663_0017191_39_929 285
7 3300046615 Ga0495656_0116758 Ga0495656_0116758_319_1209 285
8 3300047318 Ga0495636_0184589 Ga0495636_0184589_14_904 285
9 3300039062 Ga0400483_006042 Ga0400483_006042_976_1851 287
10 3300049580 Ga0501046_0175747 Ga0501046_0175747_12_1007 289
11 3300049581 Ga0501047_0117809 Ga0501047_0117809_1528_2523 292
12 3300049585 Ga0501069_0236787 Ga0501069_0236787_25_1020 292
13 3300049742 Ga0501080_0028302 Ga0501080_0028302_2312_3307 292
14 3300049744 Ga0501083_0001601 Ga0501083_0001601_12046_13041 292
15 3300049822 Ga0501035_0262069 Ga0501035_0262069_430_1425 292
16 3300049823 Ga0501044_0323781 Ga0501044_0323781_432_1427 292
17 3300049741 Ga0501079_0026598 Ga0501079_0026598_3392_4402 295
18 3300054114 Ga0501084_0286847 Ga0501084_0286847_24_1034 295
19 3300049571 Ga0501034_0149114 Ga0501034_0149114_1388_2290 297
20 3300025245 Ga0207425_1001464 Ga0207425_10014646 305
21 3300025294 Ga0209025_1009169 Ga0209025_10091696 305
22 3300025297 Ga0209758_1008908 Ga0209758_10089082 305
23 3300046452 Ga0495617_004110 Ga0495617_004110_2772_3815 308
24 3300046457 Ga0495590_0001425 Ga0495590_0001425_1763_2806 308
25 3300046460 Ga0495638_0001662 Ga0495638_0001662_4676_5719 308
26 3300046474 Ga0495605_0001375 Ga0495605_0001375_12478_13521 308
27 3300046492 Ga0495585_0013874 Ga0495585_0013874_85_1128 308
28 3300046501 Ga0495607_0044418 Ga0495607_0044418_1460_2503 308
29 3300046506 Ga0495583_0000437 Ga0495583_0000437_56886_57929 308
30 3300046513 Ga0495616_0010936 Ga0495616_0010936_81_1124 308
31 3300046523 Ga0495644_0001379 Ga0495644_0001379_8405_9448 308
32 3300046524 Ga0495648_0003112 Ga0495648_0003112_6300_7343 308
33 3300046538 Ga0495609_0002211 Ga0495609_0002211_2259_3302 308
34 3300046648 Ga0495611_0002011 Ga0495611_0002011_4961_6004 308
35 3300046660 Ga0495625_0004179 Ga0495625_0004179_8019_9062 308
36 3300046664 Ga0495659_0000761 Ga0495659_0000761_7734_8777 308
37 3300046692 Ga0495671_0013883 Ga0495671_0013883_2793_3836 308
38 3300047318 Ga0495636_0004780 Ga0495636_0004780_95_1138 308
39 3300047320 Ga0495672_0026817 Ga0495672_0026817_277_1320 308
40 3300047323 Ga0495683_0004098 Ga0495683_0004098_603_1646 308
41 3300047443 Ga0495687_000331 Ga0495687_000331_6076_7119 308
42 3300047445 Ga0495677_0009717 Ga0495677_0009717_2479_3522 308
43 3300047447 Ga0495685_000016 Ga0495685_000016_59701_60744 308
44 3300049459 Ga0495678_002208 Ga0495678_002208_5118_6161 308
45 3300005539 Ga0068853_100475370 Ga0068853_1004753702 309
46 3300005616 Ga0068852_100001905 Ga0068852_10000190513 310
47 3300009093 Ga0105240_10060469 Ga0105240_100604692 310
48 3300013307 Ga0157372_10023417 Ga0157372_100234173 310
49 3300005328 Ga0070676_10027595 Ga0070676_100275952 311
50 3300005331 Ga0070670_100053124 Ga0070670_1000531244 311
51 3300005333 Ga0070677_10006624 Ga0070677_100066244 311
52 3300005334 Ga0068869_100104364 Ga0068869_1001043642 311
53 3300005438 Ga0070701_10014899 Ga0070701_100148992 311
54 3300005441 Ga0070700_100029645 Ga0070700_1000296453 311
55 3300005548 Ga0070665_100303402 Ga0070665_1003034022 311
56 3300005618 Ga0068864_100255152 Ga0068864_1002551523 311
57 3300009148 Ga0105243_10025896 Ga0105243_100258963 311
58 3300017792 Ga0163161_10033284 Ga0163161_100332843 311
59 3300025901 Ga0207688_10003663 Ga0207688_100036635 311
60 3300025907 Ga0207645_10002351 Ga0207645_100023513 311
61 3300025925 Ga0207650_10290855 Ga0207650_102908552 311
62 3300025935 Ga0207709_10042529 Ga0207709_100425292 311
63 3300025936 Ga0207670_10153665 Ga0207670_101536652 311
64 3300025942 Ga0207689_10012499 Ga0207689_100124998 311
65 3300025986 Ga0207658_10215061 Ga0207658_102150612 311
66 3300026095 Ga0207676_10075039 Ga0207676_100750393 311
67 3300026118 Ga0207675_100003679 Ga0207675_1000036793 311
68 3300028380 Ga0268265_10172449 Ga0268265_101724491 311
69 3300005345 Ga0070692_10041465 Ga0070692_100414653 313
70 3300013105 Ga0157369_10338878 Ga0157369_103388782 313
71 3300013307 Ga0157372_10408475 Ga0157372_104084752 313
72 3300002773 JGI25152J39213_1000946 JGI25152J39213_100094614 314
73 3300003771 Ga0055526_1000099 Ga0055526_10000999 314
74 3300025295 Ga0209564_1000006 Ga0209564_1000006314 314
75 3300028794 Ga0307515_10272168 Ga0307515_102721682 314
76 3300046452 Ga0495617_002703 Ga0495617_002703_5646_6689 314
77 3300046558 Ga0495633_0008307 Ga0495633_0008307_3166_4209 314
78 3300046660 Ga0495625_0005141 Ga0495625_0005141_7699_8754 314
79 3300049460 Ga0495682_0000415 Ga0495682_0000415_11740_12783 314
80 3300003856 Ga0058692_1001416 Ga0058692_10014161 315
81 3300013307 Ga0157372_10014317 Ga0157372_100143175 315
82 3300044712 Ga0453684_0145089 Ga0453684_0145089_104_1111 315
83 3300048922 Ga0496119_0009669 Ga0496119_0009669_33_1040 315
84 3300048927 Ga0496124_0304772 Ga0496124_0304772_19_1026 315
85 3300030731 Ga0316177_1019129 Ga0316177_10191292 316
86 3300030736 Ga0316180_1053175 Ga0316180_10531752 316
87 3300036401 Ga0373937_0229089 Ga0373937_0229089_293_1279 316
88 3300042876 Ga0451577_0166491 Ga0451577_0166491_899_1921 316
89 3300047445 Ga0495677_0015976 Ga0495677_0015976_1445_2488 316
90 3300005436 Ga0070713_100007989 Ga0070713_1000079895 317
91 3300025711 Ga0207696_1000040 Ga0207696_1000040274 317
92 3300025981 Ga0207640_10010884 Ga0207640_100108845 317
93 3300031241 Ga0265325_10025196 Ga0265325_100251963 317
94 3300046523 Ga0495644_0001177 Ga0495644_0001177_9135_10178 317
95 3300049742 Ga0501080_0326500 Ga0501080_0326500_35_1027 317
96 3300021361 Ga0213872_10017516 Ga0213872_100175162 318
97 3300039447 Ga0436361_0752100 Ga0436361_0752100_592_1620 318
98 3300044712 Ga0453684_0009242 Ga0453684_0009242_7910_8878 318
99 3300049589 Ga0501073_0005354 Ga0501073_0005354_3246_4241 318
100 3300025913 Ga0207695_10168322 Ga0207695_101683223 319
101 3300028379 Ga0268266_10012441 Ga0268266_100124414 319
102 3300038725 Ga0400484_10432 Ga0400484_10432_1386_2357 319
103 3300005327 Ga0070658_10058489 Ga0070658_100584893 320
104 3300005539 Ga0068853_100304903 Ga0068853_1003049032 320
105 3300005547 Ga0070693_100121690 Ga0070693_1001216902 320
106 3300009101 Ga0105247_10033382 Ga0105247_100333821 320
107 3300009551 Ga0105238_10060609 Ga0105238_100606092 320
108 3300013105 Ga0157369_10000904 Ga0157369_100009046 320
109 3300025900 Ga0207710_10066201 Ga0207710_100662011 320
110 3300025913 Ga0207695_10216939 Ga0207695_102169393 320
111 3300025924 Ga0207694_10299831 Ga0207694_102998312 320
112 iso_pu_bacteria 2891633521 2891637105 320
113 3300009093 Ga0105240_10206981 Ga0105240_102069813 321
114 3300031251 Ga0265327_10000295 Ga0265327_1000029546 321
115 3300031251 Ga0265327_10001761 Ga0265327_100017612 321
116 3300031251 Ga0265327_10012657 Ga0265327_100126574 321
117 3300038726 Ga0400490_18098 Ga0400490_18098_1172_2152 321
118 3300038741 Ga0400488_41548 Ga0400488_41548_173_1153 321
119 3300038741 Ga0400488_58081 Ga0400488_58081_250_1227 321
120 3300039062 Ga0400483_146382 Ga0400483_146382_546_1526 321
121 3300039062 Ga0400483_157778 Ga0400483_157778_633_1613 321
122 3300039062 Ga0400483_169174 Ga0400483_169174_213_1190 321
123 3300039062 Ga0400483_262975 Ga0400483_262975_710_1687 321
124 3300039093 Ga0400489_04156 Ga0400489_04156_327_1307 321
125 3300044712 Ga0453684_0355220 Ga0453684_0355220_659_1633 321
126 3300005563 Ga0068855_100014676 Ga0068855_10001467610 322
127 3300005459 Ga0068867_100202484 Ga0068867_1002024841 323
128 3300030745 Ga0316182_1125834 Ga0316182_11258343 323
129 3300046491 Ga0495584_0005198 Ga0495584_0005198_4485_5528 323
130 3300031665 Ga0316575_10015788 Ga0316575_100157884 324
131 3300046513 Ga0495616_0005056 Ga0495616_0005056_3592_4635 324
132 3300046558 Ga0495633_0025737 Ga0495633_0025737_714_1757 324
133 iso_pu_bacteria 2511231025 2511382497 324
134 iso_pu_bacteria 2511231035 2511432968 324
135 iso_pu_bacteria 2876601092 2876601160 324
136 iso_pu_bacteria 2939602548 2939604974 324
137 iso_pu_bacteria 2939617950 2939620906 324
138 iso_pu_bacteria 8016733728 8016733807 324
139 iso_pu_bacteria 8019499862 8019504362 324
140 3300005434 Ga0070709_10165943 Ga0070709_101659431 325
141 3300046501 Ga0495607_0009044 Ga0495607_0009044_4588_5646 325
142 3300046507 Ga0495606_0004861 Ga0495606_0004861_4628_5686 325
143 iso_pu_bacteria 2608642108 2608672147 325
144 iso_pu_bacteria 2844528606 2844532831 325
145 iso_pu_bacteria 2865014394 2865017872 325
146 iso_pu_bacteria 2881609920 2881612929 325
147 iso_pu_bacteria 2945951305 2945955060 325
148 iso_pu_bacteria 2599185299 2599929568 326
149 iso_pu_bacteria 2648501693 2650899941 326
150 iso_pu_bacteria 2684622997 2686356689 326
151 iso_pu_bacteria 2808606414 2809127803 326
152 iso_pu_bacteria 2847797336 2847797491 326
153 iso_pu_bacteria 2984494565 2984498915 326
154 iso_pu_bacteria 2990261002 2990264827 326
155 3300003320 rootH2_10021225 rootH2_1002122519 328
156 3300003856 Ga0058692_1000131 Ga0058692_100013137 328
157 3300003856 Ga0058692_1000281 Ga0058692_100028117 328
158 3300005289 Ga0065704_10000868 Ga0065704_100008682 328
159 3300005289 Ga0065704_10002090 Ga0065704_100020906 328
160 3300006946 Ga0079104_1000059 Ga0079104_100005915 328
161 3300009011 Ga0105251_10002764 Ga0105251_100027642 328
162 3300009036 Ga0105244_10002241 Ga0105244_100022418 328
163 3300011119 Ga0105246_10003929 Ga0105246_100039298 328
164 3300013100 Ga0157373_10000185 Ga0157373_1000018550 328
165 3300013102 Ga0157371_10000489 Ga0157371_1000048935 328
166 3300013105 Ga0157369_10000184 Ga0157369_1000018469 328
167 3300013306 Ga0163162_10065492 Ga0163162_100654924 328
168 3300025261 Ga0209233_1011905 Ga0209233_10119052 328
169 3300025711 Ga0207696_1000364 Ga0207696_10003642 328
170 3300025728 Ga0207655_1001696 Ga0207655_10016964 328
171 3300025735 Ga0207713_1080833 Ga0207713_10808331 328
172 3300027312 Ga0209371_1000029 Ga0209371_1000029138 328
173 3300027312 Ga0209371_1000238 Ga0209371_100023853 328
174 3300027312 Ga0209371_1000974 Ga0209371_10009748 328
175 3300030500 Ga0268256_1000198 Ga0268256_100019813 328
176 3300030500 Ga0268256_1000825 Ga0268256_10008258 328
177 3300031727 Ga0316576_10133941 Ga0316576_101339411 328
178 3300036712 Ga0316584_0034968 Ga0316584_0034968_1905_2954 328
179 3300046452 Ga0495617_032981 Ga0495617_032981_601_1644 328
180 3300046458 Ga0495591_000067 Ga0495591_000067_69023_70066 328
181 3300046530 Ga0495654_0000064 Ga0495654_0000064_69029_70072 328
182 3300048904 Ga0496101_0000081 Ga0496101_0000081_67985_69028 328
183 3300048922 Ga0496119_0002360 Ga0496119_0002360_19618_20661 328
184 3300048923 Ga0496120_0008049 Ga0496120_0008049_267_1310 328
185 3300048925 Ga0496122_0004121 Ga0496122_0004121_10233_11276 328
186 3300048926 Ga0496123_0003391 Ga0496123_0003391_2642_3685 328
187 3300048927 Ga0496124_0009885 Ga0496124_0009885_2039_3082 328
188 3300048927 Ga0496124_0015318 Ga0496124_0015318_1803_2846 328
189 3300048929 Ga0496126_0096546 Ga0496126_0096546_533_1576 328
190 iso_pu_bacteria 2828305725 2828309456 328
191 3300003771 Ga0055526_1002548 Ga0055526_10025482 329
192 3300003773 Ga0055537_1000344 Ga0055537_10003449 329
193 3300003775 Ga0055524_1016089 Ga0055524_10160892 329
194 3300003784 Ga0055534_1000310 Ga0055534_10003109 329
195 3300003790 Ga0055528_1000124 Ga0055528_100012418 329
196 3300005340 Ga0070689_100100915 Ga0070689_1001009152 329
197 3300005548 Ga0070665_100015950 Ga0070665_1000159506 329
198 3300005617 Ga0068859_100113150 Ga0068859_1001131502 329
199 3300005618 Ga0068864_100418448 Ga0068864_1004184481 329
200 3300005841 Ga0068863_100010515 Ga0068863_1000105156 329
201 3300005844 Ga0068862_100137182 Ga0068862_1001371822 329
202 3300006051 Ga0075364_10023585 Ga0075364_100235853 329
203 3300006931 Ga0097620_100113148 Ga0097620_1001131482 329
204 3300009011 Ga0105251_10003159 Ga0105251_1000315911 329
205 3300009092 Ga0105250_10005591 Ga0105250_100055915 329
206 3300011119 Ga0105246_10001990 Ga0105246_100019903 329
207 3300013306 Ga0163162_10023835 Ga0163162_100238355 329
208 3300013307 Ga0157372_10031002 Ga0157372_100310025 329
209 3300013307 Ga0157372_10092373 Ga0157372_100923732 329
210 3300014497 Ga0182008_10027479 Ga0182008_100274793 329
211 3300015261 Ga0182006_1009409 Ga0182006_10094093 329
212 3300015262 Ga0182007_10074231 Ga0182007_100742311 329
213 3300025233 Ga0209437_100188 Ga0209437_10018868 329
214 3300025263 Ga0209565_1000006 Ga0209565_1000006110 329
215 3300025273 Ga0209673_1000004 Ga0209673_1000004719 329
216 3300025291 Ga0209675_1000006 Ga0209675_1000006109 329
217 3300025295 Ga0209564_1000064 Ga0209564_1000064168 329
218 3300025299 Ga0209256_1000365 Ga0209256_10003658 329
219 3300025711 Ga0207696_1000237 Ga0207696_100023722 329
220 3300025728 Ga0207655_1005312 Ga0207655_10053125 329
221 3300025728 Ga0207655_1010564 Ga0207655_10105642 329
222 3300025735 Ga0207713_1000214 Ga0207713_100021456 329
223 3300025933 Ga0207706_10001654 Ga0207706_1000165421 329
224 3300025972 Ga0207668_10023520 Ga0207668_100235203 329
225 3300027312 Ga0209371_1001489 Ga0209371_10014897 329
226 3300030500 Ga0268256_1000252 Ga0268256_100025211 329
227 3300030500 Ga0268256_1000467 Ga0268256_100046732 329
228 3300030742 Ga0316183_1189911 Ga0316183_11899112 329
229 3300031730 Ga0307516_10179758 Ga0307516_101797581 329
230 3300041407 Ga0439447_003530 Ga0439447_003530_4480_5535 329
231 3300041411 Ga0439466_0000015 Ga0439466_0000015_54711_55766 329
232 3300042016 Ga0439463_002391 Ga0439463_002391_1029_2084 329
233 3300042139 Ga0450904_000331 Ga0450904_000331_3451_4440 329
234 3300042146 Ga0450907_000033 Ga0450907_000033_32911_33966 329
235 3300042439 Ga0439464_0007003 Ga0439464_0007003_1337_2392 329
236 3300046452 Ga0495617_027405 Ga0495617_027405_652_1641 329
237 3300046457 Ga0495590_0054257 Ga0495590_0054257_209_1243 329
238 3300046458 Ga0495591_004466 Ga0495591_004466_2192_3181 329
239 3300046458 Ga0495591_005222 Ga0495591_005222_2215_3270 329
240 3300046459 Ga0495629_0062007 Ga0495629_0062007_543_1547 329
241 3300046460 Ga0495638_0015540 Ga0495638_0015540_475_1509 329
242 3300046471 Ga0495650_0014187 Ga0495650_0014187_1587_2576 329
243 3300046474 Ga0495605_0001339 Ga0495605_0001339_12699_13688 329
244 3300046491 Ga0495584_0082895 Ga0495584_0082895_278_1294 329
245 3300046492 Ga0495585_0009515 Ga0495585_0009515_2805_3860 329
246 3300046492 Ga0495585_0012233 Ga0495585_0012233_2936_3925 329
247 3300046501 Ga0495607_0008397 Ga0495607_0008397_1001_2005 329
248 3300046506 Ga0495583_0001917 Ga0495583_0001917_4233_5222 329
249 3300046506 Ga0495583_0002771 Ga0495583_0002771_12731_13720 329
250 3300046506 Ga0495583_0049841 Ga0495583_0049841_254_1270 329
251 3300046507 Ga0495606_0000214 Ga0495606_0000214_16644_17633 329
252 3300046513 Ga0495616_0014779 Ga0495616_0014779_1749_2765 329
253 3300046518 Ga0495631_0006680 Ga0495631_0006680_1851_2840 329
254 3300046519 Ga0495632_0043489 Ga0495632_0043489_193_1182 329
255 3300046520 Ga0495637_0000020 Ga0495637_0000020_48570_49559 329
256 3300046524 Ga0495648_0000680 Ga0495648_0000680_32880_33935 329
257 3300046524 Ga0495648_0072444 Ga0495648_0072444_797_1786 329
258 3300046528 Ga0495642_0023176 Ga0495642_0023176_968_2002 329
259 3300046538 Ga0495609_0000425 Ga0495609_0000425_33425_34441 329
260 3300046616 Ga0495668_0000158 Ga0495668_0000158_13891_14913 329
261 3300046648 Ga0495611_0003785 Ga0495611_0003785_837_1826 329
262 3300046660 Ga0495625_0000133 Ga0495625_0000133_33002_33991 329
263 3300046660 Ga0495625_0033171 Ga0495625_0033171_1978_2967 329
264 3300046665 Ga0495661_0013885 Ga0495661_0013885_204_1238 329
265 3300046689 Ga0495613_0265691 Ga0495613_0265691_14_1018 329
266 3300046692 Ga0495671_0037978 Ga0495671_0037978_1423_2412 329
267 3300046694 Ga0495649_0006735 Ga0495649_0006735_4172_5161 329
268 3300046694 Ga0495649_0015022 Ga0495649_0015022_219_1253 329
269 3300046810 Ga0495660_0000797 Ga0495660_0000797_22459_23448 329
270 3300046810 Ga0495660_0029987 Ga0495660_0029987_41_1030 329
271 3300046810 Ga0495660_0042749 Ga0495660_0042749_479_1534 329
272 3300046810 Ga0495660_0075573 Ga0495660_0075573_282_1286 329
273 3300047315 Ga0495581_0155197 Ga0495581_0155197_59_1063 329
274 3300047320 Ga0495672_0000128 Ga0495672_0000128_58808_59863 329
275 3300047321 Ga0495676_0000181 Ga0495676_0000181_34700_35689 329
276 3300047322 Ga0495680_0045474 Ga0495680_0045474_729_1733 329
277 3300047443 Ga0495687_053447 Ga0495687_053447_210_1244 329
278 3300047446 Ga0495679_002986 Ga0495679_002986_7040_8074 329
279 3300047446 Ga0495679_003149 Ga0495679_003149_631_1686 329
280 3300047469 Ga0495673_0003031 Ga0495673_0003031_3686_4675 329
281 3300047470 Ga0495681_0010408 Ga0495681_0010408_2652_3668 329
282 3300047472 Ga0495686_0003355 Ga0495686_0003355_6029_7051 329
283 3300047472 Ga0495686_0011265 Ga0495686_0011265_982_1971 329
284 3300048903 Ga0496100_0015558 Ga0496100_0015558_1620_2675 329
285 3300048905 Ga0496102_0038450 Ga0496102_0038450_2366_3421 329
286 3300048908 Ga0496105_0002929 Ga0496105_0002929_4507_5562 329
287 3300048919 Ga0496116_0051608 Ga0496116_0051608_777_1832 329
288 3300048919 Ga0496116_0060918 Ga0496116_0060918_701_1756 329
289 3300048920 Ga0496117_0000435 Ga0496117_0000435_10194_11249 329
290 3300048920 Ga0496117_0002590 Ga0496117_0002590_11244_12299 329
291 3300048921 Ga0496118_0000512 Ga0496118_0000512_10194_11249 329
292 3300048921 Ga0496118_0007001 Ga0496118_0007001_899_1954 329
293 3300048922 Ga0496119_0000259 Ga0496119_0000259_63672_64727 329
294 3300048922 Ga0496119_0000294 Ga0496119_0000294_10291_11346 329
295 3300048923 Ga0496120_0002336 Ga0496120_0002336_10291_11346 329
296 3300048923 Ga0496120_0004232 Ga0496120_0004232_899_1954 329
297 3300048924 Ga0496121_0000244 Ga0496121_0000244_58808_59863 329
298 3300048924 Ga0496121_0002238 Ga0496121_0002238_14935_15924 329
299 3300048925 Ga0496122_0001196 Ga0496122_0001196_29126_30115 329
300 3300048925 Ga0496122_0007468 Ga0496122_0007468_10193_11248 329
301 3300048926 Ga0496123_0000594 Ga0496123_0000594_46613_47602 329
302 3300048926 Ga0496123_0012145 Ga0496123_0012145_5431_6486 329
303 3300048927 Ga0496124_0000295 Ga0496124_0000295_58841_59896 329
304 3300048927 Ga0496124_0077773 Ga0496124_0077773_937_1992 329
305 3300048927 Ga0496124_0203665 Ga0496124_0203665_340_1344 329
306 3300048928 Ga0496125_0002359 Ga0496125_0002359_5276_6331 329
307 3300050491 nmdc:mga00v17_28587_c1 nmdc:mga00v17_28587_c1_1338_2393 329
308 iso_pu_bacteria 2513237087 2513589026 329
309 iso_pu_bacteria 8001522603 8001523913 329
310 3300001989 JGI24739J22299_10000283 JGI24739J22299_1000028319 330
311 3300009011 Ga0105251_10000234 Ga0105251_1000023418 330
312 3300009011 Ga0105251_10001125 Ga0105251_1000112516 330
313 3300009011 Ga0105251_10027643 Ga0105251_100276432 330
314 3300009036 Ga0105244_10002167 Ga0105244_100021672 330
315 3300009092 Ga0105250_10000012 Ga0105250_10000012227 330
316 3300010375 Ga0105239_10362815 Ga0105239_103628152 330
317 3300013102 Ga0157371_10007341 Ga0157371_100073412 330
318 3300013104 Ga0157370_10002299 Ga0157370_1000229917 330
319 3300013307 Ga0157372_10018013 Ga0157372_100180133 330
320 3300013307 Ga0157372_10099561 Ga0157372_100995611 330
321 3300013307 Ga0157372_10464345 Ga0157372_104643451 330
322 3300025728 Ga0207655_1000178 Ga0207655_100017853 330
323 3300025728 Ga0207655_1011154 Ga0207655_10111543 330
324 3300027312 Ga0209371_1000154 Ga0209371_100015484 330
325 3300027312 Ga0209371_1000263 Ga0209371_100026356 330
326 3300030500 Ga0268256_1000899 Ga0268256_10008997 330
327 3300038726 Ga0400490_57155 Ga0400490_57155_5063_6067 330
328 3300039110 Ga0400487_61984 Ga0400487_61984_15883_16926 330
329 3300042006 Ga0439432_000657 Ga0439432_000657_6518_7576 330
330 3300042010 Ga0439452_000050 Ga0439452_000050_61683_62741 330
331 3300042876 Ga0451577_0037150 Ga0451577_0037150_3295_4293 330
332 3300042876 Ga0451577_0409305 Ga0451577_0409305_143_1165 330
333 3300044712 Ga0453684_0001452 Ga0453684_0001452_50141_51139 330
334 3300044712 Ga0453684_0003292 Ga0453684_0003292_10468_11469 330
335 3300044712 Ga0453684_0058382 Ga0453684_0058382_1045_2043 330
336 3300045051 Ga0451576_0016196 Ga0451576_0016196_6596_7594 330
337 3300045051 Ga0451576_0056353 Ga0451576_0056353_1422_2420 330
338 3300045051 Ga0451576_0072821 Ga0451576_0072821_1869_2867 330
339 3300045051 Ga0451576_0093842 Ga0451576_0093842_1210_2208 330
340 3300046500 Ga0495596_0008288 Ga0495596_0008288_127_1185 330
341 3300048919 Ga0496116_0000209 Ga0496116_0000209_51700_52758 330
342 3300048919 Ga0496116_0004900 Ga0496116_0004900_3179_4237 330
343 3300048920 Ga0496117_0001156 Ga0496117_0001156_33521_34579 330
344 3300048921 Ga0496118_0024987 Ga0496118_0024987_4025_5083 330
345 3300048923 Ga0496120_0000314 Ga0496120_0000314_49149_50207 330
346 3300048927 Ga0496124_0007812 Ga0496124_0007812_1670_2728 330
347 3300048927 Ga0496124_0022890 Ga0496124_0022890_1610_2668 330
348 3300053156 Ga0500622_0000002 Ga0500622_0000002_529871_530881 330
349 3300002987 JGI25159J45721_1003749 JGI25159J45721_10037494 331
350 3300005262 Ga0065165_1000050 Ga0065165_1000050153 331
351 3300009011 Ga0105251_10000382 Ga0105251_1000038231 331
352 3300009011 Ga0105251_10019039 Ga0105251_100190392 331
353 3300009011 Ga0105251_10076430 Ga0105251_100764302 331
354 3300009036 Ga0105244_10069739 Ga0105244_100697391 331
355 3300009092 Ga0105250_10002533 Ga0105250_1000253311 331
356 3300013100 Ga0157373_10049869 Ga0157373_100498692 331
357 3300013100 Ga0157373_10074594 Ga0157373_100745942 331
358 3300013102 Ga0157371_10002513 Ga0157371_100025133 331
359 3300013102 Ga0157371_10047507 Ga0157371_100475073 331
360 3300013104 Ga0157370_10000388 Ga0157370_1000038849 331
361 3300025284 Ga0209130_1000065 Ga0209130_1000065152 331
362 3300025302 Ga0207426_1048573 Ga0207426_10485731 331
363 3300031250 Ga0265331_10060977 Ga0265331_100609772 331
364 3300042006 Ga0439432_004987 Ga0439432_004987_540_1535 331
365 3300042009 Ga0439451_001273 Ga0439451_001273_3088_4083 331
366 3300042016 Ga0439463_000057 Ga0439463_000057_9868_10863 331
367 3300044673 Ga0453683_0013014 Ga0453683_0013014_192_1193 331
368 3300046453 Ga0495627_000662 Ga0495627_000662_12936_13931 331
369 3300046453 Ga0495627_000811 Ga0495627_000811_3797_4807 331
370 3300046458 Ga0495591_000692 Ga0495591_000692_19939_20934 331
371 3300046458 Ga0495591_005356 Ga0495591_005356_4772_5767 331
372 3300046458 Ga0495591_021518 Ga0495591_021518_35_1030 331
373 3300046458 Ga0495591_023084 Ga0495591_023084_940_1935 331
374 3300046458 Ga0495591_043397 Ga0495591_043397_256_1251 331
375 3300046471 Ga0495650_0007116 Ga0495650_0007116_3650_4645 331
376 3300046471 Ga0495650_0020905 Ga0495650_0020905_763_1758 331
377 3300046474 Ga0495605_0000062 Ga0495605_0000062_62242_63237 331
378 3300046474 Ga0495605_0000646 Ga0495605_0000646_22022_23017 331
379 3300046474 Ga0495605_0001077 Ga0495605_0001077_13593_14588 331
380 3300046491 Ga0495584_0047460 Ga0495584_0047460_923_1918 331
381 3300046499 Ga0495594_0014149 Ga0495594_0014149_1459_2454 331
382 3300046500 Ga0495596_0048218 Ga0495596_0048218_644_1639 331
383 3300046501 Ga0495607_0000535 Ga0495607_0000535_32662_33657 331
384 3300046501 Ga0495607_0001879 Ga0495607_0001879_3629_4624 331
385 3300046501 Ga0495607_0002217 Ga0495607_0002217_655_1650 331
386 3300046501 Ga0495607_0013924 Ga0495607_0013924_3268_4263 331
387 3300046501 Ga0495607_0085165 Ga0495607_0085165_562_1557 331
388 3300046506 Ga0495583_0000015 Ga0495583_0000015_235553_236548 331
389 3300046506 Ga0495583_0000821 Ga0495583_0000821_33400_34395 331
390 3300046506 Ga0495583_0001665 Ga0495583_0001665_11289_12314 331
391 3300046506 Ga0495583_0007496 Ga0495583_0007496_2338_3333 331
392 3300046506 Ga0495583_0026835 Ga0495583_0026835_125_1120 331
393 3300046507 Ga0495606_0000352 Ga0495606_0000352_53_1048 331
394 3300046507 Ga0495606_0000892 Ga0495606_0000892_38348_39343 331
395 3300046507 Ga0495606_0015322 Ga0495606_0015322_1249_2244 331
396 3300046512 Ga0495610_0048111 Ga0495610_0048111_1069_2064 331
397 3300046515 Ga0495620_0000050 Ga0495620_0000050_79847_80842 331
398 3300046515 Ga0495620_0001299 Ga0495620_0001299_12001_12996 331
399 3300046515 Ga0495620_0004967 Ga0495620_0004967_5359_6354 331
400 3300046518 Ga0495631_0001124 Ga0495631_0001124_3680_4690 331
401 3300046518 Ga0495631_0010499 Ga0495631_0010499_2162_3157 331
402 3300046519 Ga0495632_0005948 Ga0495632_0005948_6762_7757 331
403 3300046519 Ga0495632_0065967 Ga0495632_0065967_402_1412 331
404 3300046520 Ga0495637_0001280 Ga0495637_0001280_179_1174 331
405 3300046520 Ga0495637_0039117 Ga0495637_0039117_36_1031 331
406 3300046520 Ga0495637_0061987 Ga0495637_0061987_200_1195 331
407 3300046522 Ga0495643_0124807 Ga0495643_0124807_162_1202 331
408 3300046524 Ga0495648_0013129 Ga0495648_0013129_3613_4608 331
409 3300046528 Ga0495642_0095925 Ga0495642_0095925_192_1223 331
410 3300046530 Ga0495654_0001141 Ga0495654_0001141_3796_4806 331
411 3300046530 Ga0495654_0001487 Ga0495654_0001487_6593_7588 331
412 3300046530 Ga0495654_0005820 Ga0495654_0005820_3670_4665 331
413 3300046530 Ga0495654_0008569 Ga0495654_0008569_3413_4408 331
414 3300046530 Ga0495654_0051032 Ga0495654_0051032_26_1021 331
415 3300046538 Ga0495609_0000143 Ga0495609_0000143_63000_63995 331
416 3300046538 Ga0495609_0000372 Ga0495609_0000372_3685_4680 331
417 3300046538 Ga0495609_0000461 Ga0495609_0000461_3648_4643 331
418 3300046542 Ga0495597_0001312 Ga0495597_0001312_4488_5483 331
419 3300046542 Ga0495597_0009711 Ga0495597_0009711_2391_3386 331
420 3300046542 Ga0495597_0047648 Ga0495597_0047648_875_1870 331
421 3300046557 Ga0495622_0025516 Ga0495622_0025516_106_1101 331
422 3300046558 Ga0495633_0000084 Ga0495633_0000084_44119_45114 331
423 3300046616 Ga0495668_0034303 Ga0495668_0034303_1221_2216 331
424 3300046616 Ga0495668_0046035 Ga0495668_0046035_78_1073 331
425 3300046648 Ga0495611_0000910 Ga0495611_0000910_13242_14237 331
426 3300046665 Ga0495661_0000065 Ga0495661_0000065_79866_80861 331
427 3300046665 Ga0495661_0000370 Ga0495661_0000370_4439_5434 331
428 3300046665 Ga0495661_0000542 Ga0495661_0000542_3685_4680 331
429 3300046665 Ga0495661_0057874 Ga0495661_0057874_181_1176 331
430 3300046692 Ga0495671_0001993 Ga0495671_0001993_11103_12113 331
431 3300046692 Ga0495671_0006339 Ga0495671_0006339_3432_4427 331
432 3300046692 Ga0495671_0010036 Ga0495671_0010036_3073_4068 331
433 3300046694 Ga0495649_0001797 Ga0495649_0001797_12476_13471 331
434 3300046794 Ga0495589_0012119 Ga0495589_0012119_1176_2171 331
435 3300046810 Ga0495660_0002243 Ga0495660_0002243_6983_7978 331
436 3300046810 Ga0495660_0002803 Ga0495660_0002803_6817_7812 331
437 3300047320 Ga0495672_0007247 Ga0495672_0007247_4873_5883 331
438 3300047320 Ga0495672_0027912 Ga0495672_0027912_2522_3517 331
439 3300047320 Ga0495672_0028690 Ga0495672_0028690_2128_3123 331
440 3300047320 Ga0495672_0046286 Ga0495672_0046286_1580_2575 331
441 3300047320 Ga0495672_0163391 Ga0495672_0163391_69_1064 331
442 3300047323 Ga0495683_0000109 Ga0495683_0000109_3633_4628 331
443 3300047443 Ga0495687_054471 Ga0495687_054471_666_1661 331
444 3300047446 Ga0495679_000132 Ga0495679_000132_32232_33227 331
445 3300047446 Ga0495679_001170 Ga0495679_001170_4634_5629 331
446 3300047469 Ga0495673_0001604 Ga0495673_0001604_3647_4642 331
447 3300047469 Ga0495673_0002244 Ga0495673_0002244_12662_13657 331
448 3300047469 Ga0495673_0002792 Ga0495673_0002792_3676_4671 331
449 3300047470 Ga0495681_0001925 Ga0495681_0001925_1027_2022 331
450 3300047470 Ga0495681_0005164 Ga0495681_0005164_2337_3332 331
451 3300047470 Ga0495681_0056762 Ga0495681_0056762_21_1016 331
452 3300048091 Ga0495626_0000218 Ga0495626_0000218_34371_35366 331
453 3300048091 Ga0495626_0004767 Ga0495626_0004767_18_1013 331
454 3300048921 Ga0496118_0060883 Ga0496118_0060883_729_1724 331
455 3300048921 Ga0496118_0241542 Ga0496118_0241542_25_1020 331
456 3300048924 Ga0496121_0001560 Ga0496121_0001560_32855_33850 331
457 3300048925 Ga0496122_0024555 Ga0496122_0024555_2363_3358 331
458 3300048925 Ga0496122_0092381 Ga0496122_0092381_143_1138 331
459 3300048926 Ga0496123_0017829 Ga0496123_0017829_3599_4594 331
460 3300048926 Ga0496123_0071073 Ga0496123_0071073_38_1033 331
461 3300048927 Ga0496124_0001266 Ga0496124_0001266_3682_4677 331
462 3300048927 Ga0496124_0016208 Ga0496124_0016208_2128_3123 331
463 3300049459 Ga0495678_000017 Ga0495678_000017_201733_202728 331
464 3300049459 Ga0495678_004822 Ga0495678_004822_3660_4655 331
465 3300049459 Ga0495678_030736 Ga0495678_030736_1063_2058 331
466 3300049460 Ga0495682_0000235 Ga0495682_0000235_38898_39908 331
467 3300049460 Ga0495682_0000375 Ga0495682_0000375_13040_14035 331
468 3300049853 Ga0501226_000002 Ga0501226_000002_318802_319797 331
469 3300053121 Ga0500607_044538 Ga0500607_044538_829_1827 331
470 3300053140 Ga0500573_0082124 Ga0500573_0082124_798_1793 331
471 3300053177 Ga0500636_0000320 Ga0500636_0000320_11812_12810 331
472 3300053729 Ga0500625_009789 Ga0500625_009789_888_1886 331
473 iso_pu_bacteria 2894510363 2894513229 331
474 3300032005 Ga0307411_10262024 Ga0307411_102620241 332
475 3300046528 Ga0495642_0020919 Ga0495642_0020919_266_1309 332
476 3300046615 Ga0495656_0002718 Ga0495656_0002718_4505_5548 332
477 3300047447 Ga0495685_030254 Ga0495685_030254_250_1293 332
478 3300048090 Ga0495615_0000731 Ga0495615_0000731_2993_4036 332
479 3300048905 Ga0496102_0000695 Ga0496102_0000695_5518_6561 332
480 3300048927 Ga0496124_0000161 Ga0496124_0000161_93937_94974 332
481 iso_pu_bacteria 2939669807 2939670753 332
482 3300031344 Ga0265316_10062654 Ga0265316_100626544 333
483 3300037312 Ga0395899_0000141 Ga0395899_0000141_58845_59873 333
484 3300046523 Ga0495644_0013095 Ga0495644_0013095_925_1953 333
485 3300046616 Ga0495668_0052916 Ga0495668_0052916_151_1179 333
486 3300048905 Ga0496102_0524852 Ga0496102_0524852_58_1083 333
487 3300005327 Ga0070658_10199837 Ga0070658_101998372 334
488 3300005445 Ga0070708_100243191 Ga0070708_1002431912 334
489 3300005458 Ga0070681_10001782 Ga0070681_100017829 334
490 3300005546 Ga0070696_100170801 Ga0070696_1001708012 334
491 3300005549 Ga0070704_100219684 Ga0070704_1002196842 334
492 3300006871 Ga0075434_100123079 Ga0075434_1001230793 334
493 3300025912 Ga0207707_10032892 Ga0207707_100328923 334
494 3300025922 Ga0207646_10038514 Ga0207646_100385144 334
495 3300031251 Ga0265327_10000596 Ga0265327_1000059640 334
496 3300035695 Ga0373927_0025120 Ga0373927_0025120_1202_2218 334
497 3300039062 Ga0400483_097611 Ga0400483_097611_31_1056 334
498 3300039062 Ga0400483_197009 Ga0400483_197009_790_1818 334
499 3300045051 Ga0451576_0001019 Ga0451576_0001019_20556_21608 334
500 3300005327 Ga0070658_10063672 Ga0070658_100636723 335
501 3300005334 Ga0068869_100000941 Ga0068869_1000009419 335
502 3300005334 Ga0068869_100006964 Ga0068869_1000069647 335
503 3300005336 Ga0070680_100153328 Ga0070680_1001533281 335
504 3300005549 Ga0070704_100037856 Ga0070704_1000378562 335
505 3300005840 Ga0068870_10117614 Ga0068870_101176143 335
506 3300005843 Ga0068860_100032694 Ga0068860_1000326943 335
507 3300013297 Ga0157378_10212251 Ga0157378_102122512 335
508 3300014968 Ga0157379_10079473 Ga0157379_100794732 335
509 3300025315 Ga0207697_10002307 Ga0207697_100023076 335
510 3300025893 Ga0207682_10002219 Ga0207682_100022196 335
511 3300025908 Ga0207643_10003373 Ga0207643_100033738 335
512 3300025931 Ga0207644_10045469 Ga0207644_100454693 335
513 3300025933 Ga0207706_10028059 Ga0207706_100280593 335
514 3300025942 Ga0207689_10002241 Ga0207689_100022412 335
515 3300026089 Ga0207648_10022390 Ga0207648_100223905 335
516 3300026116 Ga0207674_10014799 Ga0207674_100147995 335
517 3300026121 Ga0207683_10019040 Ga0207683_100190406 335
518 3300031251 Ga0265327_10016338 Ga0265327_100163385 335
519 3300031251 Ga0265327_10026921 Ga0265327_100269212 335
520 3300042436 Ga0439435_0030403 Ga0439435_0030403_209_1246 335
521 3300042876 Ga0451577_0009523 Ga0451577_0009523_7245_8264 335
522 3300042876 Ga0451577_0016674 Ga0451577_0016674_4546_5559 335
523 3300044712 Ga0453684_0010860 Ga0453684_0010860_6243_7262 335
524 3300045051 Ga0451576_0001188 Ga0451576_0001188_29473_30492 335
525 3300045051 Ga0451576_0002786 Ga0451576_0002786_12025_13044 335
526 3300045051 Ga0451576_0036754 Ga0451576_0036754_3835_4848 335
527 3300045051 Ga0451576_0056742 Ga0451576_0056742_2078_3091 335
528 3300048911 Ga0496108_0213602 Ga0496108_0213602_229_1251 335
529 3300048924 Ga0496121_0003426 Ga0496121_0003426_12079_13176 335
530 3300048928 Ga0496125_0109531 Ga0496125_0109531_635_1732 335
531 iso_pu_bacteria 2923525760 2923526276 336
532 3300006038 Ga0075365_10003065 Ga0075365_100030659 337
533 3300006186 Ga0075369_10014439 Ga0075369_100144394 337
534 3300006186 Ga0075369_10042950 Ga0075369_100429503 337
535 3300006195 Ga0075366_10009881 Ga0075366_100098814 337
536 3300006353 Ga0075370_10056625 Ga0075370_100566253 337
537 3300030521 Ga0307511_10000164 Ga0307511_1000016416 337
538 3300033179 Ga0307507_10039851 Ga0307507_100398515 337
539 3300050492 nmdc:mga0yw44_177781_c1 nmdc:mga0yw44_177781_c1_336_1364 337
540 3300050492 nmdc:mga0yw44_9256_c1 nmdc:mga0yw44_9256_c1_704_1732 337
541 3300050493 nmdc:mga0k408_125741_c1 nmdc:mga0k408_125741_c1_457_1485 337
542 3300050494 nmdc:mga06z11_32886_c1 nmdc:mga06z11_32886_c1_716_1744 337
543 3300050496 nmdc:mga07m45_27529_c1 nmdc:mga07m45_27529_c1_687_1715 337
544 3300053090 Ga0500646_0002822 Ga0500646_0002822_2108_3178 337
545 3300053139 Ga0500568_0024923 Ga0500568_0024923_195_1265 337
546 3300053151 Ga0500604_0009938 Ga0500604_0009938_200_1270 337
547 iso_pu_bacteria 2919493220 2919497326 338
548 iso_pu_bacteria 2919543075 2919547471 338
549 iso_pu_bacteria 3007252601 3007254636 339
550 iso_pu_bacteria 2510065053 2510284868 340
551 iso_pu_bacteria 2510065055 2510295178 340
552 iso_pu_bacteria 2510065058 2510312246 340
553 iso_pu_bacteria 2511231004 2511256097 340
554 iso_pu_bacteria 2511231006 2511266080 340
555 iso_pu_bacteria 2511231007 2511272792 340
556 iso_pu_bacteria 2511231010 2511288753 340
557 iso_pu_bacteria 2511231012 2511300147 340
558 iso_pu_bacteria 2511231014 2511316349 340
559 iso_pu_bacteria 2511231015 2511319415 340
560 iso_pu_bacteria 2511231016 2511323520 340
561 iso_pu_bacteria 2511231017 2511330959 340
562 iso_pu_bacteria 2511231018 2511337800 340
563 iso_pu_bacteria 2511231019 2511344562 340
564 iso_pu_bacteria 2511231020 2511349144 340
565 iso_pu_bacteria 2511231021 2511354090 340
566 iso_pu_bacteria 2511231022 2511365047 340
567 iso_pu_bacteria 2511231024 2511376021 340
568 iso_pu_bacteria 2511231156 2511822490 340
569 iso_pu_bacteria 2512047018 2512325985 340
570 iso_pu_bacteria 2554235132 2554818054 340
571 iso_pu_bacteria 2554235231 2555247822 340
572 iso_pu_bacteria 2582580891 2583789776 340
573 iso_pu_bacteria 2597489887 2597855690 340
574 iso_pu_bacteria 2597489888 2597861698 340
575 iso_pu_bacteria 2597489889 2597867421 340
576 iso_pu_bacteria 2599185155 2599327334 340
577 iso_pu_bacteria 2599185160 2599356680 340
578 iso_pu_bacteria 2599185161 2599363288 340
579 iso_pu_bacteria 2599185162 2599369760 340
580 iso_pu_bacteria 2599185163 2599376397 340
581 iso_pu_bacteria 2599185164 2599381785 340
582 iso_pu_bacteria 2599185165 2599388071 340
583 iso_pu_bacteria 2599185166 2599395405 340
584 iso_pu_bacteria 2599185167 2599398820 340
585 iso_pu_bacteria 2599185168 2599407170 340
586 iso_pu_bacteria 2599185179 2599450875 340
587 iso_pu_bacteria 2599185181 2599463513 340
588 iso_pu_bacteria 2599185182 2599469137 340
589 iso_pu_bacteria 2599185185 2599485592 340
590 iso_pu_bacteria 2599185186 2599492532 340
591 iso_pu_bacteria 2599185188 2599500074 340
592 iso_pu_bacteria 2599185189 2599506461 340
593 iso_pu_bacteria 2599185190 2599514179 340
594 iso_pu_bacteria 2599185191 2599518780 340
595 iso_pu_bacteria 2599185212 2599616651 340
596 iso_pu_bacteria 2599185248 2599769448 340
597 iso_pu_bacteria 2599185257 2599806721 340
598 iso_pu_bacteria 2599185288 2599883542 340
599 iso_pu_bacteria 2599185289 2599886868 340
600 iso_pu_bacteria 2599185290 2599893486 340
601 iso_pu_bacteria 2599185291 2599898197 340
602 iso_pu_bacteria 2599185300 2599930930 340
603 iso_pu_bacteria 2599185302 2599944691 340
604 iso_pu_bacteria 2599185303 2599950729 340
605 iso_pu_bacteria 2599185304 2599957311 340
606 iso_pu_bacteria 2599185305 2599962005 340
607 iso_pu_bacteria 2599185306 2599964583 340
608 iso_pu_bacteria 2599185307 2599972995 340
609 iso_pu_bacteria 2599185308 2599978876 340
610 iso_pu_bacteria 2599185309 2599983262 340
611 iso_pu_bacteria 2599185310 2599991649 340
612 iso_pu_bacteria 2599185311 2599994809 340
613 iso_pu_bacteria 2599185312 2600000928 340
614 iso_pu_bacteria 2599185313 2600004898 340
615 iso_pu_bacteria 2599185314 2600012836 340
616 iso_pu_bacteria 2599185315 2600018939 340
617 iso_pu_bacteria 2599185316 2600027035 340
618 iso_pu_bacteria 2599185317 2600030951 340
619 iso_pu_bacteria 2599185318 2600034626 340
620 iso_pu_bacteria 2599185319 2600043432 340
621 iso_pu_bacteria 2599185320 2600048269 340
622 iso_pu_bacteria 2599185321 2600053360 340
623 iso_pu_bacteria 2599185322 2600062744 340
624 iso_pu_bacteria 2599185323 2600068441 340
625 iso_pu_bacteria 2599185324 2600071827 340
626 iso_pu_bacteria 2599185325 2600077703 340
627 iso_pu_bacteria 2599185356 2600216142 340
628 iso_pu_bacteria 2600254930 2600360842 340
629 iso_pu_bacteria 2600254954 2600443876 340
630 iso_pu_bacteria 2600255283 2601627157 340
631 iso_pu_bacteria 2600255296 2601692380 340
632 iso_pu_bacteria 2600255313 2601776309 340
633 iso_pu_bacteria 2600255318 2601797869 340
634 iso_pu_bacteria 2600255389 2602008673 340
635 iso_pu_bacteria 2603880185 2606076648 340
636 iso_pu_bacteria 2603880199 2606128938 340
637 iso_pu_bacteria 2606217733 2608380642 340
638 iso_pu_bacteria 2619619299 2621302148 340
639 iso_pu_bacteria 2623620443 2624478255 340
640 iso_pu_bacteria 2623620446 2624489798 340
641 iso_pu_bacteria 2643221565 2643841023 340
642 iso_pu_bacteria 2643221571 2643872586 340
643 iso_pu_bacteria 2643221589 2643954868 340
644 iso_pu_bacteria 2643221602 2644024508 340
645 iso_pu_bacteria 2643221633 2644190202 340
646 iso_pu_bacteria 2643221650 2644282037 340
647 iso_pu_bacteria 2643221713 2644619680 340
648 iso_pu_bacteria 2651869719 2652547004 340
649 iso_pu_bacteria 2667528170 2671090764 340
650 iso_pu_bacteria 2667528171 2671099930 340
651 iso_pu_bacteria 2667528176 2671127380 340
652 iso_pu_bacteria 2671180172 2671772372 340
653 iso_pu_bacteria 2675903420 2677898923 340
654 iso_pu_bacteria 2675903515 2678261027 340
655 iso_pu_bacteria 2713897149 2715755510 340
656 iso_pu_bacteria 2718217725 2718632193 340
657 iso_pu_bacteria 2721755607 2723246592 340
658 iso_pu_bacteria 2728369097 2729148672 340
659 iso_pu_bacteria 2738541265 2738674117 340
660 iso_pu_bacteria 2738541271 2738687556 340
661 iso_pu_bacteria 2738541282 2738752510 340
662 iso_pu_bacteria 2738541294 2738807875 340
663 iso_pu_bacteria 2738541303 2738861551 340
664 iso_pu_bacteria 2738541309 2738895235 340
665 iso_pu_bacteria 2738543004 2739200496 340
666 iso_pu_bacteria 2738543015 2739260025 340
667 iso_pu_bacteria 2738543016 2739263177 340
668 iso_pu_bacteria 2738543020 2739287108 340
669 iso_pu_bacteria 2738543021 2739292421 340
670 iso_pu_bacteria 2740892503 2743735107 340
671 iso_pu_bacteria 2744054620 2745006338 340
672 iso_pu_bacteria 2765235841 2765586412 340
673 iso_pu_bacteria 2773857670 2774119521 340
674 iso_pu_bacteria 2773857672 2774132363 340
675 iso_pu_bacteria 2784132063 2784261012 340
676 iso_pu_bacteria 2784132072 2784315932 340
677 iso_pu_bacteria 2791355520 2794594016 340
678 iso_pu_bacteria 2806310737 2807410654 340
679 iso_pu_bacteria 2806310745 2807458995 340
680 iso_pu_bacteria 2808606361 2808855978 340
681 iso_pu_bacteria 2808606373 2808905394 340
682 iso_pu_bacteria 2808606376 2808922707 340
683 iso_pu_bacteria 2808606377 2808933118 340
684 iso_pu_bacteria 2808606378 2808936058 340
685 iso_pu_bacteria 2808606379 2808939658 340
686 iso_pu_bacteria 2808606380 2808944394 340
687 iso_pu_bacteria 2808606381 2808955240 340
688 iso_pu_bacteria 2808606382 2808955906 340
689 iso_pu_bacteria 2808606383 2808964445 340
690 iso_pu_bacteria 2808606385 2808976626 340
691 iso_pu_bacteria 2808606388 2808991936 340
692 iso_pu_bacteria 2808606389 2808999333 340
693 iso_pu_bacteria 2808606445 2809218013 340
694 iso_pu_bacteria 2811994881 2812370226 340
695 iso_pu_bacteria 2816332298 2817488442 340
696 iso_pu_bacteria 2818991464 2819705254 340
697 iso_pu_bacteria 2823421272 2823425471 340
698 iso_pu_bacteria 2825651385 2825654231 340
699 iso_pu_bacteria 2826581358 2826586158 340
700 iso_pu_bacteria 2834028612 2834032181 340
701 iso_pu_bacteria 2842805378 2842809900 340
702 iso_pu_bacteria 2842815866 2842817794 340
703 iso_pu_bacteria 2842826826 2842830548 340
704 iso_pu_bacteria 2842832357 2842834196 340
705 iso_pu_bacteria 2842837860 2842838669 340
706 iso_pu_bacteria 2842843487 2842846328 340
707 iso_pu_bacteria 2842849001 2842851742 340
708 iso_pu_bacteria 2842854478 2842858688 340
709 iso_pu_bacteria 2844665904 2844667937 340
710 iso_pu_bacteria 2852612431 2852617107 340
711 iso_pu_bacteria 2852657418 2852660418 340
712 iso_pu_bacteria 2852667396 2852671904 340
713 iso_pu_bacteria 2860339153 2860343605 340
714 iso_pu_bacteria 2860867994 2860868468 340
715 iso_pu_bacteria 2878029506 2878030198 340
716 iso_pu_bacteria 2880230671 2880231147 340
717 iso_pu_bacteria 2904518522 2904519603 340
718 iso_pu_bacteria 2904550169 2904555515 340
719 iso_pu_bacteria 2908446538 2908447061 340
720 iso_pu_bacteria 2912963787 2912968687 340
721 iso_pu_bacteria 2913036834 2913037318 340
722 iso_pu_bacteria 2917070673 2917071209 340
723 iso_pu_bacteria 2917832318 2917834099 340
724 iso_pu_bacteria 2919063839 2919066119 340
725 iso_pu_bacteria 2919125081 2919127678 340
726 iso_pu_bacteria 2919155634 2919155725 340
727 iso_pu_bacteria 2919385768 2919389737 340
728 iso_pu_bacteria 2919456309 2919460023 340
729 iso_pu_bacteria 2919481497 2919486935 340
730 iso_pu_bacteria 2919487758 2919488666 340
731 iso_pu_bacteria 2919501602 2919502206 340
732 iso_pu_bacteria 2919697872 2919698922 340
733 iso_pu_bacteria 2923153595 2923154102 340
734 iso_pu_bacteria 2923519811 2923524314 340
735 iso_pu_bacteria 2923586266 2923589822 340
736 iso_pu_bacteria 2926063275 2926063879 340
737 iso_pu_bacteria 2929144301 2929144852 340
738 iso_pu_bacteria 2929189879 2929190329 340
739 iso_pu_bacteria 2931369376 2931371811 340
740 iso_pu_bacteria 2931390751 2931391411 340
741 iso_pu_bacteria 2931396565 2931398877 340
742 iso_pu_bacteria 2935353572 2935359037 340
743 iso_pu_bacteria 2939636861 2939641144 340
744 iso_pu_bacteria 2939651529 2939654027 340
745 iso_pu_bacteria 2945928738 2945930134 340
746 iso_pu_bacteria 2945961074 2945967624 340
747 iso_pu_bacteria 2946027586 2946028675 340
748 iso_pu_bacteria 2947233263 2947235204 340
749 iso_pu_bacteria 2974298342 2974298709 340
750 iso_pu_bacteria 2984286254 2984291957 340
751 iso_pu_bacteria 2984499530 2984501002 340
752 iso_pu_bacteria 2984504281 2984505552 340
753 iso_pu_bacteria 2988728565 2988732240 340
754 iso_pu_bacteria 2990196909 2990198745 340
755 iso_pu_bacteria 3007315729 3007316581 340
756 iso_pu_bacteria 3007395558 3007399654 340
757 iso_pu_bacteria 3007419365 3007420051 340
758 iso_pu_bacteria 3007511990 3007517950 340
759 iso_pu_bacteria 3007619802 3007622009 340
760 iso_pu_bacteria 3007718800 3007720295 340
761 iso_pu_bacteria 3007803356 3007805380 340
762 iso_pu_bacteria 3007861166 3007864294 340
763 iso_pu_bacteria 3007866637 3007872128 340
764 iso_pu_bacteria 3007872151 3007872649 340
765 iso_pu_bacteria 637000220 637317854 340
766 iso_pu_bacteria 651053060 651177815 340
767 iso_pu_bacteria 8011350971 8011352675 340
768 iso_pu_bacteria 8015687852 8015688351 340
769 iso_pu_bacteria 8016728285 8016732527 340
770 iso_pu_bacteria 8019769354 8019770338 340
771 iso_pu_bacteria 8019775933 8019777374 340
772 iso_pu_bacteria 8034962539 8034963449 340
773 iso_pu_bacteria 8052494512 8052499623 340
774 iso_pu_bacteria 8054285046 8054290978 340
775 iso_pu_bacteria 8054347763 8054350099 340
776 iso_pu_bacteria 8054503363 8054503996 340
777 iso_pu_bacteria 8055817908 8055818396 340
778 iso_pu_bacteria 8055878733 8055879390 340
779 iso_pu_bacteria 8056115690 8056115946 340
780 iso_pu_bacteria 8056120720 8056121100 340
781 iso_pu_bacteria 8056125926 8056126508 340
782 iso_pu_bacteria 8056131705 8056132370 340
783 iso_pu_bacteria 8056137416 8056137817 340
784 iso_pu_bacteria 8056143049 8056143780 340
785 iso_pu_bacteria 8056148874 8056152509 340
786 iso_pu_bacteria 8056155041 8056158550 340
787 iso_pu_bacteria 8056161164 8056164376 340
788 iso_pu_bacteria 8056177738 8056183009 340
789 iso_pu_bacteria 8057798959 8057802740 340
790 3300047446 Ga0495679_010711 Ga0495679_010711_78_1106 342
791 2124908027 MRS2a_Contig_87 MRS2a_00716240 344
792 2162886007 SwRhRL2b_contig_3164853 SwRhRL2b_0510.00007580 344
793 3300002737 JGI25162J39368_1000179 JGI25162J39368_100017957 344
794 3300002771 JGI25163J39215_1000534 JGI25163J39215_10005348 344
795 3300002771 JGI25163J39215_1001084 JGI25163J39215_10010841 344
796 3300002772 JGI25164J39214_1000145 JGI25164J39214_100014557 344
797 3300002772 JGI25164J39214_1000148 JGI25164J39214_10001482 344
798 3300003214 JGI25165J46597_1000266 JGI25165J46597_10002662 344
799 3300003214 JGI25165J46597_1000268 JGI25165J46597_10002682 344
800 3300003751 Ga0055538_1000037 Ga0055538_100003762 344
801 3300003752 Ga0055539_1000048 Ga0055539_100004862 344
802 3300003756 Ga0055533_1000059 Ga0055533_100005962 344
803 3300003758 Ga0055532_1000096 Ga0055532_100009617 344
804 3300003759 Ga0055525_1000189 Ga0055525_100018962 344
805 3300003761 Ga0055535_1006573 Ga0055535_10065732 344
806 3300003781 Ga0055536_1002223 Ga0055536_10022232 344
807 3300003791 Ga0055530_10000374 Ga0055530_100003743 344
808 3300003791 Ga0055530_10000913 Ga0055530_100009132 344
809 3300003791 Ga0055530_10006069 Ga0055530_100060692 344
810 3300003791 Ga0055530_10008702 Ga0055530_100087022 344
811 3300003792 Ga0055540_1000337 Ga0055540_10003372 344
812 3300003792 Ga0055540_1000646 Ga0055540_10006462 344
813 3300003792 Ga0055540_1000657 Ga0055540_10006572 344
814 3300003794 Ga0055531_10000375 Ga0055531_1000037512 344
815 3300003841 Ga0055541_1000035 Ga0055541_100003598 344
816 3300003856 Ga0058692_1008935 Ga0058692_10089352 344
817 3300005288 Ga0065714_10004524 Ga0065714_100045242 344
818 3300005288 Ga0065714_10005755 Ga0065714_100057551 344
819 3300005288 Ga0065714_10066037 Ga0065714_100660372 344
820 3300005288 Ga0065714_10066740 Ga0065714_100667403 344
821 3300005288 Ga0065714_10073326 Ga0065714_100733263 344
822 3300005289 Ga0065704_10000791 Ga0065704_100007912 344
823 3300005289 Ga0065704_10074337 Ga0065704_100743373 344
824 3300005290 Ga0065712_10067752 Ga0065712_1006775244 344
825 3300005290 Ga0065712_10073947 Ga0065712_100739474 344
826 3300005331 Ga0070670_100001434 Ga0070670_10000143415 344
827 3300005344 Ga0070661_100000078 Ga0070661_10000007815 344
828 3300005353 Ga0070669_100001899 Ga0070669_1000018993 344
829 3300005353 Ga0070669_100008275 Ga0070669_1000082754 344
830 3300005457 Ga0070662_100003322 Ga0070662_1000033224 344
831 3300005457 Ga0070662_100003973 Ga0070662_1000039737 344
832 3300005539 Ga0068853_100000210 Ga0068853_10000021013 344
833 3300005548 Ga0070665_100106199 Ga0070665_1001061993 344
834 3300005564 Ga0070664_100007381 Ga0070664_1000073812 344
835 3300005564 Ga0070664_100011338 Ga0070664_1000113382 344
836 3300005578 Ga0068854_100002209 Ga0068854_1000022098 344
837 3300005834 Ga0068851_10000004 Ga0068851_10000004213 344
838 3300006051 Ga0075364_10010083 Ga0075364_100100832 344
839 3300006058 Ga0075432_10001130 Ga0075432_100011302 344
840 3300006058 Ga0075432_10001732 Ga0075432_100017324 344
841 3300006058 Ga0075432_10011064 Ga0075432_100110642 344
842 3300006058 Ga0075432_10020977 Ga0075432_100209772 344
843 3300006177 Ga0075362_10075464 Ga0075362_100754642 344
844 3300006914 Ga0075436_100113931 Ga0075436_1001139312 344
845 3300006946 Ga0079104_1000638 Ga0079104_10006383 344
846 3300006946 Ga0079104_1000654 Ga0079104_10006542 344
847 3300006946 Ga0079104_1002562 Ga0079104_10025629 344
848 3300009011 Ga0105251_10002054 Ga0105251_1000205411 344
849 3300009011 Ga0105251_10003211 Ga0105251_100032118 344
850 3300009011 Ga0105251_10003431 Ga0105251_100034312 344
851 3300009011 Ga0105251_10004126 Ga0105251_100041262 344
852 3300009011 Ga0105251_10009375 Ga0105251_100093753 344
853 3300009011 Ga0105251_10014752 Ga0105251_100147522 344
854 3300009011 Ga0105251_10030370 Ga0105251_100303702 344
855 3300009036 Ga0105244_10000133 Ga0105244_1000013360 344
856 3300009036 Ga0105244_10001762 Ga0105244_100017622 344
857 3300009036 Ga0105244_10004326 Ga0105244_100043267 344
858 3300009036 Ga0105244_10007567 Ga0105244_100075673 344
859 3300009036 Ga0105244_10008580 Ga0105244_100085805 344
860 3300009036 Ga0105244_10044122 Ga0105244_100441221 344
861 3300009036 Ga0105244_10053818 Ga0105244_100538182 344
862 3300009036 Ga0105244_10069843 Ga0105244_100698432 344
863 3300009036 Ga0105244_10134819 Ga0105244_101348191 344
864 3300009036 Ga0105244_10151729 Ga0105244_101517291 344
865 3300009092 Ga0105250_10000423 Ga0105250_100004232 344
866 3300009092 Ga0105250_10000998 Ga0105250_100009983 344
867 3300009092 Ga0105250_10002789 Ga0105250_100027892 344
868 3300009092 Ga0105250_10005320 Ga0105250_100053202 344
869 3300009148 Ga0105243_10001058 Ga0105243_1000105821 344
870 3300009148 Ga0105243_10012296 Ga0105243_100122963 344
871 3300009148 Ga0105243_10019081 Ga0105243_100190813 344
872 3300009148 Ga0105243_10042061 Ga0105243_100420613 344
873 3300009176 Ga0105242_10004878 Ga0105242_100048783 344
874 3300009177 Ga0105248_10075602 Ga0105248_100756022 344
875 3300009545 Ga0105237_10007904 Ga0105237_100079043 344
876 3300009545 Ga0105237_10062200 Ga0105237_100622002 344
877 3300011119 Ga0105246_10005406 Ga0105246_100054066 344
878 3300011119 Ga0105246_10008920 Ga0105246_100089202 344
879 3300011119 Ga0105246_10012531 Ga0105246_100125313 344
880 3300012498 Ga0157345_1000037 Ga0157345_10000372 344
881 3300013100 Ga0157373_10014952 Ga0157373_100149522 344
882 3300013100 Ga0157373_10020174 Ga0157373_100201742 344
883 3300013100 Ga0157373_10106827 Ga0157373_101068273 344
884 3300013102 Ga0157371_10000839 Ga0157371_100008392 344
885 3300013102 Ga0157371_10004811 Ga0157371_100048112 344
886 3300013102 Ga0157371_10075888 Ga0157371_100758882 344
887 3300013104 Ga0157370_10108139 Ga0157370_101081392 344
888 3300013104 Ga0157370_10372650 Ga0157370_103726501 344
889 3300013105 Ga0157369_10001610 Ga0157369_1000161025 344
890 3300013105 Ga0157369_10002373 Ga0157369_100023739 344
891 3300013105 Ga0157369_10008368 Ga0157369_1000836810 344
892 3300013105 Ga0157369_10018752 Ga0157369_100187528 344
893 3300013105 Ga0157369_10054958 Ga0157369_100549582 344
894 3300013105 Ga0157369_10307531 Ga0157369_103075312 344
895 3300013306 Ga0163162_10016283 Ga0163162_100162832 344
896 3300013306 Ga0163162_10034257 Ga0163162_100342574 344
897 3300013307 Ga0157372_10000947 Ga0157372_1000094724 344
898 3300013307 Ga0157372_10006103 Ga0157372_1000610310 344
899 3300013307 Ga0157372_10046612 Ga0157372_100466122 344
900 3300013308 Ga0157375_10001804 Ga0157375_100018042 344
901 3300013308 Ga0157375_10008927 Ga0157375_100089279 344
902 3300014497 Ga0182008_10000659 Ga0182008_1000065920 344
903 3300014497 Ga0182008_10002039 Ga0182008_100020392 344
904 3300014497 Ga0182008_10016896 Ga0182008_100168962 344
905 3300014497 Ga0182008_10045926 Ga0182008_100459262 344
906 3300014497 Ga0182008_10063521 Ga0182008_100635212 344
907 3300014497 Ga0182008_10147453 Ga0182008_101474531 344
908 3300015261 Ga0182006_1003547 Ga0182006_10035478 344
909 3300015261 Ga0182006_1003616 Ga0182006_10036161 344
910 3300015261 Ga0182006_1004404 Ga0182006_10044042 344
911 3300015261 Ga0182006_1008803 Ga0182006_10088032 344
912 3300015261 Ga0182006_1016247 Ga0182006_10162472 344
913 3300015262 Ga0182007_10003862 Ga0182007_100038622 344
914 3300015265 Ga0182005_1009339 Ga0182005_10093392 344
915 3300015265 Ga0182005_1027290 Ga0182005_10272901 344
916 3300017792 Ga0163161_10005035 Ga0163161_100050357 344
917 3300017792 Ga0163161_10013791 Ga0163161_100137916 344
918 3300017792 Ga0163161_10019911 Ga0163161_100199113 344
919 3300017792 Ga0163161_10049299 Ga0163161_100492992 344
920 3300017792 Ga0163161_10064469 Ga0163161_100644692 344
921 3300025207 Ga0209760_100181 Ga0209760_1001811 344
922 3300025207 Ga0209760_100215 Ga0209760_10021520 344
923 3300025224 Ga0209784_100028 Ga0209784_10002897 344
924 3300025225 Ga0209566_100028 Ga0209566_10002897 344
925 3300025226 Ga0209674_100047 Ga0209674_10004797 344
926 3300025229 Ga0209147_100031 Ga0209147_10003197 344
927 3300025230 Ga0209563_100050 Ga0209563_10005097 344
928 3300025231 Ga0207427_100014 Ga0207427_100014410 344
929 3300025231 Ga0207427_100016 Ga0207427_100016202 344
930 3300025233 Ga0209437_100011 Ga0209437_100011391 344
931 3300025233 Ga0209437_100016 Ga0209437_100016227 344
932 3300025242 Ga0209258_100150 Ga0209258_10015052 344
933 3300025246 Ga0209646_1000165 Ga0209646_100016558 344
934 3300025253 Ga0209677_100029 Ga0209677_10002997 344
935 3300025261 Ga0209233_1000019 Ga0209233_1000019391 344
936 3300025261 Ga0209233_1000036 Ga0209233_1000036410 344
937 3300025291 Ga0209675_1002284 Ga0209675_10022845 344
938 3300025292 Ga0209676_1000025 Ga0209676_1000025233 344
939 3300025292 Ga0209676_1000032 Ga0209676_1000032380 344
940 3300025292 Ga0209676_1000326 Ga0209676_10003263 344
941 3300025292 Ga0209676_1001232 Ga0209676_100123218 344
942 3300025292 Ga0209676_1001980 Ga0209676_100198011 344
943 3300025292 Ga0209676_1005752 Ga0209676_10057523 344
944 3300025298 Ga0209050_1000025 Ga0209050_1000025381 344
945 3300025298 Ga0209050_1000028 Ga0209050_1000028300 344
946 3300025298 Ga0209050_1001079 Ga0209050_100107925 344
947 3300025298 Ga0209050_1001508 Ga0209050_100150821 344
948 3300025303 Ga0209051_1000026 Ga0209051_100002628 344
949 3300025303 Ga0209051_1000080 Ga0209051_1000080133 344
950 3300025303 Ga0209051_1000334 Ga0209051_100033420 344
951 3300025304 Ga0209257_1000034 Ga0209257_1000034233 344
952 3300025321 Ga0207656_10000007 Ga0207656_1000000743 344
953 3300025711 Ga0207696_1000020 Ga0207696_10000209 344
954 3300025711 Ga0207696_1000057 Ga0207696_100005765 344
955 3300025711 Ga0207696_1000064 Ga0207696_1000064102 344
956 3300025711 Ga0207696_1000229 Ga0207696_100022967 344
957 3300025711 Ga0207696_1007021 Ga0207696_10070212 344
958 3300025711 Ga0207696_1007799 Ga0207696_10077994 344
959 3300025711 Ga0207696_1007856 Ga0207696_10078562 344
960 3300025728 Ga0207655_1000014 Ga0207655_1000014195 344
961 3300025728 Ga0207655_1000565 Ga0207655_100056536 344
962 3300025728 Ga0207655_1000922 Ga0207655_10009222 344
963 3300025728 Ga0207655_1001818 Ga0207655_10018182 344
964 3300025728 Ga0207655_1002188 Ga0207655_10021889 344
965 3300025728 Ga0207655_1003594 Ga0207655_10035948 344
966 3300025728 Ga0207655_1003980 Ga0207655_10039802 344
967 3300025728 Ga0207655_1004144 Ga0207655_10041442 344
968 3300025728 Ga0207655_1006369 Ga0207655_10063692 344
969 3300025728 Ga0207655_1012256 Ga0207655_10122562 344
970 3300025728 Ga0207655_1013504 Ga0207655_10135043 344
971 3300025728 Ga0207655_1013668 Ga0207655_10136683 344
972 3300025728 Ga0207655_1015717 Ga0207655_10157171 344
973 3300025728 Ga0207655_1017326 Ga0207655_10173262 344
974 3300025728 Ga0207655_1021257 Ga0207655_10212572 344
975 3300025728 Ga0207655_1024286 Ga0207655_10242862 344
976 3300025735 Ga0207713_1000031 Ga0207713_1000031167 344
977 3300025735 Ga0207713_1001119 Ga0207713_10011192 344
978 3300025735 Ga0207713_1001809 Ga0207713_10018093 344
979 3300025735 Ga0207713_1001942 Ga0207713_10019422 344
980 3300025735 Ga0207713_1002040 Ga0207713_10020403 344
981 3300025735 Ga0207713_1003061 Ga0207713_10030615 344
982 3300025735 Ga0207713_1003833 Ga0207713_10038332 344
983 3300025735 Ga0207713_1005577 Ga0207713_10055772 344
984 3300025735 Ga0207713_1008147 Ga0207713_10081476 344
985 3300025735 Ga0207713_1010113 Ga0207713_10101132 344
986 3300025735 Ga0207713_1012460 Ga0207713_10124602 344
987 3300025735 Ga0207713_1012859 Ga0207713_10128592 344
988 3300025735 Ga0207713_1032120 Ga0207713_10321202 344
989 3300025735 Ga0207713_1044489 Ga0207713_10444892 344
990 3300025735 Ga0207713_1057203 Ga0207713_10572032 344
991 3300025914 Ga0207671_10000015 Ga0207671_10000015293 344
992 3300025920 Ga0207649_10000001 Ga0207649_10000001194 344
993 3300025923 Ga0207681_10000480 Ga0207681_1000048017 344
994 3300025923 Ga0207681_10007538 Ga0207681_100075383 344
995 3300025925 Ga0207650_10000868 Ga0207650_1000086817 344
996 3300025925 Ga0207650_10001058 Ga0207650_100010582 344
997 3300025933 Ga0207706_10000624 Ga0207706_100006243 344
998 3300025933 Ga0207706_10006689 Ga0207706_100066892 344
999 3300025934 Ga0207686_10001543 Ga0207686_100015433 344
1000 3300025935 Ga0207709_10000022 Ga0207709_10000022231 344
1001 3300025935 Ga0207709_10000578 Ga0207709_100005782 344
1002 3300025935 Ga0207709_10000971 Ga0207709_1000097115 344
1003 3300025935 Ga0207709_10006325 Ga0207709_100063252 344
1004 3300025935 Ga0207709_10019161 Ga0207709_100191612 344
1005 3300025941 Ga0207711_10085114 Ga0207711_100851142 344
1006 3300025945 Ga0207679_10000011 Ga0207679_10000011194 344
1007 3300025945 Ga0207679_10023183 Ga0207679_100231832 344
1008 3300025981 Ga0207640_10026265 Ga0207640_100262652 344
1009 3300027111 Ga0209281_1000026 Ga0209281_1000026334 344
1010 3300027111 Ga0209281_1000033 Ga0209281_1000033192 344
1011 3300027296 Ga0209389_1000095 Ga0209389_100009516 344
1012 3300027312 Ga0209371_1000217 Ga0209371_10002173 344
1013 3300027312 Ga0209371_1000380 Ga0209371_10003808 344
1014 3300027378 Ga0209981_1003651 Ga0209981_10036512 344
1015 3300027526 Ga0209968_1006407 Ga0209968_10064072 344
1016 3300027552 Ga0209982_1002108 Ga0209982_10021083 344
1017 3300027665 Ga0209983_1007848 Ga0209983_10078482 344
1018 3300027682 Ga0209971_1033319 Ga0209971_10333191 344
1019 3300027907 Ga0207428_10016444 Ga0207428_100164443 344
1020 3300027907 Ga0207428_10033095 Ga0207428_100330953 344
1021 3300027907 Ga0207428_10033756 Ga0207428_100337562 344
1022 3300028379 Ga0268266_10198194 Ga0268266_101981942 344
1023 3300030500 Ga0268256_1000173 Ga0268256_100017365 344
1024 3300030500 Ga0268256_1000428 Ga0268256_10004283 344
1025 3300030521 Ga0307511_10051523 Ga0307511_100515232 344
1026 3300030521 Ga0307511_10111468 Ga0307511_101114682 344
1027 3300030731 Ga0316177_1021354 Ga0316177_10213543 344
1028 3300030735 Ga0316178_1078135 Ga0316178_10781355 344
1029 3300030744 Ga0316181_1110847 Ga0316181_11108472 344
1030 3300031507 Ga0307509_10144094 Ga0307509_101440942 344
1031 3300031548 Ga0307408_100000002 Ga0307408_100000002188 344
1032 3300031548 Ga0307408_100009618 Ga0307408_1000096183 344
1033 3300031548 Ga0307408_100028041 Ga0307408_1000280412 344
1034 3300031548 Ga0307408_100034742 Ga0307408_1000347423 344
1035 3300031548 Ga0307408_100135172 Ga0307408_1001351722 344
1036 3300031730 Ga0307516_10064967 Ga0307516_100649673 344
1037 3300031824 Ga0307413_10016707 Ga0307413_100167072 344
1038 3300031824 Ga0307413_10096802 Ga0307413_100968021 344
1039 3300031824 Ga0307413_10097219 Ga0307413_100972191 344
1040 3300031901 Ga0307406_10009702 Ga0307406_100097022 344
1041 3300031903 Ga0307407_10150306 Ga0307407_101503062 344
1042 3300031911 Ga0307412_10008578 Ga0307412_100085783 344
1043 3300031911 Ga0307412_10043006 Ga0307412_100430062 344
1044 3300031911 Ga0307412_10057077 Ga0307412_100570772 344
1045 3300031911 Ga0307412_10066900 Ga0307412_100669003 344
1046 3300032004 Ga0307414_10025242 Ga0307414_100252422 344
1047 3300032004 Ga0307414_10044524 Ga0307414_100445242 344
1048 3300033180 Ga0307510_10003578 Ga0307510_1000357814 344
1049 3300038705 Ga0237819_01318 Ga0237819_01318_2540_3574 344
1050 3300041404 Ga0439436_0000131 Ga0439436_0000131_15818_16867 344
1051 3300041405 Ga0439438_000621 Ga0439438_000621_2330_3379 344
1052 3300041405 Ga0439438_001072 Ga0439438_001072_7522_8556 344
1053 3300041405 Ga0439438_001956 Ga0439438_001956_4595_5629 344
1054 3300041405 Ga0439438_004256 Ga0439438_004256_1092_2126 344
1055 3300041405 Ga0439438_009079 Ga0439438_009079_1352_2386 344
1056 3300041405 Ga0439438_012486 Ga0439438_012486_538_1572 344
1057 3300041405 Ga0439438_014007 Ga0439438_014007_257_1291 344
1058 3300041407 Ga0439447_000763 Ga0439447_000763_4867_5916 344
1059 3300041407 Ga0439447_003290 Ga0439447_003290_3637_4671 344
1060 3300041407 Ga0439447_003365 Ga0439447_003365_1842_2876 344
1061 3300041407 Ga0439447_004430 Ga0439447_004430_3002_4036 344
1062 3300041411 Ga0439466_0001219 Ga0439466_0001219_5289_6323 344
1063 3300041411 Ga0439466_0001604 Ga0439466_0001604_1511_2554 344
1064 3300041411 Ga0439466_0002254 Ga0439466_0002254_148_1182 344
1065 3300041411 Ga0439466_0006665 Ga0439466_0006665_2683_3717 344
1066 3300041411 Ga0439466_0013355 Ga0439466_0013355_403_1437 344
1067 3300041997 Ga0439431_0005050 Ga0439431_0005050_843_1877 344
1068 3300041997 Ga0439431_0010457 Ga0439431_0010457_187_1230 344
1069 3300042006 Ga0439432_000649 Ga0439432_000649_8731_9765 344
1070 3300042006 Ga0439432_001927 Ga0439432_001927_6740_7774 344
1071 3300042006 Ga0439432_002690 Ga0439432_002690_4868_5917 344
1072 3300042006 Ga0439432_011302 Ga0439432_011302_422_1471 344
1073 3300042006 Ga0439432_044885 Ga0439432_044885_334_1368 344
1074 3300042010 Ga0439452_000992 Ga0439452_000992_5632_6675 344
1075 3300042010 Ga0439452_002987 Ga0439452_002987_3408_4442 344
1076 3300042010 Ga0439452_003025 Ga0439452_003025_1394_2428 344
1077 3300042010 Ga0439452_004088 Ga0439452_004088_2990_4024 344
1078 3300042010 Ga0439452_004161 Ga0439452_004161_505_1539 344
1079 3300042010 Ga0439452_021262 Ga0439452_021262_32_1066 344
1080 3300042013 Ga0439456_000329 Ga0439456_000329_5079_6128 344
1081 3300042013 Ga0439456_007851 Ga0439456_007851_76_1110 344
1082 3300042013 Ga0439456_027872 Ga0439456_027872_117_1151 344
1083 3300042016 Ga0439463_001831 Ga0439463_001831_3666_4700 344
1084 3300042016 Ga0439463_005866 Ga0439463_005866_830_1864 344
1085 3300042115 Ga0450911_000012 Ga0450911_000012_99315_100349 344
1086 3300042115 Ga0450911_001365 Ga0450911_001365_3490_4524 344
1087 3300042122 Ga0450920_000648 Ga0450920_000648_1135_2169 344
1088 3300042124 Ga0450922_001330 Ga0450922_001330_319_1353 344
1089 3300042125 Ga0450923_002136 Ga0450923_002136_1162_2211 344
1090 3300042127 Ga0450890_000220 Ga0450890_000220_6765_7799 344
1091 3300042137 Ga0450902_002922 Ga0450902_002922_499_1533 344
1092 3300042138 Ga0450903_000913 Ga0450903_000913_3645_4679 344
1093 3300042138 Ga0450903_003513 Ga0450903_003513_534_1568 344
1094 3300042138 Ga0450903_004340 Ga0450903_004340_291_1325 344
1095 3300042139 Ga0450904_003232 Ga0450904_003232_143_1177 344
1096 3300042142 Ga0450905_000840 Ga0450905_000840_1547_2596 344
1097 3300042142 Ga0450905_009907 Ga0450905_009907_166_1215 344
1098 3300042145 Ga0450906_004745 Ga0450906_004745_772_1806 344
1099 3300042146 Ga0450907_000627 Ga0450907_000627_712_1746 344
1100 3300042146 Ga0450907_000768 Ga0450907_000768_4850_5884 344
1101 3300042146 Ga0450907_001477 Ga0450907_001477_1646_2680 344
1102 3300042156 Ga0439446_0000393 Ga0439446_0000393_2532_3566 344
1103 3300042156 Ga0439446_0002527 Ga0439446_0002527_3118_4167 344
1104 3300042156 Ga0439446_0013723 Ga0439446_0013723_752_1786 344
1105 3300042185 Ga0450909_000503 Ga0450909_000503_2811_3845 344
1106 3300042435 Ga0439434_0001949 Ga0439434_0001949_1153_2202 344
1107 3300042435 Ga0439434_0003864 Ga0439434_0003864_1096_2130 344
1108 3300042439 Ga0439464_0000082 Ga0439464_0000082_6497_7540 344
1109 3300042439 Ga0439464_0005345 Ga0439464_0005345_154_1191 344
1110 3300042439 Ga0439464_0008678 Ga0439464_0008678_511_1560 344
1111 3300042461 Ga0439460_0002525 Ga0439460_0002525_1840_2874 344
1112 3300042461 Ga0439460_0004133 Ga0439460_0004133_85_1119 344
1113 3300042461 Ga0439460_0005262 Ga0439460_0005262_768_1802 344
1114 3300042530 Ga0450916_001163 Ga0450916_001163_1192_2226 344
1115 3300042876 Ga0451577_0037145 Ga0451577_0037145_2631_3680 344
1116 3300042993 Ga0439440_0005495 Ga0439440_0005495_483_1517 344
1117 3300046452 Ga0495617_001444 Ga0495617_001444_2499_3533 344
1118 3300046452 Ga0495617_011992 Ga0495617_011992_905_1939 344
1119 3300046452 Ga0495617_025525 Ga0495617_025525_103_1137 344
1120 3300046452 Ga0495617_028626 Ga0495617_028626_495_1529 344
1121 3300046452 Ga0495617_043503 Ga0495617_043503_176_1210 344
1122 3300046453 Ga0495627_000529 Ga0495627_000529_27075_28109 344
1123 3300046453 Ga0495627_003516 Ga0495627_003516_322_1356 344
1124 3300046453 Ga0495627_007045 Ga0495627_007045_1123_2157 344
1125 3300046453 Ga0495627_007204 Ga0495627_007204_983_2017 344
1126 3300046455 Ga0495603_0047656 Ga0495603_0047656_47_1081 344
1127 3300046457 Ga0495590_0002060 Ga0495590_0002060_1333_2367 344
1128 3300046457 Ga0495590_0005466 Ga0495590_0005466_1732_2766 344
1129 3300046457 Ga0495590_0023022 Ga0495590_0023022_1068_2102 344
1130 3300046458 Ga0495591_002059 Ga0495591_002059_3552_4586 344
1131 3300046458 Ga0495591_006073 Ga0495591_006073_3865_4899 344
1132 3300046458 Ga0495591_011302 Ga0495591_011302_1867_2901 344
1133 3300046458 Ga0495591_017834 Ga0495591_017834_1341_2375 344
1134 3300046458 Ga0495591_036932 Ga0495591_036932_343_1377 344
1135 3300046459 Ga0495629_0019909 Ga0495629_0019909_1408_2442 344
1136 3300046460 Ga0495638_0006393 Ga0495638_0006393_7028_8062 344
1137 3300046460 Ga0495638_0010178 Ga0495638_0010178_3388_4422 344
1138 3300046460 Ga0495638_0034196 Ga0495638_0034196_1107_2141 344
1139 3300046460 Ga0495638_0047796 Ga0495638_0047796_701_1735 344
1140 3300046463 Ga0495653_0015624 Ga0495653_0015624_3586_4620 344
1141 3300046463 Ga0495653_0017528 Ga0495653_0017528_3529_4563 344
1142 3300046471 Ga0495650_0007745 Ga0495650_0007745_1825_2859 344
1143 3300046471 Ga0495650_0034337 Ga0495650_0034337_264_1298 344
1144 3300046471 Ga0495650_0059124 Ga0495650_0059124_104_1138 344
1145 3300046471 Ga0495650_0075593 Ga0495650_0075593_87_1121 344
1146 3300046471 Ga0495650_0087797 Ga0495650_0087797_140_1174 344
1147 3300046473 Ga0495582_0008697 Ga0495582_0008697_3655_4689 344
1148 3300046474 Ga0495605_0008266 Ga0495605_0008266_3538_4572 344
1149 3300046474 Ga0495605_0021556 Ga0495605_0021556_110_1144 344
1150 3300046474 Ga0495605_0022366 Ga0495605_0022366_1110_2144 344
1151 3300046474 Ga0495605_0025019 Ga0495605_0025019_1872_2906 344
1152 3300046474 Ga0495605_0061667 Ga0495605_0061667_617_1651 344
1153 3300046475 Ga0495639_0001422 Ga0495639_0001422_2441_3475 344
1154 3300046491 Ga0495584_0002039 Ga0495584_0002039_2419_3453 344
1155 3300046491 Ga0495584_0002652 Ga0495584_0002652_6838_7872 344
1156 3300046491 Ga0495584_0002719 Ga0495584_0002719_6558_7592 344
1157 3300046491 Ga0495584_0005232 Ga0495584_0005232_2359_3393 344
1158 3300046491 Ga0495584_0015118 Ga0495584_0015118_1790_2824 344
1159 3300046491 Ga0495584_0027740 Ga0495584_0027740_1019_2053 344
1160 3300046491 Ga0495584_0034216 Ga0495584_0034216_519_1553 344
1161 3300046491 Ga0495584_0034587 Ga0495584_0034587_1269_2303 344
1162 3300046492 Ga0495585_0002838 Ga0495585_0002838_3657_4691 344
1163 3300046492 Ga0495585_0012938 Ga0495585_0012938_21_1055 344
1164 3300046492 Ga0495585_0015956 Ga0495585_0015956_879_1928 344
1165 3300046492 Ga0495585_0026159 Ga0495585_0026159_1960_2994 344
1166 3300046492 Ga0495585_0033012 Ga0495585_0033012_1435_2469 344
1167 3300046499 Ga0495594_0078005 Ga0495594_0078005_331_1365 344
1168 3300046500 Ga0495596_0003856 Ga0495596_0003856_3540_4574 344
1169 3300046501 Ga0495607_0003678 Ga0495607_0003678_6898_7932 344
1170 3300046501 Ga0495607_0005538 Ga0495607_0005538_320_1369 344
1171 3300046501 Ga0495607_0007499 Ga0495607_0007499_3571_4605 344
1172 3300046501 Ga0495607_0011846 Ga0495607_0011846_3371_4405 344
1173 3300046501 Ga0495607_0029106 Ga0495607_0029106_39_1073 344
1174 3300046506 Ga0495583_0006370 Ga0495583_0006370_3553_4587 344
1175 3300046506 Ga0495583_0031423 Ga0495583_0031423_1091_2125 344
1176 3300046507 Ga0495606_0010283 Ga0495606_0010283_6744_7778 344
1177 3300046507 Ga0495606_0016259 Ga0495606_0016259_1223_2257 344
1178 3300046507 Ga0495606_0016825 Ga0495606_0016825_3565_4599 344
1179 3300046507 Ga0495606_0023314 Ga0495606_0023314_3114_4148 344
1180 3300046507 Ga0495606_0056751 Ga0495606_0056751_1006_2040 344
1181 3300046512 Ga0495610_0011015 Ga0495610_0011015_3397_4431 344
1182 3300046512 Ga0495610_0022749 Ga0495610_0022749_382_1416 344
1183 3300046512 Ga0495610_0031606 Ga0495610_0031606_614_1648 344
1184 3300046512 Ga0495610_0043963 Ga0495610_0043963_1100_2134 344
1185 3300046512 Ga0495610_0114325 Ga0495610_0114325_70_1104 344
1186 3300046513 Ga0495616_0009212 Ga0495616_0009212_3526_4560 344
1187 3300046513 Ga0495616_0012671 Ga0495616_0012671_3475_4509 344
1188 3300046513 Ga0495616_0025945 Ga0495616_0025945_1190_2224 344
1189 3300046513 Ga0495616_0089734 Ga0495616_0089734_411_1445 344
1190 3300046515 Ga0495620_0000033 Ga0495620_0000033_111796_112845 344
1191 3300046515 Ga0495620_0001883 Ga0495620_0001883_7753_8787 344
1192 3300046515 Ga0495620_0023181 Ga0495620_0023181_1499_2533 344
1193 3300046515 Ga0495620_0031026 Ga0495620_0031026_665_1699 344
1194 3300046515 Ga0495620_0075995 Ga0495620_0075995_42_1076 344
1195 3300046518 Ga0495631_0002205 Ga0495631_0002205_2157_3191 344
1196 3300046518 Ga0495631_0009569 Ga0495631_0009569_3639_4673 344
1197 3300046518 Ga0495631_0034746 Ga0495631_0034746_1105_2139 344
1198 3300046519 Ga0495632_0007571 Ga0495632_0007571_3553_4587 344
1199 3300046519 Ga0495632_0009381 Ga0495632_0009381_2320_3354 344
1200 3300046519 Ga0495632_0009519 Ga0495632_0009519_2220_3269 344
1201 3300046519 Ga0495632_0009791 Ga0495632_0009791_1277_2311 344
1202 3300046519 Ga0495632_0028616 Ga0495632_0028616_1094_2128 344
1203 3300046519 Ga0495632_0063062 Ga0495632_0063062_101_1135 344
1204 3300046519 Ga0495632_0086625 Ga0495632_0086625_129_1163 344
1205 3300046520 Ga0495637_0001968 Ga0495637_0001968_6921_7955 344
1206 3300046520 Ga0495637_0002004 Ga0495637_0002004_6909_7943 344
1207 3300046520 Ga0495637_0006757 Ga0495637_0006757_3502_4536 344
1208 3300046520 Ga0495637_0010653 Ga0495637_0010653_2349_3383 344
1209 3300046520 Ga0495637_0011044 Ga0495637_0011044_2189_3223 344
1210 3300046520 Ga0495637_0015762 Ga0495637_0015762_11_1045 344
1211 3300046520 Ga0495637_0023979 Ga0495637_0023979_1257_2291 344
1212 3300046522 Ga0495643_0000320 Ga0495643_0000320_59765_60814 344
1213 3300046522 Ga0495643_0001218 Ga0495643_0001218_3626_4675 344
1214 3300046522 Ga0495643_0001318 Ga0495643_0001318_18201_19235 344
1215 3300046522 Ga0495643_0002020 Ga0495643_0002020_12622_13656 344
1216 3300046522 Ga0495643_0016340 Ga0495643_0016340_2581_3615 344
1217 3300046522 Ga0495643_0020842 Ga0495643_0020842_214_1248 344
1218 3300046522 Ga0495643_0065242 Ga0495643_0065242_835_1869 344
1219 3300046523 Ga0495644_0003842 Ga0495644_0003842_1499_2533 344
1220 3300046523 Ga0495644_0007880 Ga0495644_0007880_1812_2846 344
1221 3300046524 Ga0495648_0001594 Ga0495648_0001594_2751_3800 344
1222 3300046524 Ga0495648_0005817 Ga0495648_0005817_3570_4604 344
1223 3300046524 Ga0495648_0015038 Ga0495648_0015038_3389_4423 344
1224 3300046524 Ga0495648_0031170 Ga0495648_0031170_683_1717 344
1225 3300046524 Ga0495648_0032899 Ga0495648_0032899_524_1558 344
1226 3300046524 Ga0495648_0045049 Ga0495648_0045049_545_1579 344
1227 3300046524 Ga0495648_0050273 Ga0495648_0050273_452_1486 344
1228 3300046524 Ga0495648_0104973 Ga0495648_0104973_233_1267 344
1229 3300046526 Ga0495666_0008728 Ga0495666_0008728_1014_2048 344
1230 3300046526 Ga0495666_0010084 Ga0495666_0010084_658_1692 344
1231 3300046528 Ga0495642_0001037 Ga0495642_0001037_3603_4637 344
1232 3300046528 Ga0495642_0003526 Ga0495642_0003526_1560_2594 344
1233 3300046530 Ga0495654_0003927 Ga0495654_0003927_7533_8567 344
1234 3300046530 Ga0495654_0005161 Ga0495654_0005161_5084_6118 344
1235 3300046530 Ga0495654_0013529 Ga0495654_0013529_385_1419 344
1236 3300046530 Ga0495654_0029406 Ga0495654_0029406_812_1846 344
1237 3300046530 Ga0495654_0034179 Ga0495654_0034179_951_1985 344
1238 3300046530 Ga0495654_0041770 Ga0495654_0041770_88_1122 344
1239 3300046530 Ga0495654_0118054 Ga0495654_0118054_147_1181 344
1240 3300046535 Ga0495586_0007783 Ga0495586_0007783_2310_3344 344
1241 3300046536 Ga0495587_0028138 Ga0495587_0028138_1324_2358 344
1242 3300046538 Ga0495609_0006713 Ga0495609_0006713_1354_2388 344
1243 3300046538 Ga0495609_0029798 Ga0495609_0029798_1109_2143 344
1244 3300046538 Ga0495609_0090785 Ga0495609_0090785_24_1058 344
1245 3300046542 Ga0495597_0007155 Ga0495597_0007155_3550_4584 344
1246 3300046542 Ga0495597_0016104 Ga0495597_0016104_1823_2857 344
1247 3300046542 Ga0495597_0023291 Ga0495597_0023291_1048_2097 344
1248 3300046557 Ga0495622_0003131 Ga0495622_0003131_3654_4688 344
1249 3300046557 Ga0495622_0003486 Ga0495622_0003486_3629_4663 344
1250 3300046557 Ga0495622_0003697 Ga0495622_0003697_2488_3522 344
1251 3300046558 Ga0495633_0005836 Ga0495633_0005836_2764_3798 344
1252 3300046558 Ga0495633_0013790 Ga0495633_0013790_2562_3596 344
1253 3300046558 Ga0495633_0026655 Ga0495633_0026655_853_1887 344
1254 3300046616 Ga0495668_0008501 Ga0495668_0008501_3545_4579 344
1255 3300046616 Ga0495668_0020927 Ga0495668_0020927_1654_2688 344
1256 3300046642 Ga0495634_0025576 Ga0495634_0025576_1571_2605 344
1257 3300046648 Ga0495611_0004851 Ga0495611_0004851_3468_4502 344
1258 3300046660 Ga0495625_0039024 Ga0495625_0039024_1245_2279 344
1259 3300046660 Ga0495625_0068636 Ga0495625_0068636_1046_2080 344
1260 3300046660 Ga0495625_0084031 Ga0495625_0084031_787_1821 344
1261 3300046663 Ga0495635_0003150 Ga0495635_0003150_7165_8199 344
1262 3300046663 Ga0495635_0020517 Ga0495635_0020517_2452_3486 344
1263 3300046664 Ga0495659_0000898 Ga0495659_0000898_7115_8149 344
1264 3300046665 Ga0495661_0000027 Ga0495661_0000027_135288_136337 344
1265 3300046665 Ga0495661_0002713 Ga0495661_0002713_3271_4305 344
1266 3300046665 Ga0495661_0021626 Ga0495661_0021626_2095_3129 344
1267 3300046665 Ga0495661_0042821 Ga0495661_0042821_1006_2040 344
1268 3300046674 Ga0495588_0005887 Ga0495588_0005887_2264_3298 344
1269 3300046679 Ga0495623_0113346 Ga0495623_0113346_52_1086 344
1270 3300046680 Ga0495646_0024969 Ga0495646_0024969_1131_2165 344
1271 3300046680 Ga0495646_0029258 Ga0495646_0029258_1414_2448 344
1272 3300046680 Ga0495646_0088129 Ga0495646_0088129_749_1783 344
1273 3300046684 Ga0495669_0005394 Ga0495669_0005394_3554_4588 344
1274 3300046689 Ga0495613_0239131 Ga0495613_0239131_207_1241 344
1275 3300046690 Ga0495624_0010987 Ga0495624_0010987_1673_2707 344
1276 3300046691 Ga0495670_0006616 Ga0495670_0006616_3484_4518 344
1277 3300046691 Ga0495670_0018417 Ga0495670_0018417_1721_2755 344
1278 3300046692 Ga0495671_0003627 Ga0495671_0003627_5989_7023 344
1279 3300046692 Ga0495671_0008302 Ga0495671_0008302_3697_4731 344
1280 3300046692 Ga0495671_0011636 Ga0495671_0011636_3785_4819 344
1281 3300046692 Ga0495671_0022710 Ga0495671_0022710_1794_2828 344
1282 3300046692 Ga0495671_0028826 Ga0495671_0028826_262_1296 344
1283 3300046692 Ga0495671_0086428 Ga0495671_0086428_326_1360 344
1284 3300046694 Ga0495649_0005095 Ga0495649_0005095_3660_4694 344
1285 3300046694 Ga0495649_0007572 Ga0495649_0007572_4179_5270 344
1286 3300046694 Ga0495649_0008280 Ga0495649_0008280_3382_4416 344
1287 3300046694 Ga0495649_0021138 Ga0495649_0021138_1026_2060 344
1288 3300046694 Ga0495649_0028112 Ga0495649_0028112_778_1812 344
1289 3300046694 Ga0495649_0049769 Ga0495649_0049769_162_1196 344
1290 3300046694 Ga0495649_0053183 Ga0495649_0053183_1090_2124 344
1291 3300046694 Ga0495649_0154499 Ga0495649_0154499_121_1155 344
1292 3300046794 Ga0495589_0000779 Ga0495589_0000779_3495_4529 344
1293 3300046794 Ga0495589_0001384 Ga0495589_0001384_3667_4701 344
1294 3300046794 Ga0495589_0028800 Ga0495589_0028800_745_1779 344
1295 3300046810 Ga0495660_0012424 Ga0495660_0012424_2125_3159 344
1296 3300046810 Ga0495660_0013851 Ga0495660_0013851_2583_3617 344
1297 3300046810 Ga0495660_0015751 Ga0495660_0015751_2176_3210 344
1298 3300046810 Ga0495660_0035194 Ga0495660_0035194_1152_2186 344
1299 3300046810 Ga0495660_0037361 Ga0495660_0037361_615_1649 344
1300 3300046810 Ga0495660_0044958 Ga0495660_0044958_394_1428 344
1301 3300046810 Ga0495660_0058841 Ga0495660_0058841_988_2022 344
1302 3300047315 Ga0495581_0016399 Ga0495581_0016399_2299_3333 344
1303 3300047317 Ga0495604_0014396 Ga0495604_0014396_1719_2753 344
1304 3300047317 Ga0495604_0027098 Ga0495604_0027098_1090_2124 344
1305 3300047317 Ga0495604_0065044 Ga0495604_0065044_1106_2140 344
1306 3300047318 Ga0495636_0005482 Ga0495636_0005482_3345_4379 344
1307 3300047318 Ga0495636_0037720 Ga0495636_0037720_911_1945 344
1308 3300047320 Ga0495672_0000763 Ga0495672_0000763_30366_31400 344
1309 3300047320 Ga0495672_0006798 Ga0495672_0006798_1524_2558 344
1310 3300047320 Ga0495672_0028178 Ga0495672_0028178_273_1307 344
1311 3300047320 Ga0495672_0029496 Ga0495672_0029496_1468_2502 344
1312 3300047320 Ga0495672_0035435 Ga0495672_0035435_1569_2603 344
1313 3300047320 Ga0495672_0042520 Ga0495672_0042520_1155_2189 344
1314 3300047320 Ga0495672_0053732 Ga0495672_0053732_324_1358 344
1315 3300047320 Ga0495672_0060169 Ga0495672_0060169_1007_2041 344
1316 3300047321 Ga0495676_0023384 Ga0495676_0023384_3430_4464 344
1317 3300047321 Ga0495676_0025400 Ga0495676_0025400_1092_2183 344
1318 3300047322 Ga0495680_0059666 Ga0495680_0059666_1126_2160 344
1319 3300047323 Ga0495683_0000044 Ga0495683_0000044_91861_92910 344
1320 3300047323 Ga0495683_0006364 Ga0495683_0006364_1862_2896 344
1321 3300047323 Ga0495683_0007390 Ga0495683_0007390_2204_3238 344
1322 3300047443 Ga0495687_011346 Ga0495687_011346_18_1052 344
1323 3300047443 Ga0495687_020451 Ga0495687_020451_889_1923 344
1324 3300047444 Ga0495675_0030981 Ga0495675_0030981_287_1321 344
1325 3300047445 Ga0495677_0012445 Ga0495677_0012445_685_1719 344
1326 3300047446 Ga0495679_008146 Ga0495679_008146_2086_3120 344
1327 3300047446 Ga0495679_019486 Ga0495679_019486_579_1613 344
1328 3300047469 Ga0495673_0002585 Ga0495673_0002585_7937_8971 344
1329 3300047469 Ga0495673_0008758 Ga0495673_0008758_1190_2224 344
1330 3300047469 Ga0495673_0011692 Ga0495673_0011692_1801_2835 344
1331 3300047469 Ga0495673_0020978 Ga0495673_0020978_1191_2225 344
1332 3300047469 Ga0495673_0021947 Ga0495673_0021947_156_1190 344
1333 3300047469 Ga0495673_0022877 Ga0495673_0022877_1244_2278 344
1334 3300047469 Ga0495673_0045595 Ga0495673_0045595_574_1608 344
1335 3300047470 Ga0495681_0004457 Ga0495681_0004457_7014_8048 344
1336 3300047470 Ga0495681_0009885 Ga0495681_0009885_3507_4541 344
1337 3300047470 Ga0495681_0010214 Ga0495681_0010214_3556_4590 344
1338 3300047470 Ga0495681_0032244 Ga0495681_0032244_674_1708 344
1339 3300047470 Ga0495681_0049286 Ga0495681_0049286_41_1075 344
1340 3300047470 Ga0495681_0086147 Ga0495681_0086147_205_1239 344
1341 3300047472 Ga0495686_0013640 Ga0495686_0013640_1232_2266 344
1342 3300047472 Ga0495686_0036498 Ga0495686_0036498_1585_2619 344
1343 3300047472 Ga0495686_0080318 Ga0495686_0080318_842_1876 344
1344 3300047673 Ga0495593_0056273 Ga0495593_0056273_102_1136 344
1345 3300047673 Ga0495593_0097531 Ga0495593_0097531_91_1125 344
1346 3300048091 Ga0495626_0002818 Ga0495626_0002818_3546_4580 344
1347 3300048091 Ga0495626_0002988 Ga0495626_0002988_3557_4591 344
1348 3300048091 Ga0495626_0006156 Ga0495626_0006156_2273_3307 344
1349 3300048091 Ga0495626_0007037 Ga0495626_0007037_1675_2709 344
1350 3300048091 Ga0495626_0008455 Ga0495626_0008455_1121_2155 344
1351 3300048091 Ga0495626_0011117 Ga0495626_0011117_1691_2725 344
1352 3300048091 Ga0495626_0011321 Ga0495626_0011321_1857_2891 344
1353 3300048905 Ga0496102_0019211 Ga0496102_0019211_1311_2345 344
1354 3300048914 Ga0496111_0101712 Ga0496111_0101712_199_1248 344
1355 3300048915 Ga0496112_0088735 Ga0496112_0088735_492_1526 344
1356 3300048917 Ga0496114_0028589 Ga0496114_0028589_170_1219 344
1357 3300048919 Ga0496116_0000567 Ga0496116_0000567_44976_46010 344
1358 3300048919 Ga0496116_0000699 Ga0496116_0000699_39014_40048 344
1359 3300048919 Ga0496116_0005627 Ga0496116_0005627_7166_8200 344
1360 3300048919 Ga0496116_0029132 Ga0496116_0029132_1266_2315 344
1361 3300048919 Ga0496116_0038984 Ga0496116_0038984_1366_2400 344
1362 3300048919 Ga0496116_0100577 Ga0496116_0100577_22_1056 344
1363 3300048920 Ga0496117_0000970 Ga0496117_0000970_5788_6837 344
1364 3300048920 Ga0496117_0005390 Ga0496117_0005390_3271_4305 344
1365 3300048920 Ga0496117_0005662 Ga0496117_0005662_60_1109 344
1366 3300048920 Ga0496117_0015316 Ga0496117_0015316_2039_3073 344
1367 3300048920 Ga0496117_0060409 Ga0496117_0060409_1306_2340 344
1368 3300048920 Ga0496117_0064469 Ga0496117_0064469_1359_2408 344
1369 3300048921 Ga0496118_0003741 Ga0496118_0003741_12748_13797 344
1370 3300048921 Ga0496118_0013161 Ga0496118_0013161_5905_6939 344
1371 3300048921 Ga0496118_0020934 Ga0496118_0020934_1181_2230 344
1372 3300048921 Ga0496118_0029278 Ga0496118_0029278_3483_4517 344
1373 3300048921 Ga0496118_0066163 Ga0496118_0066163_1361_2395 344
1374 3300048921 Ga0496118_0196226 Ga0496118_0196226_86_1120 344
1375 3300048922 Ga0496119_0000071 Ga0496119_0000071_101871_102920 344
1376 3300048922 Ga0496119_0061053 Ga0496119_0061053_478_1512 344
1377 3300048923 Ga0496120_0001138 Ga0496120_0001138_33185_34234 344
1378 3300048924 Ga0496121_0001800 Ga0496121_0001800_3491_4525 344
1379 3300048924 Ga0496121_0038220 Ga0496121_0038220_1145_2179 344
1380 3300048924 Ga0496121_0055901 Ga0496121_0055901_1131_2165 344
1381 3300048924 Ga0496121_0094317 Ga0496121_0094317_664_1698 344
1382 3300048925 Ga0496122_0002157 Ga0496122_0002157_8438_9487 344
1383 3300048925 Ga0496122_0010986 Ga0496122_0010986_819_1853 344
1384 3300048925 Ga0496122_0035282 Ga0496122_0035282_1051_2085 344
1385 3300048925 Ga0496122_0039381 Ga0496122_0039381_2538_3572 344
1386 3300048926 Ga0496123_0001464 Ga0496123_0001464_12366_13415 344
1387 3300048926 Ga0496123_0010203 Ga0496123_0010203_723_1757 344
1388 3300048926 Ga0496123_0053420 Ga0496123_0053420_1538_2575 344
1389 3300048926 Ga0496123_0054141 Ga0496123_0054141_740_1774 344
1390 3300048927 Ga0496124_0013081 Ga0496124_0013081_3636_4685 344
1391 3300048927 Ga0496124_0020818 Ga0496124_0020818_1760_2794 344
1392 3300048927 Ga0496124_0044724 Ga0496124_0044724_180_1229 344
1393 3300048928 Ga0496125_0005700 Ga0496125_0005700_3258_4292 344
1394 3300048928 Ga0496125_0006235 Ga0496125_0006235_3166_4200 344
1395 3300048928 Ga0496125_0022792 Ga0496125_0022792_1181_2230 344
1396 3300048928 Ga0496125_0087678 Ga0496125_0087678_164_1213 344
1397 3300048929 Ga0496126_0037383 Ga0496126_0037383_781_1830 344
1398 3300048929 Ga0496126_0070636 Ga0496126_0070636_971_2005 344
1399 3300048929 Ga0496126_0120094 Ga0496126_0120094_784_1818 344
1400 3300048929 Ga0496126_0223009 Ga0496126_0223009_11_1060 344
1401 3300049459 Ga0495678_002786 Ga0495678_002786_3764_4798 344
1402 3300049459 Ga0495678_004463 Ga0495678_004463_240_1274 344
1403 3300049459 Ga0495678_012743 Ga0495678_012743_2195_3229 344
1404 3300049459 Ga0495678_015697 Ga0495678_015697_92_1126 344
1405 3300049459 Ga0495678_023028 Ga0495678_023028_1202_2251 344
1406 3300049459 Ga0495678_029026 Ga0495678_029026_1191_2225 344
1407 3300049460 Ga0495682_0013192 Ga0495682_0013192_1026_2060 344
1408 3300049460 Ga0495682_0021880 Ga0495682_0021880_695_1729 344
1409 3300049571 Ga0501034_0000165 Ga0501034_0000165_12598_13647 344
1410 3300049571 Ga0501034_0024789 Ga0501034_0024789_2926_3960 344
1411 3300049574 Ga0501038_0048395 Ga0501038_0048395_2621_3655 344
1412 3300049758 Ga0501241_000551 Ga0501241_000551_281_1315 344
1413 3300053111 Ga0500572_002322 Ga0500572_002322_30_1064 344
1414 3300053135 Ga0500659_0005122 Ga0500659_0005122_5119_6168 344
1415 3300053161 Ga0500634_0015157 Ga0500634_0015157_2084_3118 344
1416 iso_pu_bacteria 2511231011 2511297382 344
1417 iso_pu_bacteria 2511231023 2511368960 344
1418 iso_pu_bacteria 2511231031 2511414329 344
1419 iso_pu_bacteria 2554235341 2555667459 344
1420 iso_pu_bacteria 2600254931 2600364849 344
1421 iso_pu_bacteria 2713897148 2715749242 344
1422 iso_pu_bacteria 2738543025 2739311316 344
1423 iso_pu_bacteria 2773857673 2774134769 344
1424 iso_pu_bacteria 2818991456 2819657267 344
1425 iso_pu_bacteria 2946006987 2946012478 344
1426 iso_pu_bacteria 2969304461 2969304994 344
1427 iso_pu_bacteria 2974289157 2974293316 344
1428 iso_pu_bacteria 2998139840 2998140499 344
1429 iso_pu_bacteria 3007614139 3007617840 344
1430 iso_pu_bacteria 3007855910 3007859734 344
1431 iso_pu_bacteria 8029995093 8030000240 344
1432 iso_pu_bacteria 8054929484 8054934199 344
1433 iso_pu_bacteria 8056166840 8056170552 344
1434 iso_pu_bacteria 8056172158 8056176672 344
1435 iso_pu_bacteria 8056569372 8056572354 344

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01075

Glyco_transf_9

Glycosyltransferase family 9 (heptosyltransferase)

118

368

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1psw-assembly1.cif.gz_A structure of e. coli adp-heptose lps heptosyltransferase ii 0.9328 1 336
1psw-assembly1.cif.gz_A structure of e. coli adp-heptose lps heptosyltransferase ii 0.9137 1 336
3tov-assembly2.cif.gz_B the crystal structure of the glycosyl transferase family 9 from veillonella parvula dsm 2008 0.8612 2 336
3tov-assembly1.cif.gz_A the crystal structure of the glycosyl transferase family 9 from veillonella parvula dsm 2008 0.8486 2 336
3tov-assembly1.cif.gz_A the crystal structure of the glycosyl transferase family 9 from veillonella parvula dsm 2008 0.8254 2 336
ID Description Score Start End Superfamily
af_P37692_2_151_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9841 2 142 3.40.50.2000
1pswA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9712 2 142 3.40.50.2000
1pswA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9316 157 336 3.40.50.2000
af_P37692_2_151_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9196 2 142 3.40.50.2000
1pswA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9143 2 142 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A832X174-F1-model_v4 deleted 0.9949 14 137
AF-A0A703UJM1-F1-model_v4 lipopolysaccharide heptosyltransferase II (EC 2.4.99.24) 0.9913 1 137 GO:0005829
GO:0008713
GO:0009244
AF-A0A2S5M2U0-F1-model_v4 lipopolysaccharide heptosyltransferase II (EC 2.4.99.24) 0.9897 2 122 GO:0005829
GO:0008713
GO:0009244
AF-A0A767W205-F1-model_v4 lipopolysaccharide heptosyltransferase II (EC 2.4.99.24) 0.981 1 149 GO:0005829
GO:0008713
GO:0009244
AF-A0A832X174-F1-model_v4 deleted 0.9792 14 137

Feature Viewer

pLDDT pTM Quality
92.91 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map