F493902
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1430 | 517 | 2860 | 115 |
Family's Representative Sequence
| Representative Sequence | 3300046660|Ga0495625_0406750|Ga0495625_0406750_214_636 |
| Length | 140 |
| Sequence | MSDWLANFVGDPYALLVLVIAGFLPNEVWRMLGLWLGGGVDEGSEVLIWVRAVATAILAGVIAQILVQPPGALASVPDWLRYGAVAAGFIVFMLTRRSIFAGVVCGEAAMVAGKWWLGGLQPPHNSLLSLQHKKTSGETA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 9 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 85 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 93 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 104 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 136 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 213 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 214 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 215 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 218 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 220 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 221 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 222 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 223 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 224 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 226 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 228 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 229 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 230 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 231 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 232 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 233 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 234 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 235 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 236 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 237 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 238 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 239 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 240 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 241 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 242 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 243 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 244 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 247 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 248 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 252 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 253 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 254 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 255 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 256 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 257 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 258 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 259 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 260 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 261 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 262 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 263 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 264 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 265 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 266 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 267 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 268 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 270 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 272 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 273 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 274 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 275 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 276 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 277 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 278 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 279 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 280 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 281 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 282 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 284 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 285 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 286 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 287 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 288 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 289 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 290 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 291 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 292 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 293 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 294 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 295 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 296 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 297 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 298 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 299 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 300 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 395 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 396 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 397 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 398 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 399 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 400 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 401 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 403 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 404 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 405 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 406 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 407 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 408 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 409 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 410 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 411 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 412 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 413 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 414 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 415 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 416 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 417 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 418 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 419 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 420 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 443 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 444 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 445 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 446 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 447 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 448 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 449 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 455 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 458 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 462 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 463 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 464 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 465 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 466 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 467 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 468 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 469 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 470 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 471 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 472 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 473 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 474 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 475 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 476 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 477 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 478 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 479 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 480 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 481 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 482 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 483 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 484 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 485 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 486 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 487 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 488 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 489 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 490 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 491 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 492 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 493 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 494 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 495 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 496 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 497 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 498 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 499 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 500 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 501 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 502 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 503 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 504 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 505 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 506 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 507 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 508 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 509 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 510 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 511 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 512 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 513 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 514 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 515 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 516 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 517 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.86 |
| Metatranscriptomes | 0.07 |
| Isolates | 0.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.8 |
| Nodule | 0.07 |
| Rhizoplane | 6.5 |
| Rhizosphere | 73.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495625_0406750 | 3300046660 | Bacteria | 849 |
| 2 | JGI24740J21852_10018916 | 3300001979 | Bacteria | 2433 |
| 3 | JGI24739J22299_10037604 | 3300001989 | Bacteria | 1630 |
| 4 | JGI24735J21928_10017658 | 3300002067 | Bacteria | 2205 |
| 5 | JGI24034J26672_10043150 | 3300002239 | Bacteria | 761 |
| 6 | JGI25406J46586_10006595 | 3300003203 | Bacteria | 5335 |
| 7 | rootH1_10245633 | 3300003323 | Bacteria | 1412 |
| 8 | rootH1_10331927 | 3300003323 | Bacteria | 1041 |
| 9 | JGI25404J52841_10000284 | 3300003659 | Bacteria | 6542 |
| 10 | JGI25404J52841_10004715 | 3300003659 | Bacteria | 2784 |
| 11 | JGI25404J52841_10008794 | 3300003659 | Bacteria | 2157 |
| 12 | JGI25404J52841_10012849 | 3300003659 | Bacteria | 1816 |
| 13 | JGI25404J52841_10014178 | 3300003659 | Bacteria | 1729 |
| 14 | Ga0055526_1017110 | 3300003771 | Bacteria | 2792 |
| 15 | Ga0070658_10084498 | 3300005327 | Bacteria | 2610 |
| 16 | Ga0070676_10230035 | 3300005328 | Bacteria | 1228 |
| 17 | Ga0070683_100075117 | 3300005329 | Bacteria | 3158 |
| 18 | Ga0070690_100140369 | 3300005330 | Bacteria | 1640 |
| 19 | Ga0070690_100329500 | 3300005330 | Bacteria | 1103 |
| 20 | Ga0070670_100216359 | 3300005331 | Bacteria | 1667 |
| 21 | Ga0070670_101255005 | 3300005331 | Bacteria | 678 |
| 22 | Ga0068869_100052003 | 3300005334 | Bacteria | 2973 |
| 23 | Ga0068869_100118587 | 3300005334 | Bacteria | 2021 |
| 24 | Ga0068869_100199930 | 3300005334 | Bacteria | 1575 |
| 25 | Ga0068869_100544171 | 3300005334 | Bacteria | 974 |
| 26 | Ga0070666_10576762 | 3300005335 | Bacteria | 820 |
| 27 | Ga0070680_100055739 | 3300005336 | Bacteria | 3230 |
| 28 | Ga0070680_100116478 | 3300005336 | Bacteria | 2227 |
| 29 | Ga0070680_100135204 | 3300005336 | Bacteria | 2065 |
| 30 | Ga0070682_101494226 | 3300005337 | Bacteria | 581 |
| 31 | Ga0068868_100238841 | 3300005338 | Bacteria | 1526 |
| 32 | Ga0068868_100529506 | 3300005338 | Bacteria | 1036 |
| 33 | Ga0068868_100536017 | 3300005338 | Bacteria | 1030 |
| 34 | Ga0068868_100846972 | 3300005338 | Bacteria | 828 |
| 35 | Ga0070689_100309548 | 3300005340 | Bacteria | 1317 |
| 36 | Ga0070689_100360363 | 3300005340 | Bacteria | 1222 |
| 37 | Ga0070689_100808855 | 3300005340 | Bacteria | 824 |
| 38 | Ga0070691_10110224 | 3300005341 | Bacteria | 1376 |
| 39 | Ga0070687_101016541 | 3300005343 | Bacteria | 602 |
| 40 | Ga0070661_100298463 | 3300005344 | Bacteria | 1253 |
| 41 | Ga0070692_10589669 | 3300005345 | Bacteria | 734 |
| 42 | Ga0070692_10687928 | 3300005345 | Bacteria | 687 |
| 43 | Ga0070668_100065242 | 3300005347 | Bacteria | 2824 |
| 44 | Ga0070668_100248210 | 3300005347 | Bacteria | 1477 |
| 45 | Ga0070668_100298097 | 3300005347 | Bacteria | 1351 |
| 46 | Ga0070668_100368048 | 3300005347 | Bacteria | 1220 |
| 47 | Ga0070668_100452177 | 3300005347 | Bacteria | 1104 |
| 48 | Ga0070668_100639780 | 3300005347 | Bacteria | 934 |
| 49 | Ga0070668_100773098 | 3300005347 | Bacteria | 851 |
| 50 | Ga0070668_100817871 | 3300005347 | Bacteria | 829 |
| 51 | Ga0070669_100166629 | 3300005353 | Bacteria | 1715 |
| 52 | Ga0070669_100251368 | 3300005353 | Bacteria | 1408 |
| 53 | Ga0070669_101213858 | 3300005353 | Bacteria | 652 |
| 54 | Ga0070671_100245054 | 3300005355 | Bacteria | 1521 |
| 55 | Ga0070671_100635296 | 3300005355 | Bacteria | 924 |
| 56 | Ga0070671_101145657 | 3300005355 | Bacteria | 684 |
| 57 | Ga0070671_101250748 | 3300005355 | Bacteria | 654 |
| 58 | Ga0070674_100053767 | 3300005356 | Bacteria | 2782 |
| 59 | Ga0070674_100106814 | 3300005356 | Bacteria | 2049 |
| 60 | Ga0070674_101947050 | 3300005356 | Bacteria | 535 |
| 61 | Ga0070673_100235500 | 3300005364 | Bacteria | 1590 |
| 62 | Ga0070673_100368142 | 3300005364 | Bacteria | 1279 |
| 63 | Ga0070688_100234467 | 3300005365 | Bacteria | 1300 |
| 64 | Ga0070688_100327781 | 3300005365 | Bacteria | 1114 |
| 65 | Ga0070688_100579307 | 3300005365 | Bacteria | 856 |
| 66 | Ga0070688_100830649 | 3300005365 | Bacteria | 724 |
| 67 | Ga0070659_100111795 | 3300005366 | Bacteria | 2206 |
| 68 | Ga0070659_100852448 | 3300005366 | Bacteria | 794 |
| 69 | Ga0070667_100286345 | 3300005367 | Bacteria | 1481 |
| 70 | Ga0070709_10015318 | 3300005434 | Bacteria | 4360 |
| 71 | Ga0070709_10255217 | 3300005434 | Bacteria | 1265 |
| 72 | Ga0070709_10312389 | 3300005434 | Bacteria | 1151 |
| 73 | Ga0070709_10326413 | 3300005434 | Bacteria | 1128 |
| 74 | Ga0070709_11136663 | 3300005434 | Bacteria | 626 |
| 75 | Ga0070714_100009232 | 3300005435 | Bacteria | 7747 |
| 76 | Ga0070714_100095477 | 3300005435 | Bacteria | 2611 |
| 77 | Ga0070714_100750762 | 3300005435 | Bacteria | 943 |
| 78 | Ga0070713_100001913 | 3300005436 | Bacteria | 13423 |
| 79 | Ga0070713_100008075 | 3300005436 | Bacteria | 7440 |
| 80 | Ga0070713_100021836 | 3300005436 | Bacteria | 4934 |
| 81 | Ga0070713_100021931 | 3300005436 | Bacteria | 4926 |
| 82 | Ga0070713_100396764 | 3300005436 | Bacteria | 1288 |
| 83 | Ga0070713_100838945 | 3300005436 | Bacteria | 882 |
| 84 | Ga0070710_10001428 | 3300005437 | Bacteria | 11278 |
| 85 | Ga0070710_10021540 | 3300005437 | Bacteria | 3361 |
| 86 | Ga0070710_10159964 | 3300005437 | Bacteria | 1396 |
| 87 | Ga0070710_10896839 | 3300005437 | Bacteria | 640 |
| 88 | Ga0070710_10941383 | 3300005437 | Bacteria | 626 |
| 89 | Ga0070701_10154385 | 3300005438 | Bacteria | 1324 |
| 90 | Ga0070701_10271144 | 3300005438 | Bacteria | 1033 |
| 91 | Ga0070711_100002884 | 3300005439 | Bacteria | 9901 |
| 92 | Ga0070711_100022506 | 3300005439 | Bacteria | 4086 |
| 93 | Ga0070711_100849314 | 3300005439 | Bacteria | 777 |
| 94 | Ga0070711_100999219 | 3300005439 | Bacteria | 718 |
| 95 | Ga0070705_100142370 | 3300005440 | Bacteria | 1580 |
| 96 | Ga0070700_100087149 | 3300005441 | Bacteria | 2029 |
| 97 | Ga0070700_100340364 | 3300005441 | Bacteria | 1109 |
| 98 | Ga0070694_100737143 | 3300005444 | Bacteria | 804 |
| 99 | Ga0070663_100018502 | 3300005455 | Bacteria | 4570 |
| 100 | Ga0070663_100020934 | 3300005455 | Bacteria | 4339 |
| 101 | Ga0070663_100029630 | 3300005455 | Bacteria | 3743 |
| 102 | Ga0070663_100102906 | 3300005455 | Bacteria | 2134 |
| 103 | Ga0070663_100105474 | 3300005455 | Bacteria | 2109 |
| 104 | Ga0070663_100208070 | 3300005455 | Bacteria | 1531 |
| 105 | Ga0070663_100357665 | 3300005455 | Bacteria | 1184 |
| 106 | Ga0070663_100861056 | 3300005455 | Bacteria | 780 |
| 107 | Ga0070663_101467329 | 3300005455 | Bacteria | 606 |
| 108 | Ga0070678_100008379 | 3300005456 | Bacteria | 6189 |
| 109 | Ga0070678_100071386 | 3300005456 | Bacteria | 2599 |
| 110 | Ga0070678_100162351 | 3300005456 | Bacteria | 1811 |
| 111 | Ga0070678_100241447 | 3300005456 | Bacteria | 1511 |
| 112 | Ga0070678_100419219 | 3300005456 | Bacteria | 1167 |
| 113 | Ga0070678_100530375 | 3300005456 | Bacteria | 1043 |
| 114 | Ga0070678_101965262 | 3300005456 | Bacteria | 553 |
| 115 | Ga0070678_102153808 | 3300005456 | Bacteria | 528 |
| 116 | Ga0070662_100101524 | 3300005457 | Bacteria | 2178 |
| 117 | Ga0070662_100526195 | 3300005457 | Bacteria | 988 |
| 118 | Ga0070662_100544906 | 3300005457 | Bacteria | 972 |
| 119 | Ga0070662_101272236 | 3300005457 | Bacteria | 633 |
| 120 | Ga0070681_10072711 | 3300005458 | Bacteria | 3401 |
| 121 | Ga0070681_10117014 | 3300005458 | Bacteria | 2602 |
| 122 | Ga0070681_11196568 | 3300005458 | Bacteria | 682 |
| 123 | Ga0068867_100163781 | 3300005459 | Bacteria | 1756 |
| 124 | Ga0070685_10269893 | 3300005466 | Bacteria | 1135 |
| 125 | Ga0070706_100515445 | 3300005467 | Bacteria | 1112 |
| 126 | Ga0070706_100519340 | 3300005467 | Bacteria | 1108 |
| 127 | Ga0070707_100319127 | 3300005468 | Bacteria | 1510 |
| 128 | Ga0070707_100820373 | 3300005468 | Bacteria | 894 |
| 129 | Ga0070707_101501412 | 3300005468 | Bacteria | 641 |
| 130 | Ga0070707_102152343 | 3300005468 | Bacteria | 525 |
| 131 | Ga0070698_100183267 | 3300005471 | Bacteria | 2032 |
| 132 | Ga0070698_100185402 | 3300005471 | Bacteria | 2019 |
| 133 | Ga0070698_101919341 | 3300005471 | Unclassified | 545 |
| 134 | Ga0070699_100141536 | 3300005518 | Bacteria | 2125 |
| 135 | Ga0070679_100010022 | 3300005530 | Bacteria | 8973 |
| 136 | Ga0070679_100074939 | 3300005530 | Bacteria | 3374 |
| 137 | Ga0070684_100159468 | 3300005535 | Bacteria | 2046 |
| 138 | Ga0070684_101266737 | 3300005535 | Bacteria | 694 |
| 139 | Ga0070697_101075536 | 3300005536 | Bacteria | 716 |
| 140 | Ga0070697_101292318 | 3300005536 | Bacteria | 651 |
| 141 | Ga0068853_100006903 | 3300005539 | Bacteria | 9063 |
| 142 | Ga0068853_100323189 | 3300005539 | Bacteria | 1431 |
| 143 | Ga0068853_100453799 | 3300005539 | Bacteria | 1206 |
| 144 | Ga0068853_100717130 | 3300005539 | Bacteria | 955 |
| 145 | Ga0068853_100784836 | 3300005539 | Bacteria | 912 |
| 146 | Ga0070672_100227548 | 3300005543 | Bacteria | 1566 |
| 147 | Ga0070672_100354887 | 3300005543 | Bacteria | 1250 |
| 148 | Ga0070672_101014453 | 3300005543 | Bacteria | 736 |
| 149 | Ga0070686_100199392 | 3300005544 | Bacteria | 1434 |
| 150 | Ga0070695_100377702 | 3300005545 | Bacteria | 1069 |
| 151 | Ga0070696_100452323 | 3300005546 | Bacteria | 1013 |
| 152 | Ga0070696_101339913 | 3300005546 | Bacteria | 609 |
| 153 | Ga0070693_100040365 | 3300005547 | Bacteria | 2620 |
| 154 | Ga0070693_100105898 | 3300005547 | Bacteria | 1721 |
| 155 | Ga0070665_100002761 | 3300005548 | Bacteria | 19030 |
| 156 | Ga0070665_100028064 | 3300005548 | Bacteria | 5669 |
| 157 | Ga0070665_100036089 | 3300005548 | Bacteria | 4974 |
| 158 | Ga0070665_100232823 | 3300005548 | Bacteria | 1842 |
| 159 | Ga0070665_100241295 | 3300005548 | Bacteria | 1808 |
| 160 | Ga0070665_100535610 | 3300005548 | Bacteria | 1183 |
| 161 | Ga0070665_100783630 | 3300005548 | Bacteria | 966 |
| 162 | Ga0070665_101126063 | 3300005548 | Bacteria | 796 |
| 163 | Ga0070665_101281209 | 3300005548 | Bacteria | 743 |
| 164 | Ga0070704_100625093 | 3300005549 | Bacteria | 949 |
| 165 | Ga0068855_100005114 | 3300005563 | Bacteria | 15990 |
| 166 | Ga0068855_100061235 | 3300005563 | Bacteria | 4398 |
| 167 | Ga0068855_100106133 | 3300005563 | Bacteria | 3229 |
| 168 | Ga0068855_101348151 | 3300005563 | Bacteria | 737 |
| 169 | Ga0068857_100029142 | 3300005577 | Bacteria | 4871 |
| 170 | Ga0068857_100152385 | 3300005577 | Bacteria | 2095 |
| 171 | Ga0068857_100190946 | 3300005577 | Bacteria | 1865 |
| 172 | Ga0068854_100015484 | 3300005578 | Bacteria | 5054 |
| 173 | Ga0068854_100024882 | 3300005578 | Bacteria | 4104 |
| 174 | Ga0068854_101632339 | 3300005578 | Bacteria | 588 |
| 175 | Ga0068854_102266864 | 3300005578 | Bacteria | 503 |
| 176 | Ga0068856_100010355 | 3300005614 | Bacteria | 9057 |
| 177 | Ga0068856_100016084 | 3300005614 | Bacteria | 7231 |
| 178 | Ga0068856_100523613 | 3300005614 | Bacteria | 1207 |
| 179 | Ga0070702_100017077 | 3300005615 | Bacteria | 3736 |
| 180 | Ga0070702_100271496 | 3300005615 | Bacteria | 1160 |
| 181 | Ga0068852_100210962 | 3300005616 | Bacteria | 1842 |
| 182 | Ga0068859_100032608 | 3300005617 | Bacteria | 5231 |
| 183 | Ga0068859_100036626 | 3300005617 | Bacteria | 4925 |
| 184 | Ga0068859_101590398 | 3300005617 | Bacteria | 722 |
| 185 | Ga0068859_102956824 | 3300005617 | Bacteria | 520 |
| 186 | Ga0068859_103024148 | 3300005617 | Bacteria | 514 |
| 187 | Ga0068864_100122963 | 3300005618 | Bacteria | 2323 |
| 188 | Ga0068864_100388207 | 3300005618 | Bacteria | 1325 |
| 189 | Ga0068866_10769440 | 3300005718 | Bacteria | 667 |
| 190 | Ga0068866_11094072 | 3300005718 | Bacteria | 571 |
| 191 | Ga0068861_100291490 | 3300005719 | Bacteria | 1409 |
| 192 | Ga0068851_10002904 | 3300005834 | Bacteria | 7569 |
| 193 | Ga0068863_100342772 | 3300005841 | Bacteria | 1454 |
| 194 | Ga0068863_100744675 | 3300005841 | Bacteria | 975 |
| 195 | Ga0068858_100081959 | 3300005842 | Bacteria | 2998 |
| 196 | Ga0068858_100429075 | 3300005842 | Bacteria | 1272 |
| 197 | Ga0068858_100612353 | 3300005842 | Bacteria | 1057 |
| 198 | Ga0068858_101370014 | 3300005842 | Bacteria | 697 |
| 199 | Ga0068860_100000149 | 3300005843 | Bacteria | 113068 |
| 200 | Ga0068860_100066977 | 3300005843 | Bacteria | 3412 |
| 201 | Ga0068860_100178468 | 3300005843 | Bacteria | 2053 |
| 202 | Ga0068860_100313494 | 3300005843 | Bacteria | 1539 |
| 203 | Ga0068860_100834815 | 3300005843 | Bacteria | 936 |
| 204 | Ga0068860_102467838 | 3300005843 | Bacteria | 540 |
| 205 | Ga0068862_100092022 | 3300005844 | Bacteria | 2642 |
| 206 | Ga0068862_100227331 | 3300005844 | Bacteria | 1691 |
| 207 | Ga0068862_100278417 | 3300005844 | Bacteria | 1532 |
| 208 | Ga0068862_100418115 | 3300005844 | Bacteria | 1257 |
| 209 | Ga0068862_100692512 | 3300005844 | Bacteria | 986 |
| 210 | Ga0068862_100768635 | 3300005844 | Bacteria | 938 |
| 211 | Ga0081455_10008954 | 3300005937 | Bacteria | 10344 |
| 212 | Ga0081455_10010256 | 3300005937 | Bacteria | 9526 |
| 213 | Ga0081455_10038775 | 3300005937 | Bacteria | 4217 |
| 214 | Ga0081455_10137816 | 3300005937 | Bacteria | 1899 |
| 215 | Ga0081538_10366194 | 3300005981 | Bacteria | 521 |
| 216 | Ga0081540_1001309 | 3300005983 | Bacteria | 21732 |
| 217 | Ga0081540_1001846 | 3300005983 | Bacteria | 17751 |
| 218 | Ga0081540_1004914 | 3300005983 | Bacteria | 10063 |
| 219 | Ga0081540_1017082 | 3300005983 | Bacteria | 4509 |
| 220 | Ga0081540_1017644 | 3300005983 | Bacteria | 4409 |
| 221 | Ga0081540_1018007 | 3300005983 | Bacteria | 4349 |
| 222 | Ga0081540_1019764 | 3300005983 | Bacteria | 4080 |
| 223 | Ga0081540_1026602 | 3300005983 | Bacteria | 3298 |
| 224 | Ga0081540_1028970 | 3300005983 | Bacteria | 3096 |
| 225 | Ga0081540_1057747 | 3300005983 | Bacteria | 1875 |
| 226 | Ga0081540_1172786 | 3300005983 | Bacteria | 820 |
| 227 | Ga0081539_10000176 | 3300005985 | Bacteria | 150292 |
| 228 | Ga0081539_10001416 | 3300005985 | Bacteria | 41282 |
| 229 | Ga0081539_10023931 | 3300005985 | Bacteria | 3983 |
| 230 | Ga0081539_10219926 | 3300005985 | Bacteria | 865 |
| 231 | Ga0070717_10006449 | 3300006028 | Bacteria | 8633 |
| 232 | Ga0070717_10007137 | 3300006028 | Bacteria | 8279 |
| 233 | Ga0070717_10012334 | 3300006028 | Bacteria | 6513 |
| 234 | Ga0070717_10415341 | 3300006028 | Bacteria | 1210 |
| 235 | Ga0075365_10042089 | 3300006038 | Bacteria | 2985 |
| 236 | Ga0075365_10129843 | 3300006038 | Bacteria | 1743 |
| 237 | Ga0075365_10239811 | 3300006038 | Bacteria | 1273 |
| 238 | Ga0075365_10429735 | 3300006038 | Bacteria | 932 |
| 239 | Ga0075365_10741444 | 3300006038 | Bacteria | 694 |
| 240 | Ga0075365_11144698 | 3300006038 | Bacteria | 548 |
| 241 | Ga0075365_11346469 | 3300006038 | Bacteria | 501 |
| 242 | Ga0075368_10118826 | 3300006042 | Bacteria | 1093 |
| 243 | Ga0075368_10198478 | 3300006042 | Bacteria | 849 |
| 244 | Ga0075363_100050436 | 3300006048 | Bacteria | 2217 |
| 245 | Ga0075363_100069001 | 3300006048 | Bacteria | 1918 |
| 246 | Ga0075363_100613262 | 3300006048 | Bacteria | 653 |
| 247 | Ga0075364_10183397 | 3300006051 | Bacteria | 1417 |
| 248 | Ga0075364_10401061 | 3300006051 | Bacteria | 936 |
| 249 | Ga0075364_10474157 | 3300006051 | Bacteria | 855 |
| 250 | Ga0075364_10675943 | 3300006051 | Bacteria | 705 |
| 251 | Ga0070715_10000460 | 3300006163 | Bacteria | 10536 |
| 252 | Ga0070716_100002855 | 3300006173 | Bacteria | 8047 |
| 253 | Ga0070716_100229188 | 3300006173 | Bacteria | 1253 |
| 254 | Ga0070716_100274003 | 3300006173 | Bacteria | 1161 |
| 255 | Ga0070716_100366005 | 3300006173 | Bacteria | 1025 |
| 256 | Ga0070716_100511754 | 3300006173 | Bacteria | 888 |
| 257 | Ga0070716_101426344 | 3300006173 | Bacteria | 564 |
| 258 | Ga0070712_100007349 | 3300006175 | Bacteria | 6875 |
| 259 | Ga0070712_100033986 | 3300006175 | Bacteria | 3454 |
| 260 | Ga0070712_100137861 | 3300006175 | Bacteria | 1858 |
| 261 | Ga0070712_100409923 | 3300006175 | Bacteria | 1121 |
| 262 | Ga0070712_101041671 | 3300006175 | Bacteria | 709 |
| 263 | Ga0075362_10032172 | 3300006177 | Bacteria | 2274 |
| 264 | Ga0075362_10442349 | 3300006177 | Bacteria | 660 |
| 265 | Ga0075362_10476935 | 3300006177 | Bacteria | 636 |
| 266 | Ga0075367_10193737 | 3300006178 | Bacteria | 1269 |
| 267 | Ga0075367_10205660 | 3300006178 | Bacteria | 1230 |
| 268 | Ga0075367_10962582 | 3300006178 | Bacteria | 545 |
| 269 | Ga0075367_10980478 | 3300006178 | Bacteria | 539 |
| 270 | Ga0075367_11024060 | 3300006178 | Bacteria | 527 |
| 271 | Ga0075369_10030536 | 3300006186 | Bacteria | 2270 |
| 272 | Ga0075369_10051573 | 3300006186 | Bacteria | 1781 |
| 273 | Ga0075369_10177426 | 3300006186 | Bacteria | 980 |
| 274 | Ga0075369_10252106 | 3300006186 | Bacteria | 820 |
| 275 | Ga0075369_10522609 | 3300006186 | Bacteria | 565 |
| 276 | Ga0075366_10124923 | 3300006195 | Bacteria | 1551 |
| 277 | Ga0075366_10189049 | 3300006195 | Bacteria | 1251 |
| 278 | Ga0075366_10199128 | 3300006195 | Bacteria | 1218 |
| 279 | Ga0075366_10386647 | 3300006195 | Bacteria | 861 |
| 280 | Ga0097621_100137460 | 3300006237 | Bacteria | 2085 |
| 281 | Ga0097621_100174216 | 3300006237 | Bacteria | 1856 |
| 282 | Ga0097621_100624080 | 3300006237 | Bacteria | 987 |
| 283 | Ga0097621_101222842 | 3300006237 | Bacteria | 708 |
| 284 | Ga0097621_101418977 | 3300006237 | Bacteria | 658 |
| 285 | Ga0075370_10024488 | 3300006353 | Bacteria | 3335 |
| 286 | Ga0075370_10142482 | 3300006353 | Bacteria | 1401 |
| 287 | Ga0075370_10195886 | 3300006353 | Bacteria | 1191 |
| 288 | Ga0075370_10336999 | 3300006353 | Bacteria | 900 |
| 289 | Ga0075370_10454695 | 3300006353 | Bacteria | 771 |
| 290 | Ga0068871_100110507 | 3300006358 | Bacteria | 2312 |
| 291 | Ga0075428_100066108 | 3300006844 | Bacteria | 3959 |
| 292 | Ga0075428_101667424 | 3300006844 | Bacteria | 666 |
| 293 | Ga0075431_100140441 | 3300006847 | Bacteria | 2490 |
| 294 | Ga0075434_100231591 | 3300006871 | Bacteria | 1867 |
| 295 | Ga0068865_100071666 | 3300006881 | Bacteria | 2459 |
| 296 | Ga0068865_100099885 | 3300006881 | Bacteria | 2122 |
| 297 | Ga0068865_100368330 | 3300006881 | Bacteria | 1168 |
| 298 | Ga0068865_100501627 | 3300006881 | Bacteria | 1012 |
| 299 | Ga0068865_101397579 | 3300006881 | Bacteria | 625 |
| 300 | Ga0097620_100032608 | 3300006931 | Bacteria | 5231 |
| 301 | Ga0097620_100036626 | 3300006931 | Bacteria | 4925 |
| 302 | Ga0097620_101590173 | 3300006931 | Bacteria | 722 |
| 303 | Ga0097620_102957478 | 3300006931 | Bacteria | 520 |
| 304 | Ga0097620_103024179 | 3300006931 | Bacteria | 514 |
| 305 | Ga0075435_100124227 | 3300007076 | Bacteria | 2156 |
| 306 | Ga0075435_101259872 | 3300007076 | Unclassified | 647 |
| 307 | Ga0099794_10036834 | 3300007265 | Bacteria | 2314 |
| 308 | Ga0099795_10027848 | 3300007788 | Bacteria | 1916 |
| 309 | Ga0099795_10052265 | 3300007788 | Bacteria | 1492 |
| 310 | Ga0099795_10061731 | 3300007788 | Bacteria | 1392 |
| 311 | Ga0105240_10004765 | 3300009093 | Bacteria | 20483 |
| 312 | Ga0105240_10034450 | 3300009093 | Bacteria | 6531 |
| 313 | Ga0105240_10071834 | 3300009093 | Bacteria | 4279 |
| 314 | Ga0105240_10078859 | 3300009093 | Bacteria | 4054 |
| 315 | Ga0105240_10230644 | 3300009093 | Bacteria | 2152 |
| 316 | Ga0105240_11066144 | 3300009093 | Bacteria | 861 |
| 317 | Ga0111539_10060214 | 3300009094 | Bacteria | 4500 |
| 318 | Ga0105245_10106409 | 3300009098 | Bacteria | 2603 |
| 319 | Ga0105245_10191629 | 3300009098 | Bacteria | 1958 |
| 320 | Ga0105245_10377635 | 3300009098 | Bacteria | 1411 |
| 321 | Ga0105245_10583897 | 3300009098 | Bacteria | 1142 |
| 322 | Ga0105245_10819958 | 3300009098 | Bacteria | 969 |
| 323 | Ga0105245_11287609 | 3300009098 | Bacteria | 780 |
| 324 | Ga0105245_12269721 | 3300009098 | Bacteria | 596 |
| 325 | Ga0105247_10025319 | 3300009101 | Bacteria | 3578 |
| 326 | Ga0105247_10164630 | 3300009101 | Bacteria | 1471 |
| 327 | Ga0105247_10258475 | 3300009101 | Bacteria | 1193 |
| 328 | Ga0105247_10571998 | 3300009101 | Bacteria | 834 |
| 329 | Ga0105247_10641124 | 3300009101 | Bacteria | 793 |
| 330 | Ga0105247_11090613 | 3300009101 | Bacteria | 629 |
| 331 | Ga0114129_11647188 | 3300009147 | Bacteria | 784 |
| 332 | Ga0105243_10172123 | 3300009148 | Bacteria | 1876 |
| 333 | Ga0105243_10388473 | 3300009148 | Bacteria | 1293 |
| 334 | Ga0105243_10581149 | 3300009148 | Bacteria | 1075 |
| 335 | Ga0105243_11040773 | 3300009148 | Bacteria | 824 |
| 336 | Ga0105243_11462993 | 3300009148 | Bacteria | 706 |
| 337 | Ga0105243_13006512 | 3300009148 | Bacteria | 511 |
| 338 | Ga0105241_10001875 | 3300009174 | Bacteria | 15935 |
| 339 | Ga0105241_10049725 | 3300009174 | Bacteria | 3194 |
| 340 | Ga0105241_10411186 | 3300009174 | Bacteria | 1189 |
| 341 | Ga0105242_10036881 | 3300009176 | Bacteria | 3925 |
| 342 | Ga0105242_10245631 | 3300009176 | Bacteria | 1611 |
| 343 | Ga0105242_10413168 | 3300009176 | Bacteria | 1262 |
| 344 | Ga0105242_10853813 | 3300009176 | Bacteria | 906 |
| 345 | Ga0105242_11501539 | 3300009176 | Bacteria | 704 |
| 346 | Ga0105248_10185213 | 3300009177 | Bacteria | 2346 |
| 347 | Ga0105248_10933304 | 3300009177 | Bacteria | 980 |
| 348 | Ga0105237_10057288 | 3300009545 | Bacteria | 3900 |
| 349 | Ga0105237_10074813 | 3300009545 | Bacteria | 3379 |
| 350 | Ga0105237_10182633 | 3300009545 | Bacteria | 2097 |
| 351 | Ga0105237_10414356 | 3300009545 | Bacteria | 1352 |
| 352 | Ga0105237_10538641 | 3300009545 | Bacteria | 1174 |
| 353 | Ga0105237_10657888 | 3300009545 | Bacteria | 1054 |
| 354 | Ga0105237_10851956 | 3300009545 | Bacteria | 918 |
| 355 | Ga0105237_10981688 | 3300009545 | Bacteria | 851 |
| 356 | Ga0105237_11447125 | 3300009545 | Bacteria | 694 |
| 357 | Ga0105238_10010766 | 3300009551 | Bacteria | 9187 |
| 358 | Ga0105238_10022965 | 3300009551 | Bacteria | 6358 |
| 359 | Ga0105238_10104024 | 3300009551 | Bacteria | 2820 |
| 360 | Ga0105238_10105365 | 3300009551 | Bacteria | 2801 |
| 361 | Ga0105238_10339499 | 3300009551 | Bacteria | 1490 |
| 362 | Ga0105238_10467360 | 3300009551 | Bacteria | 1260 |
| 363 | Ga0105238_10533447 | 3300009551 | Bacteria | 1177 |
| 364 | Ga0105238_11636176 | 3300009551 | Bacteria | 674 |
| 365 | Ga0105238_11952177 | 3300009551 | Bacteria | 620 |
| 366 | Ga0105249_10248999 | 3300009553 | Bacteria | 1761 |
| 367 | Ga0105249_10540431 | 3300009553 | Bacteria | 1215 |
| 368 | Ga0105249_10558034 | 3300009553 | Bacteria | 1197 |
| 369 | Ga0105249_10872223 | 3300009553 | Bacteria | 966 |
| 370 | Ga0105249_11826654 | 3300009553 | Bacteria | 680 |
| 371 | Ga0105249_13110340 | 3300009553 | Bacteria | 533 |
| 372 | Ga0099796_10028131 | 3300010159 | Bacteria | 1802 |
| 373 | Ga0099796_10073148 | 3300010159 | Bacteria | 1242 |
| 374 | Ga0099796_10492846 | 3300010159 | Bacteria | 548 |
| 375 | Ga0105239_10023684 | 3300010375 | Bacteria | 6759 |
| 376 | Ga0105239_10117927 | 3300010375 | Bacteria | 2946 |
| 377 | Ga0105239_10296279 | 3300010375 | Bacteria | 1821 |
| 378 | Ga0105239_10363184 | 3300010375 | Bacteria | 1635 |
| 379 | Ga0105239_10445611 | 3300010375 | Bacteria | 1468 |
| 380 | Ga0105239_11052192 | 3300010375 | Bacteria | 936 |
| 381 | Ga0105239_11113824 | 3300010375 | Bacteria | 909 |
| 382 | Ga0105246_10272362 | 3300011119 | Bacteria | 1354 |
| 383 | Ga0105246_10738007 | 3300011119 | Bacteria | 867 |
| 384 | Ga0105246_10858383 | 3300011119 | Bacteria | 810 |
| 385 | Ga0157371_10580325 | 3300013102 | Bacteria | 833 |
| 386 | Ga0157370_10027175 | 3300013104 | Bacteria | 5642 |
| 387 | Ga0157370_10255017 | 3300013104 | Bacteria | 1622 |
| 388 | Ga0157369_10761473 | 3300013105 | Bacteria | 996 |
| 389 | Ga0157369_12192452 | 3300013105 | Bacteria | 560 |
| 390 | Ga0157374_10058369 | 3300013296 | Bacteria | 3606 |
| 391 | Ga0157374_10353092 | 3300013296 | Bacteria | 1461 |
| 392 | Ga0157374_11556082 | 3300013296 | Bacteria | 685 |
| 393 | Ga0157374_12630916 | 3300013296 | Bacteria | 531 |
| 394 | Ga0157378_10027145 | 3300013297 | Bacteria | 5052 |
| 395 | Ga0157378_10375694 | 3300013297 | Bacteria | 1395 |
| 396 | Ga0163162_10064357 | 3300013306 | Bacteria | 3712 |
| 397 | Ga0163162_10457298 | 3300013306 | Bacteria | 1408 |
| 398 | Ga0163162_10558336 | 3300013306 | Bacteria | 1273 |
| 399 | Ga0163162_10592383 | 3300013306 | Bacteria | 1235 |
| 400 | Ga0163162_10749804 | 3300013306 | Bacteria | 1096 |
| 401 | Ga0163162_10821781 | 3300013306 | Bacteria | 1046 |
| 402 | Ga0163162_11547979 | 3300013306 | Bacteria | 756 |
| 403 | Ga0163162_12648991 | 3300013306 | Bacteria | 577 |
| 404 | Ga0157372_10146202 | 3300013307 | Bacteria | 2726 |
| 405 | Ga0157372_10566633 | 3300013307 | Bacteria | 1324 |
| 406 | Ga0157372_13316849 | 3300013307 | Bacteria | 513 |
| 407 | Ga0157375_10017467 | 3300013308 | Bacteria | 6475 |
| 408 | Ga0157375_10046033 | 3300013308 | Bacteria | 4250 |
| 409 | Ga0157375_10289997 | 3300013308 | Bacteria | 1799 |
| 410 | Ga0157375_11084594 | 3300013308 | Bacteria | 937 |
| 411 | Ga0157375_11569927 | 3300013308 | Bacteria | 778 |
| 412 | Ga0157375_11975945 | 3300013308 | Bacteria | 693 |
| 413 | Ga0157375_12144644 | 3300013308 | Bacteria | 665 |
| 414 | Ga0157375_12379754 | 3300013308 | Bacteria | 632 |
| 415 | Ga0163163_10012476 | 3300014325 | Bacteria | 7745 |
| 416 | Ga0163163_10091768 | 3300014325 | Bacteria | 3052 |
| 417 | Ga0163163_10490339 | 3300014325 | Bacteria | 1290 |
| 418 | Ga0163163_10496239 | 3300014325 | Bacteria | 1282 |
| 419 | Ga0163163_10525014 | 3300014325 | Bacteria | 1246 |
| 420 | Ga0163163_11044300 | 3300014325 | Bacteria | 880 |
| 421 | Ga0163163_11238310 | 3300014325 | Bacteria | 809 |
| 422 | Ga0157380_10156299 | 3300014326 | Bacteria | 1977 |
| 423 | Ga0157380_10339773 | 3300014326 | Bacteria | 1400 |
| 424 | Ga0157380_12815690 | 3300014326 | Bacteria | 553 |
| 425 | Ga0182008_10707214 | 3300014497 | Bacteria | 576 |
| 426 | Ga0182008_10790206 | 3300014497 | Bacteria | 550 |
| 427 | Ga0157377_10440009 | 3300014745 | Bacteria | 897 |
| 428 | Ga0157377_10833812 | 3300014745 | Bacteria | 683 |
| 429 | Ga0157379_10091190 | 3300014968 | Bacteria | 2734 |
| 430 | Ga0157379_10166683 | 3300014968 | Bacteria | 1988 |
| 431 | Ga0157379_10175791 | 3300014968 | Bacteria | 1933 |
| 432 | Ga0157379_10332247 | 3300014968 | Bacteria | 1389 |
| 433 | Ga0157379_10819157 | 3300014968 | Bacteria | 879 |
| 434 | Ga0157376_10050762 | 3300014969 | Bacteria | 3443 |
| 435 | Ga0157376_10056908 | 3300014969 | Bacteria | 3269 |
| 436 | Ga0157376_11424776 | 3300014969 | Bacteria | 725 |
| 437 | Ga0157376_11570659 | 3300014969 | Bacteria | 692 |
| 438 | Ga0163161_10047763 | 3300017792 | Bacteria | 3090 |
| 439 | Ga0163161_10209322 | 3300017792 | Bacteria | 1506 |
| 440 | Ga0163161_10902197 | 3300017792 | Bacteria | 749 |
| 441 | Ga0213876_10112793 | 3300021384 | Bacteria | 1443 |
| 442 | Ga0213876_10171651 | 3300021384 | Bacteria | 1154 |
| 443 | Ga0209148_1009946 | 3300025254 | Bacteria | 1825 |
| 444 | Ga0209233_1006130 | 3300025261 | Bacteria | 3909 |
| 445 | Ga0209455_1004451 | 3300025272 | Bacteria | 4579 |
| 446 | Ga0209130_1048229 | 3300025284 | Bacteria | 787 |
| 447 | Ga0209564_1000871 | 3300025295 | Bacteria | 40145 |
| 448 | Ga0209758_1008123 | 3300025297 | Bacteria | 6901 |
| 449 | Ga0209758_1063189 | 3300025297 | Bacteria | 1207 |
| 450 | Ga0207697_10238697 | 3300025315 | Bacteria | 803 |
| 451 | Ga0207697_10412722 | 3300025315 | Bacteria | 600 |
| 452 | Ga0207656_10589871 | 3300025321 | Bacteria | 567 |
| 453 | Ga0207653_10157501 | 3300025885 | Bacteria | 839 |
| 454 | Ga0207682_10196848 | 3300025893 | Bacteria | 925 |
| 455 | Ga0207692_10001538 | 3300025898 | Bacteria | 8667 |
| 456 | Ga0207692_10028383 | 3300025898 | Bacteria | 2646 |
| 457 | Ga0207692_10529546 | 3300025898 | Bacteria | 751 |
| 458 | Ga0207642_10088013 | 3300025899 | Bacteria | 1527 |
| 459 | Ga0207642_10526914 | 3300025899 | Bacteria | 727 |
| 460 | Ga0207710_10019866 | 3300025900 | Bacteria | 2868 |
| 461 | Ga0207710_10280018 | 3300025900 | Bacteria | 839 |
| 462 | Ga0207710_10335780 | 3300025900 | Bacteria | 768 |
| 463 | Ga0207688_10047181 | 3300025901 | Bacteria | 2406 |
| 464 | Ga0207688_10523570 | 3300025901 | Bacteria | 744 |
| 465 | Ga0207680_10437246 | 3300025903 | Bacteria | 928 |
| 466 | Ga0207647_10000524 | 3300025904 | Bacteria | 30598 |
| 467 | Ga0207647_10661253 | 3300025904 | Bacteria | 572 |
| 468 | Ga0207685_10026923 | 3300025905 | Bacteria | 2006 |
| 469 | Ga0207685_10057892 | 3300025905 | Bacteria | 1522 |
| 470 | Ga0207685_10314205 | 3300025905 | Bacteria | 779 |
| 471 | Ga0207699_10001041 | 3300025906 | Bacteria | 13082 |
| 472 | Ga0207699_10027422 | 3300025906 | Bacteria | 3153 |
| 473 | Ga0207699_10253360 | 3300025906 | Bacteria | 1214 |
| 474 | Ga0207699_10298069 | 3300025906 | Bacteria | 1125 |
| 475 | Ga0207699_10992873 | 3300025906 | Unclassified | 620 |
| 476 | Ga0207645_10154625 | 3300025907 | Bacteria | 1498 |
| 477 | Ga0207643_10830070 | 3300025908 | Bacteria | 599 |
| 478 | Ga0207643_10988809 | 3300025908 | Bacteria | 544 |
| 479 | Ga0207705_10065134 | 3300025909 | Bacteria | 2634 |
| 480 | Ga0207684_10045107 | 3300025910 | Bacteria | 3740 |
| 481 | Ga0207654_10007949 | 3300025911 | Bacteria | 5348 |
| 482 | Ga0207707_10006494 | 3300025912 | Bacteria | 10211 |
| 483 | Ga0207707_10094713 | 3300025912 | Bacteria | 2609 |
| 484 | Ga0207707_10116754 | 3300025912 | Bacteria | 2332 |
| 485 | Ga0207695_10000883 | 3300025913 | Bacteria | 54495 |
| 486 | Ga0207695_10126760 | 3300025913 | Bacteria | 2514 |
| 487 | Ga0207695_10199856 | 3300025913 | Bacteria | 1913 |
| 488 | Ga0207671_10137988 | 3300025914 | Bacteria | 1877 |
| 489 | Ga0207671_10179914 | 3300025914 | Bacteria | 1645 |
| 490 | Ga0207671_10609544 | 3300025914 | Bacteria | 870 |
| 491 | Ga0207671_11325480 | 3300025914 | Bacteria | 560 |
| 492 | Ga0207693_10001357 | 3300025915 | Bacteria | 21659 |
| 493 | Ga0207693_10045134 | 3300025915 | Bacteria | 3463 |
| 494 | Ga0207693_10308039 | 3300025915 | Bacteria | 1240 |
| 495 | Ga0207663_10000873 | 3300025916 | Bacteria | 13685 |
| 496 | Ga0207663_11601478 | 3300025916 | Bacteria | 524 |
| 497 | Ga0207660_10018272 | 3300025917 | Bacteria | 4670 |
| 498 | Ga0207660_10170460 | 3300025917 | Bacteria | 1684 |
| 499 | Ga0207660_10228304 | 3300025917 | Bacteria | 1463 |
| 500 | Ga0207662_10399236 | 3300025918 | Bacteria | 932 |
| 501 | Ga0207649_10411728 | 3300025920 | Bacteria | 1014 |
| 502 | Ga0207649_10468338 | 3300025920 | Bacteria | 954 |
| 503 | Ga0207652_10019705 | 3300025921 | Bacteria | 5550 |
| 504 | Ga0207652_10036809 | 3300025921 | Bacteria | 4139 |
| 505 | Ga0207646_10423807 | 3300025922 | Bacteria | 1201 |
| 506 | Ga0207646_10848782 | 3300025922 | Bacteria | 812 |
| 507 | Ga0207681_10101995 | 3300025923 | Bacteria | 2071 |
| 508 | Ga0207681_10109814 | 3300025923 | Bacteria | 2004 |
| 509 | Ga0207681_10960941 | 3300025923 | Bacteria | 716 |
| 510 | Ga0207681_11295058 | 3300025923 | Bacteria | 612 |
| 511 | Ga0207694_10000436 | 3300025924 | Bacteria | 38791 |
| 512 | Ga0207694_10286713 | 3300025924 | Bacteria | 1353 |
| 513 | Ga0207694_10299073 | 3300025924 | Bacteria | 1325 |
| 514 | Ga0207694_11700015 | 3300025924 | Bacteria | 531 |
| 515 | Ga0207650_10236529 | 3300025925 | Bacteria | 1475 |
| 516 | Ga0207650_11091003 | 3300025925 | Bacteria | 679 |
| 517 | Ga0207687_10060012 | 3300025927 | Bacteria | 2681 |
| 518 | Ga0207687_10300323 | 3300025927 | Bacteria | 1293 |
| 519 | Ga0207687_11770332 | 3300025927 | Bacteria | 529 |
| 520 | Ga0207700_10015973 | 3300025928 | Bacteria | 4974 |
| 521 | Ga0207700_10302656 | 3300025928 | Bacteria | 1381 |
| 522 | Ga0207700_10342683 | 3300025928 | Bacteria | 1300 |
| 523 | Ga0207700_10937011 | 3300025928 | Bacteria | 775 |
| 524 | Ga0207700_11135075 | 3300025928 | Bacteria | 698 |
| 525 | Ga0207664_10041469 | 3300025929 | Bacteria | 3585 |
| 526 | Ga0207664_11467708 | 3300025929 | Bacteria | 603 |
| 527 | Ga0207644_10147516 | 3300025931 | Bacteria | 1818 |
| 528 | Ga0207644_10283718 | 3300025931 | Bacteria | 1330 |
| 529 | Ga0207644_10438402 | 3300025931 | Bacteria | 1072 |
| 530 | Ga0207690_10103616 | 3300025932 | Bacteria | 2037 |
| 531 | Ga0207706_10198004 | 3300025933 | Bacteria | 1762 |
| 532 | Ga0207706_10281363 | 3300025933 | Bacteria | 1451 |
| 533 | Ga0207706_10412454 | 3300025933 | Bacteria | 1170 |
| 534 | Ga0207706_10445662 | 3300025933 | Bacteria | 1120 |
| 535 | Ga0207686_10203174 | 3300025934 | Bacteria | 1420 |
| 536 | Ga0207686_10282709 | 3300025934 | Bacteria | 1225 |
| 537 | Ga0207686_10621417 | 3300025934 | Bacteria | 852 |
| 538 | Ga0207709_10091661 | 3300025935 | Bacteria | 1988 |
| 539 | Ga0207709_10600067 | 3300025935 | Bacteria | 872 |
| 540 | Ga0207709_10967122 | 3300025935 | Bacteria | 695 |
| 541 | Ga0207709_11384005 | 3300025935 | Bacteria | 582 |
| 542 | Ga0207709_11413899 | 3300025935 | Bacteria | 576 |
| 543 | Ga0207709_11835392 | 3300025935 | Bacteria | 504 |
| 544 | Ga0207670_10304394 | 3300025936 | Bacteria | 1249 |
| 545 | Ga0207670_10319432 | 3300025936 | Bacteria | 1221 |
| 546 | Ga0207670_10824054 | 3300025936 | Bacteria | 774 |
| 547 | Ga0207669_10016092 | 3300025937 | Bacteria | 3790 |
| 548 | Ga0207669_10395901 | 3300025937 | Bacteria | 1080 |
| 549 | Ga0207669_10668490 | 3300025937 | Bacteria | 851 |
| 550 | Ga0207669_10754247 | 3300025937 | Bacteria | 804 |
| 551 | Ga0207704_10091211 | 3300025938 | Bacteria | 2002 |
| 552 | Ga0207704_10301770 | 3300025938 | Bacteria | 1227 |
| 553 | Ga0207704_10349967 | 3300025938 | Bacteria | 1150 |
| 554 | Ga0207704_10552679 | 3300025938 | Bacteria | 936 |
| 555 | Ga0207665_10006588 | 3300025939 | Bacteria | 7699 |
| 556 | Ga0207665_10195062 | 3300025939 | Bacteria | 1473 |
| 557 | Ga0207691_10113728 | 3300025940 | Bacteria | 2405 |
| 558 | Ga0207691_10125639 | 3300025940 | Bacteria | 2270 |
| 559 | Ga0207691_10160565 | 3300025940 | Bacteria | 1972 |
| 560 | Ga0207691_10165942 | 3300025940 | Bacteria | 1935 |
| 561 | Ga0207691_10315793 | 3300025940 | Bacteria | 1340 |
| 562 | Ga0207711_10024524 | 3300025941 | Bacteria | 5055 |
| 563 | Ga0207711_10055599 | 3300025941 | Bacteria | 3398 |
| 564 | Ga0207711_10470816 | 3300025941 | Bacteria | 1170 |
| 565 | Ga0207711_10998527 | 3300025941 | Bacteria | 776 |
| 566 | Ga0207689_10014560 | 3300025942 | Bacteria | 6688 |
| 567 | Ga0207689_10075631 | 3300025942 | Bacteria | 2768 |
| 568 | Ga0207689_10102772 | 3300025942 | Bacteria | 2348 |
| 569 | Ga0207689_10928424 | 3300025942 | Bacteria | 734 |
| 570 | Ga0207689_11306754 | 3300025942 | Bacteria | 609 |
| 571 | Ga0207661_10356198 | 3300025944 | Bacteria | 1321 |
| 572 | Ga0207661_10507815 | 3300025944 | Bacteria | 1102 |
| 573 | Ga0207679_10363784 | 3300025945 | Bacteria | 1264 |
| 574 | Ga0207667_10011785 | 3300025949 | Bacteria | 10128 |
| 575 | Ga0207667_10016252 | 3300025949 | Bacteria | 8408 |
| 576 | Ga0207667_10090923 | 3300025949 | Bacteria | 3154 |
| 577 | Ga0207667_10137082 | 3300025949 | Bacteria | 2520 |
| 578 | Ga0207667_11199465 | 3300025949 | Bacteria | 739 |
| 579 | Ga0207651_10197939 | 3300025960 | Bacteria | 1608 |
| 580 | Ga0207651_10308307 | 3300025960 | Bacteria | 1319 |
| 581 | Ga0207651_10628643 | 3300025960 | Bacteria | 941 |
| 582 | Ga0207651_11197130 | 3300025960 | Bacteria | 682 |
| 583 | Ga0207651_11477859 | 3300025960 | Bacteria | 612 |
| 584 | Ga0207712_10188234 | 3300025961 | Bacteria | 1627 |
| 585 | Ga0207712_10884593 | 3300025961 | Bacteria | 789 |
| 586 | Ga0207712_11061111 | 3300025961 | Bacteria | 720 |
| 587 | Ga0207712_11401113 | 3300025961 | Bacteria | 625 |
| 588 | Ga0207668_10026995 | 3300025972 | Bacteria | 3736 |
| 589 | Ga0207668_10048033 | 3300025972 | Bacteria | 2926 |
| 590 | Ga0207668_10055192 | 3300025972 | Bacteria | 2760 |
| 591 | Ga0207668_10569343 | 3300025972 | Bacteria | 983 |
| 592 | Ga0207668_11293627 | 3300025972 | Bacteria | 656 |
| 593 | Ga0207640_10030276 | 3300025981 | Bacteria | 3331 |
| 594 | Ga0207640_10072075 | 3300025981 | Bacteria | 2329 |
| 595 | Ga0207640_10244776 | 3300025981 | Bacteria | 1388 |
| 596 | Ga0207640_10609766 | 3300025981 | Bacteria | 925 |
| 597 | Ga0207640_10927596 | 3300025981 | Bacteria | 762 |
| 598 | Ga0207658_10200356 | 3300025986 | Bacteria | 1666 |
| 599 | Ga0207658_10912458 | 3300025986 | Bacteria | 800 |
| 600 | Ga0207677_10155522 | 3300026023 | Bacteria | 1770 |
| 601 | Ga0207677_10337149 | 3300026023 | Bacteria | 1258 |
| 602 | Ga0207677_10798997 | 3300026023 | Bacteria | 844 |
| 603 | Ga0207677_10835388 | 3300026023 | Bacteria | 827 |
| 604 | Ga0207677_11721265 | 3300026023 | Bacteria | 581 |
| 605 | Ga0207703_10045095 | 3300026035 | Bacteria | 3546 |
| 606 | Ga0207703_10138753 | 3300026035 | Bacteria | 2108 |
| 607 | Ga0207639_10032959 | 3300026041 | Bacteria | 3818 |
| 608 | Ga0207639_10082300 | 3300026041 | Bacteria | 2552 |
| 609 | Ga0207639_10083086 | 3300026041 | Bacteria | 2541 |
| 610 | Ga0207639_10083580 | 3300026041 | Bacteria | 2534 |
| 611 | Ga0207639_11434653 | 3300026041 | Bacteria | 648 |
| 612 | Ga0207678_10002505 | 3300026067 | Bacteria | 16717 |
| 613 | Ga0207678_10012047 | 3300026067 | Bacteria | 7595 |
| 614 | Ga0207678_10057400 | 3300026067 | Bacteria | 3350 |
| 615 | Ga0207678_10069632 | 3300026067 | Bacteria | 3017 |
| 616 | Ga0207678_10098073 | 3300026067 | Bacteria | 2504 |
| 617 | Ga0207678_10272664 | 3300026067 | Bacteria | 1451 |
| 618 | Ga0207678_10276198 | 3300026067 | Bacteria | 1441 |
| 619 | Ga0207708_10077114 | 3300026075 | Bacteria | 2557 |
| 620 | Ga0207708_10078138 | 3300026075 | Bacteria | 2541 |
| 621 | Ga0207708_10098621 | 3300026075 | Bacteria | 2259 |
| 622 | Ga0207708_10576324 | 3300026075 | Bacteria | 951 |
| 623 | Ga0207702_10000005 | 3300026078 | Bacteria | 420296 |
| 624 | Ga0207702_10245744 | 3300026078 | Bacteria | 1678 |
| 625 | Ga0207641_10674097 | 3300026088 | Bacteria | 1017 |
| 626 | Ga0207641_11329376 | 3300026088 | Bacteria | 719 |
| 627 | Ga0207648_10116422 | 3300026089 | Bacteria | 2349 |
| 628 | Ga0207648_11356699 | 3300026089 | Bacteria | 668 |
| 629 | Ga0207676_10096995 | 3300026095 | Bacteria | 2435 |
| 630 | Ga0207676_10480108 | 3300026095 | Bacteria | 1177 |
| 631 | Ga0207676_10787130 | 3300026095 | Bacteria | 927 |
| 632 | Ga0207674_10010135 | 3300026116 | Bacteria | 10716 |
| 633 | Ga0207674_10012171 | 3300026116 | Bacteria | 9631 |
| 634 | Ga0207674_10075883 | 3300026116 | Bacteria | 3371 |
| 635 | Ga0207674_10257701 | 3300026116 | Bacteria | 1691 |
| 636 | Ga0207675_100042951 | 3300026118 | Bacteria | 4221 |
| 637 | Ga0207675_100223869 | 3300026118 | Bacteria | 1813 |
| 638 | Ga0207675_100618618 | 3300026118 | Bacteria | 1087 |
| 639 | Ga0207675_102344476 | 3300026118 | Bacteria | 547 |
| 640 | Ga0207683_10016315 | 3300026121 | Bacteria | 6322 |
| 641 | Ga0207683_10017331 | 3300026121 | Bacteria | 6138 |
| 642 | Ga0207683_10160633 | 3300026121 | Bacteria | 2031 |
| 643 | Ga0207683_10183829 | 3300026121 | Bacteria | 1896 |
| 644 | Ga0207683_10204245 | 3300026121 | Bacteria | 1797 |
| 645 | Ga0207683_10318009 | 3300026121 | Bacteria | 1425 |
| 646 | Ga0207683_10520176 | 3300026121 | Bacteria | 1099 |
| 647 | Ga0207683_10719616 | 3300026121 | Bacteria | 926 |
| 648 | Ga0207698_10244333 | 3300026142 | Bacteria | 1638 |
| 649 | Ga0207698_10382864 | 3300026142 | Bacteria | 1339 |
| 650 | Ga0209588_1001786 | 3300027671 | Bacteria | 5709 |
| 651 | Ga0268266_10002595 | 3300028379 | Bacteria | 19142 |
| 652 | Ga0268266_10015491 | 3300028379 | Bacteria | 6541 |
| 653 | Ga0268266_10061183 | 3300028379 | Bacteria | 3247 |
| 654 | Ga0268266_10086654 | 3300028379 | Bacteria | 2738 |
| 655 | Ga0268266_10111685 | 3300028379 | Bacteria | 2422 |
| 656 | Ga0268266_10242183 | 3300028379 | Bacteria | 1665 |
| 657 | Ga0268266_10433167 | 3300028379 | Bacteria | 1248 |
| 658 | Ga0268266_10530280 | 3300028379 | Bacteria | 1126 |
| 659 | Ga0268266_10609932 | 3300028379 | Bacteria | 1048 |
| 660 | Ga0268265_10086493 | 3300028380 | Bacteria | 2491 |
| 661 | Ga0268265_10192057 | 3300028380 | Bacteria | 1764 |
| 662 | Ga0268265_10260857 | 3300028380 | Bacteria | 1540 |
| 663 | Ga0268265_10411219 | 3300028380 | Bacteria | 1253 |
| 664 | Ga0268265_10507435 | 3300028380 | Bacteria | 1137 |
| 665 | Ga0268265_10739933 | 3300028380 | Bacteria | 953 |
| 666 | Ga0268265_12342688 | 3300028380 | Bacteria | 540 |
| 667 | Ga0268264_10000084 | 3300028381 | Bacteria | 242128 |
| 668 | Ga0268264_10308456 | 3300028381 | Bacteria | 1492 |
| 669 | Ga0268264_10879419 | 3300028381 | Bacteria | 898 |
| 670 | Ga0268264_11286445 | 3300028381 | Bacteria | 741 |
| 671 | Ga0307517_10000369 | 3300028786 | Bacteria | 77795 |
| 672 | Ga0307517_10319512 | 3300028786 | Bacteria | 860 |
| 673 | Ga0307517_10369578 | 3300028786 | Bacteria | 771 |
| 674 | Ga0307515_10013420 | 3300028794 | Bacteria | 15318 |
| 675 | Ga0307515_10379216 | 3300028794 | Bacteria | 1047 |
| 676 | Ga0307515_10555452 | 3300028794 | Bacteria | 758 |
| 677 | Ga0307511_10167846 | 3300030521 | Bacteria | 1214 |
| 678 | Ga0307511_10363113 | 3300030521 | Bacteria | 615 |
| 679 | Ga0265330_10390655 | 3300031235 | Bacteria | 588 |
| 680 | Ga0265332_10031536 | 3300031238 | Bacteria | 2312 |
| 681 | Ga0265325_10083915 | 3300031241 | Bacteria | 1580 |
| 682 | Ga0265339_10315651 | 3300031249 | Bacteria | 742 |
| 683 | Ga0265331_10150792 | 3300031250 | Bacteria | 1056 |
| 684 | Ga0265316_10354906 | 3300031344 | Bacteria | 1061 |
| 685 | Ga0307513_10230970 | 3300031456 | Bacteria | 1663 |
| 686 | Ga0307513_10235003 | 3300031456 | Bacteria | 1643 |
| 687 | Ga0307513_10496669 | 3300031456 | Bacteria | 938 |
| 688 | Ga0307513_10997807 | 3300031456 | Bacteria | 547 |
| 689 | Ga0307509_10072887 | 3300031507 | Bacteria | 3577 |
| 690 | Ga0307509_10073475 | 3300031507 | Bacteria | 3560 |
| 691 | Ga0307509_10115650 | 3300031507 | Bacteria | 2674 |
| 692 | Ga0307509_10299515 | 3300031507 | Bacteria | 1357 |
| 693 | Ga0307509_10623411 | 3300031507 | Bacteria | 749 |
| 694 | Ga0307509_10685347 | 3300031507 | Bacteria | 692 |
| 695 | Ga0307408_100111744 | 3300031548 | Bacteria | 2100 |
| 696 | Ga0307408_101496255 | 3300031548 | Bacteria | 638 |
| 697 | Ga0265313_10246272 | 3300031595 | Bacteria | 730 |
| 698 | Ga0307508_10047728 | 3300031616 | Bacteria | 3817 |
| 699 | Ga0307508_10399318 | 3300031616 | Bacteria | 966 |
| 700 | Ga0307508_10422963 | 3300031616 | Bacteria | 924 |
| 701 | Ga0307508_10430681 | 3300031616 | Bacteria | 911 |
| 702 | Ga0265314_10170340 | 3300031711 | Bacteria | 1315 |
| 703 | Ga0265342_10486181 | 3300031712 | Bacteria | 631 |
| 704 | Ga0307516_10021202 | 3300031730 | Bacteria | 6696 |
| 705 | Ga0307516_10070865 | 3300031730 | Bacteria | 3348 |
| 706 | Ga0307516_10082196 | 3300031730 | Bacteria | 3063 |
| 707 | Ga0307516_10124721 | 3300031730 | Bacteria | 2361 |
| 708 | Ga0307516_10229663 | 3300031730 | Bacteria | 1560 |
| 709 | Ga0307405_10395838 | 3300031731 | Bacteria | 1080 |
| 710 | Ga0307405_10847291 | 3300031731 | Bacteria | 769 |
| 711 | Ga0307413_10750540 | 3300031824 | Bacteria | 816 |
| 712 | Ga0307413_11084458 | 3300031824 | Bacteria | 691 |
| 713 | Ga0307410_10687159 | 3300031852 | Bacteria | 861 |
| 714 | Ga0307410_10690610 | 3300031852 | Bacteria | 859 |
| 715 | Ga0307410_10813122 | 3300031852 | Bacteria | 796 |
| 716 | Ga0307406_10305657 | 3300031901 | Bacteria | 1224 |
| 717 | Ga0307406_10324210 | 3300031901 | Bacteria | 1193 |
| 718 | Ga0307406_11348322 | 3300031901 | Bacteria | 624 |
| 719 | Ga0307407_10585430 | 3300031903 | Bacteria | 829 |
| 720 | Ga0307412_10828692 | 3300031911 | Bacteria | 805 |
| 721 | Ga0307409_100598259 | 3300031995 | Bacteria | 1089 |
| 722 | Ga0307409_100708351 | 3300031995 | Bacteria | 1007 |
| 723 | Ga0307416_100581995 | 3300032002 | Bacteria | 1197 |
| 724 | Ga0307416_100998994 | 3300032002 | Bacteria | 940 |
| 725 | Ga0307416_101290043 | 3300032002 | Bacteria | 836 |
| 726 | Ga0307416_101803363 | 3300032002 | Bacteria | 716 |
| 727 | Ga0307416_101920548 | 3300032002 | Bacteria | 695 |
| 728 | Ga0307411_10125314 | 3300032005 | Bacteria | 1867 |
| 729 | Ga0307411_10777241 | 3300032005 | Bacteria | 841 |
| 730 | Ga0307415_100221468 | 3300032126 | Bacteria | 1517 |
| 731 | Ga0307415_100511168 | 3300032126 | Bacteria | 1052 |
| 732 | Ga0307510_10005024 | 3300033180 | Bacteria | 15672 |
| 733 | Ga0307510_10009194 | 3300033180 | Bacteria | 11768 |
| 734 | Ga0307510_10270452 | 3300033180 | Bacteria | 1176 |
| 735 | Ga0316215_1013852 | 3300033544 | Bacteria | 805 |
| 736 | Ga0373930_0038774 | 3300034816 | Bacteria | 1008 |
| 737 | Ga0373948_0114130 | 3300034817 | Bacteria | 647 |
| 738 | Ga0373926_0334032 | 3300035083 | Bacteria | 594 |
| 739 | Ga0373934_0002431 | 3300035086 | Bacteria | 6851 |
| 740 | Ga0373940_0058854 | 3300035088 | Bacteria | 1095 |
| 741 | Ga0373940_0216543 | 3300035088 | Bacteria | 635 |
| 742 | Ga0373944_0010473 | 3300035089 | Bacteria | 2530 |
| 743 | Ga0373949_0104761 | 3300035090 | Bacteria | 779 |
| 744 | Ga0373951_0170977 | 3300035091 | Bacteria | 620 |
| 745 | Ga0373923_0003726 | 3300035111 | Bacteria | 4939 |
| 746 | Ga0373932_0044241 | 3300035112 | Bacteria | 1298 |
| 747 | Ga0373932_0078207 | 3300035112 | Bacteria | 1040 |
| 748 | Ga0373936_0200841 | 3300035113 | Bacteria | 880 |
| 749 | Ga0373936_0213465 | 3300035113 | Bacteria | 854 |
| 750 | Ga0373936_0350054 | 3300035113 | Bacteria | 673 |
| 751 | Ga0373939_0535118 | 3300035114 | Bacteria | 505 |
| 752 | Ga0373945_0002603 | 3300035116 | Bacteria | 5652 |
| 753 | Ga0373953_0000929 | 3300035117 | Bacteria | 8201 |
| 754 | Ga0373953_0005411 | 3300035117 | Bacteria | 4142 |
| 755 | Ga0373953_0113058 | 3300035117 | Bacteria | 1149 |
| 756 | Ga0373953_0486722 | 3300035117 | Bacteria | 546 |
| 757 | Ga0373954_0000067 | 3300035118 | Bacteria | 37060 |
| 758 | Ga0373954_0024815 | 3300035118 | Bacteria | 2735 |
| 759 | Ga0373954_0025269 | 3300035118 | Bacteria | 2714 |
| 760 | Ga0373954_0075643 | 3300035118 | Bacteria | 1604 |
| 761 | Ga0373954_0270539 | 3300035118 | Bacteria | 837 |
| 762 | Ga0373956_0001639 | 3300035119 | Bacteria | 9221 |
| 763 | Ga0373956_0007638 | 3300035119 | Bacteria | 4358 |
| 764 | Ga0373956_0182891 | 3300035119 | Bacteria | 991 |
| 765 | Ga0373957_0000501 | 3300035120 | Bacteria | 9810 |
| 766 | Ga0373957_0006447 | 3300035120 | Bacteria | 3698 |
| 767 | Ga0373960_0222618 | 3300035121 | Bacteria | 676 |
| 768 | Ga0373943_0001888 | 3300035170 | Bacteria | 9476 |
| 769 | Ga0373943_0192509 | 3300035170 | Bacteria | 1125 |
| 770 | Ga0373946_0004239 | 3300035171 | Bacteria | 5120 |
| 771 | Ga0373946_0073134 | 3300035171 | Bacteria | 1485 |
| 772 | Ga0373946_0451301 | 3300035171 | Bacteria | 655 |
| 773 | Ga0373955_0000377 | 3300035172 | Bacteria | 18785 |
| 774 | Ga0373955_0138333 | 3300035172 | Bacteria | 1426 |
| 775 | Ga0373955_0305681 | 3300035172 | Bacteria | 959 |
| 776 | Ga0373924_0004215 | 3300035410 | Bacteria | 5011 |
| 777 | Ga0373924_0050507 | 3300035410 | Bacteria | 1722 |
| 778 | Ga0373924_0074032 | 3300035410 | Bacteria | 1440 |
| 779 | Ga0373931_0055359 | 3300035691 | Bacteria | 2122 |
| 780 | Ga0373931_0226586 | 3300035691 | Bacteria | 1128 |
| 781 | Ga0373931_0866974 | 3300035691 | Bacteria | 605 |
| 782 | Ga0373931_1070036 | 3300035691 | Bacteria | 548 |
| 783 | Ga0373935_0037417 | 3300035692 | Bacteria | 3037 |
| 784 | Ga0373935_0040858 | 3300035692 | Bacteria | 2912 |
| 785 | Ga0373935_0051478 | 3300035692 | Bacteria | 2615 |
| 786 | Ga0373935_0128160 | 3300035692 | Bacteria | 1702 |
| 787 | Ga0373935_0411134 | 3300035692 | Bacteria | 973 |
| 788 | Ga0373927_0003905 | 3300035695 | Bacteria | 10571 |
| 789 | Ga0373927_0010432 | 3300035695 | Bacteria | 6194 |
| 790 | Ga0373927_0044542 | 3300035695 | Bacteria | 2870 |
| 791 | Ga0373927_0494060 | 3300035695 | Bacteria | 808 |
| 792 | Ga0373933_0000324 | 3300035724 | Bacteria | 30843 |
| 793 | Ga0373933_0000519 | 3300035724 | Bacteria | 24082 |
| 794 | Ga0373933_0089294 | 3300035724 | Bacteria | 1899 |
| 795 | Ga0373933_0362051 | 3300035724 | Bacteria | 943 |
| 796 | Ga0373947_0008954 | 3300035725 | Bacteria | 5754 |
| 797 | Ga0373947_0024948 | 3300035725 | Bacteria | 3487 |
| 798 | Ga0373947_1004066 | 3300035725 | Bacteria | 569 |
| 799 | Ga0373947_1149189 | 3300035725 | Bacteria | 529 |
| 800 | Ga0373937_0001425 | 3300036401 | Bacteria | 19991 |
| 801 | Ga0373937_0028466 | 3300036401 | Bacteria | 5056 |
| 802 | Ga0373937_0046615 | 3300036401 | Bacteria | 3964 |
| 803 | Ga0373937_0051681 | 3300036401 | Bacteria | 3767 |
| 804 | Ga0373937_0095291 | 3300036401 | Bacteria | 2759 |
| 805 | Ga0373937_1202387 | 3300036401 | Bacteria | 706 |
| 806 | Ga0372808_009233 | 3300036459 | Bacteria | 1377 |
| 807 | Ga0373925_0035160 | 3300037068 | Bacteria | 3696 |
| 808 | Ga0373925_0044313 | 3300037068 | Bacteria | 3303 |
| 809 | Ga0373925_0126961 | 3300037068 | Bacteria | 1985 |
| 810 | Ga0373925_0450652 | 3300037068 | Bacteria | 1054 |
| 811 | Ga0373925_0587708 | 3300037068 | Bacteria | 917 |
| 812 | Ga0395900_0331538 | 3300037418 | Bacteria | 1500 |
| 813 | Ga0395898_0173684 | 3300037466 | Bacteria | 2060 |
| 814 | Ga0395898_0508131 | 3300037466 | Bacteria | 1146 |
| 815 | Ga0395905_0078255 | 3300037471 | Bacteria | 3099 |
| 816 | Ga0395905_0863503 | 3300037471 | Bacteria | 808 |
| 817 | Ga0395901_0231547 | 3300038443 | Bacteria | 1929 |
| 818 | Ga0436365_0272569 | 3300039437 | Bacteria | 2078 |
| 819 | Ga0436365_0912513 | 3300039437 | Bacteria | 1481 |
| 820 | Ga0436365_1453434 | 3300039437 | Bacteria | 1308 |
| 821 | Ga0436360_0319798 | 3300039438 | Bacteria | 836 |
| 822 | Ga0436361_0769166 | 3300039447 | Bacteria | 622 |
| 823 | Ga0436361_1169830 | 3300039447 | Bacteria | 630 |
| 824 | Ga0436363_1429749 | 3300039450 | Bacteria | 525 |
| 825 | Ga0436363_1677536 | 3300039450 | Bacteria | 693 |
| 826 | Ga0439465_0008956 | 3300041413 | Bacteria | 3154 |
| 827 | Ga0439465_0174173 | 3300041413 | Bacteria | 776 |
| 828 | Ga0439465_0174241 | 3300041413 | Bacteria | 776 |
| 829 | Ga0451787_538535 | 3300041441 | Bacteria | 871 |
| 830 | Ga0451791_0066321 | 3300041451 | Bacteria | 961 |
| 831 | Ga0451791_0489189 | 3300041451 | Bacteria | 531 |
| 832 | Ga0451791_0730688 | 3300041451 | Bacteria | 866 |
| 833 | Ga0451791_1303076 | 3300041451 | Bacteria | 791 |
| 834 | Ga0451793_0071078 | 3300041452 | Bacteria | 519 |
| 835 | Ga0451798_0329382 | 3300041458 | Bacteria | 552 |
| 836 | Ga0451798_1021059 | 3300041458 | Bacteria | 1029 |
| 837 | Ga0451800_1157606 | 3300041459 | Bacteria | 712 |
| 838 | Ga0451800_1572657 | 3300041459 | Bacteria | 711 |
| 839 | Ga0451802_1182178 | 3300041460 | Bacteria | 877 |
| 840 | Ga0451802_1196601 | 3300041460 | Bacteria | 555 |
| 841 | Ga0451807_0562609 | 3300041486 | Bacteria | 508 |
| 842 | Ga0451807_0964125 | 3300041486 | Bacteria | 581 |
| 843 | Ga0451807_1090274 | 3300041486 | Bacteria | 651 |
| 844 | Ga0451833_0175461 | 3300041491 | Bacteria | 748 |
| 845 | Ga0451837_1686692 | 3300041494 | Bacteria | 802 |
| 846 | Ga0451841_1132424 | 3300041498 | Bacteria | 711 |
| 847 | Ga0451845_0269736 | 3300041501 | Bacteria | 510 |
| 848 | Ga0439431_0096186 | 3300041997 | Bacteria | 810 |
| 849 | Ga0439432_250390 | 3300042006 | Bacteria | 508 |
| 850 | Ga0450900_013176 | 3300042136 | Bacteria | 1090 |
| 851 | Ga0439458_0088481 | 3300042157 | Bacteria | 795 |
| 852 | Ga0439459_0079791 | 3300042438 | Bacteria | 771 |
| 853 | Ga0466963_0286380 | 3300044694 | Bacteria | 1158 |
| 854 | Ga0466963_0513366 | 3300044694 | Bacteria | 846 |
| 855 | Ga0466957_1191876 | 3300044842 | Bacteria | 551 |
| 856 | Ga0451576_0584387 | 3300045051 | Bacteria | 1174 |
| 857 | Ga0466967_0802600 | 3300045976 | Bacteria | 934 |
| 858 | Ga0495617_060657 | 3300046452 | Bacteria | 1251 |
| 859 | Ga0495617_076494 | 3300046452 | Bacteria | 1098 |
| 860 | Ga0495592_0046096 | 3300046454 | Bacteria | 3250 |
| 861 | Ga0495592_0046648 | 3300046454 | Bacteria | 3229 |
| 862 | Ga0495592_0048935 | 3300046454 | Bacteria | 3143 |
| 863 | Ga0495603_0001576 | 3300046455 | Bacteria | 13338 |
| 864 | Ga0495603_0002921 | 3300046455 | Bacteria | 10104 |
| 865 | Ga0495603_0042436 | 3300046455 | Bacteria | 2719 |
| 866 | Ga0495603_0272974 | 3300046455 | Bacteria | 972 |
| 867 | Ga0495603_0316279 | 3300046455 | Bacteria | 896 |
| 868 | Ga0495603_0416407 | 3300046455 | Bacteria | 770 |
| 869 | Ga0495603_0672904 | 3300046455 | Bacteria | 592 |
| 870 | Ga0495603_0743938 | 3300046455 | Bacteria | 560 |
| 871 | Ga0495590_0028519 | 3300046457 | Bacteria | 1957 |
| 872 | Ga0495590_0158313 | 3300046457 | Bacteria | 823 |
| 873 | Ga0495590_0296728 | 3300046457 | Bacteria | 607 |
| 874 | Ga0495591_041130 | 3300046458 | Bacteria | 1314 |
| 875 | Ga0495629_0000117 | 3300046459 | Bacteria | 70838 |
| 876 | Ga0495629_0009626 | 3300046459 | Bacteria | 7058 |
| 877 | Ga0495629_0051277 | 3300046459 | Bacteria | 2888 |
| 878 | Ga0495629_0052231 | 3300046459 | Bacteria | 2860 |
| 879 | Ga0495629_0118340 | 3300046459 | Bacteria | 1846 |
| 880 | Ga0495629_0308867 | 3300046459 | Bacteria | 1082 |
| 881 | Ga0495638_0012452 | 3300046460 | Bacteria | 5829 |
| 882 | Ga0495638_0013191 | 3300046460 | Bacteria | 5637 |
| 883 | Ga0495638_0093876 | 3300046460 | Bacteria | 1804 |
| 884 | Ga0495638_0111195 | 3300046460 | Bacteria | 1627 |
| 885 | Ga0495638_0132396 | 3300046460 | Bacteria | 1463 |
| 886 | Ga0495638_0164961 | 3300046460 | Bacteria | 1275 |
| 887 | Ga0495638_0180585 | 3300046460 | Bacteria | 1204 |
| 888 | Ga0495638_0380222 | 3300046460 | Bacteria | 738 |
| 889 | Ga0495641_0002118 | 3300046461 | Bacteria | 16012 |
| 890 | Ga0495641_0178345 | 3300046461 | Bacteria | 951 |
| 891 | Ga0495651_0291656 | 3300046462 | Bacteria | 1098 |
| 892 | Ga0495651_0322396 | 3300046462 | Bacteria | 1029 |
| 893 | Ga0495653_0001052 | 3300046463 | Bacteria | 21243 |
| 894 | Ga0495653_0005677 | 3300046463 | Bacteria | 10189 |
| 895 | Ga0495580_0004355 | 3300046472 | Bacteria | 11890 |
| 896 | Ga0495582_0001007 | 3300046473 | Bacteria | 15801 |
| 897 | Ga0495582_0006998 | 3300046473 | Bacteria | 6272 |
| 898 | Ga0495582_0215666 | 3300046473 | Bacteria | 1098 |
| 899 | Ga0495605_0141765 | 3300046474 | Bacteria | 1078 |
| 900 | Ga0495605_0299951 | 3300046474 | Bacteria | 680 |
| 901 | Ga0495605_0412386 | 3300046474 | Bacteria | 560 |
| 902 | Ga0495639_0001543 | 3300046475 | Bacteria | 10275 |
| 903 | Ga0495639_0070139 | 3300046475 | Bacteria | 1618 |
| 904 | Ga0495639_0389224 | 3300046475 | Bacteria | 703 |
| 905 | Ga0495662_0004867 | 3300046476 | Bacteria | 6729 |
| 906 | Ga0495664_0002486 | 3300046477 | Bacteria | 9915 |
| 907 | Ga0495664_0025293 | 3300046477 | Bacteria | 3456 |
| 908 | Ga0495664_0027203 | 3300046477 | Bacteria | 3333 |
| 909 | Ga0495664_0489657 | 3300046477 | Bacteria | 735 |
| 910 | Ga0495584_0090452 | 3300046491 | Bacteria | 1543 |
| 911 | Ga0495584_0151811 | 3300046491 | Bacteria | 1177 |
| 912 | Ga0495584_0157224 | 3300046491 | Bacteria | 1155 |
| 913 | Ga0495584_0273903 | 3300046491 | Bacteria | 858 |
| 914 | Ga0495584_0367795 | 3300046491 | Bacteria | 730 |
| 915 | Ga0495584_0571246 | 3300046491 | Bacteria | 576 |
| 916 | Ga0495585_0274787 | 3300046492 | Bacteria | 834 |
| 917 | Ga0495585_0354727 | 3300046492 | Bacteria | 712 |
| 918 | Ga0495585_0367730 | 3300046492 | Bacteria | 696 |
| 919 | Ga0495585_0602758 | 3300046492 | Bacteria | 516 |
| 920 | Ga0495594_0000662 | 3300046499 | Bacteria | 17783 |
| 921 | Ga0495594_0100839 | 3300046499 | Bacteria | 1624 |
| 922 | Ga0495594_0217634 | 3300046499 | Bacteria | 1089 |
| 923 | Ga0495596_0074381 | 3300046500 | Bacteria | 1319 |
| 924 | Ga0495596_0144327 | 3300046500 | Bacteria | 925 |
| 925 | Ga0495583_0146704 | 3300046506 | Bacteria | 980 |
| 926 | Ga0495606_0007334 | 3300046507 | Bacteria | 9914 |
| 927 | Ga0495606_0119647 | 3300046507 | Bacteria | 1578 |
| 928 | Ga0495606_0159353 | 3300046507 | Bacteria | 1318 |
| 929 | Ga0495608_0067428 | 3300046511 | Bacteria | 2340 |
| 930 | Ga0495608_0086752 | 3300046511 | Bacteria | 2028 |
| 931 | Ga0495610_0027441 | 3300046512 | Bacteria | 3025 |
| 932 | Ga0495610_0244598 | 3300046512 | Bacteria | 714 |
| 933 | Ga0495616_0082447 | 3300046513 | Bacteria | 1536 |
| 934 | Ga0495616_0195491 | 3300046513 | Bacteria | 892 |
| 935 | Ga0495618_0006096 | 3300046514 | Bacteria | 7313 |
| 936 | Ga0495618_0026157 | 3300046514 | Bacteria | 3625 |
| 937 | Ga0495620_0039486 | 3300046515 | Bacteria | 2085 |
| 938 | Ga0495620_0155520 | 3300046515 | Bacteria | 890 |
| 939 | Ga0495628_0003826 | 3300046516 | Bacteria | 13414 |
| 940 | Ga0495628_0011244 | 3300046516 | Bacteria | 7575 |
| 941 | Ga0495628_0150762 | 3300046516 | Bacteria | 1771 |
| 942 | Ga0495628_1101860 | 3300046516 | Bacteria | 542 |
| 943 | Ga0495630_0001278 | 3300046517 | Bacteria | 17348 |
| 944 | Ga0495630_0088527 | 3300046517 | Bacteria | 2338 |
| 945 | Ga0495630_0174376 | 3300046517 | Bacteria | 1639 |
| 946 | Ga0495630_1183960 | 3300046517 | Bacteria | 578 |
| 947 | Ga0495631_0119505 | 3300046518 | Bacteria | 1133 |
| 948 | Ga0495631_0151228 | 3300046518 | Bacteria | 996 |
| 949 | Ga0495631_0156434 | 3300046518 | Bacteria | 978 |
| 950 | Ga0495632_0047263 | 3300046519 | Bacteria | 2135 |
| 951 | Ga0495632_0060128 | 3300046519 | Bacteria | 1847 |
| 952 | Ga0495632_0102087 | 3300046519 | Bacteria | 1351 |
| 953 | Ga0495632_0243352 | 3300046519 | Bacteria | 808 |
| 954 | Ga0495632_0253061 | 3300046519 | Bacteria | 789 |
| 955 | Ga0495637_0240062 | 3300046520 | Bacteria | 655 |
| 956 | Ga0495643_0185764 | 3300046522 | Bacteria | 1007 |
| 957 | Ga0495644_0401923 | 3300046523 | Bacteria | 542 |
| 958 | Ga0495648_0196717 | 3300046524 | Bacteria | 1013 |
| 959 | Ga0495648_0343530 | 3300046524 | Bacteria | 684 |
| 960 | Ga0495666_0056048 | 3300046526 | Bacteria | 1888 |
| 961 | Ga0495666_0057120 | 3300046526 | Bacteria | 1868 |
| 962 | Ga0495642_0040785 | 3300046528 | Bacteria | 1887 |
| 963 | Ga0495652_0051997 | 3300046529 | Bacteria | 3496 |
| 964 | Ga0495652_0190799 | 3300046529 | Bacteria | 1564 |
| 965 | Ga0495652_0489579 | 3300046529 | Bacteria | 854 |
| 966 | Ga0495652_0764365 | 3300046529 | Bacteria | 646 |
| 967 | Ga0495654_0064407 | 3300046530 | Bacteria | 1752 |
| 968 | Ga0495665_0002979 | 3300046531 | Bacteria | 9154 |
| 969 | Ga0495665_0044270 | 3300046531 | Bacteria | 2365 |
| 970 | Ga0495640_0003398 | 3300046533 | Bacteria | 12815 |
| 971 | Ga0495640_0010256 | 3300046533 | Bacteria | 7249 |
| 972 | Ga0495640_0014352 | 3300046533 | Bacteria | 5998 |
| 973 | Ga0495640_0066202 | 3300046533 | Bacteria | 2437 |
| 974 | Ga0495586_0008523 | 3300046535 | Bacteria | 5456 |
| 975 | Ga0495586_0150910 | 3300046535 | Bacteria | 1307 |
| 976 | Ga0495587_0201811 | 3300046536 | Bacteria | 1124 |
| 977 | Ga0495598_0121690 | 3300046537 | Bacteria | 885 |
| 978 | Ga0495598_0303029 | 3300046537 | Bacteria | 605 |
| 979 | Ga0495609_0178810 | 3300046538 | Bacteria | 894 |
| 980 | Ga0495621_0045276 | 3300046539 | Bacteria | 1558 |
| 981 | Ga0495621_0104968 | 3300046539 | Bacteria | 1079 |
| 982 | Ga0495597_0308424 | 3300046542 | Bacteria | 613 |
| 983 | Ga0495645_0003011 | 3300046543 | Bacteria | 11398 |
| 984 | Ga0495645_0062858 | 3300046543 | Bacteria | 2688 |
| 985 | Ga0495622_0008476 | 3300046557 | Bacteria | 4760 |
| 986 | Ga0495622_0010153 | 3300046557 | Bacteria | 4353 |
| 987 | Ga0495633_0141572 | 3300046558 | Bacteria | 1112 |
| 988 | Ga0495667_0000305 | 3300046559 | Bacteria | 31224 |
| 989 | Ga0495667_0013520 | 3300046559 | Bacteria | 5523 |
| 990 | Ga0495667_0055353 | 3300046559 | Bacteria | 2609 |
| 991 | Ga0495667_0239935 | 3300046559 | Bacteria | 1155 |
| 992 | Ga0495667_0463175 | 3300046559 | Bacteria | 796 |
| 993 | Ga0495667_0474339 | 3300046559 | Bacteria | 785 |
| 994 | Ga0495656_0072060 | 3300046615 | Bacteria | 1537 |
| 995 | Ga0495656_0314996 | 3300046615 | Bacteria | 805 |
| 996 | Ga0495656_0651585 | 3300046615 | Bacteria | 565 |
| 997 | Ga0495668_0163375 | 3300046616 | Bacteria | 1220 |
| 998 | Ga0495668_0281519 | 3300046616 | Bacteria | 911 |
| 999 | Ga0495668_0342494 | 3300046616 | Bacteria | 820 |
| 1000 | Ga0495668_0687123 | 3300046616 | Bacteria | 566 |
| 1001 | Ga0495668_0742130 | 3300046616 | Bacteria | 543 |
| 1002 | Ga0495634_0003435 | 3300046642 | Bacteria | 12708 |
| 1003 | Ga0495634_0012645 | 3300046642 | Bacteria | 6110 |
| 1004 | Ga0495634_0116442 | 3300046642 | Bacteria | 1714 |
| 1005 | Ga0495611_0068474 | 3300046648 | Bacteria | 1620 |
| 1006 | Ga0495611_0266170 | 3300046648 | Bacteria | 793 |
| 1007 | Ga0495625_0083625 | 3300046660 | Bacteria | 2218 |
| 1008 | Ga0495625_0129353 | 3300046660 | Bacteria | 1711 |
| 1009 | Ga0495625_0179509 | 3300046660 | Bacteria | 1409 |
| 1010 | Ga0495625_0308987 | 3300046660 | Bacteria | 1010 |
| 1011 | Ga0495635_0000102 | 3300046663 | Bacteria | 50623 |
| 1012 | Ga0495635_0004903 | 3300046663 | Bacteria | 9306 |
| 1013 | Ga0495635_0043797 | 3300046663 | Bacteria | 3087 |
| 1014 | Ga0495635_0185121 | 3300046663 | Bacteria | 1415 |
| 1015 | Ga0495635_0372315 | 3300046663 | Bacteria | 951 |
| 1016 | Ga0495659_0175649 | 3300046664 | Bacteria | 870 |
| 1017 | Ga0495659_0355631 | 3300046664 | Bacteria | 626 |
| 1018 | Ga0495661_0136470 | 3300046665 | Bacteria | 1338 |
| 1019 | Ga0495588_0018113 | 3300046674 | Bacteria | 3430 |
| 1020 | Ga0495588_0217280 | 3300046674 | Bacteria | 1009 |
| 1021 | Ga0495588_0234120 | 3300046674 | Bacteria | 969 |
| 1022 | Ga0495588_0236938 | 3300046674 | Bacteria | 962 |
| 1023 | Ga0495657_0022520 | 3300046675 | Bacteria | 4511 |
| 1024 | Ga0495599_0011854 | 3300046678 | Bacteria | 5360 |
| 1025 | Ga0495599_0045042 | 3300046678 | Bacteria | 2766 |
| 1026 | Ga0495623_0011690 | 3300046679 | Bacteria | 5687 |
| 1027 | Ga0495623_0022925 | 3300046679 | Bacteria | 4031 |
| 1028 | Ga0495623_0222438 | 3300046679 | Bacteria | 1075 |
| 1029 | Ga0495623_0253404 | 3300046679 | Bacteria | 989 |
| 1030 | Ga0495646_0051078 | 3300046680 | Bacteria | 2503 |
| 1031 | Ga0495646_0070496 | 3300046680 | Bacteria | 2058 |
| 1032 | Ga0495646_0074138 | 3300046680 | Bacteria | 1998 |
| 1033 | Ga0495647_0006246 | 3300046681 | Bacteria | 3938 |
| 1034 | Ga0495647_0213518 | 3300046681 | Bacteria | 850 |
| 1035 | Ga0495658_0002270 | 3300046683 | Bacteria | 9713 |
| 1036 | Ga0495658_0007004 | 3300046683 | Bacteria | 5563 |
| 1037 | Ga0495669_0095452 | 3300046684 | Bacteria | 1377 |
| 1038 | Ga0495669_0125137 | 3300046684 | Bacteria | 1207 |
| 1039 | Ga0495613_0007307 | 3300046689 | Bacteria | 8226 |
| 1040 | Ga0495624_0001774 | 3300046690 | Bacteria | 16501 |
| 1041 | Ga0495624_0023749 | 3300046690 | Bacteria | 4041 |
| 1042 | Ga0495624_0376701 | 3300046690 | Bacteria | 853 |
| 1043 | Ga0495670_0026442 | 3300046691 | Bacteria | 2872 |
| 1044 | Ga0495670_0063863 | 3300046691 | Bacteria | 1854 |
| 1045 | Ga0495670_0275744 | 3300046691 | Bacteria | 899 |
| 1046 | Ga0495670_0303697 | 3300046691 | Bacteria | 855 |
| 1047 | Ga0495671_0139763 | 3300046692 | Bacteria | 1180 |
| 1048 | Ga0495671_0202203 | 3300046692 | Bacteria | 963 |
| 1049 | Ga0495671_0204473 | 3300046692 | Bacteria | 957 |
| 1050 | Ga0495671_0463029 | 3300046692 | Bacteria | 606 |
| 1051 | Ga0495589_0079811 | 3300046794 | Bacteria | 1592 |
| 1052 | Ga0495589_0438001 | 3300046794 | Bacteria | 598 |
| 1053 | Ga0495589_0534316 | 3300046794 | Bacteria | 535 |
| 1054 | Ga0495600_0000357 | 3300046809 | Bacteria | 24062 |
| 1055 | Ga0495600_0007049 | 3300046809 | Bacteria | 6866 |
| 1056 | Ga0495600_0118259 | 3300046809 | Bacteria | 1724 |
| 1057 | Ga0495600_0156550 | 3300046809 | Bacteria | 1474 |
| 1058 | Ga0495600_0660628 | 3300046809 | Bacteria | 631 |
| 1059 | Ga0495660_0069799 | 3300046810 | Bacteria | 1867 |
| 1060 | Ga0495581_0004221 | 3300047315 | Bacteria | 8282 |
| 1061 | Ga0495581_0021912 | 3300047315 | Bacteria | 3703 |
| 1062 | Ga0495581_0455134 | 3300047315 | Bacteria | 745 |
| 1063 | Ga0495581_0510096 | 3300047315 | Bacteria | 699 |
| 1064 | Ga0495604_0001099 | 3300047317 | Bacteria | 22454 |
| 1065 | Ga0495604_0107558 | 3300047317 | Bacteria | 2038 |
| 1066 | Ga0495604_0122277 | 3300047317 | Bacteria | 1883 |
| 1067 | Ga0495604_0491082 | 3300047317 | Bacteria | 797 |
| 1068 | Ga0495636_0021311 | 3300047318 | Bacteria | 2617 |
| 1069 | Ga0495636_0143180 | 3300047318 | Bacteria | 1068 |
| 1070 | Ga0495636_0154755 | 3300047318 | Bacteria | 1030 |
| 1071 | Ga0495674_0029184 | 3300047319 | Bacteria | 5025 |
| 1072 | Ga0495674_0045856 | 3300047319 | Bacteria | 3881 |
| 1073 | Ga0495674_0046750 | 3300047319 | Bacteria | 3841 |
| 1074 | Ga0495674_0325463 | 3300047319 | Bacteria | 1251 |
| 1075 | Ga0495674_0826698 | 3300047319 | Bacteria | 719 |
| 1076 | Ga0495672_0291252 | 3300047320 | Bacteria | 776 |
| 1077 | Ga0495676_0222139 | 3300047321 | Bacteria | 1301 |
| 1078 | Ga0495676_0256733 | 3300047321 | Bacteria | 1190 |
| 1079 | Ga0495676_0974231 | 3300047321 | Bacteria | 542 |
| 1080 | Ga0495680_0003585 | 3300047322 | Bacteria | 15202 |
| 1081 | Ga0495680_0039627 | 3300047322 | Bacteria | 3756 |
| 1082 | Ga0495680_0620904 | 3300047322 | Bacteria | 721 |
| 1083 | Ga0495683_0243629 | 3300047323 | Bacteria | 792 |
| 1084 | Ga0495675_0004354 | 3300047444 | Bacteria | 8568 |
| 1085 | Ga0495675_0385930 | 3300047444 | Bacteria | 818 |
| 1086 | Ga0495675_0690680 | 3300047444 | Bacteria | 572 |
| 1087 | Ga0495677_0093079 | 3300047445 | Bacteria | 1137 |
| 1088 | Ga0495679_053039 | 3300047446 | Bacteria | 1212 |
| 1089 | Ga0495685_146918 | 3300047447 | Bacteria | 767 |
| 1090 | Ga0495685_214289 | 3300047447 | Bacteria | 615 |
| 1091 | Ga0495673_0101389 | 3300047469 | Bacteria | 1163 |
| 1092 | Ga0495673_0269757 | 3300047469 | Bacteria | 617 |
| 1093 | Ga0495684_0000088 | 3300047471 | Bacteria | 64704 |
| 1094 | Ga0495684_0080694 | 3300047471 | Bacteria | 2469 |
| 1095 | Ga0495684_0081455 | 3300047471 | Bacteria | 2456 |
| 1096 | Ga0495684_0795093 | 3300047471 | Bacteria | 618 |
| 1097 | Ga0495686_0162846 | 3300047472 | Bacteria | 1302 |
| 1098 | Ga0495686_0338382 | 3300047472 | Bacteria | 821 |
| 1099 | Ga0495686_0692071 | 3300047472 | Bacteria | 521 |
| 1100 | Ga0495686_0705406 | 3300047472 | Bacteria | 514 |
| 1101 | Ga0495593_0000167 | 3300047673 | Bacteria | 33674 |
| 1102 | Ga0495593_0001656 | 3300047673 | Bacteria | 13185 |
| 1103 | Ga0495593_0013615 | 3300047673 | Bacteria | 4636 |
| 1104 | Ga0495602_0026534 | 3300048088 | Bacteria | 5584 |
| 1105 | Ga0495602_0066783 | 3300048088 | Bacteria | 3097 |
| 1106 | Ga0495614_0071945 | 3300048089 | Bacteria | 1491 |
| 1107 | Ga0495615_0099555 | 3300048090 | Bacteria | 820 |
| 1108 | Ga0495615_0303237 | 3300048090 | Bacteria | 518 |
| 1109 | Ga0495626_0019316 | 3300048091 | Bacteria | 3410 |
| 1110 | Ga0496100_0020948 | 3300048903 | Bacteria | 3929 |
| 1111 | Ga0496100_0358106 | 3300048903 | Bacteria | 1103 |
| 1112 | Ga0496100_0697736 | 3300048903 | Bacteria | 792 |
| 1113 | Ga0496100_0826750 | 3300048903 | Bacteria | 726 |
| 1114 | Ga0496101_0001657 | 3300048904 | Bacteria | 13361 |
| 1115 | Ga0496102_0001372 | 3300048905 | Bacteria | 21715 |
| 1116 | Ga0496102_0086703 | 3300048905 | Bacteria | 2892 |
| 1117 | Ga0496102_0395918 | 3300048905 | Bacteria | 1299 |
| 1118 | Ga0496102_0690313 | 3300048905 | Bacteria | 944 |
| 1119 | Ga0496102_0845271 | 3300048905 | Bacteria | 837 |
| 1120 | Ga0496102_1359266 | 3300048905 | Unclassified | 629 |
| 1121 | Ga0496102_1899293 | 3300048905 | Bacteria | 512 |
| 1122 | Ga0496103_0093885 | 3300048906 | Bacteria | 1895 |
| 1123 | Ga0496103_0328941 | 3300048906 | Bacteria | 983 |
| 1124 | Ga0496103_0392970 | 3300048906 | Bacteria | 891 |
| 1125 | Ga0496103_0968469 | 3300048906 | Bacteria | 531 |
| 1126 | Ga0496104_0031068 | 3300048907 | Bacteria | 4965 |
| 1127 | Ga0496104_0085123 | 3300048907 | Bacteria | 3017 |
| 1128 | Ga0496104_0187032 | 3300048907 | Bacteria | 1982 |
| 1129 | Ga0496104_0225068 | 3300048907 | Bacteria | 1788 |
| 1130 | Ga0496104_0225312 | 3300048907 | Bacteria | 1787 |
| 1131 | Ga0496104_0281079 | 3300048907 | Bacteria | 1577 |
| 1132 | Ga0496104_0618069 | 3300048907 | Bacteria | 993 |
| 1133 | Ga0496104_0733998 | 3300048907 | Bacteria | 895 |
| 1134 | Ga0496105_0065252 | 3300048908 | Bacteria | 3005 |
| 1135 | Ga0496105_0068753 | 3300048908 | Bacteria | 2926 |
| 1136 | Ga0496105_0152431 | 3300048908 | Bacteria | 1899 |
| 1137 | Ga0496105_0182313 | 3300048908 | Bacteria | 1719 |
| 1138 | Ga0496105_0554994 | 3300048908 | Bacteria | 896 |
| 1139 | Ga0496106_0018200 | 3300048909 | Bacteria | 5195 |
| 1140 | Ga0496106_0102432 | 3300048909 | Bacteria | 2221 |
| 1141 | Ga0496106_0116553 | 3300048909 | Bacteria | 2084 |
| 1142 | Ga0496106_0568920 | 3300048909 | Bacteria | 909 |
| 1143 | Ga0496106_1167057 | 3300048909 | Bacteria | 601 |
| 1144 | Ga0496107_0181393 | 3300048910 | Bacteria | 1563 |
| 1145 | Ga0496107_0279700 | 3300048910 | Bacteria | 1242 |
| 1146 | Ga0496107_0354743 | 3300048910 | Bacteria | 1091 |
| 1147 | Ga0496108_0130931 | 3300048911 | Bacteria | 2156 |
| 1148 | Ga0496108_0174724 | 3300048911 | Bacteria | 1859 |
| 1149 | Ga0496108_0593451 | 3300048911 | Bacteria | 965 |
| 1150 | Ga0496109_0042846 | 3300048912 | Bacteria | 4102 |
| 1151 | Ga0496109_0109721 | 3300048912 | Bacteria | 2565 |
| 1152 | Ga0496109_0138611 | 3300048912 | Bacteria | 2274 |
| 1153 | Ga0496109_0144493 | 3300048912 | Bacteria | 2225 |
| 1154 | Ga0496109_0146203 | 3300048912 | Bacteria | 2212 |
| 1155 | Ga0496110_0030095 | 3300048913 | Bacteria | 4678 |
| 1156 | Ga0496110_0086342 | 3300048913 | Bacteria | 2801 |
| 1157 | Ga0496110_0152116 | 3300048913 | Bacteria | 2095 |
| 1158 | Ga0496110_0640483 | 3300048913 | Bacteria | 962 |
| 1159 | Ga0496110_1347820 | 3300048913 | Bacteria | 623 |
| 1160 | Ga0496111_0189945 | 3300048914 | Bacteria | 1527 |
| 1161 | Ga0496111_0342815 | 3300048914 | Bacteria | 1106 |
| 1162 | Ga0496112_0000004 | 3300048915 | Bacteria | 553294 |
| 1163 | Ga0496112_0074028 | 3300048915 | Bacteria | 3368 |
| 1164 | Ga0496112_0076941 | 3300048915 | Bacteria | 3299 |
| 1165 | Ga0496112_0119142 | 3300048915 | Bacteria | 2609 |
| 1166 | Ga0496112_0151225 | 3300048915 | Bacteria | 2288 |
| 1167 | Ga0496112_0191316 | 3300048915 | Bacteria | 2008 |
| 1168 | Ga0496112_0632604 | 3300048915 | Bacteria | 1000 |
| 1169 | Ga0496112_1154598 | 3300048915 | Bacteria | 692 |
| 1170 | Ga0496112_1754946 | 3300048915 | Bacteria | 533 |
| 1171 | Ga0496112_1767522 | 3300048915 | Bacteria | 530 |
| 1172 | Ga0496112_1780548 | 3300048915 | Bacteria | 528 |
| 1173 | Ga0496113_0033282 | 3300048916 | Bacteria | 3752 |
| 1174 | Ga0496113_0051955 | 3300048916 | Bacteria | 3059 |
| 1175 | Ga0496113_0060663 | 3300048916 | Bacteria | 2852 |
| 1176 | Ga0496113_0272102 | 3300048916 | Bacteria | 1354 |
| 1177 | Ga0496113_1099883 | 3300048916 | Bacteria | 623 |
| 1178 | Ga0496113_1446804 | 3300048916 | Bacteria | 531 |
| 1179 | Ga0496114_0012013 | 3300048917 | Bacteria | 6926 |
| 1180 | Ga0496114_0195591 | 3300048917 | Bacteria | 1770 |
| 1181 | Ga0496114_0750081 | 3300048917 | Bacteria | 853 |
| 1182 | Ga0496114_1420270 | 3300048917 | Bacteria | 581 |
| 1183 | Ga0496114_1670612 | 3300048917 | Bacteria | 525 |
| 1184 | Ga0496115_0001007 | 3300048918 | Bacteria | 20465 |
| 1185 | Ga0496115_0022258 | 3300048918 | Bacteria | 4909 |
| 1186 | Ga0496115_0128395 | 3300048918 | Bacteria | 2089 |
| 1187 | Ga0496115_1168140 | 3300048918 | Bacteria | 580 |
| 1188 | Ga0496116_0007069 | 3300048919 | Bacteria | 10052 |
| 1189 | Ga0496117_0037823 | 3300048920 | Bacteria | 3589 |
| 1190 | Ga0496117_0069135 | 3300048920 | Bacteria | 2380 |
| 1191 | Ga0496117_0107461 | 3300048920 | Bacteria | 1748 |
| 1192 | Ga0496117_0109295 | 3300048920 | Bacteria | 1727 |
| 1193 | Ga0496117_0200975 | 3300048920 | Bacteria | 1126 |
| 1194 | Ga0496117_0407123 | 3300048920 | Bacteria | 684 |
| 1195 | Ga0496118_0055848 | 3300048921 | Bacteria | 2974 |
| 1196 | Ga0496118_0272019 | 3300048921 | Bacteria | 948 |
| 1197 | Ga0496118_0404229 | 3300048921 | Bacteria | 708 |
| 1198 | Ga0496118_0404807 | 3300048921 | Bacteria | 707 |
| 1199 | Ga0496119_0080662 | 3300048922 | Bacteria | 1876 |
| 1200 | Ga0496119_0149386 | 3300048922 | Bacteria | 1254 |
| 1201 | Ga0496119_0168481 | 3300048922 | Bacteria | 1159 |
| 1202 | Ga0496120_0124831 | 3300048923 | Bacteria | 1326 |
| 1203 | Ga0496120_0147930 | 3300048923 | Bacteria | 1184 |
| 1204 | Ga0496121_0009175 | 3300048924 | Bacteria | 11434 |
| 1205 | Ga0496121_0037086 | 3300048924 | Bacteria | 4334 |
| 1206 | Ga0496121_0045611 | 3300048924 | Bacteria | 3764 |
| 1207 | Ga0496121_0051419 | 3300048924 | Bacteria | 3470 |
| 1208 | Ga0496121_0053882 | 3300048924 | Bacteria | 3366 |
| 1209 | Ga0496121_0124024 | 3300048924 | Bacteria | 1945 |
| 1210 | Ga0496121_0135276 | 3300048924 | Bacteria | 1837 |
| 1211 | Ga0496121_0307834 | 3300048924 | Bacteria | 1072 |
| 1212 | Ga0496121_0331468 | 3300048924 | Bacteria | 1021 |
| 1213 | Ga0496121_0560093 | 3300048924 | Bacteria | 713 |
| 1214 | Ga0496121_0562016 | 3300048924 | Bacteria | 712 |
| 1215 | Ga0496121_0708177 | 3300048924 | Bacteria | 605 |
| 1216 | Ga0496122_0086715 | 3300048925 | Bacteria | 2153 |
| 1217 | Ga0496122_0466420 | 3300048925 | Bacteria | 622 |
| 1218 | Ga0496123_0008569 | 3300048926 | Bacteria | 9371 |
| 1219 | Ga0496123_0303488 | 3300048926 | Bacteria | 761 |
| 1220 | Ga0496123_0361620 | 3300048926 | Bacteria | 672 |
| 1221 | Ga0496124_0189890 | 3300048927 | Bacteria | 1573 |
| 1222 | Ga0496124_0400335 | 3300048927 | Bacteria | 953 |
| 1223 | Ga0496124_0777099 | 3300048927 | Bacteria | 596 |
| 1224 | Ga0496125_0008508 | 3300048928 | Bacteria | 10731 |
| 1225 | Ga0496125_0028742 | 3300048928 | Bacteria | 5012 |
| 1226 | Ga0496125_0103686 | 3300048928 | Bacteria | 2086 |
| 1227 | Ga0496125_0147849 | 3300048928 | Bacteria | 1620 |
| 1228 | Ga0496125_0254530 | 3300048928 | Bacteria | 1105 |
| 1229 | Ga0496125_0378682 | 3300048928 | Bacteria | 835 |
| 1230 | Ga0496125_0524605 | 3300048928 | Bacteria | 661 |
| 1231 | Ga0496126_0005960 | 3300048929 | Bacteria | 13713 |
| 1232 | Ga0496126_0029531 | 3300048929 | Bacteria | 5208 |
| 1233 | Ga0496126_0035465 | 3300048929 | Bacteria | 4675 |
| 1234 | Ga0496126_0090130 | 3300048929 | Bacteria | 2698 |
| 1235 | Ga0496126_0093235 | 3300048929 | Bacteria | 2644 |
| 1236 | Ga0496126_0135189 | 3300048929 | Bacteria | 2127 |
| 1237 | Ga0496126_0171278 | 3300048929 | Bacteria | 1849 |
| 1238 | Ga0496126_0237766 | 3300048929 | Bacteria | 1523 |
| 1239 | Ga0496126_0254613 | 3300048929 | Bacteria | 1462 |
| 1240 | Ga0496126_0558077 | 3300048929 | Bacteria | 908 |
| 1241 | Ga0496126_0634908 | 3300048929 | Bacteria | 837 |
| 1242 | Ga0496126_0699162 | 3300048929 | Bacteria | 788 |
| 1243 | Ga0496126_0870795 | 3300048929 | Bacteria | 685 |
| 1244 | Ga0496126_0941713 | 3300048929 | Bacteria | 652 |
| 1245 | Ga0495678_150872 | 3300049459 | Bacteria | 751 |
| 1246 | Ga0495682_0027486 | 3300049460 | Bacteria | 2110 |
| 1247 | Ga0501032_0222250 | 3300049569 | Bacteria | 1229 |
| 1248 | Ga0501036_0287146 | 3300049572 | Bacteria | 1377 |
| 1249 | Ga0501036_0765263 | 3300049572 | Bacteria | 796 |
| 1250 | Ga0501038_0590958 | 3300049574 | Bacteria | 841 |
| 1251 | Ga0501039_0590541 | 3300049575 | Bacteria | 871 |
| 1252 | Ga0501039_0974485 | 3300049575 | Bacteria | 659 |
| 1253 | Ga0501046_0053125 | 3300049580 | Bacteria | 3192 |
| 1254 | Ga0501047_0089916 | 3300049581 | Bacteria | 2947 |
| 1255 | Ga0501067_0013283 | 3300049583 | Bacteria | 4561 |
| 1256 | Ga0501067_0037376 | 3300049583 | Bacteria | 2697 |
| 1257 | Ga0501069_0428836 | 3300049585 | Bacteria | 784 |
| 1258 | Ga0501070_0015246 | 3300049586 | Bacteria | 6468 |
| 1259 | Ga0501070_0640383 | 3300049586 | Bacteria | 845 |
| 1260 | Ga0501071_0118693 | 3300049587 | Bacteria | 1960 |
| 1261 | Ga0501073_0120185 | 3300049589 | Bacteria | 1821 |
| 1262 | Ga0501074_0021500 | 3300049590 | Bacteria | 4684 |
| 1263 | Ga0501075_1248560 | 3300049591 | Bacteria | 563 |
| 1264 | Ga0501076_0421718 | 3300049592 | Bacteria | 1098 |
| 1265 | Ga0501076_0567207 | 3300049592 | Bacteria | 936 |
| 1266 | Ga0501079_0495211 | 3300049741 | Bacteria | 961 |
| 1267 | Ga0501080_0012725 | 3300049742 | Bacteria | 7716 |
| 1268 | Ga0501081_0265498 | 3300049743 | Bacteria | 1255 |
| 1269 | Ga0501035_0608871 | 3300049822 | Bacteria | 889 |
| 1270 | Ga0501035_0962429 | 3300049822 | Bacteria | 673 |
| 1271 | Ga0501044_0096467 | 3300049823 | Bacteria | 2978 |
| 1272 | Ga0501044_0932748 | 3300049823 | Bacteria | 742 |
| 1273 | Ga0501045_0408459 | 3300049824 | Bacteria | 1010 |
| 1274 | nmdc:mga03683_320039_c1 | 3300050489 | Bacteria | 730 |
| 1275 | nmdc:mga03683_54863_c1 | 3300050489 | Bacteria | 1672 |
| 1276 | nmdc:mga03683_85045_c1 | 3300050489 | Bacteria | 1371 |
| 1277 | nmdc:mga03n38_395146_c1 | 3300050490 | Bacteria | 760 |
| 1278 | nmdc:mga03n38_4080_c1 | 3300050490 | Bacteria | 4787 |
| 1279 | nmdc:mga03n38_541952_c1 | 3300050490 | Bacteria | 657 |
| 1280 | nmdc:mga03n38_845249_c1 | 3300050490 | Bacteria | 535 |
| 1281 | nmdc:mga00v17_45088_c1 | 3300050491 | Bacteria | 2662 |
| 1282 | nmdc:mga00v17_7051_c1 | 3300050491 | Bacteria | 5985 |
| 1283 | nmdc:mga0yw44_1110835_c1 | 3300050492 | Bacteria | 534 |
| 1284 | nmdc:mga0yw44_157307_c1 | 3300050492 | Bacteria | 1486 |
| 1285 | nmdc:mga0yw44_158951_c1 | 3300050492 | Bacteria | 1478 |
| 1286 | nmdc:mga0yw44_166314_c1 | 3300050492 | Bacteria | 1446 |
| 1287 | nmdc:mga0yw44_17788_c1 | 3300050492 | Bacteria | 3877 |
| 1288 | nmdc:mga0yw44_195162_c1 | 3300050492 | Bacteria | 1336 |
| 1289 | nmdc:mga0yw44_72048_c2 | 3300050492 | Bacteria | 1837 |
| 1290 | nmdc:mga0yw44_91276_c1 | 3300050492 | Bacteria | 1925 |
| 1291 | nmdc:mga0k408_134733_c1 | 3300050493 | Bacteria | 1467 |
| 1292 | nmdc:mga0k408_248065_c1 | 3300050493 | Bacteria | 1063 |
| 1293 | nmdc:mga0k408_297527_c1 | 3300050493 | Bacteria | 963 |
| 1294 | nmdc:mga0k408_312697_c1 | 3300050493 | Bacteria | 937 |
| 1295 | nmdc:mga0k408_636663_c1 | 3300050493 | Bacteria | 627 |
| 1296 | nmdc:mga06z11_21966_c1 | 3300050494 | Bacteria | 2973 |
| 1297 | nmdc:mga06z11_287219_c1 | 3300050494 | Bacteria | 975 |
| 1298 | nmdc:mga06z11_361779_c1 | 3300050494 | Bacteria | 870 |
| 1299 | nmdc:mga06z11_888605_c1 | 3300050494 | Bacteria | 543 |
| 1300 | nmdc:mga07m45_135429_c1 | 3300050496 | Bacteria | 1426 |
| 1301 | nmdc:mga07m45_143059_c1 | 3300050496 | Bacteria | 1385 |
| 1302 | nmdc:mga07m45_19607_c1 | 3300050496 | Bacteria | 3666 |
| 1303 | nmdc:mga07m45_32975_c1 | 3300050496 | Bacteria | 2874 |
| 1304 | nmdc:mga05p37_1355167_c1 | 3300050507 | Bacteria | 720 |
| 1305 | nmdc:mga09592_1370420_c1 | 3300050508 | Bacteria | 579 |
| 1306 | nmdc:mga08y16_217475_c1 | 3300050511 | Bacteria | 1978 |
| 1307 | nmdc:mga0n895_1968156_c1 | 3300050512 | Bacteria | 543 |
| 1308 | nmdc:mga0n895_237094_c1 | 3300050512 | Bacteria | 1851 |
| 1309 | nmdc:mga0rr50_1191032_c1 | 3300050513 | Unclassified | 647 |
| 1310 | nmdc:mga0rr50_775255_c1 | 3300050513 | Bacteria | 818 |
| 1311 | nmdc:mga0sz30_124512_c1 | 3300050516 | Bacteria | 1134 |
| 1312 | nmdc:mga0sz30_233982_c1 | 3300050516 | Bacteria | 817 |
| 1313 | nmdc:mga0sz30_290925_c1 | 3300050516 | Bacteria | 728 |
| 1314 | nmdc:mga0sz30_390963_c1 | 3300050516 | Bacteria | 623 |
| 1315 | nmdc:mga0sz30_39865_c2 | 3300050516 | Bacteria | 1683 |
| 1316 | nmdc:mga0sz30_47846_c1 | 3300050516 | Bacteria | 1808 |
| 1317 | nmdc:mga0sz30_53267_c1 | 3300050516 | Bacteria | 1719 |
| 1318 | Ga0495601_0010740 | 3300053077 | Bacteria | 5464 |
| 1319 | Ga0495601_0091703 | 3300053077 | Bacteria | 1956 |
| 1320 | Ga0495601_0396101 | 3300053077 | Bacteria | 895 |
| 1321 | Ga0495612_0061234 | 3300053078 | Bacteria | 1559 |
| 1322 | Ga0500635_0280110 | 3300053080 | Bacteria | 656 |
| 1323 | Ga0495655_0009352 | 3300053083 | Bacteria | 1898 |
| 1324 | Ga0495655_0152781 | 3300053083 | Bacteria | 727 |
| 1325 | Ga0495595_0001173 | 3300053084 | Bacteria | 10166 |
| 1326 | Ga0495595_0043673 | 3300053084 | Bacteria | 2057 |
| 1327 | Ga0495619_0000166 | 3300053085 | Bacteria | 48296 |
| 1328 | Ga0495619_0143286 | 3300053085 | Bacteria | 1646 |
| 1329 | Ga0495619_0178718 | 3300053085 | Bacteria | 1468 |
| 1330 | Ga0500578_0027306 | 3300053086 | Bacteria | 3665 |
| 1331 | Ga0500643_026377 | 3300053087 | Bacteria | 1820 |
| 1332 | Ga0500644_0255062 | 3300053088 | Bacteria | 740 |
| 1333 | Ga0500581_281372 | 3300053089 | Bacteria | 676 |
| 1334 | Ga0500647_0075122 | 3300053091 | Bacteria | 1622 |
| 1335 | Ga0500583_0122818 | 3300053092 | Bacteria | 1285 |
| 1336 | Ga0500583_0469818 | 3300053092 | Bacteria | 595 |
| 1337 | Ga0500651_0008263 | 3300053093 | Bacteria | 6116 |
| 1338 | Ga0500651_0066009 | 3300053093 | Bacteria | 2254 |
| 1339 | Ga0500651_0244813 | 3300053093 | Bacteria | 1044 |
| 1340 | Ga0500651_0579270 | 3300053093 | Bacteria | 611 |
| 1341 | Ga0500566_0000141 | 3300053094 | Bacteria | 36876 |
| 1342 | Ga0500566_0005775 | 3300053094 | Bacteria | 7353 |
| 1343 | Ga0500566_0011586 | 3300053094 | Bacteria | 5191 |
| 1344 | Ga0500640_001964 | 3300053095 | Bacteria | 6592 |
| 1345 | Ga0500641_0003020 | 3300053096 | Bacteria | 5959 |
| 1346 | Ga0500641_0080028 | 3300053096 | Bacteria | 1385 |
| 1347 | Ga0500641_0091282 | 3300053096 | Bacteria | 1300 |
| 1348 | Ga0500650_0000214 | 3300053098 | Bacteria | 14010 |
| 1349 | Ga0500554_023213 | 3300053102 | Bacteria | 1742 |
| 1350 | Ga0500554_190777 | 3300053102 | Bacteria | 687 |
| 1351 | Ga0500555_062156 | 3300053103 | Bacteria | 1002 |
| 1352 | Ga0500555_114344 | 3300053103 | Bacteria | 678 |
| 1353 | Ga0500556_0000125 | 3300053104 | Bacteria | 65777 |
| 1354 | Ga0500562_046570 | 3300053108 | Bacteria | 1156 |
| 1355 | Ga0500562_132466 | 3300053108 | Bacteria | 679 |
| 1356 | Ga0500569_024008 | 3300053109 | Bacteria | 1645 |
| 1357 | Ga0500572_000838 | 3300053111 | Bacteria | 9643 |
| 1358 | Ga0500572_025471 | 3300053111 | Bacteria | 1604 |
| 1359 | Ga0500582_232081 | 3300053114 | Bacteria | 605 |
| 1360 | Ga0500591_078821 | 3300053115 | Bacteria | 1471 |
| 1361 | Ga0500592_005168 | 3300053116 | Bacteria | 2073 |
| 1362 | Ga0500592_055654 | 3300053116 | Bacteria | 645 |
| 1363 | Ga0500594_0023056 | 3300053118 | Bacteria | 1575 |
| 1364 | Ga0500594_0061340 | 3300053118 | Bacteria | 1085 |
| 1365 | Ga0500595_000454 | 3300053119 | Bacteria | 25490 |
| 1366 | Ga0500595_000732 | 3300053119 | Bacteria | 19543 |
| 1367 | Ga0500595_002046 | 3300053119 | Bacteria | 10305 |
| 1368 | Ga0500595_003733 | 3300053119 | Bacteria | 7022 |
| 1369 | Ga0500608_038718 | 3300053122 | Bacteria | 2282 |
| 1370 | Ga0500614_001145 | 3300053123 | Bacteria | 6520 |
| 1371 | Ga0500618_086119 | 3300053125 | Bacteria | 705 |
| 1372 | Ga0500642_0000194 | 3300053130 | Bacteria | 24955 |
| 1373 | Ga0500642_0163218 | 3300053130 | Bacteria | 1044 |
| 1374 | Ga0500652_000210 | 3300053131 | Bacteria | 22474 |
| 1375 | Ga0500658_0172865 | 3300053134 | Bacteria | 981 |
| 1376 | Ga0500658_0210314 | 3300053134 | Bacteria | 890 |
| 1377 | Ga0500559_0000205 | 3300053136 | Bacteria | 47084 |
| 1378 | Ga0500559_0001193 | 3300053136 | Bacteria | 15436 |
| 1379 | Ga0500559_0002865 | 3300053136 | Bacteria | 8717 |
| 1380 | Ga0500559_0135640 | 3300053136 | Bacteria | 1151 |
| 1381 | Ga0500559_0146810 | 3300053136 | Bacteria | 1106 |
| 1382 | Ga0500561_0054778 | 3300053137 | Bacteria | 1100 |
| 1383 | Ga0500564_141665 | 3300053138 | Bacteria | 1032 |
| 1384 | Ga0500568_0000356 | 3300053139 | Bacteria | 35606 |
| 1385 | Ga0500568_0060570 | 3300053139 | Bacteria | 1466 |
| 1386 | Ga0500577_0276395 | 3300053142 | Bacteria | 732 |
| 1387 | Ga0500586_006207 | 3300053145 | Bacteria | 3088 |
| 1388 | Ga0500588_0065159 | 3300053146 | Bacteria | 1179 |
| 1389 | Ga0500588_0258580 | 3300053146 | Bacteria | 655 |
| 1390 | Ga0500589_086443 | 3300053147 | Bacteria | 1390 |
| 1391 | Ga0500590_009317 | 3300053148 | Bacteria | 4938 |
| 1392 | Ga0500590_106918 | 3300053148 | Bacteria | 1334 |
| 1393 | Ga0500603_000116 | 3300053150 | Bacteria | 18595 |
| 1394 | Ga0500603_000516 | 3300053150 | Bacteria | 9817 |
| 1395 | Ga0500603_015553 | 3300053150 | Bacteria | 1793 |
| 1396 | Ga0500604_0002009 | 3300053151 | Bacteria | 5628 |
| 1397 | Ga0500604_0033973 | 3300053151 | Bacteria | 1511 |
| 1398 | Ga0500616_0000895 | 3300053153 | Bacteria | 32765 |
| 1399 | Ga0500619_056453 | 3300053154 | Bacteria | 1283 |
| 1400 | Ga0500622_0002020 | 3300053156 | Bacteria | 15148 |
| 1401 | Ga0500622_0122533 | 3300053156 | Bacteria | 1259 |
| 1402 | Ga0500622_0403747 | 3300053156 | Bacteria | 554 |
| 1403 | Ga0500627_0434329 | 3300053158 | Bacteria | 555 |
| 1404 | Ga0500627_0490814 | 3300053158 | Bacteria | 512 |
| 1405 | Ga0500630_000171 | 3300053159 | Bacteria | 24352 |
| 1406 | Ga0500634_0016561 | 3300053161 | Bacteria | 3935 |
| 1407 | Ga0500634_0046954 | 3300053161 | Bacteria | 2332 |
| 1408 | Ga0500634_0052315 | 3300053161 | Bacteria | 2194 |
| 1409 | Ga0500634_0054026 | 3300053161 | Bacteria | 2153 |
| 1410 | Ga0500634_0074594 | 3300053161 | Bacteria | 1766 |
| 1411 | Ga0500638_125365 | 3300053162 | Bacteria | 1170 |
| 1412 | Ga0500639_000004 | 3300053163 | Bacteria | 216921 |
| 1413 | Ga0500636_0008650 | 3300053177 | Bacteria | 5897 |
| 1414 | Ga0500636_0125138 | 3300053177 | Bacteria | 1438 |
| 1415 | Ga0500636_0141505 | 3300053177 | Bacteria | 1331 |
| 1416 | Ga0500637_0000106 | 3300053178 | Bacteria | 29937 |
| 1417 | Ga0500637_0070515 | 3300053178 | Bacteria | 2009 |
| 1418 | Ga0500576_115956 | 3300053725 | Bacteria | 1064 |
| 1419 | Ga0500576_253826 | 3300053725 | Bacteria | 545 |
| 1420 | Ga0500611_006304 | 3300053727 | Bacteria | 1721 |
| 1421 | Ga0500611_255366 | 3300053727 | Bacteria | 506 |
| 1422 | Ga0500645_089457 | 3300053730 | Bacteria | 874 |
| 1423 | Ga0500645_149099 | 3300053730 | Bacteria | 644 |
| 1424 | Ga0500609_063377 | 3300053731 | Bacteria | 518 |
| 1425 | Ga0500596_001998 | 3300053735 | Bacteria | 4077 |
| 1426 | Ga0500596_002653 | 3300053735 | Bacteria | 3508 |
| 1427 | Ga0500596_015421 | 3300053735 | Bacteria | 1147 |
| 1428 | Ga0500601_051010 | 3300053737 | Bacteria | 515 |
| 1429 | Ga0530510_0772094 | 3300061734 | Bacteria | 733 |
| 1430 | 2513889418 | 2513237141 | Bacteria | 8496279 |
| 1431 | Ga0495625_0406750 | |||
| 1432 | JGI24740J21852_10018916 | |||
| 1433 | JGI24739J22299_10037604 | |||
| 1434 | JGI24735J21928_10017658 | |||
| 1435 | JGI24034J26672_10043150 | |||
| 1436 | JGI25406J46586_10006595 | |||
| 1437 | rootH1_10245633 | |||
| 1438 | rootH1_10331927 | |||
| 1439 | JGI25404J52841_10000284 | |||
| 1440 | JGI25404J52841_10004715 | |||
| 1441 | JGI25404J52841_10008794 | |||
| 1442 | JGI25404J52841_10012849 | |||
| 1443 | JGI25404J52841_10014178 | |||
| 1444 | Ga0055526_1017110 | |||
| 1445 | Ga0070658_10084498 | |||
| 1446 | Ga0070676_10230035 | |||
| 1447 | Ga0070683_100075117 | |||
| 1448 | Ga0070690_100140369 | |||
| 1449 | Ga0070690_100329500 | |||
| 1450 | Ga0070670_100216359 | |||
| 1451 | Ga0070670_101255005 | |||
| 1452 | Ga0068869_100052003 | |||
| 1453 | Ga0068869_100118587 | |||
| 1454 | Ga0068869_100199930 | |||
| 1455 | Ga0068869_100544171 | |||
| 1456 | Ga0070666_10576762 | |||
| 1457 | Ga0070680_100055739 | |||
| 1458 | Ga0070680_100116478 | |||
| 1459 | Ga0070680_100135204 | |||
| 1460 | Ga0070682_101494226 | |||
| 1461 | Ga0068868_100238841 | |||
| 1462 | Ga0068868_100529506 | |||
| 1463 | Ga0068868_100536017 | |||
| 1464 | Ga0068868_100846972 | |||
| 1465 | Ga0070689_100309548 | |||
| 1466 | Ga0070689_100360363 | |||
| 1467 | Ga0070689_100808855 | |||
| 1468 | Ga0070691_10110224 | |||
| 1469 | Ga0070687_101016541 | |||
| 1470 | Ga0070661_100298463 | |||
| 1471 | Ga0070692_10589669 | |||
| 1472 | Ga0070692_10687928 | |||
| 1473 | Ga0070668_100065242 | |||
| 1474 | Ga0070668_100248210 | |||
| 1475 | Ga0070668_100298097 | |||
| 1476 | Ga0070668_100368048 | |||
| 1477 | Ga0070668_100452177 | |||
| 1478 | Ga0070668_100639780 | |||
| 1479 | Ga0070668_100773098 | |||
| 1480 | Ga0070668_100817871 | |||
| 1481 | Ga0070669_100166629 | |||
| 1482 | Ga0070669_100251368 | |||
| 1483 | Ga0070669_101213858 | |||
| 1484 | Ga0070671_100245054 | |||
| 1485 | Ga0070671_100635296 | |||
| 1486 | Ga0070671_101145657 | |||
| 1487 | Ga0070671_101250748 | |||
| 1488 | Ga0070674_100053767 | |||
| 1489 | Ga0070674_100106814 | |||
| 1490 | Ga0070674_101947050 | |||
| 1491 | Ga0070673_100235500 | |||
| 1492 | Ga0070673_100368142 | |||
| 1493 | Ga0070688_100234467 | |||
| 1494 | Ga0070688_100327781 | |||
| 1495 | Ga0070688_100579307 | |||
| 1496 | Ga0070688_100830649 | |||
| 1497 | Ga0070659_100111795 | |||
| 1498 | Ga0070659_100852448 | |||
| 1499 | Ga0070667_100286345 | |||
| 1500 | Ga0070709_10015318 | |||
| 1501 | Ga0070709_10255217 | |||
| 1502 | Ga0070709_10312389 | |||
| 1503 | Ga0070709_10326413 | |||
| 1504 | Ga0070709_11136663 | |||
| 1505 | Ga0070714_100009232 | |||
| 1506 | Ga0070714_100095477 | |||
| 1507 | Ga0070714_100750762 | |||
| 1508 | Ga0070713_100001913 | |||
| 1509 | Ga0070713_100008075 | |||
| 1510 | Ga0070713_100021836 | |||
| 1511 | Ga0070713_100021931 | |||
| 1512 | Ga0070713_100396764 | |||
| 1513 | Ga0070713_100838945 | |||
| 1514 | Ga0070710_10001428 | |||
| 1515 | Ga0070710_10021540 | |||
| 1516 | Ga0070710_10159964 | |||
| 1517 | Ga0070710_10896839 | |||
| 1518 | Ga0070710_10941383 | |||
| 1519 | Ga0070701_10154385 | |||
| 1520 | Ga0070701_10271144 | |||
| 1521 | Ga0070711_100002884 | |||
| 1522 | Ga0070711_100022506 | |||
| 1523 | Ga0070711_100849314 | |||
| 1524 | Ga0070711_100999219 | |||
| 1525 | Ga0070705_100142370 | |||
| 1526 | Ga0070700_100087149 | |||
| 1527 | Ga0070700_100340364 | |||
| 1528 | Ga0070694_100737143 | |||
| 1529 | Ga0070663_100018502 | |||
| 1530 | Ga0070663_100020934 | |||
| 1531 | Ga0070663_100029630 | |||
| 1532 | Ga0070663_100102906 | |||
| 1533 | Ga0070663_100105474 | |||
| 1534 | Ga0070663_100208070 | |||
| 1535 | Ga0070663_100357665 | |||
| 1536 | Ga0070663_100861056 | |||
| 1537 | Ga0070663_101467329 | |||
| 1538 | Ga0070678_100008379 | |||
| 1539 | Ga0070678_100071386 | |||
| 1540 | Ga0070678_100162351 | |||
| 1541 | Ga0070678_100241447 | |||
| 1542 | Ga0070678_100419219 | |||
| 1543 | Ga0070678_100530375 | |||
| 1544 | Ga0070678_101965262 | |||
| 1545 | Ga0070678_102153808 | |||
| 1546 | Ga0070662_100101524 | |||
| 1547 | Ga0070662_100526195 | |||
| 1548 | Ga0070662_100544906 | |||
| 1549 | Ga0070662_101272236 | |||
| 1550 | Ga0070681_10072711 | |||
| 1551 | Ga0070681_10117014 | |||
| 1552 | Ga0070681_11196568 | |||
| 1553 | Ga0068867_100163781 | |||
| 1554 | Ga0070685_10269893 | |||
| 1555 | Ga0070706_100515445 | |||
| 1556 | Ga0070706_100519340 | |||
| 1557 | Ga0070707_100319127 | |||
| 1558 | Ga0070707_100820373 | |||
| 1559 | Ga0070707_101501412 | |||
| 1560 | Ga0070707_102152343 | |||
| 1561 | Ga0070698_100183267 | |||
| 1562 | Ga0070698_100185402 | |||
| 1563 | Ga0070698_101919341 | |||
| 1564 | Ga0070699_100141536 | |||
| 1565 | Ga0070679_100010022 | |||
| 1566 | Ga0070679_100074939 | |||
| 1567 | Ga0070684_100159468 | |||
| 1568 | Ga0070684_101266737 | |||
| 1569 | Ga0070697_101075536 | |||
| 1570 | Ga0070697_101292318 | |||
| 1571 | Ga0068853_100006903 | |||
| 1572 | Ga0068853_100323189 | |||
| 1573 | Ga0068853_100453799 | |||
| 1574 | Ga0068853_100717130 | |||
| 1575 | Ga0068853_100784836 | |||
| 1576 | Ga0070672_100227548 | |||
| 1577 | Ga0070672_100354887 | |||
| 1578 | Ga0070672_101014453 | |||
| 1579 | Ga0070686_100199392 | |||
| 1580 | Ga0070695_100377702 | |||
| 1581 | Ga0070696_100452323 | |||
| 1582 | Ga0070696_101339913 | |||
| 1583 | Ga0070693_100040365 | |||
| 1584 | Ga0070693_100105898 | |||
| 1585 | Ga0070665_100002761 | |||
| 1586 | Ga0070665_100028064 | |||
| 1587 | Ga0070665_100036089 | |||
| 1588 | Ga0070665_100232823 | |||
| 1589 | Ga0070665_100241295 | |||
| 1590 | Ga0070665_100535610 | |||
| 1591 | Ga0070665_100783630 | |||
| 1592 | Ga0070665_101126063 | |||
| 1593 | Ga0070665_101281209 | |||
| 1594 | Ga0070704_100625093 | |||
| 1595 | Ga0068855_100005114 | |||
| 1596 | Ga0068855_100061235 | |||
| 1597 | Ga0068855_100106133 | |||
| 1598 | Ga0068855_101348151 | |||
| 1599 | Ga0068857_100029142 | |||
| 1600 | Ga0068857_100152385 | |||
| 1601 | Ga0068857_100190946 | |||
| 1602 | Ga0068854_100015484 | |||
| 1603 | Ga0068854_100024882 | |||
| 1604 | Ga0068854_101632339 | |||
| 1605 | Ga0068854_102266864 | |||
| 1606 | Ga0068856_100010355 | |||
| 1607 | Ga0068856_100016084 | |||
| 1608 | Ga0068856_100523613 | |||
| 1609 | Ga0070702_100017077 | |||
| 1610 | Ga0070702_100271496 | |||
| 1611 | Ga0068852_100210962 | |||
| 1612 | Ga0068859_100032608 | |||
| 1613 | Ga0068859_100036626 | |||
| 1614 | Ga0068859_101590398 | |||
| 1615 | Ga0068859_102956824 | |||
| 1616 | Ga0068859_103024148 | |||
| 1617 | Ga0068864_100122963 | |||
| 1618 | Ga0068864_100388207 | |||
| 1619 | Ga0068866_10769440 | |||
| 1620 | Ga0068866_11094072 | |||
| 1621 | Ga0068861_100291490 | |||
| 1622 | Ga0068851_10002904 | |||
| 1623 | Ga0068863_100342772 | |||
| 1624 | Ga0068863_100744675 | |||
| 1625 | Ga0068858_100081959 | |||
| 1626 | Ga0068858_100429075 | |||
| 1627 | Ga0068858_100612353 | |||
| 1628 | Ga0068858_101370014 | |||
| 1629 | Ga0068860_100000149 | |||
| 1630 | Ga0068860_100066977 | |||
| 1631 | Ga0068860_100178468 | |||
| 1632 | Ga0068860_100313494 | |||
| 1633 | Ga0068860_100834815 | |||
| 1634 | Ga0068860_102467838 | |||
| 1635 | Ga0068862_100092022 | |||
| 1636 | Ga0068862_100227331 | |||
| 1637 | Ga0068862_100278417 | |||
| 1638 | Ga0068862_100418115 | |||
| 1639 | Ga0068862_100692512 | |||
| 1640 | Ga0068862_100768635 | |||
| 1641 | Ga0081455_10008954 | |||
| 1642 | Ga0081455_10010256 | |||
| 1643 | Ga0081455_10038775 | |||
| 1644 | Ga0081455_10137816 | |||
| 1645 | Ga0081538_10366194 | |||
| 1646 | Ga0081540_1001309 | |||
| 1647 | Ga0081540_1001846 | |||
| 1648 | Ga0081540_1004914 | |||
| 1649 | Ga0081540_1017082 | |||
| 1650 | Ga0081540_1017644 | |||
| 1651 | Ga0081540_1018007 | |||
| 1652 | Ga0081540_1019764 | |||
| 1653 | Ga0081540_1026602 | |||
| 1654 | Ga0081540_1028970 | |||
| 1655 | Ga0081540_1057747 | |||
| 1656 | Ga0081540_1172786 | |||
| 1657 | Ga0081539_10000176 | |||
| 1658 | Ga0081539_10001416 | |||
| 1659 | Ga0081539_10023931 | |||
| 1660 | Ga0081539_10219926 | |||
| 1661 | Ga0070717_10006449 | |||
| 1662 | Ga0070717_10007137 | |||
| 1663 | Ga0070717_10012334 | |||
| 1664 | Ga0070717_10415341 | |||
| 1665 | Ga0075365_10042089 | |||
| 1666 | Ga0075365_10129843 | |||
| 1667 | Ga0075365_10239811 | |||
| 1668 | Ga0075365_10429735 | |||
| 1669 | Ga0075365_10741444 | |||
| 1670 | Ga0075365_11144698 | |||
| 1671 | Ga0075365_11346469 | |||
| 1672 | Ga0075368_10118826 | |||
| 1673 | Ga0075368_10198478 | |||
| 1674 | Ga0075363_100050436 | |||
| 1675 | Ga0075363_100069001 | |||
| 1676 | Ga0075363_100613262 | |||
| 1677 | Ga0075364_10183397 | |||
| 1678 | Ga0075364_10401061 | |||
| 1679 | Ga0075364_10474157 | |||
| 1680 | Ga0075364_10675943 | |||
| 1681 | Ga0070715_10000460 | |||
| 1682 | Ga0070716_100002855 | |||
| 1683 | Ga0070716_100229188 | |||
| 1684 | Ga0070716_100274003 | |||
| 1685 | Ga0070716_100366005 | |||
| 1686 | Ga0070716_100511754 | |||
| 1687 | Ga0070716_101426344 | |||
| 1688 | Ga0070712_100007349 | |||
| 1689 | Ga0070712_100033986 | |||
| 1690 | Ga0070712_100137861 | |||
| 1691 | Ga0070712_100409923 | |||
| 1692 | Ga0070712_101041671 | |||
| 1693 | Ga0075362_10032172 | |||
| 1694 | Ga0075362_10442349 | |||
| 1695 | Ga0075362_10476935 | |||
| 1696 | Ga0075367_10193737 | |||
| 1697 | Ga0075367_10205660 | |||
| 1698 | Ga0075367_10962582 | |||
| 1699 | Ga0075367_10980478 | |||
| 1700 | Ga0075367_11024060 | |||
| 1701 | Ga0075369_10030536 | |||
| 1702 | Ga0075369_10051573 | |||
| 1703 | Ga0075369_10177426 | |||
| 1704 | Ga0075369_10252106 | |||
| 1705 | Ga0075369_10522609 | |||
| 1706 | Ga0075366_10124923 | |||
| 1707 | Ga0075366_10189049 | |||
| 1708 | Ga0075366_10199128 | |||
| 1709 | Ga0075366_10386647 | |||
| 1710 | Ga0097621_100137460 | |||
| 1711 | Ga0097621_100174216 | |||
| 1712 | Ga0097621_100624080 | |||
| 1713 | Ga0097621_101222842 | |||
| 1714 | Ga0097621_101418977 | |||
| 1715 | Ga0075370_10024488 | |||
| 1716 | Ga0075370_10142482 | |||
| 1717 | Ga0075370_10195886 | |||
| 1718 | Ga0075370_10336999 | |||
| 1719 | Ga0075370_10454695 | |||
| 1720 | Ga0068871_100110507 | |||
| 1721 | Ga0075428_100066108 | |||
| 1722 | Ga0075428_101667424 | |||
| 1723 | Ga0075431_100140441 | |||
| 1724 | Ga0075434_100231591 | |||
| 1725 | Ga0068865_100071666 | |||
| 1726 | Ga0068865_100099885 | |||
| 1727 | Ga0068865_100368330 | |||
| 1728 | Ga0068865_100501627 | |||
| 1729 | Ga0068865_101397579 | |||
| 1730 | Ga0097620_100032608 | |||
| 1731 | Ga0097620_100036626 | |||
| 1732 | Ga0097620_101590173 | |||
| 1733 | Ga0097620_102957478 | |||
| 1734 | Ga0097620_103024179 | |||
| 1735 | Ga0075435_100124227 | |||
| 1736 | Ga0075435_101259872 | |||
| 1737 | Ga0099794_10036834 | |||
| 1738 | Ga0099795_10027848 | |||
| 1739 | Ga0099795_10052265 | |||
| 1740 | Ga0099795_10061731 | |||
| 1741 | Ga0105240_10004765 | |||
| 1742 | Ga0105240_10034450 | |||
| 1743 | Ga0105240_10071834 | |||
| 1744 | Ga0105240_10078859 | |||
| 1745 | Ga0105240_10230644 | |||
| 1746 | Ga0105240_11066144 | |||
| 1747 | Ga0111539_10060214 | |||
| 1748 | Ga0105245_10106409 | |||
| 1749 | Ga0105245_10191629 | |||
| 1750 | Ga0105245_10377635 | |||
| 1751 | Ga0105245_10583897 | |||
| 1752 | Ga0105245_10819958 | |||
| 1753 | Ga0105245_11287609 | |||
| 1754 | Ga0105245_12269721 | |||
| 1755 | Ga0105247_10025319 | |||
| 1756 | Ga0105247_10164630 | |||
| 1757 | Ga0105247_10258475 | |||
| 1758 | Ga0105247_10571998 | |||
| 1759 | Ga0105247_10641124 | |||
| 1760 | Ga0105247_11090613 | |||
| 1761 | Ga0114129_11647188 | |||
| 1762 | Ga0105243_10172123 | |||
| 1763 | Ga0105243_10388473 | |||
| 1764 | Ga0105243_10581149 | |||
| 1765 | Ga0105243_11040773 | |||
| 1766 | Ga0105243_11462993 | |||
| 1767 | Ga0105243_13006512 | |||
| 1768 | Ga0105241_10001875 | |||
| 1769 | Ga0105241_10049725 | |||
| 1770 | Ga0105241_10411186 | |||
| 1771 | Ga0105242_10036881 | |||
| 1772 | Ga0105242_10245631 | |||
| 1773 | Ga0105242_10413168 | |||
| 1774 | Ga0105242_10853813 | |||
| 1775 | Ga0105242_11501539 | |||
| 1776 | Ga0105248_10185213 | |||
| 1777 | Ga0105248_10933304 | |||
| 1778 | Ga0105237_10057288 | |||
| 1779 | Ga0105237_10074813 | |||
| 1780 | Ga0105237_10182633 | |||
| 1781 | Ga0105237_10414356 | |||
| 1782 | Ga0105237_10538641 | |||
| 1783 | Ga0105237_10657888 | |||
| 1784 | Ga0105237_10851956 | |||
| 1785 | Ga0105237_10981688 | |||
| 1786 | Ga0105237_11447125 | |||
| 1787 | Ga0105238_10010766 | |||
| 1788 | Ga0105238_10022965 | |||
| 1789 | Ga0105238_10104024 | |||
| 1790 | Ga0105238_10105365 | |||
| 1791 | Ga0105238_10339499 | |||
| 1792 | Ga0105238_10467360 | |||
| 1793 | Ga0105238_10533447 | |||
| 1794 | Ga0105238_11636176 | |||
| 1795 | Ga0105238_11952177 | |||
| 1796 | Ga0105249_10248999 | |||
| 1797 | Ga0105249_10540431 | |||
| 1798 | Ga0105249_10558034 | |||
| 1799 | Ga0105249_10872223 | |||
| 1800 | Ga0105249_11826654 | |||
| 1801 | Ga0105249_13110340 | |||
| 1802 | Ga0099796_10028131 | |||
| 1803 | Ga0099796_10073148 | |||
| 1804 | Ga0099796_10492846 | |||
| 1805 | Ga0105239_10023684 | |||
| 1806 | Ga0105239_10117927 | |||
| 1807 | Ga0105239_10296279 | |||
| 1808 | Ga0105239_10363184 | |||
| 1809 | Ga0105239_10445611 | |||
| 1810 | Ga0105239_11052192 | |||
| 1811 | Ga0105239_11113824 | |||
| 1812 | Ga0105246_10272362 | |||
| 1813 | Ga0105246_10738007 | |||
| 1814 | Ga0105246_10858383 | |||
| 1815 | Ga0157371_10580325 | |||
| 1816 | Ga0157370_10027175 | |||
| 1817 | Ga0157370_10255017 | |||
| 1818 | Ga0157369_10761473 | |||
| 1819 | Ga0157369_12192452 | |||
| 1820 | Ga0157374_10058369 | |||
| 1821 | Ga0157374_10353092 | |||
| 1822 | Ga0157374_11556082 | |||
| 1823 | Ga0157374_12630916 | |||
| 1824 | Ga0157378_10027145 | |||
| 1825 | Ga0157378_10375694 | |||
| 1826 | Ga0163162_10064357 | |||
| 1827 | Ga0163162_10457298 | |||
| 1828 | Ga0163162_10558336 | |||
| 1829 | Ga0163162_10592383 | |||
| 1830 | Ga0163162_10749804 | |||
| 1831 | Ga0163162_10821781 | |||
| 1832 | Ga0163162_11547979 | |||
| 1833 | Ga0163162_12648991 | |||
| 1834 | Ga0157372_10146202 | |||
| 1835 | Ga0157372_10566633 | |||
| 1836 | Ga0157372_13316849 | |||
| 1837 | Ga0157375_10017467 | |||
| 1838 | Ga0157375_10046033 | |||
| 1839 | Ga0157375_10289997 | |||
| 1840 | Ga0157375_11084594 | |||
| 1841 | Ga0157375_11569927 | |||
| 1842 | Ga0157375_11975945 | |||
| 1843 | Ga0157375_12144644 | |||
| 1844 | Ga0157375_12379754 | |||
| 1845 | Ga0163163_10012476 | |||
| 1846 | Ga0163163_10091768 | |||
| 1847 | Ga0163163_10490339 | |||
| 1848 | Ga0163163_10496239 | |||
| 1849 | Ga0163163_10525014 | |||
| 1850 | Ga0163163_11044300 | |||
| 1851 | Ga0163163_11238310 | |||
| 1852 | Ga0157380_10156299 | |||
| 1853 | Ga0157380_10339773 | |||
| 1854 | Ga0157380_12815690 | |||
| 1855 | Ga0182008_10707214 | |||
| 1856 | Ga0182008_10790206 | |||
| 1857 | Ga0157377_10440009 | |||
| 1858 | Ga0157377_10833812 | |||
| 1859 | Ga0157379_10091190 | |||
| 1860 | Ga0157379_10166683 | |||
| 1861 | Ga0157379_10175791 | |||
| 1862 | Ga0157379_10332247 | |||
| 1863 | Ga0157379_10819157 | |||
| 1864 | Ga0157376_10050762 | |||
| 1865 | Ga0157376_10056908 | |||
| 1866 | Ga0157376_11424776 | |||
| 1867 | Ga0157376_11570659 | |||
| 1868 | Ga0163161_10047763 | |||
| 1869 | Ga0163161_10209322 | |||
| 1870 | Ga0163161_10902197 | |||
| 1871 | Ga0213876_10112793 | |||
| 1872 | Ga0213876_10171651 | |||
| 1873 | Ga0209148_1009946 | |||
| 1874 | Ga0209233_1006130 | |||
| 1875 | Ga0209455_1004451 | |||
| 1876 | Ga0209130_1048229 | |||
| 1877 | Ga0209564_1000871 | |||
| 1878 | Ga0209758_1008123 | |||
| 1879 | Ga0209758_1063189 | |||
| 1880 | Ga0207697_10238697 | |||
| 1881 | Ga0207697_10412722 | |||
| 1882 | Ga0207656_10589871 | |||
| 1883 | Ga0207653_10157501 | |||
| 1884 | Ga0207682_10196848 | |||
| 1885 | Ga0207692_10001538 | |||
| 1886 | Ga0207692_10028383 | |||
| 1887 | Ga0207692_10529546 | |||
| 1888 | Ga0207642_10088013 | |||
| 1889 | Ga0207642_10526914 | |||
| 1890 | Ga0207710_10019866 | |||
| 1891 | Ga0207710_10280018 | |||
| 1892 | Ga0207710_10335780 | |||
| 1893 | Ga0207688_10047181 | |||
| 1894 | Ga0207688_10523570 | |||
| 1895 | Ga0207680_10437246 | |||
| 1896 | Ga0207647_10000524 | |||
| 1897 | Ga0207647_10661253 | |||
| 1898 | Ga0207685_10026923 | |||
| 1899 | Ga0207685_10057892 | |||
| 1900 | Ga0207685_10314205 | |||
| 1901 | Ga0207699_10001041 | |||
| 1902 | Ga0207699_10027422 | |||
| 1903 | Ga0207699_10253360 | |||
| 1904 | Ga0207699_10298069 | |||
| 1905 | Ga0207699_10992873 | |||
| 1906 | Ga0207645_10154625 | |||
| 1907 | Ga0207643_10830070 | |||
| 1908 | Ga0207643_10988809 | |||
| 1909 | Ga0207705_10065134 | |||
| 1910 | Ga0207684_10045107 | |||
| 1911 | Ga0207654_10007949 | |||
| 1912 | Ga0207707_10006494 | |||
| 1913 | Ga0207707_10094713 | |||
| 1914 | Ga0207707_10116754 | |||
| 1915 | Ga0207695_10000883 | |||
| 1916 | Ga0207695_10126760 | |||
| 1917 | Ga0207695_10199856 | |||
| 1918 | Ga0207671_10137988 | |||
| 1919 | Ga0207671_10179914 | |||
| 1920 | Ga0207671_10609544 | |||
| 1921 | Ga0207671_11325480 | |||
| 1922 | Ga0207693_10001357 | |||
| 1923 | Ga0207693_10045134 | |||
| 1924 | Ga0207693_10308039 | |||
| 1925 | Ga0207663_10000873 | |||
| 1926 | Ga0207663_11601478 | |||
| 1927 | Ga0207660_10018272 | |||
| 1928 | Ga0207660_10170460 | |||
| 1929 | Ga0207660_10228304 | |||
| 1930 | Ga0207662_10399236 | |||
| 1931 | Ga0207649_10411728 | |||
| 1932 | Ga0207649_10468338 | |||
| 1933 | Ga0207652_10019705 | |||
| 1934 | Ga0207652_10036809 | |||
| 1935 | Ga0207646_10423807 | |||
| 1936 | Ga0207646_10848782 | |||
| 1937 | Ga0207681_10101995 | |||
| 1938 | Ga0207681_10109814 | |||
| 1939 | Ga0207681_10960941 | |||
| 1940 | Ga0207681_11295058 | |||
| 1941 | Ga0207694_10000436 | |||
| 1942 | Ga0207694_10286713 | |||
| 1943 | Ga0207694_10299073 | |||
| 1944 | Ga0207694_11700015 | |||
| 1945 | Ga0207650_10236529 | |||
| 1946 | Ga0207650_11091003 | |||
| 1947 | Ga0207687_10060012 | |||
| 1948 | Ga0207687_10300323 | |||
| 1949 | Ga0207687_11770332 | |||
| 1950 | Ga0207700_10015973 | |||
| 1951 | Ga0207700_10302656 | |||
| 1952 | Ga0207700_10342683 | |||
| 1953 | Ga0207700_10937011 | |||
| 1954 | Ga0207700_11135075 | |||
| 1955 | Ga0207664_10041469 | |||
| 1956 | Ga0207664_11467708 | |||
| 1957 | Ga0207644_10147516 | |||
| 1958 | Ga0207644_10283718 | |||
| 1959 | Ga0207644_10438402 | |||
| 1960 | Ga0207690_10103616 | |||
| 1961 | Ga0207706_10198004 | |||
| 1962 | Ga0207706_10281363 | |||
| 1963 | Ga0207706_10412454 | |||
| 1964 | Ga0207706_10445662 | |||
| 1965 | Ga0207686_10203174 | |||
| 1966 | Ga0207686_10282709 | |||
| 1967 | Ga0207686_10621417 | |||
| 1968 | Ga0207709_10091661 | |||
| 1969 | Ga0207709_10600067 | |||
| 1970 | Ga0207709_10967122 | |||
| 1971 | Ga0207709_11384005 | |||
| 1972 | Ga0207709_11413899 | |||
| 1973 | Ga0207709_11835392 | |||
| 1974 | Ga0207670_10304394 | |||
| 1975 | Ga0207670_10319432 | |||
| 1976 | Ga0207670_10824054 | |||
| 1977 | Ga0207669_10016092 | |||
| 1978 | Ga0207669_10395901 | |||
| 1979 | Ga0207669_10668490 | |||
| 1980 | Ga0207669_10754247 | |||
| 1981 | Ga0207704_10091211 | |||
| 1982 | Ga0207704_10301770 | |||
| 1983 | Ga0207704_10349967 | |||
| 1984 | Ga0207704_10552679 | |||
| 1985 | Ga0207665_10006588 | |||
| 1986 | Ga0207665_10195062 | |||
| 1987 | Ga0207691_10113728 | |||
| 1988 | Ga0207691_10125639 | |||
| 1989 | Ga0207691_10160565 | |||
| 1990 | Ga0207691_10165942 | |||
| 1991 | Ga0207691_10315793 | |||
| 1992 | Ga0207711_10024524 | |||
| 1993 | Ga0207711_10055599 | |||
| 1994 | Ga0207711_10470816 | |||
| 1995 | Ga0207711_10998527 | |||
| 1996 | Ga0207689_10014560 | |||
| 1997 | Ga0207689_10075631 | |||
| 1998 | Ga0207689_10102772 | |||
| 1999 | Ga0207689_10928424 | |||
| 2000 | Ga0207689_11306754 | |||
| 2001 | Ga0207661_10356198 | |||
| 2002 | Ga0207661_10507815 | |||
| 2003 | Ga0207679_10363784 | |||
| 2004 | Ga0207667_10011785 | |||
| 2005 | Ga0207667_10016252 | |||
| 2006 | Ga0207667_10090923 | |||
| 2007 | Ga0207667_10137082 | |||
| 2008 | Ga0207667_11199465 | |||
| 2009 | Ga0207651_10197939 | |||
| 2010 | Ga0207651_10308307 | |||
| 2011 | Ga0207651_10628643 | |||
| 2012 | Ga0207651_11197130 | |||
| 2013 | Ga0207651_11477859 | |||
| 2014 | Ga0207712_10188234 | |||
| 2015 | Ga0207712_10884593 | |||
| 2016 | Ga0207712_11061111 | |||
| 2017 | Ga0207712_11401113 | |||
| 2018 | Ga0207668_10026995 | |||
| 2019 | Ga0207668_10048033 | |||
| 2020 | Ga0207668_10055192 | |||
| 2021 | Ga0207668_10569343 | |||
| 2022 | Ga0207668_11293627 | |||
| 2023 | Ga0207640_10030276 | |||
| 2024 | Ga0207640_10072075 | |||
| 2025 | Ga0207640_10244776 | |||
| 2026 | Ga0207640_10609766 | |||
| 2027 | Ga0207640_10927596 | |||
| 2028 | Ga0207658_10200356 | |||
| 2029 | Ga0207658_10912458 | |||
| 2030 | Ga0207677_10155522 | |||
| 2031 | Ga0207677_10337149 | |||
| 2032 | Ga0207677_10798997 | |||
| 2033 | Ga0207677_10835388 | |||
| 2034 | Ga0207677_11721265 | |||
| 2035 | Ga0207703_10045095 | |||
| 2036 | Ga0207703_10138753 | |||
| 2037 | Ga0207639_10032959 | |||
| 2038 | Ga0207639_10082300 | |||
| 2039 | Ga0207639_10083086 | |||
| 2040 | Ga0207639_10083580 | |||
| 2041 | Ga0207639_11434653 | |||
| 2042 | Ga0207678_10002505 | |||
| 2043 | Ga0207678_10012047 | |||
| 2044 | Ga0207678_10057400 | |||
| 2045 | Ga0207678_10069632 | |||
| 2046 | Ga0207678_10098073 | |||
| 2047 | Ga0207678_10272664 | |||
| 2048 | Ga0207678_10276198 | |||
| 2049 | Ga0207708_10077114 | |||
| 2050 | Ga0207708_10078138 | |||
| 2051 | Ga0207708_10098621 | |||
| 2052 | Ga0207708_10576324 | |||
| 2053 | Ga0207702_10000005 | |||
| 2054 | Ga0207702_10245744 | |||
| 2055 | Ga0207641_10674097 | |||
| 2056 | Ga0207641_11329376 | |||
| 2057 | Ga0207648_10116422 | |||
| 2058 | Ga0207648_11356699 | |||
| 2059 | Ga0207676_10096995 | |||
| 2060 | Ga0207676_10480108 | |||
| 2061 | Ga0207676_10787130 | |||
| 2062 | Ga0207674_10010135 | |||
| 2063 | Ga0207674_10012171 | |||
| 2064 | Ga0207674_10075883 | |||
| 2065 | Ga0207674_10257701 | |||
| 2066 | Ga0207675_100042951 | |||
| 2067 | Ga0207675_100223869 | |||
| 2068 | Ga0207675_100618618 | |||
| 2069 | Ga0207675_102344476 | |||
| 2070 | Ga0207683_10016315 | |||
| 2071 | Ga0207683_10017331 | |||
| 2072 | Ga0207683_10160633 | |||
| 2073 | Ga0207683_10183829 | |||
| 2074 | Ga0207683_10204245 | |||
| 2075 | Ga0207683_10318009 | |||
| 2076 | Ga0207683_10520176 | |||
| 2077 | Ga0207683_10719616 | |||
| 2078 | Ga0207698_10244333 | |||
| 2079 | Ga0207698_10382864 | |||
| 2080 | Ga0209588_1001786 | |||
| 2081 | Ga0268266_10002595 | |||
| 2082 | Ga0268266_10015491 | |||
| 2083 | Ga0268266_10061183 | |||
| 2084 | Ga0268266_10086654 | |||
| 2085 | Ga0268266_10111685 | |||
| 2086 | Ga0268266_10242183 | |||
| 2087 | Ga0268266_10433167 | |||
| 2088 | Ga0268266_10530280 | |||
| 2089 | Ga0268266_10609932 | |||
| 2090 | Ga0268265_10086493 | |||
| 2091 | Ga0268265_10192057 | |||
| 2092 | Ga0268265_10260857 | |||
| 2093 | Ga0268265_10411219 | |||
| 2094 | Ga0268265_10507435 | |||
| 2095 | Ga0268265_10739933 | |||
| 2096 | Ga0268265_12342688 | |||
| 2097 | Ga0268264_10000084 | |||
| 2098 | Ga0268264_10308456 | |||
| 2099 | Ga0268264_10879419 | |||
| 2100 | Ga0268264_11286445 | |||
| 2101 | Ga0307517_10000369 | |||
| 2102 | Ga0307517_10319512 | |||
| 2103 | Ga0307517_10369578 | |||
| 2104 | Ga0307515_10013420 | |||
| 2105 | Ga0307515_10379216 | |||
| 2106 | Ga0307515_10555452 | |||
| 2107 | Ga0307511_10167846 | |||
| 2108 | Ga0307511_10363113 | |||
| 2109 | Ga0265330_10390655 | |||
| 2110 | Ga0265332_10031536 | |||
| 2111 | Ga0265325_10083915 | |||
| 2112 | Ga0265339_10315651 | |||
| 2113 | Ga0265331_10150792 | |||
| 2114 | Ga0265316_10354906 | |||
| 2115 | Ga0307513_10230970 | |||
| 2116 | Ga0307513_10235003 | |||
| 2117 | Ga0307513_10496669 | |||
| 2118 | Ga0307513_10997807 | |||
| 2119 | Ga0307509_10072887 | |||
| 2120 | Ga0307509_10073475 | |||
| 2121 | Ga0307509_10115650 | |||
| 2122 | Ga0307509_10299515 | |||
| 2123 | Ga0307509_10623411 | |||
| 2124 | Ga0307509_10685347 | |||
| 2125 | Ga0307408_100111744 | |||
| 2126 | Ga0307408_101496255 | |||
| 2127 | Ga0265313_10246272 | |||
| 2128 | Ga0307508_10047728 | |||
| 2129 | Ga0307508_10399318 | |||
| 2130 | Ga0307508_10422963 | |||
| 2131 | Ga0307508_10430681 | |||
| 2132 | Ga0265314_10170340 | |||
| 2133 | Ga0265342_10486181 | |||
| 2134 | Ga0307516_10021202 | |||
| 2135 | Ga0307516_10070865 | |||
| 2136 | Ga0307516_10082196 | |||
| 2137 | Ga0307516_10124721 | |||
| 2138 | Ga0307516_10229663 | |||
| 2139 | Ga0307405_10395838 | |||
| 2140 | Ga0307405_10847291 | |||
| 2141 | Ga0307413_10750540 | |||
| 2142 | Ga0307413_11084458 | |||
| 2143 | Ga0307410_10687159 | |||
| 2144 | Ga0307410_10690610 | |||
| 2145 | Ga0307410_10813122 | |||
| 2146 | Ga0307406_10305657 | |||
| 2147 | Ga0307406_10324210 | |||
| 2148 | Ga0307406_11348322 | |||
| 2149 | Ga0307407_10585430 | |||
| 2150 | Ga0307412_10828692 | |||
| 2151 | Ga0307409_100598259 | |||
| 2152 | Ga0307409_100708351 | |||
| 2153 | Ga0307416_100581995 | |||
| 2154 | Ga0307416_100998994 | |||
| 2155 | Ga0307416_101290043 | |||
| 2156 | Ga0307416_101803363 | |||
| 2157 | Ga0307416_101920548 | |||
| 2158 | Ga0307411_10125314 | |||
| 2159 | Ga0307411_10777241 | |||
| 2160 | Ga0307415_100221468 | |||
| 2161 | Ga0307415_100511168 | |||
| 2162 | Ga0307510_10005024 | |||
| 2163 | Ga0307510_10009194 | |||
| 2164 | Ga0307510_10270452 | |||
| 2165 | Ga0316215_1013852 | |||
| 2166 | Ga0373930_0038774 | |||
| 2167 | Ga0373948_0114130 | |||
| 2168 | Ga0373926_0334032 | |||
| 2169 | Ga0373934_0002431 | |||
| 2170 | Ga0373940_0058854 | |||
| 2171 | Ga0373940_0216543 | |||
| 2172 | Ga0373944_0010473 | |||
| 2173 | Ga0373949_0104761 | |||
| 2174 | Ga0373951_0170977 | |||
| 2175 | Ga0373923_0003726 | |||
| 2176 | Ga0373932_0044241 | |||
| 2177 | Ga0373932_0078207 | |||
| 2178 | Ga0373936_0200841 | |||
| 2179 | Ga0373936_0213465 | |||
| 2180 | Ga0373936_0350054 | |||
| 2181 | Ga0373939_0535118 | |||
| 2182 | Ga0373945_0002603 | |||
| 2183 | Ga0373953_0000929 | |||
| 2184 | Ga0373953_0005411 | |||
| 2185 | Ga0373953_0113058 | |||
| 2186 | Ga0373953_0486722 | |||
| 2187 | Ga0373954_0000067 | |||
| 2188 | Ga0373954_0024815 | |||
| 2189 | Ga0373954_0025269 | |||
| 2190 | Ga0373954_0075643 | |||
| 2191 | Ga0373954_0270539 | |||
| 2192 | Ga0373956_0001639 | |||
| 2193 | Ga0373956_0007638 | |||
| 2194 | Ga0373956_0182891 | |||
| 2195 | Ga0373957_0000501 | |||
| 2196 | Ga0373957_0006447 | |||
| 2197 | Ga0373960_0222618 | |||
| 2198 | Ga0373943_0001888 | |||
| 2199 | Ga0373943_0192509 | |||
| 2200 | Ga0373946_0004239 | |||
| 2201 | Ga0373946_0073134 | |||
| 2202 | Ga0373946_0451301 | |||
| 2203 | Ga0373955_0000377 | |||
| 2204 | Ga0373955_0138333 | |||
| 2205 | Ga0373955_0305681 | |||
| 2206 | Ga0373924_0004215 | |||
| 2207 | Ga0373924_0050507 | |||
| 2208 | Ga0373924_0074032 | |||
| 2209 | Ga0373931_0055359 | |||
| 2210 | Ga0373931_0226586 | |||
| 2211 | Ga0373931_0866974 | |||
| 2212 | Ga0373931_1070036 | |||
| 2213 | Ga0373935_0037417 | |||
| 2214 | Ga0373935_0040858 | |||
| 2215 | Ga0373935_0051478 | |||
| 2216 | Ga0373935_0128160 | |||
| 2217 | Ga0373935_0411134 | |||
| 2218 | Ga0373927_0003905 | |||
| 2219 | Ga0373927_0010432 | |||
| 2220 | Ga0373927_0044542 | |||
| 2221 | Ga0373927_0494060 | |||
| 2222 | Ga0373933_0000324 | |||
| 2223 | Ga0373933_0000519 | |||
| 2224 | Ga0373933_0089294 | |||
| 2225 | Ga0373933_0362051 | |||
| 2226 | Ga0373947_0008954 | |||
| 2227 | Ga0373947_0024948 | |||
| 2228 | Ga0373947_1004066 | |||
| 2229 | Ga0373947_1149189 | |||
| 2230 | Ga0373937_0001425 | |||
| 2231 | Ga0373937_0028466 | |||
| 2232 | Ga0373937_0046615 | |||
| 2233 | Ga0373937_0051681 | |||
| 2234 | Ga0373937_0095291 | |||
| 2235 | Ga0373937_1202387 | |||
| 2236 | Ga0372808_009233 | |||
| 2237 | Ga0373925_0035160 | |||
| 2238 | Ga0373925_0044313 | |||
| 2239 | Ga0373925_0126961 | |||
| 2240 | Ga0373925_0450652 | |||
| 2241 | Ga0373925_0587708 | |||
| 2242 | Ga0395900_0331538 | |||
| 2243 | Ga0395898_0173684 | |||
| 2244 | Ga0395898_0508131 | |||
| 2245 | Ga0395905_0078255 | |||
| 2246 | Ga0395905_0863503 | |||
| 2247 | Ga0395901_0231547 | |||
| 2248 | Ga0436365_0272569 | |||
| 2249 | Ga0436365_0912513 | |||
| 2250 | Ga0436365_1453434 | |||
| 2251 | Ga0436360_0319798 | |||
| 2252 | Ga0436361_0769166 | |||
| 2253 | Ga0436361_1169830 | |||
| 2254 | Ga0436363_1429749 | |||
| 2255 | Ga0436363_1677536 | |||
| 2256 | Ga0439465_0008956 | |||
| 2257 | Ga0439465_0174173 | |||
| 2258 | Ga0439465_0174241 | |||
| 2259 | Ga0451787_538535 | |||
| 2260 | Ga0451791_0066321 | |||
| 2261 | Ga0451791_0489189 | |||
| 2262 | Ga0451791_0730688 | |||
| 2263 | Ga0451791_1303076 | |||
| 2264 | Ga0451793_0071078 | |||
| 2265 | Ga0451798_0329382 | |||
| 2266 | Ga0451798_1021059 | |||
| 2267 | Ga0451800_1157606 | |||
| 2268 | Ga0451800_1572657 | |||
| 2269 | Ga0451802_1182178 | |||
| 2270 | Ga0451802_1196601 | |||
| 2271 | Ga0451807_0562609 | |||
| 2272 | Ga0451807_0964125 | |||
| 2273 | Ga0451807_1090274 | |||
| 2274 | Ga0451833_0175461 | |||
| 2275 | Ga0451837_1686692 | |||
| 2276 | Ga0451841_1132424 | |||
| 2277 | Ga0451845_0269736 | |||
| 2278 | Ga0439431_0096186 | |||
| 2279 | Ga0439432_250390 | |||
| 2280 | Ga0450900_013176 | |||
| 2281 | Ga0439458_0088481 | |||
| 2282 | Ga0439459_0079791 | |||
| 2283 | Ga0466963_0286380 | |||
| 2284 | Ga0466963_0513366 | |||
| 2285 | Ga0466957_1191876 | |||
| 2286 | Ga0451576_0584387 | |||
| 2287 | Ga0466967_0802600 | |||
| 2288 | Ga0495617_060657 | |||
| 2289 | Ga0495617_076494 | |||
| 2290 | Ga0495592_0046096 | |||
| 2291 | Ga0495592_0046648 | |||
| 2292 | Ga0495592_0048935 | |||
| 2293 | Ga0495603_0001576 | |||
| 2294 | Ga0495603_0002921 | |||
| 2295 | Ga0495603_0042436 | |||
| 2296 | Ga0495603_0272974 | |||
| 2297 | Ga0495603_0316279 | |||
| 2298 | Ga0495603_0416407 | |||
| 2299 | Ga0495603_0672904 | |||
| 2300 | Ga0495603_0743938 | |||
| 2301 | Ga0495590_0028519 | |||
| 2302 | Ga0495590_0158313 | |||
| 2303 | Ga0495590_0296728 | |||
| 2304 | Ga0495591_041130 | |||
| 2305 | Ga0495629_0000117 | |||
| 2306 | Ga0495629_0009626 | |||
| 2307 | Ga0495629_0051277 | |||
| 2308 | Ga0495629_0052231 | |||
| 2309 | Ga0495629_0118340 | |||
| 2310 | Ga0495629_0308867 | |||
| 2311 | Ga0495638_0012452 | |||
| 2312 | Ga0495638_0013191 | |||
| 2313 | Ga0495638_0093876 | |||
| 2314 | Ga0495638_0111195 | |||
| 2315 | Ga0495638_0132396 | |||
| 2316 | Ga0495638_0164961 | |||
| 2317 | Ga0495638_0180585 | |||
| 2318 | Ga0495638_0380222 | |||
| 2319 | Ga0495641_0002118 | |||
| 2320 | Ga0495641_0178345 | |||
| 2321 | Ga0495651_0291656 | |||
| 2322 | Ga0495651_0322396 | |||
| 2323 | Ga0495653_0001052 | |||
| 2324 | Ga0495653_0005677 | |||
| 2325 | Ga0495580_0004355 | |||
| 2326 | Ga0495582_0001007 | |||
| 2327 | Ga0495582_0006998 | |||
| 2328 | Ga0495582_0215666 | |||
| 2329 | Ga0495605_0141765 | |||
| 2330 | Ga0495605_0299951 | |||
| 2331 | Ga0495605_0412386 | |||
| 2332 | Ga0495639_0001543 | |||
| 2333 | Ga0495639_0070139 | |||
| 2334 | Ga0495639_0389224 | |||
| 2335 | Ga0495662_0004867 | |||
| 2336 | Ga0495664_0002486 | |||
| 2337 | Ga0495664_0025293 | |||
| 2338 | Ga0495664_0027203 | |||
| 2339 | Ga0495664_0489657 | |||
| 2340 | Ga0495584_0090452 | |||
| 2341 | Ga0495584_0151811 | |||
| 2342 | Ga0495584_0157224 | |||
| 2343 | Ga0495584_0273903 | |||
| 2344 | Ga0495584_0367795 | |||
| 2345 | Ga0495584_0571246 | |||
| 2346 | Ga0495585_0274787 | |||
| 2347 | Ga0495585_0354727 | |||
| 2348 | Ga0495585_0367730 | |||
| 2349 | Ga0495585_0602758 | |||
| 2350 | Ga0495594_0000662 | |||
| 2351 | Ga0495594_0100839 | |||
| 2352 | Ga0495594_0217634 | |||
| 2353 | Ga0495596_0074381 | |||
| 2354 | Ga0495596_0144327 | |||
| 2355 | Ga0495583_0146704 | |||
| 2356 | Ga0495606_0007334 | |||
| 2357 | Ga0495606_0119647 | |||
| 2358 | Ga0495606_0159353 | |||
| 2359 | Ga0495608_0067428 | |||
| 2360 | Ga0495608_0086752 | |||
| 2361 | Ga0495610_0027441 | |||
| 2362 | Ga0495610_0244598 | |||
| 2363 | Ga0495616_0082447 | |||
| 2364 | Ga0495616_0195491 | |||
| 2365 | Ga0495618_0006096 | |||
| 2366 | Ga0495618_0026157 | |||
| 2367 | Ga0495620_0039486 | |||
| 2368 | Ga0495620_0155520 | |||
| 2369 | Ga0495628_0003826 | |||
| 2370 | Ga0495628_0011244 | |||
| 2371 | Ga0495628_0150762 | |||
| 2372 | Ga0495628_1101860 | |||
| 2373 | Ga0495630_0001278 | |||
| 2374 | Ga0495630_0088527 | |||
| 2375 | Ga0495630_0174376 | |||
| 2376 | Ga0495630_1183960 | |||
| 2377 | Ga0495631_0119505 | |||
| 2378 | Ga0495631_0151228 | |||
| 2379 | Ga0495631_0156434 | |||
| 2380 | Ga0495632_0047263 | |||
| 2381 | Ga0495632_0060128 | |||
| 2382 | Ga0495632_0102087 | |||
| 2383 | Ga0495632_0243352 | |||
| 2384 | Ga0495632_0253061 | |||
| 2385 | Ga0495637_0240062 | |||
| 2386 | Ga0495643_0185764 | |||
| 2387 | Ga0495644_0401923 | |||
| 2388 | Ga0495648_0196717 | |||
| 2389 | Ga0495648_0343530 | |||
| 2390 | Ga0495666_0056048 | |||
| 2391 | Ga0495666_0057120 | |||
| 2392 | Ga0495642_0040785 | |||
| 2393 | Ga0495652_0051997 | |||
| 2394 | Ga0495652_0190799 | |||
| 2395 | Ga0495652_0489579 | |||
| 2396 | Ga0495652_0764365 | |||
| 2397 | Ga0495654_0064407 | |||
| 2398 | Ga0495665_0002979 | |||
| 2399 | Ga0495665_0044270 | |||
| 2400 | Ga0495640_0003398 | |||
| 2401 | Ga0495640_0010256 | |||
| 2402 | Ga0495640_0014352 | |||
| 2403 | Ga0495640_0066202 | |||
| 2404 | Ga0495586_0008523 | |||
| 2405 | Ga0495586_0150910 | |||
| 2406 | Ga0495587_0201811 | |||
| 2407 | Ga0495598_0121690 | |||
| 2408 | Ga0495598_0303029 | |||
| 2409 | Ga0495609_0178810 | |||
| 2410 | Ga0495621_0045276 | |||
| 2411 | Ga0495621_0104968 | |||
| 2412 | Ga0495597_0308424 | |||
| 2413 | Ga0495645_0003011 | |||
| 2414 | Ga0495645_0062858 | |||
| 2415 | Ga0495622_0008476 | |||
| 2416 | Ga0495622_0010153 | |||
| 2417 | Ga0495633_0141572 | |||
| 2418 | Ga0495667_0000305 | |||
| 2419 | Ga0495667_0013520 | |||
| 2420 | Ga0495667_0055353 | |||
| 2421 | Ga0495667_0239935 | |||
| 2422 | Ga0495667_0463175 | |||
| 2423 | Ga0495667_0474339 | |||
| 2424 | Ga0495656_0072060 | |||
| 2425 | Ga0495656_0314996 | |||
| 2426 | Ga0495656_0651585 | |||
| 2427 | Ga0495668_0163375 | |||
| 2428 | Ga0495668_0281519 | |||
| 2429 | Ga0495668_0342494 | |||
| 2430 | Ga0495668_0687123 | |||
| 2431 | Ga0495668_0742130 | |||
| 2432 | Ga0495634_0003435 | |||
| 2433 | Ga0495634_0012645 | |||
| 2434 | Ga0495634_0116442 | |||
| 2435 | Ga0495611_0068474 | |||
| 2436 | Ga0495611_0266170 | |||
| 2437 | Ga0495625_0083625 | |||
| 2438 | Ga0495625_0129353 | |||
| 2439 | Ga0495625_0179509 | |||
| 2440 | Ga0495625_0308987 | |||
| 2441 | Ga0495635_0000102 | |||
| 2442 | Ga0495635_0004903 | |||
| 2443 | Ga0495635_0043797 | |||
| 2444 | Ga0495635_0185121 | |||
| 2445 | Ga0495635_0372315 | |||
| 2446 | Ga0495659_0175649 | |||
| 2447 | Ga0495659_0355631 | |||
| 2448 | Ga0495661_0136470 | |||
| 2449 | Ga0495588_0018113 | |||
| 2450 | Ga0495588_0217280 | |||
| 2451 | Ga0495588_0234120 | |||
| 2452 | Ga0495588_0236938 | |||
| 2453 | Ga0495657_0022520 | |||
| 2454 | Ga0495599_0011854 | |||
| 2455 | Ga0495599_0045042 | |||
| 2456 | Ga0495623_0011690 | |||
| 2457 | Ga0495623_0022925 | |||
| 2458 | Ga0495623_0222438 | |||
| 2459 | Ga0495623_0253404 | |||
| 2460 | Ga0495646_0051078 | |||
| 2461 | Ga0495646_0070496 | |||
| 2462 | Ga0495646_0074138 | |||
| 2463 | Ga0495647_0006246 | |||
| 2464 | Ga0495647_0213518 | |||
| 2465 | Ga0495658_0002270 | |||
| 2466 | Ga0495658_0007004 | |||
| 2467 | Ga0495669_0095452 | |||
| 2468 | Ga0495669_0125137 | |||
| 2469 | Ga0495613_0007307 | |||
| 2470 | Ga0495624_0001774 | |||
| 2471 | Ga0495624_0023749 | |||
| 2472 | Ga0495624_0376701 | |||
| 2473 | Ga0495670_0026442 | |||
| 2474 | Ga0495670_0063863 | |||
| 2475 | Ga0495670_0275744 | |||
| 2476 | Ga0495670_0303697 | |||
| 2477 | Ga0495671_0139763 | |||
| 2478 | Ga0495671_0202203 | |||
| 2479 | Ga0495671_0204473 | |||
| 2480 | Ga0495671_0463029 | |||
| 2481 | Ga0495589_0079811 | |||
| 2482 | Ga0495589_0438001 | |||
| 2483 | Ga0495589_0534316 | |||
| 2484 | Ga0495600_0000357 | |||
| 2485 | Ga0495600_0007049 | |||
| 2486 | Ga0495600_0118259 | |||
| 2487 | Ga0495600_0156550 | |||
| 2488 | Ga0495600_0660628 | |||
| 2489 | Ga0495660_0069799 | |||
| 2490 | Ga0495581_0004221 | |||
| 2491 | Ga0495581_0021912 | |||
| 2492 | Ga0495581_0455134 | |||
| 2493 | Ga0495581_0510096 | |||
| 2494 | Ga0495604_0001099 | |||
| 2495 | Ga0495604_0107558 | |||
| 2496 | Ga0495604_0122277 | |||
| 2497 | Ga0495604_0491082 | |||
| 2498 | Ga0495636_0021311 | |||
| 2499 | Ga0495636_0143180 | |||
| 2500 | Ga0495636_0154755 | |||
| 2501 | Ga0495674_0029184 | |||
| 2502 | Ga0495674_0045856 | |||
| 2503 | Ga0495674_0046750 | |||
| 2504 | Ga0495674_0325463 | |||
| 2505 | Ga0495674_0826698 | |||
| 2506 | Ga0495672_0291252 | |||
| 2507 | Ga0495676_0222139 | |||
| 2508 | Ga0495676_0256733 | |||
| 2509 | Ga0495676_0974231 | |||
| 2510 | Ga0495680_0003585 | |||
| 2511 | Ga0495680_0039627 | |||
| 2512 | Ga0495680_0620904 | |||
| 2513 | Ga0495683_0243629 | |||
| 2514 | Ga0495675_0004354 | |||
| 2515 | Ga0495675_0385930 | |||
| 2516 | Ga0495675_0690680 | |||
| 2517 | Ga0495677_0093079 | |||
| 2518 | Ga0495679_053039 | |||
| 2519 | Ga0495685_146918 | |||
| 2520 | Ga0495685_214289 | |||
| 2521 | Ga0495673_0101389 | |||
| 2522 | Ga0495673_0269757 | |||
| 2523 | Ga0495684_0000088 | |||
| 2524 | Ga0495684_0080694 | |||
| 2525 | Ga0495684_0081455 | |||
| 2526 | Ga0495684_0795093 | |||
| 2527 | Ga0495686_0162846 | |||
| 2528 | Ga0495686_0338382 | |||
| 2529 | Ga0495686_0692071 | |||
| 2530 | Ga0495686_0705406 | |||
| 2531 | Ga0495593_0000167 | |||
| 2532 | Ga0495593_0001656 | |||
| 2533 | Ga0495593_0013615 | |||
| 2534 | Ga0495602_0026534 | |||
| 2535 | Ga0495602_0066783 | |||
| 2536 | Ga0495614_0071945 | |||
| 2537 | Ga0495615_0099555 | |||
| 2538 | Ga0495615_0303237 | |||
| 2539 | Ga0495626_0019316 | |||
| 2540 | Ga0496100_0020948 | |||
| 2541 | Ga0496100_0358106 | |||
| 2542 | Ga0496100_0697736 | |||
| 2543 | Ga0496100_0826750 | |||
| 2544 | Ga0496101_0001657 | |||
| 2545 | Ga0496102_0001372 | |||
| 2546 | Ga0496102_0086703 | |||
| 2547 | Ga0496102_0395918 | |||
| 2548 | Ga0496102_0690313 | |||
| 2549 | Ga0496102_0845271 | |||
| 2550 | Ga0496102_1359266 | |||
| 2551 | Ga0496102_1899293 | |||
| 2552 | Ga0496103_0093885 | |||
| 2553 | Ga0496103_0328941 | |||
| 2554 | Ga0496103_0392970 | |||
| 2555 | Ga0496103_0968469 | |||
| 2556 | Ga0496104_0031068 | |||
| 2557 | Ga0496104_0085123 | |||
| 2558 | Ga0496104_0187032 | |||
| 2559 | Ga0496104_0225068 | |||
| 2560 | Ga0496104_0225312 | |||
| 2561 | Ga0496104_0281079 | |||
| 2562 | Ga0496104_0618069 | |||
| 2563 | Ga0496104_0733998 | |||
| 2564 | Ga0496105_0065252 | |||
| 2565 | Ga0496105_0068753 | |||
| 2566 | Ga0496105_0152431 | |||
| 2567 | Ga0496105_0182313 | |||
| 2568 | Ga0496105_0554994 | |||
| 2569 | Ga0496106_0018200 | |||
| 2570 | Ga0496106_0102432 | |||
| 2571 | Ga0496106_0116553 | |||
| 2572 | Ga0496106_0568920 | |||
| 2573 | Ga0496106_1167057 | |||
| 2574 | Ga0496107_0181393 | |||
| 2575 | Ga0496107_0279700 | |||
| 2576 | Ga0496107_0354743 | |||
| 2577 | Ga0496108_0130931 | |||
| 2578 | Ga0496108_0174724 | |||
| 2579 | Ga0496108_0593451 | |||
| 2580 | Ga0496109_0042846 | |||
| 2581 | Ga0496109_0109721 | |||
| 2582 | Ga0496109_0138611 | |||
| 2583 | Ga0496109_0144493 | |||
| 2584 | Ga0496109_0146203 | |||
| 2585 | Ga0496110_0030095 | |||
| 2586 | Ga0496110_0086342 | |||
| 2587 | Ga0496110_0152116 | |||
| 2588 | Ga0496110_0640483 | |||
| 2589 | Ga0496110_1347820 | |||
| 2590 | Ga0496111_0189945 | |||
| 2591 | Ga0496111_0342815 | |||
| 2592 | Ga0496112_0000004 | |||
| 2593 | Ga0496112_0074028 | |||
| 2594 | Ga0496112_0076941 | |||
| 2595 | Ga0496112_0119142 | |||
| 2596 | Ga0496112_0151225 | |||
| 2597 | Ga0496112_0191316 | |||
| 2598 | Ga0496112_0632604 | |||
| 2599 | Ga0496112_1154598 | |||
| 2600 | Ga0496112_1754946 | |||
| 2601 | Ga0496112_1767522 | |||
| 2602 | Ga0496112_1780548 | |||
| 2603 | Ga0496113_0033282 | |||
| 2604 | Ga0496113_0051955 | |||
| 2605 | Ga0496113_0060663 | |||
| 2606 | Ga0496113_0272102 | |||
| 2607 | Ga0496113_1099883 | |||
| 2608 | Ga0496113_1446804 | |||
| 2609 | Ga0496114_0012013 | |||
| 2610 | Ga0496114_0195591 | |||
| 2611 | Ga0496114_0750081 | |||
| 2612 | Ga0496114_1420270 | |||
| 2613 | Ga0496114_1670612 | |||
| 2614 | Ga0496115_0001007 | |||
| 2615 | Ga0496115_0022258 | |||
| 2616 | Ga0496115_0128395 | |||
| 2617 | Ga0496115_1168140 | |||
| 2618 | Ga0496116_0007069 | |||
| 2619 | Ga0496117_0037823 | |||
| 2620 | Ga0496117_0069135 | |||
| 2621 | Ga0496117_0107461 | |||
| 2622 | Ga0496117_0109295 | |||
| 2623 | Ga0496117_0200975 | |||
| 2624 | Ga0496117_0407123 | |||
| 2625 | Ga0496118_0055848 | |||
| 2626 | Ga0496118_0272019 | |||
| 2627 | Ga0496118_0404229 | |||
| 2628 | Ga0496118_0404807 | |||
| 2629 | Ga0496119_0080662 | |||
| 2630 | Ga0496119_0149386 | |||
| 2631 | Ga0496119_0168481 | |||
| 2632 | Ga0496120_0124831 | |||
| 2633 | Ga0496120_0147930 | |||
| 2634 | Ga0496121_0009175 | |||
| 2635 | Ga0496121_0037086 | |||
| 2636 | Ga0496121_0045611 | |||
| 2637 | Ga0496121_0051419 | |||
| 2638 | Ga0496121_0053882 | |||
| 2639 | Ga0496121_0124024 | |||
| 2640 | Ga0496121_0135276 | |||
| 2641 | Ga0496121_0307834 | |||
| 2642 | Ga0496121_0331468 | |||
| 2643 | Ga0496121_0560093 | |||
| 2644 | Ga0496121_0562016 | |||
| 2645 | Ga0496121_0708177 | |||
| 2646 | Ga0496122_0086715 | |||
| 2647 | Ga0496122_0466420 | |||
| 2648 | Ga0496123_0008569 | |||
| 2649 | Ga0496123_0303488 | |||
| 2650 | Ga0496123_0361620 | |||
| 2651 | Ga0496124_0189890 | |||
| 2652 | Ga0496124_0400335 | |||
| 2653 | Ga0496124_0777099 | |||
| 2654 | Ga0496125_0008508 | |||
| 2655 | Ga0496125_0028742 | |||
| 2656 | Ga0496125_0103686 | |||
| 2657 | Ga0496125_0147849 | |||
| 2658 | Ga0496125_0254530 | |||
| 2659 | Ga0496125_0378682 | |||
| 2660 | Ga0496125_0524605 | |||
| 2661 | Ga0496126_0005960 | |||
| 2662 | Ga0496126_0029531 | |||
| 2663 | Ga0496126_0035465 | |||
| 2664 | Ga0496126_0090130 | |||
| 2665 | Ga0496126_0093235 | |||
| 2666 | Ga0496126_0135189 | |||
| 2667 | Ga0496126_0171278 | |||
| 2668 | Ga0496126_0237766 | |||
| 2669 | Ga0496126_0254613 | |||
| 2670 | Ga0496126_0558077 | |||
| 2671 | Ga0496126_0634908 | |||
| 2672 | Ga0496126_0699162 | |||
| 2673 | Ga0496126_0870795 | |||
| 2674 | Ga0496126_0941713 | |||
| 2675 | Ga0495678_150872 | |||
| 2676 | Ga0495682_0027486 | |||
| 2677 | Ga0501032_0222250 | |||
| 2678 | Ga0501036_0287146 | |||
| 2679 | Ga0501036_0765263 | |||
| 2680 | Ga0501038_0590958 | |||
| 2681 | Ga0501039_0590541 | |||
| 2682 | Ga0501039_0974485 | |||
| 2683 | Ga0501046_0053125 | |||
| 2684 | Ga0501047_0089916 | |||
| 2685 | Ga0501067_0013283 | |||
| 2686 | Ga0501067_0037376 | |||
| 2687 | Ga0501069_0428836 | |||
| 2688 | Ga0501070_0015246 | |||
| 2689 | Ga0501070_0640383 | |||
| 2690 | Ga0501071_0118693 | |||
| 2691 | Ga0501073_0120185 | |||
| 2692 | Ga0501074_0021500 | |||
| 2693 | Ga0501075_1248560 | |||
| 2694 | Ga0501076_0421718 | |||
| 2695 | Ga0501076_0567207 | |||
| 2696 | Ga0501079_0495211 | |||
| 2697 | Ga0501080_0012725 | |||
| 2698 | Ga0501081_0265498 | |||
| 2699 | Ga0501035_0608871 | |||
| 2700 | Ga0501035_0962429 | |||
| 2701 | Ga0501044_0096467 | |||
| 2702 | Ga0501044_0932748 | |||
| 2703 | Ga0501045_0408459 | |||
| 2704 | nmdc:mga03683_320039_c1 | |||
| 2705 | nmdc:mga03683_54863_c1 | |||
| 2706 | nmdc:mga03683_85045_c1 | |||
| 2707 | nmdc:mga03n38_395146_c1 | |||
| 2708 | nmdc:mga03n38_4080_c1 | |||
| 2709 | nmdc:mga03n38_541952_c1 | |||
| 2710 | nmdc:mga03n38_845249_c1 | |||
| 2711 | nmdc:mga00v17_45088_c1 | |||
| 2712 | nmdc:mga00v17_7051_c1 | |||
| 2713 | nmdc:mga0yw44_1110835_c1 | |||
| 2714 | nmdc:mga0yw44_157307_c1 | |||
| 2715 | nmdc:mga0yw44_158951_c1 | |||
| 2716 | nmdc:mga0yw44_166314_c1 | |||
| 2717 | nmdc:mga0yw44_17788_c1 | |||
| 2718 | nmdc:mga0yw44_195162_c1 | |||
| 2719 | nmdc:mga0yw44_72048_c2 | |||
| 2720 | nmdc:mga0yw44_91276_c1 | |||
| 2721 | nmdc:mga0k408_134733_c1 | |||
| 2722 | nmdc:mga0k408_248065_c1 | |||
| 2723 | nmdc:mga0k408_297527_c1 | |||
| 2724 | nmdc:mga0k408_312697_c1 | |||
| 2725 | nmdc:mga0k408_636663_c1 | |||
| 2726 | nmdc:mga06z11_21966_c1 | |||
| 2727 | nmdc:mga06z11_287219_c1 | |||
| 2728 | nmdc:mga06z11_361779_c1 | |||
| 2729 | nmdc:mga06z11_888605_c1 | |||
| 2730 | nmdc:mga07m45_135429_c1 | |||
| 2731 | nmdc:mga07m45_143059_c1 | |||
| 2732 | nmdc:mga07m45_19607_c1 | |||
| 2733 | nmdc:mga07m45_32975_c1 | |||
| 2734 | nmdc:mga05p37_1355167_c1 | |||
| 2735 | nmdc:mga09592_1370420_c1 | |||
| 2736 | nmdc:mga08y16_217475_c1 | |||
| 2737 | nmdc:mga0n895_1968156_c1 | |||
| 2738 | nmdc:mga0n895_237094_c1 | |||
| 2739 | nmdc:mga0rr50_1191032_c1 | |||
| 2740 | nmdc:mga0rr50_775255_c1 | |||
| 2741 | nmdc:mga0sz30_124512_c1 | |||
| 2742 | nmdc:mga0sz30_233982_c1 | |||
| 2743 | nmdc:mga0sz30_290925_c1 | |||
| 2744 | nmdc:mga0sz30_390963_c1 | |||
| 2745 | nmdc:mga0sz30_39865_c2 | |||
| 2746 | nmdc:mga0sz30_47846_c1 | |||
| 2747 | nmdc:mga0sz30_53267_c1 | |||
| 2748 | Ga0495601_0010740 | |||
| 2749 | Ga0495601_0091703 | |||
| 2750 | Ga0495601_0396101 | |||
| 2751 | Ga0495612_0061234 | |||
| 2752 | Ga0500635_0280110 | |||
| 2753 | Ga0495655_0009352 | |||
| 2754 | Ga0495655_0152781 | |||
| 2755 | Ga0495595_0001173 | |||
| 2756 | Ga0495595_0043673 | |||
| 2757 | Ga0495619_0000166 | |||
| 2758 | Ga0495619_0143286 | |||
| 2759 | Ga0495619_0178718 | |||
| 2760 | Ga0500578_0027306 | |||
| 2761 | Ga0500643_026377 | |||
| 2762 | Ga0500644_0255062 | |||
| 2763 | Ga0500581_281372 | |||
| 2764 | Ga0500647_0075122 | |||
| 2765 | Ga0500583_0122818 | |||
| 2766 | Ga0500583_0469818 | |||
| 2767 | Ga0500651_0008263 | |||
| 2768 | Ga0500651_0066009 | |||
| 2769 | Ga0500651_0244813 | |||
| 2770 | Ga0500651_0579270 | |||
| 2771 | Ga0500566_0000141 | |||
| 2772 | Ga0500566_0005775 | |||
| 2773 | Ga0500566_0011586 | |||
| 2774 | Ga0500640_001964 | |||
| 2775 | Ga0500641_0003020 | |||
| 2776 | Ga0500641_0080028 | |||
| 2777 | Ga0500641_0091282 | |||
| 2778 | Ga0500650_0000214 | |||
| 2779 | Ga0500554_023213 | |||
| 2780 | Ga0500554_190777 | |||
| 2781 | Ga0500555_062156 | |||
| 2782 | Ga0500555_114344 | |||
| 2783 | Ga0500556_0000125 | |||
| 2784 | Ga0500562_046570 | |||
| 2785 | Ga0500562_132466 | |||
| 2786 | Ga0500569_024008 | |||
| 2787 | Ga0500572_000838 | |||
| 2788 | Ga0500572_025471 | |||
| 2789 | Ga0500582_232081 | |||
| 2790 | Ga0500591_078821 | |||
| 2791 | Ga0500592_005168 | |||
| 2792 | Ga0500592_055654 | |||
| 2793 | Ga0500594_0023056 | |||
| 2794 | Ga0500594_0061340 | |||
| 2795 | Ga0500595_000454 | |||
| 2796 | Ga0500595_000732 | |||
| 2797 | Ga0500595_002046 | |||
| 2798 | Ga0500595_003733 | |||
| 2799 | Ga0500608_038718 | |||
| 2800 | Ga0500614_001145 | |||
| 2801 | Ga0500618_086119 | |||
| 2802 | Ga0500642_0000194 | |||
| 2803 | Ga0500642_0163218 | |||
| 2804 | Ga0500652_000210 | |||
| 2805 | Ga0500658_0172865 | |||
| 2806 | Ga0500658_0210314 | |||
| 2807 | Ga0500559_0000205 | |||
| 2808 | Ga0500559_0001193 | |||
| 2809 | Ga0500559_0002865 | |||
| 2810 | Ga0500559_0135640 | |||
| 2811 | Ga0500559_0146810 | |||
| 2812 | Ga0500561_0054778 | |||
| 2813 | Ga0500564_141665 | |||
| 2814 | Ga0500568_0000356 | |||
| 2815 | Ga0500568_0060570 | |||
| 2816 | Ga0500577_0276395 | |||
| 2817 | Ga0500586_006207 | |||
| 2818 | Ga0500588_0065159 | |||
| 2819 | Ga0500588_0258580 | |||
| 2820 | Ga0500589_086443 | |||
| 2821 | Ga0500590_009317 | |||
| 2822 | Ga0500590_106918 | |||
| 2823 | Ga0500603_000116 | |||
| 2824 | Ga0500603_000516 | |||
| 2825 | Ga0500603_015553 | |||
| 2826 | Ga0500604_0002009 | |||
| 2827 | Ga0500604_0033973 | |||
| 2828 | Ga0500616_0000895 | |||
| 2829 | Ga0500619_056453 | |||
| 2830 | Ga0500622_0002020 | |||
| 2831 | Ga0500622_0122533 | |||
| 2832 | Ga0500622_0403747 | |||
| 2833 | Ga0500627_0434329 | |||
| 2834 | Ga0500627_0490814 | |||
| 2835 | Ga0500630_000171 | |||
| 2836 | Ga0500634_0016561 | |||
| 2837 | Ga0500634_0046954 | |||
| 2838 | Ga0500634_0052315 | |||
| 2839 | Ga0500634_0054026 | |||
| 2840 | Ga0500634_0074594 | |||
| 2841 | Ga0500638_125365 | |||
| 2842 | Ga0500639_000004 | |||
| 2843 | Ga0500636_0008650 | |||
| 2844 | Ga0500636_0125138 | |||
| 2845 | Ga0500636_0141505 | |||
| 2846 | Ga0500637_0000106 | |||
| 2847 | Ga0500637_0070515 | |||
| 2848 | Ga0500576_115956 | |||
| 2849 | Ga0500576_253826 | |||
| 2850 | Ga0500611_006304 | |||
| 2851 | Ga0500611_255366 | |||
| 2852 | Ga0500645_089457 | |||
| 2853 | Ga0500645_149099 | |||
| 2854 | Ga0500609_063377 | |||
| 2855 | Ga0500596_001998 | |||
| 2856 | Ga0500596_002653 | |||
| 2857 | Ga0500596_015421 | |||
| 2858 | Ga0500601_051010 | |||
| 2859 | Ga0530510_0772094 | |||
| 2860 | 2513889418 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ddw-assembly1.cif.gz_B | crystal structure of pyridoxal kinase from the escherichia coli pdxk gene complexed with pyridoxal at 3.2 a resolution | 0.3936 | 76 | 111 |
| 5gar-assembly1.cif.gz_Q | thermus thermophilus v/a-atpase, conformation 1 | 0.2897 | 35 | 109 |
| 5gar-assembly1.cif.gz_Q | thermus thermophilus v/a-atpase, conformation 1 | 0.2509 | 35 | 109 |
| 2ddw-assembly1.cif.gz_B | crystal structure of pyridoxal kinase from the escherichia coli pdxk gene complexed with pyridoxal at 3.2 a resolution | 0.1925 | 76 | 111 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FVZ5_368_530_1.20.1640.10 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.3672 | 46 | 105 | 1.20.1640.10 |
| af_I1LXA6_126_219_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.3639 | 45 | 107 | 1.20.1280.290 |
| af_Q6IQT9_24_127_1.10.10.1740 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like | 0.3567 | 43 | 110 | 1.10.10.1740 |
| af_Q6YZF3_132_221_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.3539 | 43 | 112 | 1.20.1280.290 |
| af_Q03602_623_820_1.20.1640.10 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.3526 | 34 | 105 | 1.20.1640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S8C1H4-F1-model_v4 | AzlD domain-containing protein | 0.8989 | 11 | 114 |
GO:0016020
|
| AF-A0A037UV88-F1-model_v4 | deleted | 0.8798 | 18 | 113 |
|
| AF-A0A2H6BDB5-F1-model_v4 | Branched-chain amino acid transport | 0.8734 | 6 | 114 |
GO:0016020
|
| AF-A0A0P6VGG6-F1-model_v4 | Branched-chain amino acid transport | 0.8694 | 6 | 114 |
GO:0016020
|
| AF-A0A211ZSV1-F1-model_v4 | Branched-chain amino acid transport | 0.8687 | 9 | 112 |
GO:0016020
|