F493902

General Info

Members Datasets Scaffolds Average Seq Length
1430 517 2860 115

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0406750|Ga0495625_0406750_214_636
Length 140
Sequence MSDWLANFVGDPYALLVLVIAGFLPNEVWRMLGLWLGGGVDEGSEVLIWVRAVATAILAGVIAQILVQPPGALASVPDWLRYGAVAAGFIVFMLTRRSIFAGVVCGEAAMVAGKWWLGGLQPPHNSLLSLQHKKTSGETA

Samples

Sample ID Description Type Environment
1 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
136 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
138 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
213 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
214 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
215 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
216 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
217 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
218 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
219 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
220 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
221 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
222 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
223 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
224 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
225 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
226 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
227 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
228 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
229 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
230 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
231 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
232 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
233 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
234 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
235 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
236 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
237 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
238 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
239 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
240 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
241 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
242 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
243 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
244 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
245 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
246 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
247 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
248 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
249 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
251 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
252 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
253 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
254 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
255 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
256 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
257 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
258 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
259 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
260 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
261 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
262 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
263 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
264 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
265 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
266 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
267 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
268 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
269 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
270 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
271 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
272 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
273 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
274 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
275 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
276 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
277 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
278 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
279 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
280 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
281 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
282 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
283 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
284 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
285 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
286 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
287 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
288 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
289 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
290 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
291 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
292 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
293 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
294 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
295 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
296 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
297 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
298 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
299 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
300 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
301 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
302 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
303 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
304 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
305 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
306 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
307 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
308 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
309 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
310 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
311 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
312 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
313 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
314 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
315 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
316 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
317 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
318 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
319 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
320 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
321 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
322 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
323 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
324 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
325 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
326 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
327 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
328 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
329 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
330 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
331 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
332 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
333 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
334 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
335 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
336 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
337 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
338 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
339 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
340 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
341 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
342 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
343 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
344 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
345 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
346 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
347 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
348 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
349 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
350 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
351 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
352 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
353 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
354 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
355 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
356 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
357 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
358 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
359 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
360 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
361 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
362 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
363 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
364 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
365 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
366 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
367 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
368 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
369 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
370 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
371 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
372 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
373 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
374 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
375 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
376 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
377 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
378 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
379 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
380 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
381 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
382 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
383 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
384 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
385 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
386 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
387 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
388 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
389 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
390 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
391 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
392 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
393 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
394 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
395 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
396 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
397 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
398 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
399 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
400 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
401 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
402 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
403 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
404 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
405 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
406 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
407 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
408 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
409 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
410 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
411 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
412 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
413 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
414 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
415 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
416 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
417 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
418 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
419 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
420 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
421 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
422 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
429 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
430 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
431 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
432 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
433 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
434 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
435 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
436 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
437 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
438 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
439 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
442 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
443 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
444 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
445 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
446 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
447 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
448 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
449 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
450 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
451 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
452 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
453 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
454 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
455 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
456 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
457 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
458 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
459 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
460 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
461 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
462 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
463 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
464 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
465 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
466 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
467 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
468 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
469 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
470 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
471 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
472 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
473 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
474 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
475 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
476 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
477 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
478 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
479 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
480 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
481 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
482 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
483 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
484 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
485 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
486 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
487 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
488 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
489 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
490 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
491 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
492 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
493 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
494 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
495 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
496 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
497 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
498 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
499 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
500 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
501 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
502 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
503 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
504 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
505 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
506 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
507 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
508 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
509 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
510 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
511 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
512 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
513 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
514 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
515 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
516 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
517 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0.07
Isolates 0.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.8
Nodule 0.07
Rhizoplane 6.5
Rhizosphere 73.5
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495625_0406750 3300046660 Bacteria 849
2 JGI24740J21852_10018916 3300001979 Bacteria 2433
3 JGI24739J22299_10037604 3300001989 Bacteria 1630
4 JGI24735J21928_10017658 3300002067 Bacteria 2205
5 JGI24034J26672_10043150 3300002239 Bacteria 761
6 JGI25406J46586_10006595 3300003203 Bacteria 5335
7 rootH1_10245633 3300003323 Bacteria 1412
8 rootH1_10331927 3300003323 Bacteria 1041
9 JGI25404J52841_10000284 3300003659 Bacteria 6542
10 JGI25404J52841_10004715 3300003659 Bacteria 2784
11 JGI25404J52841_10008794 3300003659 Bacteria 2157
12 JGI25404J52841_10012849 3300003659 Bacteria 1816
13 JGI25404J52841_10014178 3300003659 Bacteria 1729
14 Ga0055526_1017110 3300003771 Bacteria 2792
15 Ga0070658_10084498 3300005327 Bacteria 2610
16 Ga0070676_10230035 3300005328 Bacteria 1228
17 Ga0070683_100075117 3300005329 Bacteria 3158
18 Ga0070690_100140369 3300005330 Bacteria 1640
19 Ga0070690_100329500 3300005330 Bacteria 1103
20 Ga0070670_100216359 3300005331 Bacteria 1667
21 Ga0070670_101255005 3300005331 Bacteria 678
22 Ga0068869_100052003 3300005334 Bacteria 2973
23 Ga0068869_100118587 3300005334 Bacteria 2021
24 Ga0068869_100199930 3300005334 Bacteria 1575
25 Ga0068869_100544171 3300005334 Bacteria 974
26 Ga0070666_10576762 3300005335 Bacteria 820
27 Ga0070680_100055739 3300005336 Bacteria 3230
28 Ga0070680_100116478 3300005336 Bacteria 2227
29 Ga0070680_100135204 3300005336 Bacteria 2065
30 Ga0070682_101494226 3300005337 Bacteria 581
31 Ga0068868_100238841 3300005338 Bacteria 1526
32 Ga0068868_100529506 3300005338 Bacteria 1036
33 Ga0068868_100536017 3300005338 Bacteria 1030
34 Ga0068868_100846972 3300005338 Bacteria 828
35 Ga0070689_100309548 3300005340 Bacteria 1317
36 Ga0070689_100360363 3300005340 Bacteria 1222
37 Ga0070689_100808855 3300005340 Bacteria 824
38 Ga0070691_10110224 3300005341 Bacteria 1376
39 Ga0070687_101016541 3300005343 Bacteria 602
40 Ga0070661_100298463 3300005344 Bacteria 1253
41 Ga0070692_10589669 3300005345 Bacteria 734
42 Ga0070692_10687928 3300005345 Bacteria 687
43 Ga0070668_100065242 3300005347 Bacteria 2824
44 Ga0070668_100248210 3300005347 Bacteria 1477
45 Ga0070668_100298097 3300005347 Bacteria 1351
46 Ga0070668_100368048 3300005347 Bacteria 1220
47 Ga0070668_100452177 3300005347 Bacteria 1104
48 Ga0070668_100639780 3300005347 Bacteria 934
49 Ga0070668_100773098 3300005347 Bacteria 851
50 Ga0070668_100817871 3300005347 Bacteria 829
51 Ga0070669_100166629 3300005353 Bacteria 1715
52 Ga0070669_100251368 3300005353 Bacteria 1408
53 Ga0070669_101213858 3300005353 Bacteria 652
54 Ga0070671_100245054 3300005355 Bacteria 1521
55 Ga0070671_100635296 3300005355 Bacteria 924
56 Ga0070671_101145657 3300005355 Bacteria 684
57 Ga0070671_101250748 3300005355 Bacteria 654
58 Ga0070674_100053767 3300005356 Bacteria 2782
59 Ga0070674_100106814 3300005356 Bacteria 2049
60 Ga0070674_101947050 3300005356 Bacteria 535
61 Ga0070673_100235500 3300005364 Bacteria 1590
62 Ga0070673_100368142 3300005364 Bacteria 1279
63 Ga0070688_100234467 3300005365 Bacteria 1300
64 Ga0070688_100327781 3300005365 Bacteria 1114
65 Ga0070688_100579307 3300005365 Bacteria 856
66 Ga0070688_100830649 3300005365 Bacteria 724
67 Ga0070659_100111795 3300005366 Bacteria 2206
68 Ga0070659_100852448 3300005366 Bacteria 794
69 Ga0070667_100286345 3300005367 Bacteria 1481
70 Ga0070709_10015318 3300005434 Bacteria 4360
71 Ga0070709_10255217 3300005434 Bacteria 1265
72 Ga0070709_10312389 3300005434 Bacteria 1151
73 Ga0070709_10326413 3300005434 Bacteria 1128
74 Ga0070709_11136663 3300005434 Bacteria 626
75 Ga0070714_100009232 3300005435 Bacteria 7747
76 Ga0070714_100095477 3300005435 Bacteria 2611
77 Ga0070714_100750762 3300005435 Bacteria 943
78 Ga0070713_100001913 3300005436 Bacteria 13423
79 Ga0070713_100008075 3300005436 Bacteria 7440
80 Ga0070713_100021836 3300005436 Bacteria 4934
81 Ga0070713_100021931 3300005436 Bacteria 4926
82 Ga0070713_100396764 3300005436 Bacteria 1288
83 Ga0070713_100838945 3300005436 Bacteria 882
84 Ga0070710_10001428 3300005437 Bacteria 11278
85 Ga0070710_10021540 3300005437 Bacteria 3361
86 Ga0070710_10159964 3300005437 Bacteria 1396
87 Ga0070710_10896839 3300005437 Bacteria 640
88 Ga0070710_10941383 3300005437 Bacteria 626
89 Ga0070701_10154385 3300005438 Bacteria 1324
90 Ga0070701_10271144 3300005438 Bacteria 1033
91 Ga0070711_100002884 3300005439 Bacteria 9901
92 Ga0070711_100022506 3300005439 Bacteria 4086
93 Ga0070711_100849314 3300005439 Bacteria 777
94 Ga0070711_100999219 3300005439 Bacteria 718
95 Ga0070705_100142370 3300005440 Bacteria 1580
96 Ga0070700_100087149 3300005441 Bacteria 2029
97 Ga0070700_100340364 3300005441 Bacteria 1109
98 Ga0070694_100737143 3300005444 Bacteria 804
99 Ga0070663_100018502 3300005455 Bacteria 4570
100 Ga0070663_100020934 3300005455 Bacteria 4339
101 Ga0070663_100029630 3300005455 Bacteria 3743
102 Ga0070663_100102906 3300005455 Bacteria 2134
103 Ga0070663_100105474 3300005455 Bacteria 2109
104 Ga0070663_100208070 3300005455 Bacteria 1531
105 Ga0070663_100357665 3300005455 Bacteria 1184
106 Ga0070663_100861056 3300005455 Bacteria 780
107 Ga0070663_101467329 3300005455 Bacteria 606
108 Ga0070678_100008379 3300005456 Bacteria 6189
109 Ga0070678_100071386 3300005456 Bacteria 2599
110 Ga0070678_100162351 3300005456 Bacteria 1811
111 Ga0070678_100241447 3300005456 Bacteria 1511
112 Ga0070678_100419219 3300005456 Bacteria 1167
113 Ga0070678_100530375 3300005456 Bacteria 1043
114 Ga0070678_101965262 3300005456 Bacteria 553
115 Ga0070678_102153808 3300005456 Bacteria 528
116 Ga0070662_100101524 3300005457 Bacteria 2178
117 Ga0070662_100526195 3300005457 Bacteria 988
118 Ga0070662_100544906 3300005457 Bacteria 972
119 Ga0070662_101272236 3300005457 Bacteria 633
120 Ga0070681_10072711 3300005458 Bacteria 3401
121 Ga0070681_10117014 3300005458 Bacteria 2602
122 Ga0070681_11196568 3300005458 Bacteria 682
123 Ga0068867_100163781 3300005459 Bacteria 1756
124 Ga0070685_10269893 3300005466 Bacteria 1135
125 Ga0070706_100515445 3300005467 Bacteria 1112
126 Ga0070706_100519340 3300005467 Bacteria 1108
127 Ga0070707_100319127 3300005468 Bacteria 1510
128 Ga0070707_100820373 3300005468 Bacteria 894
129 Ga0070707_101501412 3300005468 Bacteria 641
130 Ga0070707_102152343 3300005468 Bacteria 525
131 Ga0070698_100183267 3300005471 Bacteria 2032
132 Ga0070698_100185402 3300005471 Bacteria 2019
133 Ga0070698_101919341 3300005471 Unclassified 545
134 Ga0070699_100141536 3300005518 Bacteria 2125
135 Ga0070679_100010022 3300005530 Bacteria 8973
136 Ga0070679_100074939 3300005530 Bacteria 3374
137 Ga0070684_100159468 3300005535 Bacteria 2046
138 Ga0070684_101266737 3300005535 Bacteria 694
139 Ga0070697_101075536 3300005536 Bacteria 716
140 Ga0070697_101292318 3300005536 Bacteria 651
141 Ga0068853_100006903 3300005539 Bacteria 9063
142 Ga0068853_100323189 3300005539 Bacteria 1431
143 Ga0068853_100453799 3300005539 Bacteria 1206
144 Ga0068853_100717130 3300005539 Bacteria 955
145 Ga0068853_100784836 3300005539 Bacteria 912
146 Ga0070672_100227548 3300005543 Bacteria 1566
147 Ga0070672_100354887 3300005543 Bacteria 1250
148 Ga0070672_101014453 3300005543 Bacteria 736
149 Ga0070686_100199392 3300005544 Bacteria 1434
150 Ga0070695_100377702 3300005545 Bacteria 1069
151 Ga0070696_100452323 3300005546 Bacteria 1013
152 Ga0070696_101339913 3300005546 Bacteria 609
153 Ga0070693_100040365 3300005547 Bacteria 2620
154 Ga0070693_100105898 3300005547 Bacteria 1721
155 Ga0070665_100002761 3300005548 Bacteria 19030
156 Ga0070665_100028064 3300005548 Bacteria 5669
157 Ga0070665_100036089 3300005548 Bacteria 4974
158 Ga0070665_100232823 3300005548 Bacteria 1842
159 Ga0070665_100241295 3300005548 Bacteria 1808
160 Ga0070665_100535610 3300005548 Bacteria 1183
161 Ga0070665_100783630 3300005548 Bacteria 966
162 Ga0070665_101126063 3300005548 Bacteria 796
163 Ga0070665_101281209 3300005548 Bacteria 743
164 Ga0070704_100625093 3300005549 Bacteria 949
165 Ga0068855_100005114 3300005563 Bacteria 15990
166 Ga0068855_100061235 3300005563 Bacteria 4398
167 Ga0068855_100106133 3300005563 Bacteria 3229
168 Ga0068855_101348151 3300005563 Bacteria 737
169 Ga0068857_100029142 3300005577 Bacteria 4871
170 Ga0068857_100152385 3300005577 Bacteria 2095
171 Ga0068857_100190946 3300005577 Bacteria 1865
172 Ga0068854_100015484 3300005578 Bacteria 5054
173 Ga0068854_100024882 3300005578 Bacteria 4104
174 Ga0068854_101632339 3300005578 Bacteria 588
175 Ga0068854_102266864 3300005578 Bacteria 503
176 Ga0068856_100010355 3300005614 Bacteria 9057
177 Ga0068856_100016084 3300005614 Bacteria 7231
178 Ga0068856_100523613 3300005614 Bacteria 1207
179 Ga0070702_100017077 3300005615 Bacteria 3736
180 Ga0070702_100271496 3300005615 Bacteria 1160
181 Ga0068852_100210962 3300005616 Bacteria 1842
182 Ga0068859_100032608 3300005617 Bacteria 5231
183 Ga0068859_100036626 3300005617 Bacteria 4925
184 Ga0068859_101590398 3300005617 Bacteria 722
185 Ga0068859_102956824 3300005617 Bacteria 520
186 Ga0068859_103024148 3300005617 Bacteria 514
187 Ga0068864_100122963 3300005618 Bacteria 2323
188 Ga0068864_100388207 3300005618 Bacteria 1325
189 Ga0068866_10769440 3300005718 Bacteria 667
190 Ga0068866_11094072 3300005718 Bacteria 571
191 Ga0068861_100291490 3300005719 Bacteria 1409
192 Ga0068851_10002904 3300005834 Bacteria 7569
193 Ga0068863_100342772 3300005841 Bacteria 1454
194 Ga0068863_100744675 3300005841 Bacteria 975
195 Ga0068858_100081959 3300005842 Bacteria 2998
196 Ga0068858_100429075 3300005842 Bacteria 1272
197 Ga0068858_100612353 3300005842 Bacteria 1057
198 Ga0068858_101370014 3300005842 Bacteria 697
199 Ga0068860_100000149 3300005843 Bacteria 113068
200 Ga0068860_100066977 3300005843 Bacteria 3412
201 Ga0068860_100178468 3300005843 Bacteria 2053
202 Ga0068860_100313494 3300005843 Bacteria 1539
203 Ga0068860_100834815 3300005843 Bacteria 936
204 Ga0068860_102467838 3300005843 Bacteria 540
205 Ga0068862_100092022 3300005844 Bacteria 2642
206 Ga0068862_100227331 3300005844 Bacteria 1691
207 Ga0068862_100278417 3300005844 Bacteria 1532
208 Ga0068862_100418115 3300005844 Bacteria 1257
209 Ga0068862_100692512 3300005844 Bacteria 986
210 Ga0068862_100768635 3300005844 Bacteria 938
211 Ga0081455_10008954 3300005937 Bacteria 10344
212 Ga0081455_10010256 3300005937 Bacteria 9526
213 Ga0081455_10038775 3300005937 Bacteria 4217
214 Ga0081455_10137816 3300005937 Bacteria 1899
215 Ga0081538_10366194 3300005981 Bacteria 521
216 Ga0081540_1001309 3300005983 Bacteria 21732
217 Ga0081540_1001846 3300005983 Bacteria 17751
218 Ga0081540_1004914 3300005983 Bacteria 10063
219 Ga0081540_1017082 3300005983 Bacteria 4509
220 Ga0081540_1017644 3300005983 Bacteria 4409
221 Ga0081540_1018007 3300005983 Bacteria 4349
222 Ga0081540_1019764 3300005983 Bacteria 4080
223 Ga0081540_1026602 3300005983 Bacteria 3298
224 Ga0081540_1028970 3300005983 Bacteria 3096
225 Ga0081540_1057747 3300005983 Bacteria 1875
226 Ga0081540_1172786 3300005983 Bacteria 820
227 Ga0081539_10000176 3300005985 Bacteria 150292
228 Ga0081539_10001416 3300005985 Bacteria 41282
229 Ga0081539_10023931 3300005985 Bacteria 3983
230 Ga0081539_10219926 3300005985 Bacteria 865
231 Ga0070717_10006449 3300006028 Bacteria 8633
232 Ga0070717_10007137 3300006028 Bacteria 8279
233 Ga0070717_10012334 3300006028 Bacteria 6513
234 Ga0070717_10415341 3300006028 Bacteria 1210
235 Ga0075365_10042089 3300006038 Bacteria 2985
236 Ga0075365_10129843 3300006038 Bacteria 1743
237 Ga0075365_10239811 3300006038 Bacteria 1273
238 Ga0075365_10429735 3300006038 Bacteria 932
239 Ga0075365_10741444 3300006038 Bacteria 694
240 Ga0075365_11144698 3300006038 Bacteria 548
241 Ga0075365_11346469 3300006038 Bacteria 501
242 Ga0075368_10118826 3300006042 Bacteria 1093
243 Ga0075368_10198478 3300006042 Bacteria 849
244 Ga0075363_100050436 3300006048 Bacteria 2217
245 Ga0075363_100069001 3300006048 Bacteria 1918
246 Ga0075363_100613262 3300006048 Bacteria 653
247 Ga0075364_10183397 3300006051 Bacteria 1417
248 Ga0075364_10401061 3300006051 Bacteria 936
249 Ga0075364_10474157 3300006051 Bacteria 855
250 Ga0075364_10675943 3300006051 Bacteria 705
251 Ga0070715_10000460 3300006163 Bacteria 10536
252 Ga0070716_100002855 3300006173 Bacteria 8047
253 Ga0070716_100229188 3300006173 Bacteria 1253
254 Ga0070716_100274003 3300006173 Bacteria 1161
255 Ga0070716_100366005 3300006173 Bacteria 1025
256 Ga0070716_100511754 3300006173 Bacteria 888
257 Ga0070716_101426344 3300006173 Bacteria 564
258 Ga0070712_100007349 3300006175 Bacteria 6875
259 Ga0070712_100033986 3300006175 Bacteria 3454
260 Ga0070712_100137861 3300006175 Bacteria 1858
261 Ga0070712_100409923 3300006175 Bacteria 1121
262 Ga0070712_101041671 3300006175 Bacteria 709
263 Ga0075362_10032172 3300006177 Bacteria 2274
264 Ga0075362_10442349 3300006177 Bacteria 660
265 Ga0075362_10476935 3300006177 Bacteria 636
266 Ga0075367_10193737 3300006178 Bacteria 1269
267 Ga0075367_10205660 3300006178 Bacteria 1230
268 Ga0075367_10962582 3300006178 Bacteria 545
269 Ga0075367_10980478 3300006178 Bacteria 539
270 Ga0075367_11024060 3300006178 Bacteria 527
271 Ga0075369_10030536 3300006186 Bacteria 2270
272 Ga0075369_10051573 3300006186 Bacteria 1781
273 Ga0075369_10177426 3300006186 Bacteria 980
274 Ga0075369_10252106 3300006186 Bacteria 820
275 Ga0075369_10522609 3300006186 Bacteria 565
276 Ga0075366_10124923 3300006195 Bacteria 1551
277 Ga0075366_10189049 3300006195 Bacteria 1251
278 Ga0075366_10199128 3300006195 Bacteria 1218
279 Ga0075366_10386647 3300006195 Bacteria 861
280 Ga0097621_100137460 3300006237 Bacteria 2085
281 Ga0097621_100174216 3300006237 Bacteria 1856
282 Ga0097621_100624080 3300006237 Bacteria 987
283 Ga0097621_101222842 3300006237 Bacteria 708
284 Ga0097621_101418977 3300006237 Bacteria 658
285 Ga0075370_10024488 3300006353 Bacteria 3335
286 Ga0075370_10142482 3300006353 Bacteria 1401
287 Ga0075370_10195886 3300006353 Bacteria 1191
288 Ga0075370_10336999 3300006353 Bacteria 900
289 Ga0075370_10454695 3300006353 Bacteria 771
290 Ga0068871_100110507 3300006358 Bacteria 2312
291 Ga0075428_100066108 3300006844 Bacteria 3959
292 Ga0075428_101667424 3300006844 Bacteria 666
293 Ga0075431_100140441 3300006847 Bacteria 2490
294 Ga0075434_100231591 3300006871 Bacteria 1867
295 Ga0068865_100071666 3300006881 Bacteria 2459
296 Ga0068865_100099885 3300006881 Bacteria 2122
297 Ga0068865_100368330 3300006881 Bacteria 1168
298 Ga0068865_100501627 3300006881 Bacteria 1012
299 Ga0068865_101397579 3300006881 Bacteria 625
300 Ga0097620_100032608 3300006931 Bacteria 5231
301 Ga0097620_100036626 3300006931 Bacteria 4925
302 Ga0097620_101590173 3300006931 Bacteria 722
303 Ga0097620_102957478 3300006931 Bacteria 520
304 Ga0097620_103024179 3300006931 Bacteria 514
305 Ga0075435_100124227 3300007076 Bacteria 2156
306 Ga0075435_101259872 3300007076 Unclassified 647
307 Ga0099794_10036834 3300007265 Bacteria 2314
308 Ga0099795_10027848 3300007788 Bacteria 1916
309 Ga0099795_10052265 3300007788 Bacteria 1492
310 Ga0099795_10061731 3300007788 Bacteria 1392
311 Ga0105240_10004765 3300009093 Bacteria 20483
312 Ga0105240_10034450 3300009093 Bacteria 6531
313 Ga0105240_10071834 3300009093 Bacteria 4279
314 Ga0105240_10078859 3300009093 Bacteria 4054
315 Ga0105240_10230644 3300009093 Bacteria 2152
316 Ga0105240_11066144 3300009093 Bacteria 861
317 Ga0111539_10060214 3300009094 Bacteria 4500
318 Ga0105245_10106409 3300009098 Bacteria 2603
319 Ga0105245_10191629 3300009098 Bacteria 1958
320 Ga0105245_10377635 3300009098 Bacteria 1411
321 Ga0105245_10583897 3300009098 Bacteria 1142
322 Ga0105245_10819958 3300009098 Bacteria 969
323 Ga0105245_11287609 3300009098 Bacteria 780
324 Ga0105245_12269721 3300009098 Bacteria 596
325 Ga0105247_10025319 3300009101 Bacteria 3578
326 Ga0105247_10164630 3300009101 Bacteria 1471
327 Ga0105247_10258475 3300009101 Bacteria 1193
328 Ga0105247_10571998 3300009101 Bacteria 834
329 Ga0105247_10641124 3300009101 Bacteria 793
330 Ga0105247_11090613 3300009101 Bacteria 629
331 Ga0114129_11647188 3300009147 Bacteria 784
332 Ga0105243_10172123 3300009148 Bacteria 1876
333 Ga0105243_10388473 3300009148 Bacteria 1293
334 Ga0105243_10581149 3300009148 Bacteria 1075
335 Ga0105243_11040773 3300009148 Bacteria 824
336 Ga0105243_11462993 3300009148 Bacteria 706
337 Ga0105243_13006512 3300009148 Bacteria 511
338 Ga0105241_10001875 3300009174 Bacteria 15935
339 Ga0105241_10049725 3300009174 Bacteria 3194
340 Ga0105241_10411186 3300009174 Bacteria 1189
341 Ga0105242_10036881 3300009176 Bacteria 3925
342 Ga0105242_10245631 3300009176 Bacteria 1611
343 Ga0105242_10413168 3300009176 Bacteria 1262
344 Ga0105242_10853813 3300009176 Bacteria 906
345 Ga0105242_11501539 3300009176 Bacteria 704
346 Ga0105248_10185213 3300009177 Bacteria 2346
347 Ga0105248_10933304 3300009177 Bacteria 980
348 Ga0105237_10057288 3300009545 Bacteria 3900
349 Ga0105237_10074813 3300009545 Bacteria 3379
350 Ga0105237_10182633 3300009545 Bacteria 2097
351 Ga0105237_10414356 3300009545 Bacteria 1352
352 Ga0105237_10538641 3300009545 Bacteria 1174
353 Ga0105237_10657888 3300009545 Bacteria 1054
354 Ga0105237_10851956 3300009545 Bacteria 918
355 Ga0105237_10981688 3300009545 Bacteria 851
356 Ga0105237_11447125 3300009545 Bacteria 694
357 Ga0105238_10010766 3300009551 Bacteria 9187
358 Ga0105238_10022965 3300009551 Bacteria 6358
359 Ga0105238_10104024 3300009551 Bacteria 2820
360 Ga0105238_10105365 3300009551 Bacteria 2801
361 Ga0105238_10339499 3300009551 Bacteria 1490
362 Ga0105238_10467360 3300009551 Bacteria 1260
363 Ga0105238_10533447 3300009551 Bacteria 1177
364 Ga0105238_11636176 3300009551 Bacteria 674
365 Ga0105238_11952177 3300009551 Bacteria 620
366 Ga0105249_10248999 3300009553 Bacteria 1761
367 Ga0105249_10540431 3300009553 Bacteria 1215
368 Ga0105249_10558034 3300009553 Bacteria 1197
369 Ga0105249_10872223 3300009553 Bacteria 966
370 Ga0105249_11826654 3300009553 Bacteria 680
371 Ga0105249_13110340 3300009553 Bacteria 533
372 Ga0099796_10028131 3300010159 Bacteria 1802
373 Ga0099796_10073148 3300010159 Bacteria 1242
374 Ga0099796_10492846 3300010159 Bacteria 548
375 Ga0105239_10023684 3300010375 Bacteria 6759
376 Ga0105239_10117927 3300010375 Bacteria 2946
377 Ga0105239_10296279 3300010375 Bacteria 1821
378 Ga0105239_10363184 3300010375 Bacteria 1635
379 Ga0105239_10445611 3300010375 Bacteria 1468
380 Ga0105239_11052192 3300010375 Bacteria 936
381 Ga0105239_11113824 3300010375 Bacteria 909
382 Ga0105246_10272362 3300011119 Bacteria 1354
383 Ga0105246_10738007 3300011119 Bacteria 867
384 Ga0105246_10858383 3300011119 Bacteria 810
385 Ga0157371_10580325 3300013102 Bacteria 833
386 Ga0157370_10027175 3300013104 Bacteria 5642
387 Ga0157370_10255017 3300013104 Bacteria 1622
388 Ga0157369_10761473 3300013105 Bacteria 996
389 Ga0157369_12192452 3300013105 Bacteria 560
390 Ga0157374_10058369 3300013296 Bacteria 3606
391 Ga0157374_10353092 3300013296 Bacteria 1461
392 Ga0157374_11556082 3300013296 Bacteria 685
393 Ga0157374_12630916 3300013296 Bacteria 531
394 Ga0157378_10027145 3300013297 Bacteria 5052
395 Ga0157378_10375694 3300013297 Bacteria 1395
396 Ga0163162_10064357 3300013306 Bacteria 3712
397 Ga0163162_10457298 3300013306 Bacteria 1408
398 Ga0163162_10558336 3300013306 Bacteria 1273
399 Ga0163162_10592383 3300013306 Bacteria 1235
400 Ga0163162_10749804 3300013306 Bacteria 1096
401 Ga0163162_10821781 3300013306 Bacteria 1046
402 Ga0163162_11547979 3300013306 Bacteria 756
403 Ga0163162_12648991 3300013306 Bacteria 577
404 Ga0157372_10146202 3300013307 Bacteria 2726
405 Ga0157372_10566633 3300013307 Bacteria 1324
406 Ga0157372_13316849 3300013307 Bacteria 513
407 Ga0157375_10017467 3300013308 Bacteria 6475
408 Ga0157375_10046033 3300013308 Bacteria 4250
409 Ga0157375_10289997 3300013308 Bacteria 1799
410 Ga0157375_11084594 3300013308 Bacteria 937
411 Ga0157375_11569927 3300013308 Bacteria 778
412 Ga0157375_11975945 3300013308 Bacteria 693
413 Ga0157375_12144644 3300013308 Bacteria 665
414 Ga0157375_12379754 3300013308 Bacteria 632
415 Ga0163163_10012476 3300014325 Bacteria 7745
416 Ga0163163_10091768 3300014325 Bacteria 3052
417 Ga0163163_10490339 3300014325 Bacteria 1290
418 Ga0163163_10496239 3300014325 Bacteria 1282
419 Ga0163163_10525014 3300014325 Bacteria 1246
420 Ga0163163_11044300 3300014325 Bacteria 880
421 Ga0163163_11238310 3300014325 Bacteria 809
422 Ga0157380_10156299 3300014326 Bacteria 1977
423 Ga0157380_10339773 3300014326 Bacteria 1400
424 Ga0157380_12815690 3300014326 Bacteria 553
425 Ga0182008_10707214 3300014497 Bacteria 576
426 Ga0182008_10790206 3300014497 Bacteria 550
427 Ga0157377_10440009 3300014745 Bacteria 897
428 Ga0157377_10833812 3300014745 Bacteria 683
429 Ga0157379_10091190 3300014968 Bacteria 2734
430 Ga0157379_10166683 3300014968 Bacteria 1988
431 Ga0157379_10175791 3300014968 Bacteria 1933
432 Ga0157379_10332247 3300014968 Bacteria 1389
433 Ga0157379_10819157 3300014968 Bacteria 879
434 Ga0157376_10050762 3300014969 Bacteria 3443
435 Ga0157376_10056908 3300014969 Bacteria 3269
436 Ga0157376_11424776 3300014969 Bacteria 725
437 Ga0157376_11570659 3300014969 Bacteria 692
438 Ga0163161_10047763 3300017792 Bacteria 3090
439 Ga0163161_10209322 3300017792 Bacteria 1506
440 Ga0163161_10902197 3300017792 Bacteria 749
441 Ga0213876_10112793 3300021384 Bacteria 1443
442 Ga0213876_10171651 3300021384 Bacteria 1154
443 Ga0209148_1009946 3300025254 Bacteria 1825
444 Ga0209233_1006130 3300025261 Bacteria 3909
445 Ga0209455_1004451 3300025272 Bacteria 4579
446 Ga0209130_1048229 3300025284 Bacteria 787
447 Ga0209564_1000871 3300025295 Bacteria 40145
448 Ga0209758_1008123 3300025297 Bacteria 6901
449 Ga0209758_1063189 3300025297 Bacteria 1207
450 Ga0207697_10238697 3300025315 Bacteria 803
451 Ga0207697_10412722 3300025315 Bacteria 600
452 Ga0207656_10589871 3300025321 Bacteria 567
453 Ga0207653_10157501 3300025885 Bacteria 839
454 Ga0207682_10196848 3300025893 Bacteria 925
455 Ga0207692_10001538 3300025898 Bacteria 8667
456 Ga0207692_10028383 3300025898 Bacteria 2646
457 Ga0207692_10529546 3300025898 Bacteria 751
458 Ga0207642_10088013 3300025899 Bacteria 1527
459 Ga0207642_10526914 3300025899 Bacteria 727
460 Ga0207710_10019866 3300025900 Bacteria 2868
461 Ga0207710_10280018 3300025900 Bacteria 839
462 Ga0207710_10335780 3300025900 Bacteria 768
463 Ga0207688_10047181 3300025901 Bacteria 2406
464 Ga0207688_10523570 3300025901 Bacteria 744
465 Ga0207680_10437246 3300025903 Bacteria 928
466 Ga0207647_10000524 3300025904 Bacteria 30598
467 Ga0207647_10661253 3300025904 Bacteria 572
468 Ga0207685_10026923 3300025905 Bacteria 2006
469 Ga0207685_10057892 3300025905 Bacteria 1522
470 Ga0207685_10314205 3300025905 Bacteria 779
471 Ga0207699_10001041 3300025906 Bacteria 13082
472 Ga0207699_10027422 3300025906 Bacteria 3153
473 Ga0207699_10253360 3300025906 Bacteria 1214
474 Ga0207699_10298069 3300025906 Bacteria 1125
475 Ga0207699_10992873 3300025906 Unclassified 620
476 Ga0207645_10154625 3300025907 Bacteria 1498
477 Ga0207643_10830070 3300025908 Bacteria 599
478 Ga0207643_10988809 3300025908 Bacteria 544
479 Ga0207705_10065134 3300025909 Bacteria 2634
480 Ga0207684_10045107 3300025910 Bacteria 3740
481 Ga0207654_10007949 3300025911 Bacteria 5348
482 Ga0207707_10006494 3300025912 Bacteria 10211
483 Ga0207707_10094713 3300025912 Bacteria 2609
484 Ga0207707_10116754 3300025912 Bacteria 2332
485 Ga0207695_10000883 3300025913 Bacteria 54495
486 Ga0207695_10126760 3300025913 Bacteria 2514
487 Ga0207695_10199856 3300025913 Bacteria 1913
488 Ga0207671_10137988 3300025914 Bacteria 1877
489 Ga0207671_10179914 3300025914 Bacteria 1645
490 Ga0207671_10609544 3300025914 Bacteria 870
491 Ga0207671_11325480 3300025914 Bacteria 560
492 Ga0207693_10001357 3300025915 Bacteria 21659
493 Ga0207693_10045134 3300025915 Bacteria 3463
494 Ga0207693_10308039 3300025915 Bacteria 1240
495 Ga0207663_10000873 3300025916 Bacteria 13685
496 Ga0207663_11601478 3300025916 Bacteria 524
497 Ga0207660_10018272 3300025917 Bacteria 4670
498 Ga0207660_10170460 3300025917 Bacteria 1684
499 Ga0207660_10228304 3300025917 Bacteria 1463
500 Ga0207662_10399236 3300025918 Bacteria 932
501 Ga0207649_10411728 3300025920 Bacteria 1014
502 Ga0207649_10468338 3300025920 Bacteria 954
503 Ga0207652_10019705 3300025921 Bacteria 5550
504 Ga0207652_10036809 3300025921 Bacteria 4139
505 Ga0207646_10423807 3300025922 Bacteria 1201
506 Ga0207646_10848782 3300025922 Bacteria 812
507 Ga0207681_10101995 3300025923 Bacteria 2071
508 Ga0207681_10109814 3300025923 Bacteria 2004
509 Ga0207681_10960941 3300025923 Bacteria 716
510 Ga0207681_11295058 3300025923 Bacteria 612
511 Ga0207694_10000436 3300025924 Bacteria 38791
512 Ga0207694_10286713 3300025924 Bacteria 1353
513 Ga0207694_10299073 3300025924 Bacteria 1325
514 Ga0207694_11700015 3300025924 Bacteria 531
515 Ga0207650_10236529 3300025925 Bacteria 1475
516 Ga0207650_11091003 3300025925 Bacteria 679
517 Ga0207687_10060012 3300025927 Bacteria 2681
518 Ga0207687_10300323 3300025927 Bacteria 1293
519 Ga0207687_11770332 3300025927 Bacteria 529
520 Ga0207700_10015973 3300025928 Bacteria 4974
521 Ga0207700_10302656 3300025928 Bacteria 1381
522 Ga0207700_10342683 3300025928 Bacteria 1300
523 Ga0207700_10937011 3300025928 Bacteria 775
524 Ga0207700_11135075 3300025928 Bacteria 698
525 Ga0207664_10041469 3300025929 Bacteria 3585
526 Ga0207664_11467708 3300025929 Bacteria 603
527 Ga0207644_10147516 3300025931 Bacteria 1818
528 Ga0207644_10283718 3300025931 Bacteria 1330
529 Ga0207644_10438402 3300025931 Bacteria 1072
530 Ga0207690_10103616 3300025932 Bacteria 2037
531 Ga0207706_10198004 3300025933 Bacteria 1762
532 Ga0207706_10281363 3300025933 Bacteria 1451
533 Ga0207706_10412454 3300025933 Bacteria 1170
534 Ga0207706_10445662 3300025933 Bacteria 1120
535 Ga0207686_10203174 3300025934 Bacteria 1420
536 Ga0207686_10282709 3300025934 Bacteria 1225
537 Ga0207686_10621417 3300025934 Bacteria 852
538 Ga0207709_10091661 3300025935 Bacteria 1988
539 Ga0207709_10600067 3300025935 Bacteria 872
540 Ga0207709_10967122 3300025935 Bacteria 695
541 Ga0207709_11384005 3300025935 Bacteria 582
542 Ga0207709_11413899 3300025935 Bacteria 576
543 Ga0207709_11835392 3300025935 Bacteria 504
544 Ga0207670_10304394 3300025936 Bacteria 1249
545 Ga0207670_10319432 3300025936 Bacteria 1221
546 Ga0207670_10824054 3300025936 Bacteria 774
547 Ga0207669_10016092 3300025937 Bacteria 3790
548 Ga0207669_10395901 3300025937 Bacteria 1080
549 Ga0207669_10668490 3300025937 Bacteria 851
550 Ga0207669_10754247 3300025937 Bacteria 804
551 Ga0207704_10091211 3300025938 Bacteria 2002
552 Ga0207704_10301770 3300025938 Bacteria 1227
553 Ga0207704_10349967 3300025938 Bacteria 1150
554 Ga0207704_10552679 3300025938 Bacteria 936
555 Ga0207665_10006588 3300025939 Bacteria 7699
556 Ga0207665_10195062 3300025939 Bacteria 1473
557 Ga0207691_10113728 3300025940 Bacteria 2405
558 Ga0207691_10125639 3300025940 Bacteria 2270
559 Ga0207691_10160565 3300025940 Bacteria 1972
560 Ga0207691_10165942 3300025940 Bacteria 1935
561 Ga0207691_10315793 3300025940 Bacteria 1340
562 Ga0207711_10024524 3300025941 Bacteria 5055
563 Ga0207711_10055599 3300025941 Bacteria 3398
564 Ga0207711_10470816 3300025941 Bacteria 1170
565 Ga0207711_10998527 3300025941 Bacteria 776
566 Ga0207689_10014560 3300025942 Bacteria 6688
567 Ga0207689_10075631 3300025942 Bacteria 2768
568 Ga0207689_10102772 3300025942 Bacteria 2348
569 Ga0207689_10928424 3300025942 Bacteria 734
570 Ga0207689_11306754 3300025942 Bacteria 609
571 Ga0207661_10356198 3300025944 Bacteria 1321
572 Ga0207661_10507815 3300025944 Bacteria 1102
573 Ga0207679_10363784 3300025945 Bacteria 1264
574 Ga0207667_10011785 3300025949 Bacteria 10128
575 Ga0207667_10016252 3300025949 Bacteria 8408
576 Ga0207667_10090923 3300025949 Bacteria 3154
577 Ga0207667_10137082 3300025949 Bacteria 2520
578 Ga0207667_11199465 3300025949 Bacteria 739
579 Ga0207651_10197939 3300025960 Bacteria 1608
580 Ga0207651_10308307 3300025960 Bacteria 1319
581 Ga0207651_10628643 3300025960 Bacteria 941
582 Ga0207651_11197130 3300025960 Bacteria 682
583 Ga0207651_11477859 3300025960 Bacteria 612
584 Ga0207712_10188234 3300025961 Bacteria 1627
585 Ga0207712_10884593 3300025961 Bacteria 789
586 Ga0207712_11061111 3300025961 Bacteria 720
587 Ga0207712_11401113 3300025961 Bacteria 625
588 Ga0207668_10026995 3300025972 Bacteria 3736
589 Ga0207668_10048033 3300025972 Bacteria 2926
590 Ga0207668_10055192 3300025972 Bacteria 2760
591 Ga0207668_10569343 3300025972 Bacteria 983
592 Ga0207668_11293627 3300025972 Bacteria 656
593 Ga0207640_10030276 3300025981 Bacteria 3331
594 Ga0207640_10072075 3300025981 Bacteria 2329
595 Ga0207640_10244776 3300025981 Bacteria 1388
596 Ga0207640_10609766 3300025981 Bacteria 925
597 Ga0207640_10927596 3300025981 Bacteria 762
598 Ga0207658_10200356 3300025986 Bacteria 1666
599 Ga0207658_10912458 3300025986 Bacteria 800
600 Ga0207677_10155522 3300026023 Bacteria 1770
601 Ga0207677_10337149 3300026023 Bacteria 1258
602 Ga0207677_10798997 3300026023 Bacteria 844
603 Ga0207677_10835388 3300026023 Bacteria 827
604 Ga0207677_11721265 3300026023 Bacteria 581
605 Ga0207703_10045095 3300026035 Bacteria 3546
606 Ga0207703_10138753 3300026035 Bacteria 2108
607 Ga0207639_10032959 3300026041 Bacteria 3818
608 Ga0207639_10082300 3300026041 Bacteria 2552
609 Ga0207639_10083086 3300026041 Bacteria 2541
610 Ga0207639_10083580 3300026041 Bacteria 2534
611 Ga0207639_11434653 3300026041 Bacteria 648
612 Ga0207678_10002505 3300026067 Bacteria 16717
613 Ga0207678_10012047 3300026067 Bacteria 7595
614 Ga0207678_10057400 3300026067 Bacteria 3350
615 Ga0207678_10069632 3300026067 Bacteria 3017
616 Ga0207678_10098073 3300026067 Bacteria 2504
617 Ga0207678_10272664 3300026067 Bacteria 1451
618 Ga0207678_10276198 3300026067 Bacteria 1441
619 Ga0207708_10077114 3300026075 Bacteria 2557
620 Ga0207708_10078138 3300026075 Bacteria 2541
621 Ga0207708_10098621 3300026075 Bacteria 2259
622 Ga0207708_10576324 3300026075 Bacteria 951
623 Ga0207702_10000005 3300026078 Bacteria 420296
624 Ga0207702_10245744 3300026078 Bacteria 1678
625 Ga0207641_10674097 3300026088 Bacteria 1017
626 Ga0207641_11329376 3300026088 Bacteria 719
627 Ga0207648_10116422 3300026089 Bacteria 2349
628 Ga0207648_11356699 3300026089 Bacteria 668
629 Ga0207676_10096995 3300026095 Bacteria 2435
630 Ga0207676_10480108 3300026095 Bacteria 1177
631 Ga0207676_10787130 3300026095 Bacteria 927
632 Ga0207674_10010135 3300026116 Bacteria 10716
633 Ga0207674_10012171 3300026116 Bacteria 9631
634 Ga0207674_10075883 3300026116 Bacteria 3371
635 Ga0207674_10257701 3300026116 Bacteria 1691
636 Ga0207675_100042951 3300026118 Bacteria 4221
637 Ga0207675_100223869 3300026118 Bacteria 1813
638 Ga0207675_100618618 3300026118 Bacteria 1087
639 Ga0207675_102344476 3300026118 Bacteria 547
640 Ga0207683_10016315 3300026121 Bacteria 6322
641 Ga0207683_10017331 3300026121 Bacteria 6138
642 Ga0207683_10160633 3300026121 Bacteria 2031
643 Ga0207683_10183829 3300026121 Bacteria 1896
644 Ga0207683_10204245 3300026121 Bacteria 1797
645 Ga0207683_10318009 3300026121 Bacteria 1425
646 Ga0207683_10520176 3300026121 Bacteria 1099
647 Ga0207683_10719616 3300026121 Bacteria 926
648 Ga0207698_10244333 3300026142 Bacteria 1638
649 Ga0207698_10382864 3300026142 Bacteria 1339
650 Ga0209588_1001786 3300027671 Bacteria 5709
651 Ga0268266_10002595 3300028379 Bacteria 19142
652 Ga0268266_10015491 3300028379 Bacteria 6541
653 Ga0268266_10061183 3300028379 Bacteria 3247
654 Ga0268266_10086654 3300028379 Bacteria 2738
655 Ga0268266_10111685 3300028379 Bacteria 2422
656 Ga0268266_10242183 3300028379 Bacteria 1665
657 Ga0268266_10433167 3300028379 Bacteria 1248
658 Ga0268266_10530280 3300028379 Bacteria 1126
659 Ga0268266_10609932 3300028379 Bacteria 1048
660 Ga0268265_10086493 3300028380 Bacteria 2491
661 Ga0268265_10192057 3300028380 Bacteria 1764
662 Ga0268265_10260857 3300028380 Bacteria 1540
663 Ga0268265_10411219 3300028380 Bacteria 1253
664 Ga0268265_10507435 3300028380 Bacteria 1137
665 Ga0268265_10739933 3300028380 Bacteria 953
666 Ga0268265_12342688 3300028380 Bacteria 540
667 Ga0268264_10000084 3300028381 Bacteria 242128
668 Ga0268264_10308456 3300028381 Bacteria 1492
669 Ga0268264_10879419 3300028381 Bacteria 898
670 Ga0268264_11286445 3300028381 Bacteria 741
671 Ga0307517_10000369 3300028786 Bacteria 77795
672 Ga0307517_10319512 3300028786 Bacteria 860
673 Ga0307517_10369578 3300028786 Bacteria 771
674 Ga0307515_10013420 3300028794 Bacteria 15318
675 Ga0307515_10379216 3300028794 Bacteria 1047
676 Ga0307515_10555452 3300028794 Bacteria 758
677 Ga0307511_10167846 3300030521 Bacteria 1214
678 Ga0307511_10363113 3300030521 Bacteria 615
679 Ga0265330_10390655 3300031235 Bacteria 588
680 Ga0265332_10031536 3300031238 Bacteria 2312
681 Ga0265325_10083915 3300031241 Bacteria 1580
682 Ga0265339_10315651 3300031249 Bacteria 742
683 Ga0265331_10150792 3300031250 Bacteria 1056
684 Ga0265316_10354906 3300031344 Bacteria 1061
685 Ga0307513_10230970 3300031456 Bacteria 1663
686 Ga0307513_10235003 3300031456 Bacteria 1643
687 Ga0307513_10496669 3300031456 Bacteria 938
688 Ga0307513_10997807 3300031456 Bacteria 547
689 Ga0307509_10072887 3300031507 Bacteria 3577
690 Ga0307509_10073475 3300031507 Bacteria 3560
691 Ga0307509_10115650 3300031507 Bacteria 2674
692 Ga0307509_10299515 3300031507 Bacteria 1357
693 Ga0307509_10623411 3300031507 Bacteria 749
694 Ga0307509_10685347 3300031507 Bacteria 692
695 Ga0307408_100111744 3300031548 Bacteria 2100
696 Ga0307408_101496255 3300031548 Bacteria 638
697 Ga0265313_10246272 3300031595 Bacteria 730
698 Ga0307508_10047728 3300031616 Bacteria 3817
699 Ga0307508_10399318 3300031616 Bacteria 966
700 Ga0307508_10422963 3300031616 Bacteria 924
701 Ga0307508_10430681 3300031616 Bacteria 911
702 Ga0265314_10170340 3300031711 Bacteria 1315
703 Ga0265342_10486181 3300031712 Bacteria 631
704 Ga0307516_10021202 3300031730 Bacteria 6696
705 Ga0307516_10070865 3300031730 Bacteria 3348
706 Ga0307516_10082196 3300031730 Bacteria 3063
707 Ga0307516_10124721 3300031730 Bacteria 2361
708 Ga0307516_10229663 3300031730 Bacteria 1560
709 Ga0307405_10395838 3300031731 Bacteria 1080
710 Ga0307405_10847291 3300031731 Bacteria 769
711 Ga0307413_10750540 3300031824 Bacteria 816
712 Ga0307413_11084458 3300031824 Bacteria 691
713 Ga0307410_10687159 3300031852 Bacteria 861
714 Ga0307410_10690610 3300031852 Bacteria 859
715 Ga0307410_10813122 3300031852 Bacteria 796
716 Ga0307406_10305657 3300031901 Bacteria 1224
717 Ga0307406_10324210 3300031901 Bacteria 1193
718 Ga0307406_11348322 3300031901 Bacteria 624
719 Ga0307407_10585430 3300031903 Bacteria 829
720 Ga0307412_10828692 3300031911 Bacteria 805
721 Ga0307409_100598259 3300031995 Bacteria 1089
722 Ga0307409_100708351 3300031995 Bacteria 1007
723 Ga0307416_100581995 3300032002 Bacteria 1197
724 Ga0307416_100998994 3300032002 Bacteria 940
725 Ga0307416_101290043 3300032002 Bacteria 836
726 Ga0307416_101803363 3300032002 Bacteria 716
727 Ga0307416_101920548 3300032002 Bacteria 695
728 Ga0307411_10125314 3300032005 Bacteria 1867
729 Ga0307411_10777241 3300032005 Bacteria 841
730 Ga0307415_100221468 3300032126 Bacteria 1517
731 Ga0307415_100511168 3300032126 Bacteria 1052
732 Ga0307510_10005024 3300033180 Bacteria 15672
733 Ga0307510_10009194 3300033180 Bacteria 11768
734 Ga0307510_10270452 3300033180 Bacteria 1176
735 Ga0316215_1013852 3300033544 Bacteria 805
736 Ga0373930_0038774 3300034816 Bacteria 1008
737 Ga0373948_0114130 3300034817 Bacteria 647
738 Ga0373926_0334032 3300035083 Bacteria 594
739 Ga0373934_0002431 3300035086 Bacteria 6851
740 Ga0373940_0058854 3300035088 Bacteria 1095
741 Ga0373940_0216543 3300035088 Bacteria 635
742 Ga0373944_0010473 3300035089 Bacteria 2530
743 Ga0373949_0104761 3300035090 Bacteria 779
744 Ga0373951_0170977 3300035091 Bacteria 620
745 Ga0373923_0003726 3300035111 Bacteria 4939
746 Ga0373932_0044241 3300035112 Bacteria 1298
747 Ga0373932_0078207 3300035112 Bacteria 1040
748 Ga0373936_0200841 3300035113 Bacteria 880
749 Ga0373936_0213465 3300035113 Bacteria 854
750 Ga0373936_0350054 3300035113 Bacteria 673
751 Ga0373939_0535118 3300035114 Bacteria 505
752 Ga0373945_0002603 3300035116 Bacteria 5652
753 Ga0373953_0000929 3300035117 Bacteria 8201
754 Ga0373953_0005411 3300035117 Bacteria 4142
755 Ga0373953_0113058 3300035117 Bacteria 1149
756 Ga0373953_0486722 3300035117 Bacteria 546
757 Ga0373954_0000067 3300035118 Bacteria 37060
758 Ga0373954_0024815 3300035118 Bacteria 2735
759 Ga0373954_0025269 3300035118 Bacteria 2714
760 Ga0373954_0075643 3300035118 Bacteria 1604
761 Ga0373954_0270539 3300035118 Bacteria 837
762 Ga0373956_0001639 3300035119 Bacteria 9221
763 Ga0373956_0007638 3300035119 Bacteria 4358
764 Ga0373956_0182891 3300035119 Bacteria 991
765 Ga0373957_0000501 3300035120 Bacteria 9810
766 Ga0373957_0006447 3300035120 Bacteria 3698
767 Ga0373960_0222618 3300035121 Bacteria 676
768 Ga0373943_0001888 3300035170 Bacteria 9476
769 Ga0373943_0192509 3300035170 Bacteria 1125
770 Ga0373946_0004239 3300035171 Bacteria 5120
771 Ga0373946_0073134 3300035171 Bacteria 1485
772 Ga0373946_0451301 3300035171 Bacteria 655
773 Ga0373955_0000377 3300035172 Bacteria 18785
774 Ga0373955_0138333 3300035172 Bacteria 1426
775 Ga0373955_0305681 3300035172 Bacteria 959
776 Ga0373924_0004215 3300035410 Bacteria 5011
777 Ga0373924_0050507 3300035410 Bacteria 1722
778 Ga0373924_0074032 3300035410 Bacteria 1440
779 Ga0373931_0055359 3300035691 Bacteria 2122
780 Ga0373931_0226586 3300035691 Bacteria 1128
781 Ga0373931_0866974 3300035691 Bacteria 605
782 Ga0373931_1070036 3300035691 Bacteria 548
783 Ga0373935_0037417 3300035692 Bacteria 3037
784 Ga0373935_0040858 3300035692 Bacteria 2912
785 Ga0373935_0051478 3300035692 Bacteria 2615
786 Ga0373935_0128160 3300035692 Bacteria 1702
787 Ga0373935_0411134 3300035692 Bacteria 973
788 Ga0373927_0003905 3300035695 Bacteria 10571
789 Ga0373927_0010432 3300035695 Bacteria 6194
790 Ga0373927_0044542 3300035695 Bacteria 2870
791 Ga0373927_0494060 3300035695 Bacteria 808
792 Ga0373933_0000324 3300035724 Bacteria 30843
793 Ga0373933_0000519 3300035724 Bacteria 24082
794 Ga0373933_0089294 3300035724 Bacteria 1899
795 Ga0373933_0362051 3300035724 Bacteria 943
796 Ga0373947_0008954 3300035725 Bacteria 5754
797 Ga0373947_0024948 3300035725 Bacteria 3487
798 Ga0373947_1004066 3300035725 Bacteria 569
799 Ga0373947_1149189 3300035725 Bacteria 529
800 Ga0373937_0001425 3300036401 Bacteria 19991
801 Ga0373937_0028466 3300036401 Bacteria 5056
802 Ga0373937_0046615 3300036401 Bacteria 3964
803 Ga0373937_0051681 3300036401 Bacteria 3767
804 Ga0373937_0095291 3300036401 Bacteria 2759
805 Ga0373937_1202387 3300036401 Bacteria 706
806 Ga0372808_009233 3300036459 Bacteria 1377
807 Ga0373925_0035160 3300037068 Bacteria 3696
808 Ga0373925_0044313 3300037068 Bacteria 3303
809 Ga0373925_0126961 3300037068 Bacteria 1985
810 Ga0373925_0450652 3300037068 Bacteria 1054
811 Ga0373925_0587708 3300037068 Bacteria 917
812 Ga0395900_0331538 3300037418 Bacteria 1500
813 Ga0395898_0173684 3300037466 Bacteria 2060
814 Ga0395898_0508131 3300037466 Bacteria 1146
815 Ga0395905_0078255 3300037471 Bacteria 3099
816 Ga0395905_0863503 3300037471 Bacteria 808
817 Ga0395901_0231547 3300038443 Bacteria 1929
818 Ga0436365_0272569 3300039437 Bacteria 2078
819 Ga0436365_0912513 3300039437 Bacteria 1481
820 Ga0436365_1453434 3300039437 Bacteria 1308
821 Ga0436360_0319798 3300039438 Bacteria 836
822 Ga0436361_0769166 3300039447 Bacteria 622
823 Ga0436361_1169830 3300039447 Bacteria 630
824 Ga0436363_1429749 3300039450 Bacteria 525
825 Ga0436363_1677536 3300039450 Bacteria 693
826 Ga0439465_0008956 3300041413 Bacteria 3154
827 Ga0439465_0174173 3300041413 Bacteria 776
828 Ga0439465_0174241 3300041413 Bacteria 776
829 Ga0451787_538535 3300041441 Bacteria 871
830 Ga0451791_0066321 3300041451 Bacteria 961
831 Ga0451791_0489189 3300041451 Bacteria 531
832 Ga0451791_0730688 3300041451 Bacteria 866
833 Ga0451791_1303076 3300041451 Bacteria 791
834 Ga0451793_0071078 3300041452 Bacteria 519
835 Ga0451798_0329382 3300041458 Bacteria 552
836 Ga0451798_1021059 3300041458 Bacteria 1029
837 Ga0451800_1157606 3300041459 Bacteria 712
838 Ga0451800_1572657 3300041459 Bacteria 711
839 Ga0451802_1182178 3300041460 Bacteria 877
840 Ga0451802_1196601 3300041460 Bacteria 555
841 Ga0451807_0562609 3300041486 Bacteria 508
842 Ga0451807_0964125 3300041486 Bacteria 581
843 Ga0451807_1090274 3300041486 Bacteria 651
844 Ga0451833_0175461 3300041491 Bacteria 748
845 Ga0451837_1686692 3300041494 Bacteria 802
846 Ga0451841_1132424 3300041498 Bacteria 711
847 Ga0451845_0269736 3300041501 Bacteria 510
848 Ga0439431_0096186 3300041997 Bacteria 810
849 Ga0439432_250390 3300042006 Bacteria 508
850 Ga0450900_013176 3300042136 Bacteria 1090
851 Ga0439458_0088481 3300042157 Bacteria 795
852 Ga0439459_0079791 3300042438 Bacteria 771
853 Ga0466963_0286380 3300044694 Bacteria 1158
854 Ga0466963_0513366 3300044694 Bacteria 846
855 Ga0466957_1191876 3300044842 Bacteria 551
856 Ga0451576_0584387 3300045051 Bacteria 1174
857 Ga0466967_0802600 3300045976 Bacteria 934
858 Ga0495617_060657 3300046452 Bacteria 1251
859 Ga0495617_076494 3300046452 Bacteria 1098
860 Ga0495592_0046096 3300046454 Bacteria 3250
861 Ga0495592_0046648 3300046454 Bacteria 3229
862 Ga0495592_0048935 3300046454 Bacteria 3143
863 Ga0495603_0001576 3300046455 Bacteria 13338
864 Ga0495603_0002921 3300046455 Bacteria 10104
865 Ga0495603_0042436 3300046455 Bacteria 2719
866 Ga0495603_0272974 3300046455 Bacteria 972
867 Ga0495603_0316279 3300046455 Bacteria 896
868 Ga0495603_0416407 3300046455 Bacteria 770
869 Ga0495603_0672904 3300046455 Bacteria 592
870 Ga0495603_0743938 3300046455 Bacteria 560
871 Ga0495590_0028519 3300046457 Bacteria 1957
872 Ga0495590_0158313 3300046457 Bacteria 823
873 Ga0495590_0296728 3300046457 Bacteria 607
874 Ga0495591_041130 3300046458 Bacteria 1314
875 Ga0495629_0000117 3300046459 Bacteria 70838
876 Ga0495629_0009626 3300046459 Bacteria 7058
877 Ga0495629_0051277 3300046459 Bacteria 2888
878 Ga0495629_0052231 3300046459 Bacteria 2860
879 Ga0495629_0118340 3300046459 Bacteria 1846
880 Ga0495629_0308867 3300046459 Bacteria 1082
881 Ga0495638_0012452 3300046460 Bacteria 5829
882 Ga0495638_0013191 3300046460 Bacteria 5637
883 Ga0495638_0093876 3300046460 Bacteria 1804
884 Ga0495638_0111195 3300046460 Bacteria 1627
885 Ga0495638_0132396 3300046460 Bacteria 1463
886 Ga0495638_0164961 3300046460 Bacteria 1275
887 Ga0495638_0180585 3300046460 Bacteria 1204
888 Ga0495638_0380222 3300046460 Bacteria 738
889 Ga0495641_0002118 3300046461 Bacteria 16012
890 Ga0495641_0178345 3300046461 Bacteria 951
891 Ga0495651_0291656 3300046462 Bacteria 1098
892 Ga0495651_0322396 3300046462 Bacteria 1029
893 Ga0495653_0001052 3300046463 Bacteria 21243
894 Ga0495653_0005677 3300046463 Bacteria 10189
895 Ga0495580_0004355 3300046472 Bacteria 11890
896 Ga0495582_0001007 3300046473 Bacteria 15801
897 Ga0495582_0006998 3300046473 Bacteria 6272
898 Ga0495582_0215666 3300046473 Bacteria 1098
899 Ga0495605_0141765 3300046474 Bacteria 1078
900 Ga0495605_0299951 3300046474 Bacteria 680
901 Ga0495605_0412386 3300046474 Bacteria 560
902 Ga0495639_0001543 3300046475 Bacteria 10275
903 Ga0495639_0070139 3300046475 Bacteria 1618
904 Ga0495639_0389224 3300046475 Bacteria 703
905 Ga0495662_0004867 3300046476 Bacteria 6729
906 Ga0495664_0002486 3300046477 Bacteria 9915
907 Ga0495664_0025293 3300046477 Bacteria 3456
908 Ga0495664_0027203 3300046477 Bacteria 3333
909 Ga0495664_0489657 3300046477 Bacteria 735
910 Ga0495584_0090452 3300046491 Bacteria 1543
911 Ga0495584_0151811 3300046491 Bacteria 1177
912 Ga0495584_0157224 3300046491 Bacteria 1155
913 Ga0495584_0273903 3300046491 Bacteria 858
914 Ga0495584_0367795 3300046491 Bacteria 730
915 Ga0495584_0571246 3300046491 Bacteria 576
916 Ga0495585_0274787 3300046492 Bacteria 834
917 Ga0495585_0354727 3300046492 Bacteria 712
918 Ga0495585_0367730 3300046492 Bacteria 696
919 Ga0495585_0602758 3300046492 Bacteria 516
920 Ga0495594_0000662 3300046499 Bacteria 17783
921 Ga0495594_0100839 3300046499 Bacteria 1624
922 Ga0495594_0217634 3300046499 Bacteria 1089
923 Ga0495596_0074381 3300046500 Bacteria 1319
924 Ga0495596_0144327 3300046500 Bacteria 925
925 Ga0495583_0146704 3300046506 Bacteria 980
926 Ga0495606_0007334 3300046507 Bacteria 9914
927 Ga0495606_0119647 3300046507 Bacteria 1578
928 Ga0495606_0159353 3300046507 Bacteria 1318
929 Ga0495608_0067428 3300046511 Bacteria 2340
930 Ga0495608_0086752 3300046511 Bacteria 2028
931 Ga0495610_0027441 3300046512 Bacteria 3025
932 Ga0495610_0244598 3300046512 Bacteria 714
933 Ga0495616_0082447 3300046513 Bacteria 1536
934 Ga0495616_0195491 3300046513 Bacteria 892
935 Ga0495618_0006096 3300046514 Bacteria 7313
936 Ga0495618_0026157 3300046514 Bacteria 3625
937 Ga0495620_0039486 3300046515 Bacteria 2085
938 Ga0495620_0155520 3300046515 Bacteria 890
939 Ga0495628_0003826 3300046516 Bacteria 13414
940 Ga0495628_0011244 3300046516 Bacteria 7575
941 Ga0495628_0150762 3300046516 Bacteria 1771
942 Ga0495628_1101860 3300046516 Bacteria 542
943 Ga0495630_0001278 3300046517 Bacteria 17348
944 Ga0495630_0088527 3300046517 Bacteria 2338
945 Ga0495630_0174376 3300046517 Bacteria 1639
946 Ga0495630_1183960 3300046517 Bacteria 578
947 Ga0495631_0119505 3300046518 Bacteria 1133
948 Ga0495631_0151228 3300046518 Bacteria 996
949 Ga0495631_0156434 3300046518 Bacteria 978
950 Ga0495632_0047263 3300046519 Bacteria 2135
951 Ga0495632_0060128 3300046519 Bacteria 1847
952 Ga0495632_0102087 3300046519 Bacteria 1351
953 Ga0495632_0243352 3300046519 Bacteria 808
954 Ga0495632_0253061 3300046519 Bacteria 789
955 Ga0495637_0240062 3300046520 Bacteria 655
956 Ga0495643_0185764 3300046522 Bacteria 1007
957 Ga0495644_0401923 3300046523 Bacteria 542
958 Ga0495648_0196717 3300046524 Bacteria 1013
959 Ga0495648_0343530 3300046524 Bacteria 684
960 Ga0495666_0056048 3300046526 Bacteria 1888
961 Ga0495666_0057120 3300046526 Bacteria 1868
962 Ga0495642_0040785 3300046528 Bacteria 1887
963 Ga0495652_0051997 3300046529 Bacteria 3496
964 Ga0495652_0190799 3300046529 Bacteria 1564
965 Ga0495652_0489579 3300046529 Bacteria 854
966 Ga0495652_0764365 3300046529 Bacteria 646
967 Ga0495654_0064407 3300046530 Bacteria 1752
968 Ga0495665_0002979 3300046531 Bacteria 9154
969 Ga0495665_0044270 3300046531 Bacteria 2365
970 Ga0495640_0003398 3300046533 Bacteria 12815
971 Ga0495640_0010256 3300046533 Bacteria 7249
972 Ga0495640_0014352 3300046533 Bacteria 5998
973 Ga0495640_0066202 3300046533 Bacteria 2437
974 Ga0495586_0008523 3300046535 Bacteria 5456
975 Ga0495586_0150910 3300046535 Bacteria 1307
976 Ga0495587_0201811 3300046536 Bacteria 1124
977 Ga0495598_0121690 3300046537 Bacteria 885
978 Ga0495598_0303029 3300046537 Bacteria 605
979 Ga0495609_0178810 3300046538 Bacteria 894
980 Ga0495621_0045276 3300046539 Bacteria 1558
981 Ga0495621_0104968 3300046539 Bacteria 1079
982 Ga0495597_0308424 3300046542 Bacteria 613
983 Ga0495645_0003011 3300046543 Bacteria 11398
984 Ga0495645_0062858 3300046543 Bacteria 2688
985 Ga0495622_0008476 3300046557 Bacteria 4760
986 Ga0495622_0010153 3300046557 Bacteria 4353
987 Ga0495633_0141572 3300046558 Bacteria 1112
988 Ga0495667_0000305 3300046559 Bacteria 31224
989 Ga0495667_0013520 3300046559 Bacteria 5523
990 Ga0495667_0055353 3300046559 Bacteria 2609
991 Ga0495667_0239935 3300046559 Bacteria 1155
992 Ga0495667_0463175 3300046559 Bacteria 796
993 Ga0495667_0474339 3300046559 Bacteria 785
994 Ga0495656_0072060 3300046615 Bacteria 1537
995 Ga0495656_0314996 3300046615 Bacteria 805
996 Ga0495656_0651585 3300046615 Bacteria 565
997 Ga0495668_0163375 3300046616 Bacteria 1220
998 Ga0495668_0281519 3300046616 Bacteria 911
999 Ga0495668_0342494 3300046616 Bacteria 820
1000 Ga0495668_0687123 3300046616 Bacteria 566
1001 Ga0495668_0742130 3300046616 Bacteria 543
1002 Ga0495634_0003435 3300046642 Bacteria 12708
1003 Ga0495634_0012645 3300046642 Bacteria 6110
1004 Ga0495634_0116442 3300046642 Bacteria 1714
1005 Ga0495611_0068474 3300046648 Bacteria 1620
1006 Ga0495611_0266170 3300046648 Bacteria 793
1007 Ga0495625_0083625 3300046660 Bacteria 2218
1008 Ga0495625_0129353 3300046660 Bacteria 1711
1009 Ga0495625_0179509 3300046660 Bacteria 1409
1010 Ga0495625_0308987 3300046660 Bacteria 1010
1011 Ga0495635_0000102 3300046663 Bacteria 50623
1012 Ga0495635_0004903 3300046663 Bacteria 9306
1013 Ga0495635_0043797 3300046663 Bacteria 3087
1014 Ga0495635_0185121 3300046663 Bacteria 1415
1015 Ga0495635_0372315 3300046663 Bacteria 951
1016 Ga0495659_0175649 3300046664 Bacteria 870
1017 Ga0495659_0355631 3300046664 Bacteria 626
1018 Ga0495661_0136470 3300046665 Bacteria 1338
1019 Ga0495588_0018113 3300046674 Bacteria 3430
1020 Ga0495588_0217280 3300046674 Bacteria 1009
1021 Ga0495588_0234120 3300046674 Bacteria 969
1022 Ga0495588_0236938 3300046674 Bacteria 962
1023 Ga0495657_0022520 3300046675 Bacteria 4511
1024 Ga0495599_0011854 3300046678 Bacteria 5360
1025 Ga0495599_0045042 3300046678 Bacteria 2766
1026 Ga0495623_0011690 3300046679 Bacteria 5687
1027 Ga0495623_0022925 3300046679 Bacteria 4031
1028 Ga0495623_0222438 3300046679 Bacteria 1075
1029 Ga0495623_0253404 3300046679 Bacteria 989
1030 Ga0495646_0051078 3300046680 Bacteria 2503
1031 Ga0495646_0070496 3300046680 Bacteria 2058
1032 Ga0495646_0074138 3300046680 Bacteria 1998
1033 Ga0495647_0006246 3300046681 Bacteria 3938
1034 Ga0495647_0213518 3300046681 Bacteria 850
1035 Ga0495658_0002270 3300046683 Bacteria 9713
1036 Ga0495658_0007004 3300046683 Bacteria 5563
1037 Ga0495669_0095452 3300046684 Bacteria 1377
1038 Ga0495669_0125137 3300046684 Bacteria 1207
1039 Ga0495613_0007307 3300046689 Bacteria 8226
1040 Ga0495624_0001774 3300046690 Bacteria 16501
1041 Ga0495624_0023749 3300046690 Bacteria 4041
1042 Ga0495624_0376701 3300046690 Bacteria 853
1043 Ga0495670_0026442 3300046691 Bacteria 2872
1044 Ga0495670_0063863 3300046691 Bacteria 1854
1045 Ga0495670_0275744 3300046691 Bacteria 899
1046 Ga0495670_0303697 3300046691 Bacteria 855
1047 Ga0495671_0139763 3300046692 Bacteria 1180
1048 Ga0495671_0202203 3300046692 Bacteria 963
1049 Ga0495671_0204473 3300046692 Bacteria 957
1050 Ga0495671_0463029 3300046692 Bacteria 606
1051 Ga0495589_0079811 3300046794 Bacteria 1592
1052 Ga0495589_0438001 3300046794 Bacteria 598
1053 Ga0495589_0534316 3300046794 Bacteria 535
1054 Ga0495600_0000357 3300046809 Bacteria 24062
1055 Ga0495600_0007049 3300046809 Bacteria 6866
1056 Ga0495600_0118259 3300046809 Bacteria 1724
1057 Ga0495600_0156550 3300046809 Bacteria 1474
1058 Ga0495600_0660628 3300046809 Bacteria 631
1059 Ga0495660_0069799 3300046810 Bacteria 1867
1060 Ga0495581_0004221 3300047315 Bacteria 8282
1061 Ga0495581_0021912 3300047315 Bacteria 3703
1062 Ga0495581_0455134 3300047315 Bacteria 745
1063 Ga0495581_0510096 3300047315 Bacteria 699
1064 Ga0495604_0001099 3300047317 Bacteria 22454
1065 Ga0495604_0107558 3300047317 Bacteria 2038
1066 Ga0495604_0122277 3300047317 Bacteria 1883
1067 Ga0495604_0491082 3300047317 Bacteria 797
1068 Ga0495636_0021311 3300047318 Bacteria 2617
1069 Ga0495636_0143180 3300047318 Bacteria 1068
1070 Ga0495636_0154755 3300047318 Bacteria 1030
1071 Ga0495674_0029184 3300047319 Bacteria 5025
1072 Ga0495674_0045856 3300047319 Bacteria 3881
1073 Ga0495674_0046750 3300047319 Bacteria 3841
1074 Ga0495674_0325463 3300047319 Bacteria 1251
1075 Ga0495674_0826698 3300047319 Bacteria 719
1076 Ga0495672_0291252 3300047320 Bacteria 776
1077 Ga0495676_0222139 3300047321 Bacteria 1301
1078 Ga0495676_0256733 3300047321 Bacteria 1190
1079 Ga0495676_0974231 3300047321 Bacteria 542
1080 Ga0495680_0003585 3300047322 Bacteria 15202
1081 Ga0495680_0039627 3300047322 Bacteria 3756
1082 Ga0495680_0620904 3300047322 Bacteria 721
1083 Ga0495683_0243629 3300047323 Bacteria 792
1084 Ga0495675_0004354 3300047444 Bacteria 8568
1085 Ga0495675_0385930 3300047444 Bacteria 818
1086 Ga0495675_0690680 3300047444 Bacteria 572
1087 Ga0495677_0093079 3300047445 Bacteria 1137
1088 Ga0495679_053039 3300047446 Bacteria 1212
1089 Ga0495685_146918 3300047447 Bacteria 767
1090 Ga0495685_214289 3300047447 Bacteria 615
1091 Ga0495673_0101389 3300047469 Bacteria 1163
1092 Ga0495673_0269757 3300047469 Bacteria 617
1093 Ga0495684_0000088 3300047471 Bacteria 64704
1094 Ga0495684_0080694 3300047471 Bacteria 2469
1095 Ga0495684_0081455 3300047471 Bacteria 2456
1096 Ga0495684_0795093 3300047471 Bacteria 618
1097 Ga0495686_0162846 3300047472 Bacteria 1302
1098 Ga0495686_0338382 3300047472 Bacteria 821
1099 Ga0495686_0692071 3300047472 Bacteria 521
1100 Ga0495686_0705406 3300047472 Bacteria 514
1101 Ga0495593_0000167 3300047673 Bacteria 33674
1102 Ga0495593_0001656 3300047673 Bacteria 13185
1103 Ga0495593_0013615 3300047673 Bacteria 4636
1104 Ga0495602_0026534 3300048088 Bacteria 5584
1105 Ga0495602_0066783 3300048088 Bacteria 3097
1106 Ga0495614_0071945 3300048089 Bacteria 1491
1107 Ga0495615_0099555 3300048090 Bacteria 820
1108 Ga0495615_0303237 3300048090 Bacteria 518
1109 Ga0495626_0019316 3300048091 Bacteria 3410
1110 Ga0496100_0020948 3300048903 Bacteria 3929
1111 Ga0496100_0358106 3300048903 Bacteria 1103
1112 Ga0496100_0697736 3300048903 Bacteria 792
1113 Ga0496100_0826750 3300048903 Bacteria 726
1114 Ga0496101_0001657 3300048904 Bacteria 13361
1115 Ga0496102_0001372 3300048905 Bacteria 21715
1116 Ga0496102_0086703 3300048905 Bacteria 2892
1117 Ga0496102_0395918 3300048905 Bacteria 1299
1118 Ga0496102_0690313 3300048905 Bacteria 944
1119 Ga0496102_0845271 3300048905 Bacteria 837
1120 Ga0496102_1359266 3300048905 Unclassified 629
1121 Ga0496102_1899293 3300048905 Bacteria 512
1122 Ga0496103_0093885 3300048906 Bacteria 1895
1123 Ga0496103_0328941 3300048906 Bacteria 983
1124 Ga0496103_0392970 3300048906 Bacteria 891
1125 Ga0496103_0968469 3300048906 Bacteria 531
1126 Ga0496104_0031068 3300048907 Bacteria 4965
1127 Ga0496104_0085123 3300048907 Bacteria 3017
1128 Ga0496104_0187032 3300048907 Bacteria 1982
1129 Ga0496104_0225068 3300048907 Bacteria 1788
1130 Ga0496104_0225312 3300048907 Bacteria 1787
1131 Ga0496104_0281079 3300048907 Bacteria 1577
1132 Ga0496104_0618069 3300048907 Bacteria 993
1133 Ga0496104_0733998 3300048907 Bacteria 895
1134 Ga0496105_0065252 3300048908 Bacteria 3005
1135 Ga0496105_0068753 3300048908 Bacteria 2926
1136 Ga0496105_0152431 3300048908 Bacteria 1899
1137 Ga0496105_0182313 3300048908 Bacteria 1719
1138 Ga0496105_0554994 3300048908 Bacteria 896
1139 Ga0496106_0018200 3300048909 Bacteria 5195
1140 Ga0496106_0102432 3300048909 Bacteria 2221
1141 Ga0496106_0116553 3300048909 Bacteria 2084
1142 Ga0496106_0568920 3300048909 Bacteria 909
1143 Ga0496106_1167057 3300048909 Bacteria 601
1144 Ga0496107_0181393 3300048910 Bacteria 1563
1145 Ga0496107_0279700 3300048910 Bacteria 1242
1146 Ga0496107_0354743 3300048910 Bacteria 1091
1147 Ga0496108_0130931 3300048911 Bacteria 2156
1148 Ga0496108_0174724 3300048911 Bacteria 1859
1149 Ga0496108_0593451 3300048911 Bacteria 965
1150 Ga0496109_0042846 3300048912 Bacteria 4102
1151 Ga0496109_0109721 3300048912 Bacteria 2565
1152 Ga0496109_0138611 3300048912 Bacteria 2274
1153 Ga0496109_0144493 3300048912 Bacteria 2225
1154 Ga0496109_0146203 3300048912 Bacteria 2212
1155 Ga0496110_0030095 3300048913 Bacteria 4678
1156 Ga0496110_0086342 3300048913 Bacteria 2801
1157 Ga0496110_0152116 3300048913 Bacteria 2095
1158 Ga0496110_0640483 3300048913 Bacteria 962
1159 Ga0496110_1347820 3300048913 Bacteria 623
1160 Ga0496111_0189945 3300048914 Bacteria 1527
1161 Ga0496111_0342815 3300048914 Bacteria 1106
1162 Ga0496112_0000004 3300048915 Bacteria 553294
1163 Ga0496112_0074028 3300048915 Bacteria 3368
1164 Ga0496112_0076941 3300048915 Bacteria 3299
1165 Ga0496112_0119142 3300048915 Bacteria 2609
1166 Ga0496112_0151225 3300048915 Bacteria 2288
1167 Ga0496112_0191316 3300048915 Bacteria 2008
1168 Ga0496112_0632604 3300048915 Bacteria 1000
1169 Ga0496112_1154598 3300048915 Bacteria 692
1170 Ga0496112_1754946 3300048915 Bacteria 533
1171 Ga0496112_1767522 3300048915 Bacteria 530
1172 Ga0496112_1780548 3300048915 Bacteria 528
1173 Ga0496113_0033282 3300048916 Bacteria 3752
1174 Ga0496113_0051955 3300048916 Bacteria 3059
1175 Ga0496113_0060663 3300048916 Bacteria 2852
1176 Ga0496113_0272102 3300048916 Bacteria 1354
1177 Ga0496113_1099883 3300048916 Bacteria 623
1178 Ga0496113_1446804 3300048916 Bacteria 531
1179 Ga0496114_0012013 3300048917 Bacteria 6926
1180 Ga0496114_0195591 3300048917 Bacteria 1770
1181 Ga0496114_0750081 3300048917 Bacteria 853
1182 Ga0496114_1420270 3300048917 Bacteria 581
1183 Ga0496114_1670612 3300048917 Bacteria 525
1184 Ga0496115_0001007 3300048918 Bacteria 20465
1185 Ga0496115_0022258 3300048918 Bacteria 4909
1186 Ga0496115_0128395 3300048918 Bacteria 2089
1187 Ga0496115_1168140 3300048918 Bacteria 580
1188 Ga0496116_0007069 3300048919 Bacteria 10052
1189 Ga0496117_0037823 3300048920 Bacteria 3589
1190 Ga0496117_0069135 3300048920 Bacteria 2380
1191 Ga0496117_0107461 3300048920 Bacteria 1748
1192 Ga0496117_0109295 3300048920 Bacteria 1727
1193 Ga0496117_0200975 3300048920 Bacteria 1126
1194 Ga0496117_0407123 3300048920 Bacteria 684
1195 Ga0496118_0055848 3300048921 Bacteria 2974
1196 Ga0496118_0272019 3300048921 Bacteria 948
1197 Ga0496118_0404229 3300048921 Bacteria 708
1198 Ga0496118_0404807 3300048921 Bacteria 707
1199 Ga0496119_0080662 3300048922 Bacteria 1876
1200 Ga0496119_0149386 3300048922 Bacteria 1254
1201 Ga0496119_0168481 3300048922 Bacteria 1159
1202 Ga0496120_0124831 3300048923 Bacteria 1326
1203 Ga0496120_0147930 3300048923 Bacteria 1184
1204 Ga0496121_0009175 3300048924 Bacteria 11434
1205 Ga0496121_0037086 3300048924 Bacteria 4334
1206 Ga0496121_0045611 3300048924 Bacteria 3764
1207 Ga0496121_0051419 3300048924 Bacteria 3470
1208 Ga0496121_0053882 3300048924 Bacteria 3366
1209 Ga0496121_0124024 3300048924 Bacteria 1945
1210 Ga0496121_0135276 3300048924 Bacteria 1837
1211 Ga0496121_0307834 3300048924 Bacteria 1072
1212 Ga0496121_0331468 3300048924 Bacteria 1021
1213 Ga0496121_0560093 3300048924 Bacteria 713
1214 Ga0496121_0562016 3300048924 Bacteria 712
1215 Ga0496121_0708177 3300048924 Bacteria 605
1216 Ga0496122_0086715 3300048925 Bacteria 2153
1217 Ga0496122_0466420 3300048925 Bacteria 622
1218 Ga0496123_0008569 3300048926 Bacteria 9371
1219 Ga0496123_0303488 3300048926 Bacteria 761
1220 Ga0496123_0361620 3300048926 Bacteria 672
1221 Ga0496124_0189890 3300048927 Bacteria 1573
1222 Ga0496124_0400335 3300048927 Bacteria 953
1223 Ga0496124_0777099 3300048927 Bacteria 596
1224 Ga0496125_0008508 3300048928 Bacteria 10731
1225 Ga0496125_0028742 3300048928 Bacteria 5012
1226 Ga0496125_0103686 3300048928 Bacteria 2086
1227 Ga0496125_0147849 3300048928 Bacteria 1620
1228 Ga0496125_0254530 3300048928 Bacteria 1105
1229 Ga0496125_0378682 3300048928 Bacteria 835
1230 Ga0496125_0524605 3300048928 Bacteria 661
1231 Ga0496126_0005960 3300048929 Bacteria 13713
1232 Ga0496126_0029531 3300048929 Bacteria 5208
1233 Ga0496126_0035465 3300048929 Bacteria 4675
1234 Ga0496126_0090130 3300048929 Bacteria 2698
1235 Ga0496126_0093235 3300048929 Bacteria 2644
1236 Ga0496126_0135189 3300048929 Bacteria 2127
1237 Ga0496126_0171278 3300048929 Bacteria 1849
1238 Ga0496126_0237766 3300048929 Bacteria 1523
1239 Ga0496126_0254613 3300048929 Bacteria 1462
1240 Ga0496126_0558077 3300048929 Bacteria 908
1241 Ga0496126_0634908 3300048929 Bacteria 837
1242 Ga0496126_0699162 3300048929 Bacteria 788
1243 Ga0496126_0870795 3300048929 Bacteria 685
1244 Ga0496126_0941713 3300048929 Bacteria 652
1245 Ga0495678_150872 3300049459 Bacteria 751
1246 Ga0495682_0027486 3300049460 Bacteria 2110
1247 Ga0501032_0222250 3300049569 Bacteria 1229
1248 Ga0501036_0287146 3300049572 Bacteria 1377
1249 Ga0501036_0765263 3300049572 Bacteria 796
1250 Ga0501038_0590958 3300049574 Bacteria 841
1251 Ga0501039_0590541 3300049575 Bacteria 871
1252 Ga0501039_0974485 3300049575 Bacteria 659
1253 Ga0501046_0053125 3300049580 Bacteria 3192
1254 Ga0501047_0089916 3300049581 Bacteria 2947
1255 Ga0501067_0013283 3300049583 Bacteria 4561
1256 Ga0501067_0037376 3300049583 Bacteria 2697
1257 Ga0501069_0428836 3300049585 Bacteria 784
1258 Ga0501070_0015246 3300049586 Bacteria 6468
1259 Ga0501070_0640383 3300049586 Bacteria 845
1260 Ga0501071_0118693 3300049587 Bacteria 1960
1261 Ga0501073_0120185 3300049589 Bacteria 1821
1262 Ga0501074_0021500 3300049590 Bacteria 4684
1263 Ga0501075_1248560 3300049591 Bacteria 563
1264 Ga0501076_0421718 3300049592 Bacteria 1098
1265 Ga0501076_0567207 3300049592 Bacteria 936
1266 Ga0501079_0495211 3300049741 Bacteria 961
1267 Ga0501080_0012725 3300049742 Bacteria 7716
1268 Ga0501081_0265498 3300049743 Bacteria 1255
1269 Ga0501035_0608871 3300049822 Bacteria 889
1270 Ga0501035_0962429 3300049822 Bacteria 673
1271 Ga0501044_0096467 3300049823 Bacteria 2978
1272 Ga0501044_0932748 3300049823 Bacteria 742
1273 Ga0501045_0408459 3300049824 Bacteria 1010
1274 nmdc:mga03683_320039_c1 3300050489 Bacteria 730
1275 nmdc:mga03683_54863_c1 3300050489 Bacteria 1672
1276 nmdc:mga03683_85045_c1 3300050489 Bacteria 1371
1277 nmdc:mga03n38_395146_c1 3300050490 Bacteria 760
1278 nmdc:mga03n38_4080_c1 3300050490 Bacteria 4787
1279 nmdc:mga03n38_541952_c1 3300050490 Bacteria 657
1280 nmdc:mga03n38_845249_c1 3300050490 Bacteria 535
1281 nmdc:mga00v17_45088_c1 3300050491 Bacteria 2662
1282 nmdc:mga00v17_7051_c1 3300050491 Bacteria 5985
1283 nmdc:mga0yw44_1110835_c1 3300050492 Bacteria 534
1284 nmdc:mga0yw44_157307_c1 3300050492 Bacteria 1486
1285 nmdc:mga0yw44_158951_c1 3300050492 Bacteria 1478
1286 nmdc:mga0yw44_166314_c1 3300050492 Bacteria 1446
1287 nmdc:mga0yw44_17788_c1 3300050492 Bacteria 3877
1288 nmdc:mga0yw44_195162_c1 3300050492 Bacteria 1336
1289 nmdc:mga0yw44_72048_c2 3300050492 Bacteria 1837
1290 nmdc:mga0yw44_91276_c1 3300050492 Bacteria 1925
1291 nmdc:mga0k408_134733_c1 3300050493 Bacteria 1467
1292 nmdc:mga0k408_248065_c1 3300050493 Bacteria 1063
1293 nmdc:mga0k408_297527_c1 3300050493 Bacteria 963
1294 nmdc:mga0k408_312697_c1 3300050493 Bacteria 937
1295 nmdc:mga0k408_636663_c1 3300050493 Bacteria 627
1296 nmdc:mga06z11_21966_c1 3300050494 Bacteria 2973
1297 nmdc:mga06z11_287219_c1 3300050494 Bacteria 975
1298 nmdc:mga06z11_361779_c1 3300050494 Bacteria 870
1299 nmdc:mga06z11_888605_c1 3300050494 Bacteria 543
1300 nmdc:mga07m45_135429_c1 3300050496 Bacteria 1426
1301 nmdc:mga07m45_143059_c1 3300050496 Bacteria 1385
1302 nmdc:mga07m45_19607_c1 3300050496 Bacteria 3666
1303 nmdc:mga07m45_32975_c1 3300050496 Bacteria 2874
1304 nmdc:mga05p37_1355167_c1 3300050507 Bacteria 720
1305 nmdc:mga09592_1370420_c1 3300050508 Bacteria 579
1306 nmdc:mga08y16_217475_c1 3300050511 Bacteria 1978
1307 nmdc:mga0n895_1968156_c1 3300050512 Bacteria 543
1308 nmdc:mga0n895_237094_c1 3300050512 Bacteria 1851
1309 nmdc:mga0rr50_1191032_c1 3300050513 Unclassified 647
1310 nmdc:mga0rr50_775255_c1 3300050513 Bacteria 818
1311 nmdc:mga0sz30_124512_c1 3300050516 Bacteria 1134
1312 nmdc:mga0sz30_233982_c1 3300050516 Bacteria 817
1313 nmdc:mga0sz30_290925_c1 3300050516 Bacteria 728
1314 nmdc:mga0sz30_390963_c1 3300050516 Bacteria 623
1315 nmdc:mga0sz30_39865_c2 3300050516 Bacteria 1683
1316 nmdc:mga0sz30_47846_c1 3300050516 Bacteria 1808
1317 nmdc:mga0sz30_53267_c1 3300050516 Bacteria 1719
1318 Ga0495601_0010740 3300053077 Bacteria 5464
1319 Ga0495601_0091703 3300053077 Bacteria 1956
1320 Ga0495601_0396101 3300053077 Bacteria 895
1321 Ga0495612_0061234 3300053078 Bacteria 1559
1322 Ga0500635_0280110 3300053080 Bacteria 656
1323 Ga0495655_0009352 3300053083 Bacteria 1898
1324 Ga0495655_0152781 3300053083 Bacteria 727
1325 Ga0495595_0001173 3300053084 Bacteria 10166
1326 Ga0495595_0043673 3300053084 Bacteria 2057
1327 Ga0495619_0000166 3300053085 Bacteria 48296
1328 Ga0495619_0143286 3300053085 Bacteria 1646
1329 Ga0495619_0178718 3300053085 Bacteria 1468
1330 Ga0500578_0027306 3300053086 Bacteria 3665
1331 Ga0500643_026377 3300053087 Bacteria 1820
1332 Ga0500644_0255062 3300053088 Bacteria 740
1333 Ga0500581_281372 3300053089 Bacteria 676
1334 Ga0500647_0075122 3300053091 Bacteria 1622
1335 Ga0500583_0122818 3300053092 Bacteria 1285
1336 Ga0500583_0469818 3300053092 Bacteria 595
1337 Ga0500651_0008263 3300053093 Bacteria 6116
1338 Ga0500651_0066009 3300053093 Bacteria 2254
1339 Ga0500651_0244813 3300053093 Bacteria 1044
1340 Ga0500651_0579270 3300053093 Bacteria 611
1341 Ga0500566_0000141 3300053094 Bacteria 36876
1342 Ga0500566_0005775 3300053094 Bacteria 7353
1343 Ga0500566_0011586 3300053094 Bacteria 5191
1344 Ga0500640_001964 3300053095 Bacteria 6592
1345 Ga0500641_0003020 3300053096 Bacteria 5959
1346 Ga0500641_0080028 3300053096 Bacteria 1385
1347 Ga0500641_0091282 3300053096 Bacteria 1300
1348 Ga0500650_0000214 3300053098 Bacteria 14010
1349 Ga0500554_023213 3300053102 Bacteria 1742
1350 Ga0500554_190777 3300053102 Bacteria 687
1351 Ga0500555_062156 3300053103 Bacteria 1002
1352 Ga0500555_114344 3300053103 Bacteria 678
1353 Ga0500556_0000125 3300053104 Bacteria 65777
1354 Ga0500562_046570 3300053108 Bacteria 1156
1355 Ga0500562_132466 3300053108 Bacteria 679
1356 Ga0500569_024008 3300053109 Bacteria 1645
1357 Ga0500572_000838 3300053111 Bacteria 9643
1358 Ga0500572_025471 3300053111 Bacteria 1604
1359 Ga0500582_232081 3300053114 Bacteria 605
1360 Ga0500591_078821 3300053115 Bacteria 1471
1361 Ga0500592_005168 3300053116 Bacteria 2073
1362 Ga0500592_055654 3300053116 Bacteria 645
1363 Ga0500594_0023056 3300053118 Bacteria 1575
1364 Ga0500594_0061340 3300053118 Bacteria 1085
1365 Ga0500595_000454 3300053119 Bacteria 25490
1366 Ga0500595_000732 3300053119 Bacteria 19543
1367 Ga0500595_002046 3300053119 Bacteria 10305
1368 Ga0500595_003733 3300053119 Bacteria 7022
1369 Ga0500608_038718 3300053122 Bacteria 2282
1370 Ga0500614_001145 3300053123 Bacteria 6520
1371 Ga0500618_086119 3300053125 Bacteria 705
1372 Ga0500642_0000194 3300053130 Bacteria 24955
1373 Ga0500642_0163218 3300053130 Bacteria 1044
1374 Ga0500652_000210 3300053131 Bacteria 22474
1375 Ga0500658_0172865 3300053134 Bacteria 981
1376 Ga0500658_0210314 3300053134 Bacteria 890
1377 Ga0500559_0000205 3300053136 Bacteria 47084
1378 Ga0500559_0001193 3300053136 Bacteria 15436
1379 Ga0500559_0002865 3300053136 Bacteria 8717
1380 Ga0500559_0135640 3300053136 Bacteria 1151
1381 Ga0500559_0146810 3300053136 Bacteria 1106
1382 Ga0500561_0054778 3300053137 Bacteria 1100
1383 Ga0500564_141665 3300053138 Bacteria 1032
1384 Ga0500568_0000356 3300053139 Bacteria 35606
1385 Ga0500568_0060570 3300053139 Bacteria 1466
1386 Ga0500577_0276395 3300053142 Bacteria 732
1387 Ga0500586_006207 3300053145 Bacteria 3088
1388 Ga0500588_0065159 3300053146 Bacteria 1179
1389 Ga0500588_0258580 3300053146 Bacteria 655
1390 Ga0500589_086443 3300053147 Bacteria 1390
1391 Ga0500590_009317 3300053148 Bacteria 4938
1392 Ga0500590_106918 3300053148 Bacteria 1334
1393 Ga0500603_000116 3300053150 Bacteria 18595
1394 Ga0500603_000516 3300053150 Bacteria 9817
1395 Ga0500603_015553 3300053150 Bacteria 1793
1396 Ga0500604_0002009 3300053151 Bacteria 5628
1397 Ga0500604_0033973 3300053151 Bacteria 1511
1398 Ga0500616_0000895 3300053153 Bacteria 32765
1399 Ga0500619_056453 3300053154 Bacteria 1283
1400 Ga0500622_0002020 3300053156 Bacteria 15148
1401 Ga0500622_0122533 3300053156 Bacteria 1259
1402 Ga0500622_0403747 3300053156 Bacteria 554
1403 Ga0500627_0434329 3300053158 Bacteria 555
1404 Ga0500627_0490814 3300053158 Bacteria 512
1405 Ga0500630_000171 3300053159 Bacteria 24352
1406 Ga0500634_0016561 3300053161 Bacteria 3935
1407 Ga0500634_0046954 3300053161 Bacteria 2332
1408 Ga0500634_0052315 3300053161 Bacteria 2194
1409 Ga0500634_0054026 3300053161 Bacteria 2153
1410 Ga0500634_0074594 3300053161 Bacteria 1766
1411 Ga0500638_125365 3300053162 Bacteria 1170
1412 Ga0500639_000004 3300053163 Bacteria 216921
1413 Ga0500636_0008650 3300053177 Bacteria 5897
1414 Ga0500636_0125138 3300053177 Bacteria 1438
1415 Ga0500636_0141505 3300053177 Bacteria 1331
1416 Ga0500637_0000106 3300053178 Bacteria 29937
1417 Ga0500637_0070515 3300053178 Bacteria 2009
1418 Ga0500576_115956 3300053725 Bacteria 1064
1419 Ga0500576_253826 3300053725 Bacteria 545
1420 Ga0500611_006304 3300053727 Bacteria 1721
1421 Ga0500611_255366 3300053727 Bacteria 506
1422 Ga0500645_089457 3300053730 Bacteria 874
1423 Ga0500645_149099 3300053730 Bacteria 644
1424 Ga0500609_063377 3300053731 Bacteria 518
1425 Ga0500596_001998 3300053735 Bacteria 4077
1426 Ga0500596_002653 3300053735 Bacteria 3508
1427 Ga0500596_015421 3300053735 Bacteria 1147
1428 Ga0500601_051010 3300053737 Bacteria 515
1429 Ga0530510_0772094 3300061734 Bacteria 733
1430 2513889418 2513237141 Bacteria 8496279
1431 Ga0495625_0406750
1432 JGI24740J21852_10018916
1433 JGI24739J22299_10037604
1434 JGI24735J21928_10017658
1435 JGI24034J26672_10043150
1436 JGI25406J46586_10006595
1437 rootH1_10245633
1438 rootH1_10331927
1439 JGI25404J52841_10000284
1440 JGI25404J52841_10004715
1441 JGI25404J52841_10008794
1442 JGI25404J52841_10012849
1443 JGI25404J52841_10014178
1444 Ga0055526_1017110
1445 Ga0070658_10084498
1446 Ga0070676_10230035
1447 Ga0070683_100075117
1448 Ga0070690_100140369
1449 Ga0070690_100329500
1450 Ga0070670_100216359
1451 Ga0070670_101255005
1452 Ga0068869_100052003
1453 Ga0068869_100118587
1454 Ga0068869_100199930
1455 Ga0068869_100544171
1456 Ga0070666_10576762
1457 Ga0070680_100055739
1458 Ga0070680_100116478
1459 Ga0070680_100135204
1460 Ga0070682_101494226
1461 Ga0068868_100238841
1462 Ga0068868_100529506
1463 Ga0068868_100536017
1464 Ga0068868_100846972
1465 Ga0070689_100309548
1466 Ga0070689_100360363
1467 Ga0070689_100808855
1468 Ga0070691_10110224
1469 Ga0070687_101016541
1470 Ga0070661_100298463
1471 Ga0070692_10589669
1472 Ga0070692_10687928
1473 Ga0070668_100065242
1474 Ga0070668_100248210
1475 Ga0070668_100298097
1476 Ga0070668_100368048
1477 Ga0070668_100452177
1478 Ga0070668_100639780
1479 Ga0070668_100773098
1480 Ga0070668_100817871
1481 Ga0070669_100166629
1482 Ga0070669_100251368
1483 Ga0070669_101213858
1484 Ga0070671_100245054
1485 Ga0070671_100635296
1486 Ga0070671_101145657
1487 Ga0070671_101250748
1488 Ga0070674_100053767
1489 Ga0070674_100106814
1490 Ga0070674_101947050
1491 Ga0070673_100235500
1492 Ga0070673_100368142
1493 Ga0070688_100234467
1494 Ga0070688_100327781
1495 Ga0070688_100579307
1496 Ga0070688_100830649
1497 Ga0070659_100111795
1498 Ga0070659_100852448
1499 Ga0070667_100286345
1500 Ga0070709_10015318
1501 Ga0070709_10255217
1502 Ga0070709_10312389
1503 Ga0070709_10326413
1504 Ga0070709_11136663
1505 Ga0070714_100009232
1506 Ga0070714_100095477
1507 Ga0070714_100750762
1508 Ga0070713_100001913
1509 Ga0070713_100008075
1510 Ga0070713_100021836
1511 Ga0070713_100021931
1512 Ga0070713_100396764
1513 Ga0070713_100838945
1514 Ga0070710_10001428
1515 Ga0070710_10021540
1516 Ga0070710_10159964
1517 Ga0070710_10896839
1518 Ga0070710_10941383
1519 Ga0070701_10154385
1520 Ga0070701_10271144
1521 Ga0070711_100002884
1522 Ga0070711_100022506
1523 Ga0070711_100849314
1524 Ga0070711_100999219
1525 Ga0070705_100142370
1526 Ga0070700_100087149
1527 Ga0070700_100340364
1528 Ga0070694_100737143
1529 Ga0070663_100018502
1530 Ga0070663_100020934
1531 Ga0070663_100029630
1532 Ga0070663_100102906
1533 Ga0070663_100105474
1534 Ga0070663_100208070
1535 Ga0070663_100357665
1536 Ga0070663_100861056
1537 Ga0070663_101467329
1538 Ga0070678_100008379
1539 Ga0070678_100071386
1540 Ga0070678_100162351
1541 Ga0070678_100241447
1542 Ga0070678_100419219
1543 Ga0070678_100530375
1544 Ga0070678_101965262
1545 Ga0070678_102153808
1546 Ga0070662_100101524
1547 Ga0070662_100526195
1548 Ga0070662_100544906
1549 Ga0070662_101272236
1550 Ga0070681_10072711
1551 Ga0070681_10117014
1552 Ga0070681_11196568
1553 Ga0068867_100163781
1554 Ga0070685_10269893
1555 Ga0070706_100515445
1556 Ga0070706_100519340
1557 Ga0070707_100319127
1558 Ga0070707_100820373
1559 Ga0070707_101501412
1560 Ga0070707_102152343
1561 Ga0070698_100183267
1562 Ga0070698_100185402
1563 Ga0070698_101919341
1564 Ga0070699_100141536
1565 Ga0070679_100010022
1566 Ga0070679_100074939
1567 Ga0070684_100159468
1568 Ga0070684_101266737
1569 Ga0070697_101075536
1570 Ga0070697_101292318
1571 Ga0068853_100006903
1572 Ga0068853_100323189
1573 Ga0068853_100453799
1574 Ga0068853_100717130
1575 Ga0068853_100784836
1576 Ga0070672_100227548
1577 Ga0070672_100354887
1578 Ga0070672_101014453
1579 Ga0070686_100199392
1580 Ga0070695_100377702
1581 Ga0070696_100452323
1582 Ga0070696_101339913
1583 Ga0070693_100040365
1584 Ga0070693_100105898
1585 Ga0070665_100002761
1586 Ga0070665_100028064
1587 Ga0070665_100036089
1588 Ga0070665_100232823
1589 Ga0070665_100241295
1590 Ga0070665_100535610
1591 Ga0070665_100783630
1592 Ga0070665_101126063
1593 Ga0070665_101281209
1594 Ga0070704_100625093
1595 Ga0068855_100005114
1596 Ga0068855_100061235
1597 Ga0068855_100106133
1598 Ga0068855_101348151
1599 Ga0068857_100029142
1600 Ga0068857_100152385
1601 Ga0068857_100190946
1602 Ga0068854_100015484
1603 Ga0068854_100024882
1604 Ga0068854_101632339
1605 Ga0068854_102266864
1606 Ga0068856_100010355
1607 Ga0068856_100016084
1608 Ga0068856_100523613
1609 Ga0070702_100017077
1610 Ga0070702_100271496
1611 Ga0068852_100210962
1612 Ga0068859_100032608
1613 Ga0068859_100036626
1614 Ga0068859_101590398
1615 Ga0068859_102956824
1616 Ga0068859_103024148
1617 Ga0068864_100122963
1618 Ga0068864_100388207
1619 Ga0068866_10769440
1620 Ga0068866_11094072
1621 Ga0068861_100291490
1622 Ga0068851_10002904
1623 Ga0068863_100342772
1624 Ga0068863_100744675
1625 Ga0068858_100081959
1626 Ga0068858_100429075
1627 Ga0068858_100612353
1628 Ga0068858_101370014
1629 Ga0068860_100000149
1630 Ga0068860_100066977
1631 Ga0068860_100178468
1632 Ga0068860_100313494
1633 Ga0068860_100834815
1634 Ga0068860_102467838
1635 Ga0068862_100092022
1636 Ga0068862_100227331
1637 Ga0068862_100278417
1638 Ga0068862_100418115
1639 Ga0068862_100692512
1640 Ga0068862_100768635
1641 Ga0081455_10008954
1642 Ga0081455_10010256
1643 Ga0081455_10038775
1644 Ga0081455_10137816
1645 Ga0081538_10366194
1646 Ga0081540_1001309
1647 Ga0081540_1001846
1648 Ga0081540_1004914
1649 Ga0081540_1017082
1650 Ga0081540_1017644
1651 Ga0081540_1018007
1652 Ga0081540_1019764
1653 Ga0081540_1026602
1654 Ga0081540_1028970
1655 Ga0081540_1057747
1656 Ga0081540_1172786
1657 Ga0081539_10000176
1658 Ga0081539_10001416
1659 Ga0081539_10023931
1660 Ga0081539_10219926
1661 Ga0070717_10006449
1662 Ga0070717_10007137
1663 Ga0070717_10012334
1664 Ga0070717_10415341
1665 Ga0075365_10042089
1666 Ga0075365_10129843
1667 Ga0075365_10239811
1668 Ga0075365_10429735
1669 Ga0075365_10741444
1670 Ga0075365_11144698
1671 Ga0075365_11346469
1672 Ga0075368_10118826
1673 Ga0075368_10198478
1674 Ga0075363_100050436
1675 Ga0075363_100069001
1676 Ga0075363_100613262
1677 Ga0075364_10183397
1678 Ga0075364_10401061
1679 Ga0075364_10474157
1680 Ga0075364_10675943
1681 Ga0070715_10000460
1682 Ga0070716_100002855
1683 Ga0070716_100229188
1684 Ga0070716_100274003
1685 Ga0070716_100366005
1686 Ga0070716_100511754
1687 Ga0070716_101426344
1688 Ga0070712_100007349
1689 Ga0070712_100033986
1690 Ga0070712_100137861
1691 Ga0070712_100409923
1692 Ga0070712_101041671
1693 Ga0075362_10032172
1694 Ga0075362_10442349
1695 Ga0075362_10476935
1696 Ga0075367_10193737
1697 Ga0075367_10205660
1698 Ga0075367_10962582
1699 Ga0075367_10980478
1700 Ga0075367_11024060
1701 Ga0075369_10030536
1702 Ga0075369_10051573
1703 Ga0075369_10177426
1704 Ga0075369_10252106
1705 Ga0075369_10522609
1706 Ga0075366_10124923
1707 Ga0075366_10189049
1708 Ga0075366_10199128
1709 Ga0075366_10386647
1710 Ga0097621_100137460
1711 Ga0097621_100174216
1712 Ga0097621_100624080
1713 Ga0097621_101222842
1714 Ga0097621_101418977
1715 Ga0075370_10024488
1716 Ga0075370_10142482
1717 Ga0075370_10195886
1718 Ga0075370_10336999
1719 Ga0075370_10454695
1720 Ga0068871_100110507
1721 Ga0075428_100066108
1722 Ga0075428_101667424
1723 Ga0075431_100140441
1724 Ga0075434_100231591
1725 Ga0068865_100071666
1726 Ga0068865_100099885
1727 Ga0068865_100368330
1728 Ga0068865_100501627
1729 Ga0068865_101397579
1730 Ga0097620_100032608
1731 Ga0097620_100036626
1732 Ga0097620_101590173
1733 Ga0097620_102957478
1734 Ga0097620_103024179
1735 Ga0075435_100124227
1736 Ga0075435_101259872
1737 Ga0099794_10036834
1738 Ga0099795_10027848
1739 Ga0099795_10052265
1740 Ga0099795_10061731
1741 Ga0105240_10004765
1742 Ga0105240_10034450
1743 Ga0105240_10071834
1744 Ga0105240_10078859
1745 Ga0105240_10230644
1746 Ga0105240_11066144
1747 Ga0111539_10060214
1748 Ga0105245_10106409
1749 Ga0105245_10191629
1750 Ga0105245_10377635
1751 Ga0105245_10583897
1752 Ga0105245_10819958
1753 Ga0105245_11287609
1754 Ga0105245_12269721
1755 Ga0105247_10025319
1756 Ga0105247_10164630
1757 Ga0105247_10258475
1758 Ga0105247_10571998
1759 Ga0105247_10641124
1760 Ga0105247_11090613
1761 Ga0114129_11647188
1762 Ga0105243_10172123
1763 Ga0105243_10388473
1764 Ga0105243_10581149
1765 Ga0105243_11040773
1766 Ga0105243_11462993
1767 Ga0105243_13006512
1768 Ga0105241_10001875
1769 Ga0105241_10049725
1770 Ga0105241_10411186
1771 Ga0105242_10036881
1772 Ga0105242_10245631
1773 Ga0105242_10413168
1774 Ga0105242_10853813
1775 Ga0105242_11501539
1776 Ga0105248_10185213
1777 Ga0105248_10933304
1778 Ga0105237_10057288
1779 Ga0105237_10074813
1780 Ga0105237_10182633
1781 Ga0105237_10414356
1782 Ga0105237_10538641
1783 Ga0105237_10657888
1784 Ga0105237_10851956
1785 Ga0105237_10981688
1786 Ga0105237_11447125
1787 Ga0105238_10010766
1788 Ga0105238_10022965
1789 Ga0105238_10104024
1790 Ga0105238_10105365
1791 Ga0105238_10339499
1792 Ga0105238_10467360
1793 Ga0105238_10533447
1794 Ga0105238_11636176
1795 Ga0105238_11952177
1796 Ga0105249_10248999
1797 Ga0105249_10540431
1798 Ga0105249_10558034
1799 Ga0105249_10872223
1800 Ga0105249_11826654
1801 Ga0105249_13110340
1802 Ga0099796_10028131
1803 Ga0099796_10073148
1804 Ga0099796_10492846
1805 Ga0105239_10023684
1806 Ga0105239_10117927
1807 Ga0105239_10296279
1808 Ga0105239_10363184
1809 Ga0105239_10445611
1810 Ga0105239_11052192
1811 Ga0105239_11113824
1812 Ga0105246_10272362
1813 Ga0105246_10738007
1814 Ga0105246_10858383
1815 Ga0157371_10580325
1816 Ga0157370_10027175
1817 Ga0157370_10255017
1818 Ga0157369_10761473
1819 Ga0157369_12192452
1820 Ga0157374_10058369
1821 Ga0157374_10353092
1822 Ga0157374_11556082
1823 Ga0157374_12630916
1824 Ga0157378_10027145
1825 Ga0157378_10375694
1826 Ga0163162_10064357
1827 Ga0163162_10457298
1828 Ga0163162_10558336
1829 Ga0163162_10592383
1830 Ga0163162_10749804
1831 Ga0163162_10821781
1832 Ga0163162_11547979
1833 Ga0163162_12648991
1834 Ga0157372_10146202
1835 Ga0157372_10566633
1836 Ga0157372_13316849
1837 Ga0157375_10017467
1838 Ga0157375_10046033
1839 Ga0157375_10289997
1840 Ga0157375_11084594
1841 Ga0157375_11569927
1842 Ga0157375_11975945
1843 Ga0157375_12144644
1844 Ga0157375_12379754
1845 Ga0163163_10012476
1846 Ga0163163_10091768
1847 Ga0163163_10490339
1848 Ga0163163_10496239
1849 Ga0163163_10525014
1850 Ga0163163_11044300
1851 Ga0163163_11238310
1852 Ga0157380_10156299
1853 Ga0157380_10339773
1854 Ga0157380_12815690
1855 Ga0182008_10707214
1856 Ga0182008_10790206
1857 Ga0157377_10440009
1858 Ga0157377_10833812
1859 Ga0157379_10091190
1860 Ga0157379_10166683
1861 Ga0157379_10175791
1862 Ga0157379_10332247
1863 Ga0157379_10819157
1864 Ga0157376_10050762
1865 Ga0157376_10056908
1866 Ga0157376_11424776
1867 Ga0157376_11570659
1868 Ga0163161_10047763
1869 Ga0163161_10209322
1870 Ga0163161_10902197
1871 Ga0213876_10112793
1872 Ga0213876_10171651
1873 Ga0209148_1009946
1874 Ga0209233_1006130
1875 Ga0209455_1004451
1876 Ga0209130_1048229
1877 Ga0209564_1000871
1878 Ga0209758_1008123
1879 Ga0209758_1063189
1880 Ga0207697_10238697
1881 Ga0207697_10412722
1882 Ga0207656_10589871
1883 Ga0207653_10157501
1884 Ga0207682_10196848
1885 Ga0207692_10001538
1886 Ga0207692_10028383
1887 Ga0207692_10529546
1888 Ga0207642_10088013
1889 Ga0207642_10526914
1890 Ga0207710_10019866
1891 Ga0207710_10280018
1892 Ga0207710_10335780
1893 Ga0207688_10047181
1894 Ga0207688_10523570
1895 Ga0207680_10437246
1896 Ga0207647_10000524
1897 Ga0207647_10661253
1898 Ga0207685_10026923
1899 Ga0207685_10057892
1900 Ga0207685_10314205
1901 Ga0207699_10001041
1902 Ga0207699_10027422
1903 Ga0207699_10253360
1904 Ga0207699_10298069
1905 Ga0207699_10992873
1906 Ga0207645_10154625
1907 Ga0207643_10830070
1908 Ga0207643_10988809
1909 Ga0207705_10065134
1910 Ga0207684_10045107
1911 Ga0207654_10007949
1912 Ga0207707_10006494
1913 Ga0207707_10094713
1914 Ga0207707_10116754
1915 Ga0207695_10000883
1916 Ga0207695_10126760
1917 Ga0207695_10199856
1918 Ga0207671_10137988
1919 Ga0207671_10179914
1920 Ga0207671_10609544
1921 Ga0207671_11325480
1922 Ga0207693_10001357
1923 Ga0207693_10045134
1924 Ga0207693_10308039
1925 Ga0207663_10000873
1926 Ga0207663_11601478
1927 Ga0207660_10018272
1928 Ga0207660_10170460
1929 Ga0207660_10228304
1930 Ga0207662_10399236
1931 Ga0207649_10411728
1932 Ga0207649_10468338
1933 Ga0207652_10019705
1934 Ga0207652_10036809
1935 Ga0207646_10423807
1936 Ga0207646_10848782
1937 Ga0207681_10101995
1938 Ga0207681_10109814
1939 Ga0207681_10960941
1940 Ga0207681_11295058
1941 Ga0207694_10000436
1942 Ga0207694_10286713
1943 Ga0207694_10299073
1944 Ga0207694_11700015
1945 Ga0207650_10236529
1946 Ga0207650_11091003
1947 Ga0207687_10060012
1948 Ga0207687_10300323
1949 Ga0207687_11770332
1950 Ga0207700_10015973
1951 Ga0207700_10302656
1952 Ga0207700_10342683
1953 Ga0207700_10937011
1954 Ga0207700_11135075
1955 Ga0207664_10041469
1956 Ga0207664_11467708
1957 Ga0207644_10147516
1958 Ga0207644_10283718
1959 Ga0207644_10438402
1960 Ga0207690_10103616
1961 Ga0207706_10198004
1962 Ga0207706_10281363
1963 Ga0207706_10412454
1964 Ga0207706_10445662
1965 Ga0207686_10203174
1966 Ga0207686_10282709
1967 Ga0207686_10621417
1968 Ga0207709_10091661
1969 Ga0207709_10600067
1970 Ga0207709_10967122
1971 Ga0207709_11384005
1972 Ga0207709_11413899
1973 Ga0207709_11835392
1974 Ga0207670_10304394
1975 Ga0207670_10319432
1976 Ga0207670_10824054
1977 Ga0207669_10016092
1978 Ga0207669_10395901
1979 Ga0207669_10668490
1980 Ga0207669_10754247
1981 Ga0207704_10091211
1982 Ga0207704_10301770
1983 Ga0207704_10349967
1984 Ga0207704_10552679
1985 Ga0207665_10006588
1986 Ga0207665_10195062
1987 Ga0207691_10113728
1988 Ga0207691_10125639
1989 Ga0207691_10160565
1990 Ga0207691_10165942
1991 Ga0207691_10315793
1992 Ga0207711_10024524
1993 Ga0207711_10055599
1994 Ga0207711_10470816
1995 Ga0207711_10998527
1996 Ga0207689_10014560
1997 Ga0207689_10075631
1998 Ga0207689_10102772
1999 Ga0207689_10928424
2000 Ga0207689_11306754
2001 Ga0207661_10356198
2002 Ga0207661_10507815
2003 Ga0207679_10363784
2004 Ga0207667_10011785
2005 Ga0207667_10016252
2006 Ga0207667_10090923
2007 Ga0207667_10137082
2008 Ga0207667_11199465
2009 Ga0207651_10197939
2010 Ga0207651_10308307
2011 Ga0207651_10628643
2012 Ga0207651_11197130
2013 Ga0207651_11477859
2014 Ga0207712_10188234
2015 Ga0207712_10884593
2016 Ga0207712_11061111
2017 Ga0207712_11401113
2018 Ga0207668_10026995
2019 Ga0207668_10048033
2020 Ga0207668_10055192
2021 Ga0207668_10569343
2022 Ga0207668_11293627
2023 Ga0207640_10030276
2024 Ga0207640_10072075
2025 Ga0207640_10244776
2026 Ga0207640_10609766
2027 Ga0207640_10927596
2028 Ga0207658_10200356
2029 Ga0207658_10912458
2030 Ga0207677_10155522
2031 Ga0207677_10337149
2032 Ga0207677_10798997
2033 Ga0207677_10835388
2034 Ga0207677_11721265
2035 Ga0207703_10045095
2036 Ga0207703_10138753
2037 Ga0207639_10032959
2038 Ga0207639_10082300
2039 Ga0207639_10083086
2040 Ga0207639_10083580
2041 Ga0207639_11434653
2042 Ga0207678_10002505
2043 Ga0207678_10012047
2044 Ga0207678_10057400
2045 Ga0207678_10069632
2046 Ga0207678_10098073
2047 Ga0207678_10272664
2048 Ga0207678_10276198
2049 Ga0207708_10077114
2050 Ga0207708_10078138
2051 Ga0207708_10098621
2052 Ga0207708_10576324
2053 Ga0207702_10000005
2054 Ga0207702_10245744
2055 Ga0207641_10674097
2056 Ga0207641_11329376
2057 Ga0207648_10116422
2058 Ga0207648_11356699
2059 Ga0207676_10096995
2060 Ga0207676_10480108
2061 Ga0207676_10787130
2062 Ga0207674_10010135
2063 Ga0207674_10012171
2064 Ga0207674_10075883
2065 Ga0207674_10257701
2066 Ga0207675_100042951
2067 Ga0207675_100223869
2068 Ga0207675_100618618
2069 Ga0207675_102344476
2070 Ga0207683_10016315
2071 Ga0207683_10017331
2072 Ga0207683_10160633
2073 Ga0207683_10183829
2074 Ga0207683_10204245
2075 Ga0207683_10318009
2076 Ga0207683_10520176
2077 Ga0207683_10719616
2078 Ga0207698_10244333
2079 Ga0207698_10382864
2080 Ga0209588_1001786
2081 Ga0268266_10002595
2082 Ga0268266_10015491
2083 Ga0268266_10061183
2084 Ga0268266_10086654
2085 Ga0268266_10111685
2086 Ga0268266_10242183
2087 Ga0268266_10433167
2088 Ga0268266_10530280
2089 Ga0268266_10609932
2090 Ga0268265_10086493
2091 Ga0268265_10192057
2092 Ga0268265_10260857
2093 Ga0268265_10411219
2094 Ga0268265_10507435
2095 Ga0268265_10739933
2096 Ga0268265_12342688
2097 Ga0268264_10000084
2098 Ga0268264_10308456
2099 Ga0268264_10879419
2100 Ga0268264_11286445
2101 Ga0307517_10000369
2102 Ga0307517_10319512
2103 Ga0307517_10369578
2104 Ga0307515_10013420
2105 Ga0307515_10379216
2106 Ga0307515_10555452
2107 Ga0307511_10167846
2108 Ga0307511_10363113
2109 Ga0265330_10390655
2110 Ga0265332_10031536
2111 Ga0265325_10083915
2112 Ga0265339_10315651
2113 Ga0265331_10150792
2114 Ga0265316_10354906
2115 Ga0307513_10230970
2116 Ga0307513_10235003
2117 Ga0307513_10496669
2118 Ga0307513_10997807
2119 Ga0307509_10072887
2120 Ga0307509_10073475
2121 Ga0307509_10115650
2122 Ga0307509_10299515
2123 Ga0307509_10623411
2124 Ga0307509_10685347
2125 Ga0307408_100111744
2126 Ga0307408_101496255
2127 Ga0265313_10246272
2128 Ga0307508_10047728
2129 Ga0307508_10399318
2130 Ga0307508_10422963
2131 Ga0307508_10430681
2132 Ga0265314_10170340
2133 Ga0265342_10486181
2134 Ga0307516_10021202
2135 Ga0307516_10070865
2136 Ga0307516_10082196
2137 Ga0307516_10124721
2138 Ga0307516_10229663
2139 Ga0307405_10395838
2140 Ga0307405_10847291
2141 Ga0307413_10750540
2142 Ga0307413_11084458
2143 Ga0307410_10687159
2144 Ga0307410_10690610
2145 Ga0307410_10813122
2146 Ga0307406_10305657
2147 Ga0307406_10324210
2148 Ga0307406_11348322
2149 Ga0307407_10585430
2150 Ga0307412_10828692
2151 Ga0307409_100598259
2152 Ga0307409_100708351
2153 Ga0307416_100581995
2154 Ga0307416_100998994
2155 Ga0307416_101290043
2156 Ga0307416_101803363
2157 Ga0307416_101920548
2158 Ga0307411_10125314
2159 Ga0307411_10777241
2160 Ga0307415_100221468
2161 Ga0307415_100511168
2162 Ga0307510_10005024
2163 Ga0307510_10009194
2164 Ga0307510_10270452
2165 Ga0316215_1013852
2166 Ga0373930_0038774
2167 Ga0373948_0114130
2168 Ga0373926_0334032
2169 Ga0373934_0002431
2170 Ga0373940_0058854
2171 Ga0373940_0216543
2172 Ga0373944_0010473
2173 Ga0373949_0104761
2174 Ga0373951_0170977
2175 Ga0373923_0003726
2176 Ga0373932_0044241
2177 Ga0373932_0078207
2178 Ga0373936_0200841
2179 Ga0373936_0213465
2180 Ga0373936_0350054
2181 Ga0373939_0535118
2182 Ga0373945_0002603
2183 Ga0373953_0000929
2184 Ga0373953_0005411
2185 Ga0373953_0113058
2186 Ga0373953_0486722
2187 Ga0373954_0000067
2188 Ga0373954_0024815
2189 Ga0373954_0025269
2190 Ga0373954_0075643
2191 Ga0373954_0270539
2192 Ga0373956_0001639
2193 Ga0373956_0007638
2194 Ga0373956_0182891
2195 Ga0373957_0000501
2196 Ga0373957_0006447
2197 Ga0373960_0222618
2198 Ga0373943_0001888
2199 Ga0373943_0192509
2200 Ga0373946_0004239
2201 Ga0373946_0073134
2202 Ga0373946_0451301
2203 Ga0373955_0000377
2204 Ga0373955_0138333
2205 Ga0373955_0305681
2206 Ga0373924_0004215
2207 Ga0373924_0050507
2208 Ga0373924_0074032
2209 Ga0373931_0055359
2210 Ga0373931_0226586
2211 Ga0373931_0866974
2212 Ga0373931_1070036
2213 Ga0373935_0037417
2214 Ga0373935_0040858
2215 Ga0373935_0051478
2216 Ga0373935_0128160
2217 Ga0373935_0411134
2218 Ga0373927_0003905
2219 Ga0373927_0010432
2220 Ga0373927_0044542
2221 Ga0373927_0494060
2222 Ga0373933_0000324
2223 Ga0373933_0000519
2224 Ga0373933_0089294
2225 Ga0373933_0362051
2226 Ga0373947_0008954
2227 Ga0373947_0024948
2228 Ga0373947_1004066
2229 Ga0373947_1149189
2230 Ga0373937_0001425
2231 Ga0373937_0028466
2232 Ga0373937_0046615
2233 Ga0373937_0051681
2234 Ga0373937_0095291
2235 Ga0373937_1202387
2236 Ga0372808_009233
2237 Ga0373925_0035160
2238 Ga0373925_0044313
2239 Ga0373925_0126961
2240 Ga0373925_0450652
2241 Ga0373925_0587708
2242 Ga0395900_0331538
2243 Ga0395898_0173684
2244 Ga0395898_0508131
2245 Ga0395905_0078255
2246 Ga0395905_0863503
2247 Ga0395901_0231547
2248 Ga0436365_0272569
2249 Ga0436365_0912513
2250 Ga0436365_1453434
2251 Ga0436360_0319798
2252 Ga0436361_0769166
2253 Ga0436361_1169830
2254 Ga0436363_1429749
2255 Ga0436363_1677536
2256 Ga0439465_0008956
2257 Ga0439465_0174173
2258 Ga0439465_0174241
2259 Ga0451787_538535
2260 Ga0451791_0066321
2261 Ga0451791_0489189
2262 Ga0451791_0730688
2263 Ga0451791_1303076
2264 Ga0451793_0071078
2265 Ga0451798_0329382
2266 Ga0451798_1021059
2267 Ga0451800_1157606
2268 Ga0451800_1572657
2269 Ga0451802_1182178
2270 Ga0451802_1196601
2271 Ga0451807_0562609
2272 Ga0451807_0964125
2273 Ga0451807_1090274
2274 Ga0451833_0175461
2275 Ga0451837_1686692
2276 Ga0451841_1132424
2277 Ga0451845_0269736
2278 Ga0439431_0096186
2279 Ga0439432_250390
2280 Ga0450900_013176
2281 Ga0439458_0088481
2282 Ga0439459_0079791
2283 Ga0466963_0286380
2284 Ga0466963_0513366
2285 Ga0466957_1191876
2286 Ga0451576_0584387
2287 Ga0466967_0802600
2288 Ga0495617_060657
2289 Ga0495617_076494
2290 Ga0495592_0046096
2291 Ga0495592_0046648
2292 Ga0495592_0048935
2293 Ga0495603_0001576
2294 Ga0495603_0002921
2295 Ga0495603_0042436
2296 Ga0495603_0272974
2297 Ga0495603_0316279
2298 Ga0495603_0416407
2299 Ga0495603_0672904
2300 Ga0495603_0743938
2301 Ga0495590_0028519
2302 Ga0495590_0158313
2303 Ga0495590_0296728
2304 Ga0495591_041130
2305 Ga0495629_0000117
2306 Ga0495629_0009626
2307 Ga0495629_0051277
2308 Ga0495629_0052231
2309 Ga0495629_0118340
2310 Ga0495629_0308867
2311 Ga0495638_0012452
2312 Ga0495638_0013191
2313 Ga0495638_0093876
2314 Ga0495638_0111195
2315 Ga0495638_0132396
2316 Ga0495638_0164961
2317 Ga0495638_0180585
2318 Ga0495638_0380222
2319 Ga0495641_0002118
2320 Ga0495641_0178345
2321 Ga0495651_0291656
2322 Ga0495651_0322396
2323 Ga0495653_0001052
2324 Ga0495653_0005677
2325 Ga0495580_0004355
2326 Ga0495582_0001007
2327 Ga0495582_0006998
2328 Ga0495582_0215666
2329 Ga0495605_0141765
2330 Ga0495605_0299951
2331 Ga0495605_0412386
2332 Ga0495639_0001543
2333 Ga0495639_0070139
2334 Ga0495639_0389224
2335 Ga0495662_0004867
2336 Ga0495664_0002486
2337 Ga0495664_0025293
2338 Ga0495664_0027203
2339 Ga0495664_0489657
2340 Ga0495584_0090452
2341 Ga0495584_0151811
2342 Ga0495584_0157224
2343 Ga0495584_0273903
2344 Ga0495584_0367795
2345 Ga0495584_0571246
2346 Ga0495585_0274787
2347 Ga0495585_0354727
2348 Ga0495585_0367730
2349 Ga0495585_0602758
2350 Ga0495594_0000662
2351 Ga0495594_0100839
2352 Ga0495594_0217634
2353 Ga0495596_0074381
2354 Ga0495596_0144327
2355 Ga0495583_0146704
2356 Ga0495606_0007334
2357 Ga0495606_0119647
2358 Ga0495606_0159353
2359 Ga0495608_0067428
2360 Ga0495608_0086752
2361 Ga0495610_0027441
2362 Ga0495610_0244598
2363 Ga0495616_0082447
2364 Ga0495616_0195491
2365 Ga0495618_0006096
2366 Ga0495618_0026157
2367 Ga0495620_0039486
2368 Ga0495620_0155520
2369 Ga0495628_0003826
2370 Ga0495628_0011244
2371 Ga0495628_0150762
2372 Ga0495628_1101860
2373 Ga0495630_0001278
2374 Ga0495630_0088527
2375 Ga0495630_0174376
2376 Ga0495630_1183960
2377 Ga0495631_0119505
2378 Ga0495631_0151228
2379 Ga0495631_0156434
2380 Ga0495632_0047263
2381 Ga0495632_0060128
2382 Ga0495632_0102087
2383 Ga0495632_0243352
2384 Ga0495632_0253061
2385 Ga0495637_0240062
2386 Ga0495643_0185764
2387 Ga0495644_0401923
2388 Ga0495648_0196717
2389 Ga0495648_0343530
2390 Ga0495666_0056048
2391 Ga0495666_0057120
2392 Ga0495642_0040785
2393 Ga0495652_0051997
2394 Ga0495652_0190799
2395 Ga0495652_0489579
2396 Ga0495652_0764365
2397 Ga0495654_0064407
2398 Ga0495665_0002979
2399 Ga0495665_0044270
2400 Ga0495640_0003398
2401 Ga0495640_0010256
2402 Ga0495640_0014352
2403 Ga0495640_0066202
2404 Ga0495586_0008523
2405 Ga0495586_0150910
2406 Ga0495587_0201811
2407 Ga0495598_0121690
2408 Ga0495598_0303029
2409 Ga0495609_0178810
2410 Ga0495621_0045276
2411 Ga0495621_0104968
2412 Ga0495597_0308424
2413 Ga0495645_0003011
2414 Ga0495645_0062858
2415 Ga0495622_0008476
2416 Ga0495622_0010153
2417 Ga0495633_0141572
2418 Ga0495667_0000305
2419 Ga0495667_0013520
2420 Ga0495667_0055353
2421 Ga0495667_0239935
2422 Ga0495667_0463175
2423 Ga0495667_0474339
2424 Ga0495656_0072060
2425 Ga0495656_0314996
2426 Ga0495656_0651585
2427 Ga0495668_0163375
2428 Ga0495668_0281519
2429 Ga0495668_0342494
2430 Ga0495668_0687123
2431 Ga0495668_0742130
2432 Ga0495634_0003435
2433 Ga0495634_0012645
2434 Ga0495634_0116442
2435 Ga0495611_0068474
2436 Ga0495611_0266170
2437 Ga0495625_0083625
2438 Ga0495625_0129353
2439 Ga0495625_0179509
2440 Ga0495625_0308987
2441 Ga0495635_0000102
2442 Ga0495635_0004903
2443 Ga0495635_0043797
2444 Ga0495635_0185121
2445 Ga0495635_0372315
2446 Ga0495659_0175649
2447 Ga0495659_0355631
2448 Ga0495661_0136470
2449 Ga0495588_0018113
2450 Ga0495588_0217280
2451 Ga0495588_0234120
2452 Ga0495588_0236938
2453 Ga0495657_0022520
2454 Ga0495599_0011854
2455 Ga0495599_0045042
2456 Ga0495623_0011690
2457 Ga0495623_0022925
2458 Ga0495623_0222438
2459 Ga0495623_0253404
2460 Ga0495646_0051078
2461 Ga0495646_0070496
2462 Ga0495646_0074138
2463 Ga0495647_0006246
2464 Ga0495647_0213518
2465 Ga0495658_0002270
2466 Ga0495658_0007004
2467 Ga0495669_0095452
2468 Ga0495669_0125137
2469 Ga0495613_0007307
2470 Ga0495624_0001774
2471 Ga0495624_0023749
2472 Ga0495624_0376701
2473 Ga0495670_0026442
2474 Ga0495670_0063863
2475 Ga0495670_0275744
2476 Ga0495670_0303697
2477 Ga0495671_0139763
2478 Ga0495671_0202203
2479 Ga0495671_0204473
2480 Ga0495671_0463029
2481 Ga0495589_0079811
2482 Ga0495589_0438001
2483 Ga0495589_0534316
2484 Ga0495600_0000357
2485 Ga0495600_0007049
2486 Ga0495600_0118259
2487 Ga0495600_0156550
2488 Ga0495600_0660628
2489 Ga0495660_0069799
2490 Ga0495581_0004221
2491 Ga0495581_0021912
2492 Ga0495581_0455134
2493 Ga0495581_0510096
2494 Ga0495604_0001099
2495 Ga0495604_0107558
2496 Ga0495604_0122277
2497 Ga0495604_0491082
2498 Ga0495636_0021311
2499 Ga0495636_0143180
2500 Ga0495636_0154755
2501 Ga0495674_0029184
2502 Ga0495674_0045856
2503 Ga0495674_0046750
2504 Ga0495674_0325463
2505 Ga0495674_0826698
2506 Ga0495672_0291252
2507 Ga0495676_0222139
2508 Ga0495676_0256733
2509 Ga0495676_0974231
2510 Ga0495680_0003585
2511 Ga0495680_0039627
2512 Ga0495680_0620904
2513 Ga0495683_0243629
2514 Ga0495675_0004354
2515 Ga0495675_0385930
2516 Ga0495675_0690680
2517 Ga0495677_0093079
2518 Ga0495679_053039
2519 Ga0495685_146918
2520 Ga0495685_214289
2521 Ga0495673_0101389
2522 Ga0495673_0269757
2523 Ga0495684_0000088
2524 Ga0495684_0080694
2525 Ga0495684_0081455
2526 Ga0495684_0795093
2527 Ga0495686_0162846
2528 Ga0495686_0338382
2529 Ga0495686_0692071
2530 Ga0495686_0705406
2531 Ga0495593_0000167
2532 Ga0495593_0001656
2533 Ga0495593_0013615
2534 Ga0495602_0026534
2535 Ga0495602_0066783
2536 Ga0495614_0071945
2537 Ga0495615_0099555
2538 Ga0495615_0303237
2539 Ga0495626_0019316
2540 Ga0496100_0020948
2541 Ga0496100_0358106
2542 Ga0496100_0697736
2543 Ga0496100_0826750
2544 Ga0496101_0001657
2545 Ga0496102_0001372
2546 Ga0496102_0086703
2547 Ga0496102_0395918
2548 Ga0496102_0690313
2549 Ga0496102_0845271
2550 Ga0496102_1359266
2551 Ga0496102_1899293
2552 Ga0496103_0093885
2553 Ga0496103_0328941
2554 Ga0496103_0392970
2555 Ga0496103_0968469
2556 Ga0496104_0031068
2557 Ga0496104_0085123
2558 Ga0496104_0187032
2559 Ga0496104_0225068
2560 Ga0496104_0225312
2561 Ga0496104_0281079
2562 Ga0496104_0618069
2563 Ga0496104_0733998
2564 Ga0496105_0065252
2565 Ga0496105_0068753
2566 Ga0496105_0152431
2567 Ga0496105_0182313
2568 Ga0496105_0554994
2569 Ga0496106_0018200
2570 Ga0496106_0102432
2571 Ga0496106_0116553
2572 Ga0496106_0568920
2573 Ga0496106_1167057
2574 Ga0496107_0181393
2575 Ga0496107_0279700
2576 Ga0496107_0354743
2577 Ga0496108_0130931
2578 Ga0496108_0174724
2579 Ga0496108_0593451
2580 Ga0496109_0042846
2581 Ga0496109_0109721
2582 Ga0496109_0138611
2583 Ga0496109_0144493
2584 Ga0496109_0146203
2585 Ga0496110_0030095
2586 Ga0496110_0086342
2587 Ga0496110_0152116
2588 Ga0496110_0640483
2589 Ga0496110_1347820
2590 Ga0496111_0189945
2591 Ga0496111_0342815
2592 Ga0496112_0000004
2593 Ga0496112_0074028
2594 Ga0496112_0076941
2595 Ga0496112_0119142
2596 Ga0496112_0151225
2597 Ga0496112_0191316
2598 Ga0496112_0632604
2599 Ga0496112_1154598
2600 Ga0496112_1754946
2601 Ga0496112_1767522
2602 Ga0496112_1780548
2603 Ga0496113_0033282
2604 Ga0496113_0051955
2605 Ga0496113_0060663
2606 Ga0496113_0272102
2607 Ga0496113_1099883
2608 Ga0496113_1446804
2609 Ga0496114_0012013
2610 Ga0496114_0195591
2611 Ga0496114_0750081
2612 Ga0496114_1420270
2613 Ga0496114_1670612
2614 Ga0496115_0001007
2615 Ga0496115_0022258
2616 Ga0496115_0128395
2617 Ga0496115_1168140
2618 Ga0496116_0007069
2619 Ga0496117_0037823
2620 Ga0496117_0069135
2621 Ga0496117_0107461
2622 Ga0496117_0109295
2623 Ga0496117_0200975
2624 Ga0496117_0407123
2625 Ga0496118_0055848
2626 Ga0496118_0272019
2627 Ga0496118_0404229
2628 Ga0496118_0404807
2629 Ga0496119_0080662
2630 Ga0496119_0149386
2631 Ga0496119_0168481
2632 Ga0496120_0124831
2633 Ga0496120_0147930
2634 Ga0496121_0009175
2635 Ga0496121_0037086
2636 Ga0496121_0045611
2637 Ga0496121_0051419
2638 Ga0496121_0053882
2639 Ga0496121_0124024
2640 Ga0496121_0135276
2641 Ga0496121_0307834
2642 Ga0496121_0331468
2643 Ga0496121_0560093
2644 Ga0496121_0562016
2645 Ga0496121_0708177
2646 Ga0496122_0086715
2647 Ga0496122_0466420
2648 Ga0496123_0008569
2649 Ga0496123_0303488
2650 Ga0496123_0361620
2651 Ga0496124_0189890
2652 Ga0496124_0400335
2653 Ga0496124_0777099
2654 Ga0496125_0008508
2655 Ga0496125_0028742
2656 Ga0496125_0103686
2657 Ga0496125_0147849
2658 Ga0496125_0254530
2659 Ga0496125_0378682
2660 Ga0496125_0524605
2661 Ga0496126_0005960
2662 Ga0496126_0029531
2663 Ga0496126_0035465
2664 Ga0496126_0090130
2665 Ga0496126_0093235
2666 Ga0496126_0135189
2667 Ga0496126_0171278
2668 Ga0496126_0237766
2669 Ga0496126_0254613
2670 Ga0496126_0558077
2671 Ga0496126_0634908
2672 Ga0496126_0699162
2673 Ga0496126_0870795
2674 Ga0496126_0941713
2675 Ga0495678_150872
2676 Ga0495682_0027486
2677 Ga0501032_0222250
2678 Ga0501036_0287146
2679 Ga0501036_0765263
2680 Ga0501038_0590958
2681 Ga0501039_0590541
2682 Ga0501039_0974485
2683 Ga0501046_0053125
2684 Ga0501047_0089916
2685 Ga0501067_0013283
2686 Ga0501067_0037376
2687 Ga0501069_0428836
2688 Ga0501070_0015246
2689 Ga0501070_0640383
2690 Ga0501071_0118693
2691 Ga0501073_0120185
2692 Ga0501074_0021500
2693 Ga0501075_1248560
2694 Ga0501076_0421718
2695 Ga0501076_0567207
2696 Ga0501079_0495211
2697 Ga0501080_0012725
2698 Ga0501081_0265498
2699 Ga0501035_0608871
2700 Ga0501035_0962429
2701 Ga0501044_0096467
2702 Ga0501044_0932748
2703 Ga0501045_0408459
2704 nmdc:mga03683_320039_c1
2705 nmdc:mga03683_54863_c1
2706 nmdc:mga03683_85045_c1
2707 nmdc:mga03n38_395146_c1
2708 nmdc:mga03n38_4080_c1
2709 nmdc:mga03n38_541952_c1
2710 nmdc:mga03n38_845249_c1
2711 nmdc:mga00v17_45088_c1
2712 nmdc:mga00v17_7051_c1
2713 nmdc:mga0yw44_1110835_c1
2714 nmdc:mga0yw44_157307_c1
2715 nmdc:mga0yw44_158951_c1
2716 nmdc:mga0yw44_166314_c1
2717 nmdc:mga0yw44_17788_c1
2718 nmdc:mga0yw44_195162_c1
2719 nmdc:mga0yw44_72048_c2
2720 nmdc:mga0yw44_91276_c1
2721 nmdc:mga0k408_134733_c1
2722 nmdc:mga0k408_248065_c1
2723 nmdc:mga0k408_297527_c1
2724 nmdc:mga0k408_312697_c1
2725 nmdc:mga0k408_636663_c1
2726 nmdc:mga06z11_21966_c1
2727 nmdc:mga06z11_287219_c1
2728 nmdc:mga06z11_361779_c1
2729 nmdc:mga06z11_888605_c1
2730 nmdc:mga07m45_135429_c1
2731 nmdc:mga07m45_143059_c1
2732 nmdc:mga07m45_19607_c1
2733 nmdc:mga07m45_32975_c1
2734 nmdc:mga05p37_1355167_c1
2735 nmdc:mga09592_1370420_c1
2736 nmdc:mga08y16_217475_c1
2737 nmdc:mga0n895_1968156_c1
2738 nmdc:mga0n895_237094_c1
2739 nmdc:mga0rr50_1191032_c1
2740 nmdc:mga0rr50_775255_c1
2741 nmdc:mga0sz30_124512_c1
2742 nmdc:mga0sz30_233982_c1
2743 nmdc:mga0sz30_290925_c1
2744 nmdc:mga0sz30_390963_c1
2745 nmdc:mga0sz30_39865_c2
2746 nmdc:mga0sz30_47846_c1
2747 nmdc:mga0sz30_53267_c1
2748 Ga0495601_0010740
2749 Ga0495601_0091703
2750 Ga0495601_0396101
2751 Ga0495612_0061234
2752 Ga0500635_0280110
2753 Ga0495655_0009352
2754 Ga0495655_0152781
2755 Ga0495595_0001173
2756 Ga0495595_0043673
2757 Ga0495619_0000166
2758 Ga0495619_0143286
2759 Ga0495619_0178718
2760 Ga0500578_0027306
2761 Ga0500643_026377
2762 Ga0500644_0255062
2763 Ga0500581_281372
2764 Ga0500647_0075122
2765 Ga0500583_0122818
2766 Ga0500583_0469818
2767 Ga0500651_0008263
2768 Ga0500651_0066009
2769 Ga0500651_0244813
2770 Ga0500651_0579270
2771 Ga0500566_0000141
2772 Ga0500566_0005775
2773 Ga0500566_0011586
2774 Ga0500640_001964
2775 Ga0500641_0003020
2776 Ga0500641_0080028
2777 Ga0500641_0091282
2778 Ga0500650_0000214
2779 Ga0500554_023213
2780 Ga0500554_190777
2781 Ga0500555_062156
2782 Ga0500555_114344
2783 Ga0500556_0000125
2784 Ga0500562_046570
2785 Ga0500562_132466
2786 Ga0500569_024008
2787 Ga0500572_000838
2788 Ga0500572_025471
2789 Ga0500582_232081
2790 Ga0500591_078821
2791 Ga0500592_005168
2792 Ga0500592_055654
2793 Ga0500594_0023056
2794 Ga0500594_0061340
2795 Ga0500595_000454
2796 Ga0500595_000732
2797 Ga0500595_002046
2798 Ga0500595_003733
2799 Ga0500608_038718
2800 Ga0500614_001145
2801 Ga0500618_086119
2802 Ga0500642_0000194
2803 Ga0500642_0163218
2804 Ga0500652_000210
2805 Ga0500658_0172865
2806 Ga0500658_0210314
2807 Ga0500559_0000205
2808 Ga0500559_0001193
2809 Ga0500559_0002865
2810 Ga0500559_0135640
2811 Ga0500559_0146810
2812 Ga0500561_0054778
2813 Ga0500564_141665
2814 Ga0500568_0000356
2815 Ga0500568_0060570
2816 Ga0500577_0276395
2817 Ga0500586_006207
2818 Ga0500588_0065159
2819 Ga0500588_0258580
2820 Ga0500589_086443
2821 Ga0500590_009317
2822 Ga0500590_106918
2823 Ga0500603_000116
2824 Ga0500603_000516
2825 Ga0500603_015553
2826 Ga0500604_0002009
2827 Ga0500604_0033973
2828 Ga0500616_0000895
2829 Ga0500619_056453
2830 Ga0500622_0002020
2831 Ga0500622_0122533
2832 Ga0500622_0403747
2833 Ga0500627_0434329
2834 Ga0500627_0490814
2835 Ga0500630_000171
2836 Ga0500634_0016561
2837 Ga0500634_0046954
2838 Ga0500634_0052315
2839 Ga0500634_0054026
2840 Ga0500634_0074594
2841 Ga0500638_125365
2842 Ga0500639_000004
2843 Ga0500636_0008650
2844 Ga0500636_0125138
2845 Ga0500636_0141505
2846 Ga0500637_0000106
2847 Ga0500637_0070515
2848 Ga0500576_115956
2849 Ga0500576_253826
2850 Ga0500611_006304
2851 Ga0500611_255366
2852 Ga0500645_089457
2853 Ga0500645_149099
2854 Ga0500609_063377
2855 Ga0500596_001998
2856 Ga0500596_002653
2857 Ga0500596_015421
2858 Ga0500601_051010
2859 Ga0530510_0772094
2860 2513889418

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05437

AzlD

Branched-chain amino acid transport protein (AzlD)

15

114

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ddw-assembly1.cif.gz_B crystal structure of pyridoxal kinase from the escherichia coli pdxk gene complexed with pyridoxal at 3.2 a resolution 0.3936 76 111
5gar-assembly1.cif.gz_Q thermus thermophilus v/a-atpase, conformation 1 0.2897 35 109
5gar-assembly1.cif.gz_Q thermus thermophilus v/a-atpase, conformation 1 0.2509 35 109
2ddw-assembly1.cif.gz_B crystal structure of pyridoxal kinase from the escherichia coli pdxk gene complexed with pyridoxal at 3.2 a resolution 0.1925 76 111
ID Description Score Start End Superfamily
af_Q2FVZ5_368_530_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.3672 46 105 1.20.1640.10
af_I1LXA6_126_219_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.3639 45 107 1.20.1280.290
af_Q6IQT9_24_127_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.3567 43 110 1.10.10.1740
af_Q6YZF3_132_221_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.3539 43 112 1.20.1280.290
af_Q03602_623_820_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.3526 34 105 1.20.1640.10
ID Description Score Start End GO Terms
AF-A0A7S8C1H4-F1-model_v4 AzlD domain-containing protein 0.8989 11 114 GO:0016020
AF-A0A037UV88-F1-model_v4 deleted 0.8798 18 113
AF-A0A2H6BDB5-F1-model_v4 Branched-chain amino acid transport 0.8734 6 114 GO:0016020
AF-A0A0P6VGG6-F1-model_v4 Branched-chain amino acid transport 0.8694 6 114 GO:0016020
AF-A0A211ZSV1-F1-model_v4 Branched-chain amino acid transport 0.8687 9 112 GO:0016020

Map