metagRoot

F493899

General Info

Members	Datasets	Scaffolds	Average Seq Length
1430	560	1324	429

Family's Representative Sequence

Representative Sequence	3300037471\|Ga0395905_0006102\|Ga0395905_0006102_1701_3239
Length	512
Sequence	MSQTGLLTGIKQSFQVSQGGRDLSCTSRRRCAYCTENICIFLSVKAMQEDSPTQNPSLSVFSMLSRSRADQELIMARIIGAIASSHTPTIGFALDTGKQQDPAWAPIFKAYEPVQQWLAEKKPDVLLMIYNDHVTSFFFDHYSAFALGIGQEWNVADEGGGARALPPVQGHPGLARHIGASLVADEFDMSFFQNKGLDHGCFSPLSILWAGNEQWPGAIVPLQCGVLQFPVPSARRCYKLGHALRRAIESYPEDLKVAIVATGGLSHQVHGERAGFNNTAWDQQFLDLIEKDPETIANMTQAELATLGGFEGAEVIMWLIMRGAMSSSIRCLHRDYYLPSMTGIAVAVYENTVEVPEAIAARAAAAQRAHIGHQLAGVGELAGTYPFTLETSVRAYRINSYLHQLVQPAFRERFLSNPDATFEEAGLTADERKLIAERDWRGMIHYGVIFFLLEKLGAVVGVSNLHIYAAMRGETLDEFRKTRNAPGALYSVAGQGSKDLAWNGEKRQVDSK

Samples

	Sample ID	Description	Type	Environment
1	2501025502	Paraburkholderia unamae MTI-641	Isolate	Rhizosphere
2	2508501071	Serratia proteamaculans S4	Isolate	Rhizosphere
3	2510917013	Paraburkholderia unamae MTI-641	Isolate	Rhizosphere
4	2511231006	Pseudomonas sp. GM17	Isolate	Nodule
5	2511231008	Pseudomonas sp. GM21	Isolate	Nodule
6	2511231012	Pseudomonas sp. GM33	Isolate	Nodule
7	2511231021	Pseudomonas sp. GM78	Isolate	Nodule
8	2511231022	Pseudomonas sp. GM79	Isolate	Nodule
9	2511231023	Pseudomonas sp. GM80	Isolate	Nodule
10	2511231025	Pantoea sp. YR343	Isolate	Rhizosphere
11	2511231031	Pseudomonas sp. GM16	Isolate	Nodule
12	2511231035	Pantoea sp. GM01	Isolate	Rhizosphere
13	2513237165	Cupriavidus neocaledonicus STM6070	Isolate	Nodule
14	2515154123	Trinickia symbiotica JPY347	Isolate	Nodule
15	2515154189	Paraburkholderia nodosa DSM 21604	Isolate	Unclassified
16	2582581293	Caulobacter henricii YR570	Isolate	Rhizosphere
17	2599185169	Klebsiella quasipneumoniae NFPP35	Isolate	Rhizoplane
18	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
19	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
20	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
21	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
22	2600255254	Klebsiella quasipneumoniae NFIX15	Isolate	Rhizoplane
23	2600255255	Klebsiella quasipneumoniae NFIX23	Isolate	Rhizoplane
24	2600255280	Klebsiella quasipneumoniae NFIX42	Isolate	Rhizoplane
25	2600255281	Klebsiella quasipneumoniae NFIX43	Isolate	Rhizoplane
26	2600255288	Klebsiella quasipneumoniae NFIX14	Isolate	Rhizoplane
27	2600255289	Klebsiella quasipneumoniae NFIX16	Isolate	Rhizoplane
28	2600255290	Klebsiella quasipneumoniae NFIX17	Isolate	Rhizoplane
29	2600255300	Klebsiella quasipneumoniae NFIX30	Isolate	Rhizoplane
30	2600255301	Klebsiella quasipneumoniae NFIX33	Isolate	Rhizoplane
31	2600255302	Klebsiella quasipneumoniae NFIX35	Isolate	Rhizoplane
32	2600255304	Klebsiella quasipneumoniae NFIX37	Isolate	Rhizoplane
33	2600255305	Klebsiella quasipneumoniae NFIX41	Isolate	Rhizoplane
34	2600255306	Klebsiella quasipneumoniae NFIX44	Isolate	Rhizoplane
35	2600255307	Klebsiella quasipneumoniae NFIX56	Isolate	Rhizoplane
36	2600255309	Klebsiella sp. NFIX53	Isolate	Rhizoplane
37	2600255392	Klebsiella quasipneumoniae NFIX54	Isolate	Rhizoplane
38	2602042103	Klebsiella quasipneumoniae NFIX29	Isolate	Rhizoplane
39	2602042104	Klebsiella quasipneumoniae NFIX26	Isolate	Rhizoplane
40	2602042105	Klebsiella quasipneumoniae NFIX25	Isolate	Rhizoplane
41	2602042106	Klebsiella quasipneumoniae NFIX13	Isolate	Rhizoplane
42	2602042110	Klebsiella quasipneumoniae NFIX40	Isolate	Rhizoplane
43	2603880178	Klebsiella quasipneumoniae NFIX34	Isolate	Rhizoplane
44	2603880202	Klebsiella quasipneumoniae NFIX38	Isolate	Rhizoplane
45	2603880211	Klebsiella quasipneumoniae NFIX24	Isolate	Rhizoplane
46	2636415599	Klebsiella variicola DX120E	Isolate	Unclassified
47	2643221565	Pseudomonas sp. Root562	Isolate	Unclassified
48	2643221644	Rhizobacter sp. Root1221	Isolate	Unclassified
49	2643221658	Variovorax sp. Root411	Isolate	Unclassified
50	2667528173	Rahnella sp. NFIX50	Isolate	Rhizoplane
51	2675903046	Klebsiella quasipneumoniae NFIX52	Isolate	Rhizoplane
52	2738541277	Variovorax sp. GV051	Isolate	Unclassified
53	2738541297	Duganella sp. GV083	Isolate	Unclassified
54	2738541307	Variovorax sp. GV008	Isolate	Unclassified
55	2738541357	Duganella sp. GV053	Isolate	Unclassified
56	2738543003	Duganella sp. GV066	Isolate	Unclassified
57	2738543012	Acidovorax sp. CF301	Isolate	Unclassified
58	2738543013	Variovorax sp. BT01	Isolate	Unclassified
59	2738543019	Variovorax sp. GV040	Isolate	Unclassified
60	2738543026	Duganella sp. GV089	Isolate	Unclassified
61	2738543029	Duganella sp. GV039	Isolate	Unclassified
62	2765235838	Herbaspirillum robiniae AA6	Isolate	Unclassified
63	2775507074	Klebsiella sp. D5A	Isolate	Unclassified
64	2806310673	Serratia quinivorans NCTC 13189	Isolate	Rhizosphere
65	2831265667	Variovorax guangxiensis DSM 27352	Isolate	Rhizosphere
66	2839094727	Herbaspirillum robiniae HZ10	Isolate	Nodule
67	2842711865	Duganella sp. R-73148	Isolate	Unclassified
68	2856287931	Paraburkholderia bannensis BE22	Isolate	Rhizosphere
69	2857357740	Paraburkholderia tropica BE15	Isolate	Rhizosphere
70	2857553236	Duganella sp. R-74557	Isolate	Unclassified
71	2857564685	Duganella sp. R-74599	Isolate	Unclassified
72	2876601092	Pantoea endophytica 596	Isolate	Unclassified
73	2883087390	Paraburkholderia guartelaensis CNPSo 3008	Isolate	Unclassified
74	2884086401	Kluyvera sp. PO2S7	Isolate	Rhizosphere
75	2885198086	Variovorax sp. 679	Isolate	Unclassified
76	2885211737	Variovorax sp. 553	Isolate	Unclassified
77	2885266251	Ralstonia sp. SET104	Isolate	Nodule
78	2888373701	Serratia rhizosphaerae KUDC3025	Isolate	Rhizosphere
79	2897803580	Azospirillum doebereinerae GSF71	Isolate	Unclassified
80	2904439833	Herbaspirillum sp. 1589	Isolate	Rhizosphere
81	2904474040	Rahnella aquatilis 4485	Isolate	Rhizosphere
82	2904504865	Serratia marcescens 1822	Isolate	Unclassified
83	2904513164	Klebsiella variicola 1431	Isolate	Rhizosphere
84	2904530477	Herbaspirillum huttiense 611	Isolate	Unclassified
85	2904584206	Herbaspirillum sp. 1050	Isolate	Unclassified
86	2904589729	Herbaspirillum sp. 1130	Isolate	Unclassified
87	2904601388	Herbaspirillum sp. 1273	Isolate	Rhizosphere
88	2919046199	Herbaspirillum frisingense 596	Isolate	Unclassified
89	2919079590	Herbaspirillum sp. 1173	Isolate	Unclassified
90	2919150387	Rahnella aceris 1817	Isolate	Unclassified
91	2927143783	Rahnella sp. 2050	Isolate	Unclassified
92	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
93	2928084124	Variovorax paradoxus 1218	Isolate	Unclassified
94	2945909444	Variovorax sp. CRF3-Va-1 W1I1	Isolate	Rhizosphere
95	2945945610	Variovorax paradoxus W1I18	Isolate	Rhizosphere
96	2945984333	Variovorax sp. W2I14	Isolate	Rhizosphere
97	2969079654	Klebsiella variicola E57-7	Isolate	Unclassified
98	2984559226	Klebsiella variicola SORGH_AS834	Isolate	Aerial Root
99	2984595703	Klebsiella variicola SORGH_AS1070	Isolate	Aerial Root
100	3007619802	Pseudomonas sp. PB120	Isolate	Unclassified
101	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
102	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
103	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
104	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
105	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
106	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
107	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
108	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
109	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
110	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
111	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
112	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
113	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
114	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
115	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
116	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
117	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
118	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
119	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
120	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
121	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
122	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
123	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
124	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
125	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
126	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
127	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
128	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
129	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
130	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
131	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
132	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
133	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
134	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
135	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
136	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
137	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
138	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
139	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
140	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
141	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
142	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
143	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
144	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
145	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
146	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
147	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
148	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
149	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
150	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
151	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
152	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
153	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
154	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
155	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
156	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
157	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
158	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
159	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
160	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
161	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
162	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
163	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
164	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
165	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
166	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
167	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
168	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
169	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
170	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
171	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
172	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
173	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
174	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
175	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
176	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
177	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
178	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
179	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
180	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
181	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
182	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
183	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
184	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
185	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
186	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
187	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
188	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
189	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
190	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
191	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
192	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
193	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
194	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
195	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
196	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
197	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
198	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
199	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
200	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
201	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
202	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
203	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
204	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
205	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
206	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
207	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
208	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
209	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
210	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
211	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
212	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
213	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
214	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
215	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
216	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
217	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
218	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
219	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
220	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
221	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
222	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
223	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
224	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
225	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
226	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
227	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
228	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
229	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
230	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
231	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
232	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
233	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
234	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
235	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
236	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
237	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
238	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
239	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
240	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
241	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
242	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
243	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
244	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
245	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
246	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
247	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
248	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
249	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
250	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
251	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
252	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
253	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
254	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
255	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
256	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
257	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
258	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
259	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
260	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
261	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
262	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
263	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
264	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
265	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
266	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
267	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
268	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
269	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
270	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
271	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
272	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
273	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
274	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
275	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
276	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
277	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
278	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
279	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
280	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
281	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
282	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
283	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
284	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
285	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
286	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
287	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
288	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
289	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
290	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
291	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
292	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
293	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
294	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
295	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
296	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
297	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
298	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
299	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
300	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
301	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
302	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
303	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
304	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
305	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
306	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
307	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
308	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
309	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
310	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
311	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
312	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
313	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
314	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
315	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
316	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
317	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
318	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
319	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
320	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
321	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
322	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
323	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
324	3300027424	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
325	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
326	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
327	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
328	3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
329	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
330	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
331	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
332	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
333	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
334	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
335	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
336	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
337	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
338	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
339	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
340	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
341	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
342	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
343	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
344	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
345	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
346	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
347	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
348	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
349	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
350	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
351	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
352	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
353	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
354	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
355	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
356	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
357	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
358	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
359	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
360	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
361	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
362	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
363	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
364	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
365	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
366	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
367	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
368	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
369	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
370	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
371	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
372	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
373	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
374	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
375	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
376	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
377	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
378	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
379	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
380	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
381	3300042137	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519	Metagenome	Rhizosphere
382	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
383	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
384	3300044672	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E	Metagenome	Unclassified
385	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
386	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
387	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
388	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
389	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
390	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
391	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
392	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
393	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
394	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
395	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
396	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
397	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
398	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
399	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
400	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
401	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
402	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
403	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
404	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
405	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
406	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
407	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
408	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
409	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
410	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
411	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
412	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
413	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
414	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
415	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
416	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
417	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
418	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
419	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
420	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
421	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
422	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
423	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
424	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
425	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
426	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
427	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
428	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
429	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
430	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
431	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
432	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
433	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
434	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
435	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
436	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
437	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
438	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
439	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
440	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
441	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
442	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
443	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
444	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
445	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
446	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
447	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
448	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
449	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
450	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
451	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
452	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
453	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
454	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
455	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
456	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
457	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
458	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
459	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
460	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
461	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
462	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
463	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
464	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
465	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
466	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
467	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
468	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
469	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
470	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
471	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
472	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
473	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
474	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
475	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
476	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
477	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
478	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
479	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
480	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
481	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
482	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
483	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
484	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
485	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
486	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
487	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
488	3300048986	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E	Metagenome	Unclassified
489	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
490	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
491	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
492	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
493	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
494	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
495	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
496	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
497	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
498	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
499	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
500	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
501	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
502	3300049706	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control	Metagenome	Rhizosphere
503	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
504	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
505	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
506	3300049759	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought	Metagenome	Rhizosphere
507	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
508	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
509	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
510	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
511	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
512	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
513	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
514	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
515	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
516	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
517	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
518	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
519	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
520	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
521	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
522	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
523	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
524	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
525	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
526	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
527	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
528	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
529	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
530	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
531	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
532	3300053110	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere	Metagenome	Endosphere
533	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
534	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
535	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
536	3300053120	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere	Metagenome	Endosphere
537	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
538	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
539	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
540	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
541	3300053126	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere	Metagenome	Endosphere
542	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
543	3300053135	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere	Metagenome	Endosphere
544	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
545	3300053145	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere	Metagenome	Endosphere
546	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
547	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
548	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
549	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
550	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
551	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
552	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
553	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
554	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
555	640753048	Serratia proteamaculans 568	Isolate	Endosphere
556	8016733728	Pantoea sp. SORGH_AS 659	Isolate	Unclassified
557	8019499862	Kluyvera sp. 1366	Isolate	Rhizosphere
558	8047673197	Telluria mixta LMG 11547	Isolate	Rhizosphere
559	8055878733	Pseudomonas palmensis BBB001	Isolate	Rhizosphere
560	8056177738	Pseudomonas azerbaijanoccidentalis SWRI74	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	92.59
Metatranscriptomes	0
Isolates	7.41

Biome Distribution

Category	Percentage (%)
Aerial Root	0.14
Bulb	0
Endosphere	11.89
Nodule	1.33
Rhizoplane	3.78
Rhizosphere	73.92
Stem	0
Stem Tuber	0
Unclassified	8.95

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25162J39368_1000478	3300002737	Bacteria	30707
2	JGI25163J39215_1000393	3300002771	Bacteria	13900
3	JGI25164J39214_1000325	3300002772	Bacteria	30707
4	JGI25152J39213_1000240	3300002773	Bacteria	36681
5	JGI25150J39212_1000170	3300002774	Bacteria	36653
6	JGI25151J46595_10000109	3300003187	Bacteria	112044
7	JGI25151J46595_10000545	3300003187	Bacteria	34695
8	JGI25151J46595_10000577	3300003187	Bacteria	32678
9	JGI25151J46595_10003021	3300003187	Bacteria	9562
10	JGI25151J46595_10023724	3300003187	Bacteria	2521
11	JGI25153J46596_10000084	3300003215	Bacteria	112044
12	JGI25153J46596_10002993	3300003215	Bacteria	9562
13	Ga0055538_1000235	3300003751	Bacteria	30707
14	Ga0055539_1000270	3300003752	Bacteria	30707
15	Ga0055533_1000261	3300003756	Bacteria	30707
16	Ga0055532_1000314	3300003758	Bacteria	29382
17	Ga0055525_1000362	3300003759	Bacteria	30707
18	Ga0055527_1000055	3300003760	Bacteria	97952
19	Ga0055535_1000047	3300003761	Bacteria	139836
20	Ga0055535_1000083	3300003761	Bacteria	104680
21	Ga0055529_1000193	3300003763	Bacteria	83459
22	Ga0055526_1000029	3300003771	Bacteria	148855
23	Ga0055526_1000336	3300003771	Bacteria	38625
24	Ga0055526_1004371	3300003771	Bacteria	8524
25	Ga0055537_1006490	3300003773	Bacteria	2957
26	Ga0055524_1001147	3300003775	Bacteria	15953
27	Ga0055524_1004746	3300003775	Bacteria	6215
28	Ga0055534_1000341	3300003784	Bacteria	30179
29	Ga0055534_1000777	3300003784	Bacteria	14972
30	Ga0055534_1000858	3300003784	Bacteria	13928
31	Ga0055534_1001653	3300003784	Bacteria	8599
32	Ga0055530_10000311	3300003791	Bacteria	44214
33	Ga0055540_1000016	3300003792	Bacteria	232942
34	Ga0055541_1000170	3300003841	Bacteria	30707
35	Ga0065165_1000864	3300005262	Bacteria	39604
36	Ga0065165_1001101	3300005262	Bacteria	32096
37	Ga0065714_10090107	3300005288	Bacteria	1943
38	Ga0065704_10001152	3300005289	Bacteria	12328
39	Ga0065712_10003084	3300005290	Bacteria	6362
40	Ga0070658_10001821	3300005327	Bacteria	17931
41	Ga0070658_10037808	3300005327	Bacteria	3892
42	Ga0070658_10246183	3300005327	Bacteria	1516
43	Ga0070676_10024965	3300005328	Bacteria	3373
44	Ga0070690_100000582	3300005330	Bacteria	18394
45	Ga0070690_100016117	3300005330	Bacteria	4471
46	Ga0070690_100017995	3300005330	Bacteria	4261
47	Ga0070690_100155360	3300005330	Bacteria	1564
48	Ga0070670_100000908	3300005331	Bacteria	23303
49	Ga0070670_100002568	3300005331	Bacteria	15005
50	Ga0070670_100005621	3300005331	Bacteria	10577
51	Ga0070670_100018510	3300005331	Bacteria	5976
52	Ga0070670_100080798	3300005331	Bacteria	2794
53	Ga0070677_10041730	3300005333	Bacteria	1813
54	Ga0070677_10056831	3300005333	Bacteria	1602
55	Ga0068869_100000152	3300005334	Bacteria	34316
56	Ga0068869_100004158	3300005334	Bacteria	8979
57	Ga0070666_10001894	3300005335	Bacteria	12731
58	Ga0070666_10006463	3300005335	Bacteria	7206
59	Ga0070666_10018832	3300005335	Bacteria	4447
60	Ga0070666_10117540	3300005335	Bacteria	1842
61	Ga0070680_100011969	3300005336	Bacteria	6732
62	Ga0068868_100006003	3300005338	Bacteria	8577
63	Ga0068868_100007388	3300005338	Bacteria	7826
64	Ga0068868_100016726	3300005338	Bacteria	5454
65	Ga0068868_100044836	3300005338	Bacteria	3458
66	Ga0070660_100004251	3300005339	Bacteria	9883
67	Ga0070660_100064750	3300005339	Bacteria	2844
68	Ga0070689_100007130	3300005340	Bacteria	7791
69	Ga0070689_100065581	3300005340	Bacteria	2828
70	Ga0070689_100145098	3300005340	Bacteria	1911
71	Ga0070661_100008324	3300005344	Bacteria	7165
72	Ga0070661_100014865	3300005344	Bacteria	5491
73	Ga0070668_100003108	3300005347	Bacteria	12256
74	Ga0070668_100005618	3300005347	Bacteria	9297
75	Ga0070668_100016173	3300005347	Bacteria	5581
76	Ga0070668_100056880	3300005347	Bacteria	3021
77	Ga0070669_100004064	3300005353	Bacteria	10590
78	Ga0070669_100011061	3300005353	Bacteria	6404
79	Ga0070669_100090041	3300005353	Bacteria	2299
80	Ga0070675_100003706	3300005354	Bacteria	11613
81	Ga0070675_100015089	3300005354	Bacteria	6101
82	Ga0070675_100022106	3300005354	Bacteria	5082
83	Ga0070675_100024237	3300005354	Bacteria	4859
84	Ga0070675_100029569	3300005354	Bacteria	4420
85	Ga0070675_100033225	3300005354	Bacteria	4181
86	Ga0070675_100142998	3300005354	Bacteria	2046
87	Ga0070671_100001263	3300005355	Bacteria	18957
88	Ga0070671_100010636	3300005355	Bacteria	7384
89	Ga0070671_100012077	3300005355	Bacteria	6948
90	Ga0070671_100025426	3300005355	Bacteria	4858
91	Ga0070671_100056568	3300005355	Bacteria	3263
92	Ga0070674_100029162	3300005356	Bacteria	3631
93	Ga0070673_100002395	3300005364	Bacteria	11416
94	Ga0070673_100002894	3300005364	Bacteria	10567
95	Ga0070673_100021127	3300005364	Bacteria	4711
96	Ga0070673_100058066	3300005364	Bacteria	3058
97	Ga0070659_100007556	3300005366	Bacteria	7899
98	Ga0070667_100000813	3300005367	Bacteria	29150
99	Ga0070667_100011654	3300005367	Bacteria	7269
100	Ga0070667_100089163	3300005367	Bacteria	2649
101	Ga0070709_10066415	3300005434	Bacteria	2313
102	Ga0070714_100003478	3300005435	Bacteria	11752
103	Ga0070713_100012223	3300005436	Bacteria	6289
104	Ga0070700_100016149	3300005441	Bacteria	4248
105	Ga0070700_100129467	3300005441	Bacteria	1701
106	Ga0070694_100148703	3300005444	Bacteria	1708
107	Ga0070708_100008063	3300005445	Bacteria	8442
108	Ga0070663_100078397	3300005455	Bacteria	2421
109	Ga0070678_100054923	3300005456	Bacteria	2905
110	Ga0070678_100134420	3300005456	Bacteria	1970
111	Ga0070662_100000546	3300005457	Bacteria	22896
112	Ga0070662_100010589	3300005457	Bacteria	6060
113	Ga0070662_100134504	3300005457	Bacteria	1910
114	Ga0070681_10150106	3300005458	Bacteria	2257
115	Ga0068867_100059777	3300005459	Bacteria	2825
116	Ga0068867_100070184	3300005459	Bacteria	2618
117	Ga0068867_100116158	3300005459	Bacteria	2062
118	Ga0070685_10050527	3300005466	Bacteria	2402
119	Ga0070706_100003229	3300005467	Bacteria	16104
120	Ga0070707_100023650	3300005468	Bacteria	5812
121	Ga0070698_100053957	3300005471	Bacteria	4083
122	Ga0070699_100006702	3300005518	Bacteria	10015
123	Ga0070679_100012454	3300005530	Bacteria	8128
124	Ga0070679_100143207	3300005530	Bacteria	2369
125	Ga0070679_100168645	3300005530	Bacteria	2162
126	Ga0070684_100077822	3300005535	Bacteria	2930
127	Ga0070697_100031579	3300005536	Bacteria	4261
128	Ga0068853_100022170	3300005539	Bacteria	5301
129	Ga0068853_100142387	3300005539	Bacteria	2153
130	Ga0068853_100184548	3300005539	Bacteria	1893
131	Ga0070672_100010424	3300005543	Bacteria	6449
132	Ga0070672_100047779	3300005543	Bacteria	3322
133	Ga0070672_100059394	3300005543	Bacteria	3008
134	Ga0070672_100082070	3300005543	Bacteria	2586
135	Ga0070672_100105229	3300005543	Bacteria	2294
136	Ga0070672_100218789	3300005543	Bacteria	1597
137	Ga0070686_100098217	3300005544	Bacteria	1973
138	Ga0070665_100017168	3300005548	Bacteria	7262
139	Ga0070704_100032938	3300005549	Bacteria	3500
140	Ga0070704_100122960	3300005549	Bacteria	1997
141	Ga0068855_100001533	3300005563	Bacteria	29006
142	Ga0068855_100006069	3300005563	Bacteria	14730
143	Ga0068855_100010543	3300005563	Bacteria	11146
144	Ga0068855_100020137	3300005563	Bacteria	8011
145	Ga0068855_100031660	3300005563	Bacteria	6315
146	Ga0068855_100066866	3300005563	Bacteria	4189
147	Ga0068855_100164637	3300005563	Bacteria	2515
148	Ga0070664_100001174	3300005564	Bacteria	20828
149	Ga0070664_100001978	3300005564	Bacteria	16414
150	Ga0070664_100014017	3300005564	Bacteria	6538
151	Ga0070664_100015701	3300005564	Bacteria	6198
152	Ga0070664_100216785	3300005564	Bacteria	1711
153	Ga0068857_100014270	3300005577	Bacteria	6922
154	Ga0068854_100077382	3300005578	Bacteria	2448
155	Ga0068856_100000409	3300005614	Bacteria	47269
156	Ga0068856_100036467	3300005614	Bacteria	4821
157	Ga0068856_100106106	3300005614	Bacteria	2804
158	Ga0070702_100067851	3300005615	Bacteria	2097
159	Ga0068852_100003141	3300005616	Bacteria	11513
160	Ga0068852_100009549	3300005616	Bacteria	7208
161	Ga0068852_100063791	3300005616	Bacteria	3209
162	Ga0068852_100170539	3300005616	Bacteria	2039
163	Ga0068859_100000697	3300005617	Bacteria	33649
164	Ga0068859_100019898	3300005617	Bacteria	6738
165	Ga0068859_100023535	3300005617	Bacteria	6181
166	Ga0068859_100041445	3300005617	Bacteria	4624
167	Ga0068864_100000610	3300005618	Bacteria	30198
168	Ga0068864_100001811	3300005618	Bacteria	17534
169	Ga0068864_100003181	3300005618	Bacteria	13574
170	Ga0068864_100008666	3300005618	Bacteria	8391
171	Ga0068864_100082541	3300005618	Bacteria	2820
172	Ga0068864_100083661	3300005618	Bacteria	2803
173	Ga0068864_100173034	3300005618	Bacteria	1970
174	Ga0068861_100001626	3300005719	Bacteria	14332
175	Ga0068851_10046128	3300005834	Bacteria	2204
176	Ga0068851_10047877	3300005834	Bacteria	2166
177	Ga0068851_10080112	3300005834	Bacteria	1704
178	Ga0068870_10003062	3300005840	Bacteria	7047
179	Ga0068870_10006663	3300005840	Bacteria	5105
180	Ga0068863_100000894	3300005841	Bacteria	30053
181	Ga0068863_100029681	3300005841	Bacteria	5220
182	Ga0068863_100047003	3300005841	Bacteria	4096
183	Ga0068863_100094355	3300005841	Bacteria	2840
184	Ga0068858_100038510	3300005842	Bacteria	4435
185	Ga0068858_100054907	3300005842	Bacteria	3683
186	Ga0068858_100078123	3300005842	Bacteria	3075
187	Ga0068860_100002661	3300005843	Bacteria	18597
188	Ga0068860_100018313	3300005843	Bacteria	6814
189	Ga0068860_100157398	3300005843	Bacteria	2190
190	Ga0068862_100001435	3300005844	Bacteria	22006
191	Ga0068862_100003593	3300005844	Bacteria	13276
192	Ga0068862_100012376	3300005844	Bacteria	7054
193	Ga0068862_100030834	3300005844	Bacteria	4520
194	Ga0068862_100086224	3300005844	Bacteria	2729
195	Ga0075365_10001917	3300006038	Bacteria	9807
196	Ga0075363_100004230	3300006048	Bacteria	6237
197	Ga0075364_10058324	3300006051	Bacteria	2530
198	Ga0075364_10086189	3300006051	Bacteria	2080
199	Ga0075364_10164813	3300006051	Bacteria	1497
200	Ga0075432_10000250	3300006058	Bacteria	14598
201	Ga0075432_10003230	3300006058	Bacteria	5497
202	Ga0075362_10006104	3300006177	Bacteria	4465
203	Ga0075362_10022301	3300006177	Bacteria	2667
204	Ga0075362_10054484	3300006177	Bacteria	1797
205	Ga0075366_10002623	3300006195	Bacteria	9249
206	Ga0075366_10017464	3300006195	Bacteria	4129
207	Ga0075366_10027525	3300006195	Bacteria	3335
208	Ga0097621_100001636	3300006237	Bacteria	15349
209	Ga0097621_100033043	3300006237	Bacteria	4117
210	Ga0097621_100192502	3300006237	Bacteria	1767
211	Ga0075370_10003026	3300006353	Bacteria	7925
212	Ga0068871_100018685	3300006358	Bacteria	5277
213	Ga0068871_100020437	3300006358	Bacteria	5073
214	Ga0068871_100042747	3300006358	Bacteria	3639
215	Ga0075428_100010377	3300006844	Bacteria	10343
216	Ga0075428_100034006	3300006844	Bacteria	5623
217	Ga0075428_100167541	3300006844	Bacteria	2383
218	Ga0075428_100368748	3300006844	Bacteria	1540
219	Ga0075428_100379620	3300006844	Bacteria	1515
220	Ga0075430_100119123	3300006846	Bacteria	2200
221	Ga0075430_100156694	3300006846	Bacteria	1896
222	Ga0075431_100051549	3300006847	Bacteria	4243
223	Ga0075431_100082765	3300006847	Bacteria	3313
224	Ga0075434_100044153	3300006871	Bacteria	4422
225	Ga0075434_100212816	3300006871	Bacteria	1953
226	Ga0075429_100197686	3300006880	Bacteria	1761
227	Ga0075436_100021766	3300006914	Bacteria	4400
228	Ga0075436_100040861	3300006914	Bacteria	3200
229	Ga0097620_100000697	3300006931	Bacteria	33649
230	Ga0097620_100019898	3300006931	Bacteria	6738
231	Ga0097620_100023534	3300006931	Bacteria	6181
232	Ga0097620_100041444	3300006931	Bacteria	4624
233	Ga0099823_1000045	3300006944	Bacteria	60145
234	Ga0079104_1000198	3300006946	Bacteria	84522
235	Ga0079104_1000276	3300006946	Bacteria	66810
236	Ga0099826_10000011	3300006948	Bacteria	287659
237	Ga0105251_10000034	3300009011	Bacteria	118842
238	Ga0105251_10001981	3300009011	Bacteria	16716
239	Ga0105244_10000460	3300009036	Bacteria	37216
240	Ga0105244_10000879	3300009036	Bacteria	25421
241	Ga0105244_10002332	3300009036	Bacteria	14434
242	Ga0105244_10011482	3300009036	Bacteria	5306
243	Ga0105244_10017178	3300009036	Bacteria	4098
244	Ga0105250_10000051	3300009092	Bacteria	118156
245	Ga0105250_10000063	3300009092	Bacteria	101870
246	Ga0105250_10000073	3300009092	Bacteria	94051
247	Ga0105250_10006149	3300009092	Bacteria	5276
248	Ga0105250_10017275	3300009092	Bacteria	2934
249	Ga0105250_10027849	3300009092	Bacteria	2277
250	Ga0105240_10005568	3300009093	Bacteria	18724
251	Ga0105240_10018292	3300009093	Bacteria	9419
252	Ga0105240_10178519	3300009093	Bacteria	2508
253	Ga0105240_10186560	3300009093	Bacteria	2442
254	Ga0111539_10004431	3300009094	Bacteria	18347
255	Ga0111539_10007019	3300009094	Bacteria	14450
256	Ga0111539_10034297	3300009094	Bacteria	6156
257	Ga0111539_10073901	3300009094	Bacteria	4018
258	Ga0111539_10254536	3300009094	Bacteria	2045
259	Ga0111539_10431393	3300009094	Bacteria	1534
260	Ga0105245_10015387	3300009098	Bacteria	6669
261	Ga0105245_10382042	3300009098	Bacteria	1403
262	Ga0105247_10001278	3300009101	Bacteria	18574
263	Ga0105247_10006956	3300009101	Bacteria	6965
264	Ga0114129_10076380	3300009147	Bacteria	4664
265	Ga0114129_10117177	3300009147	Bacteria	3670
266	Ga0114129_10512887	3300009147	Bacteria	1564
267	Ga0105242_10016387	3300009176	Bacteria	5760
268	Ga0105248_10003189	3300009177	Bacteria	18180
269	Ga0105248_10021815	3300009177	Bacteria	7097
270	Ga0105248_10060967	3300009177	Bacteria	4235
271	Ga0105248_10119350	3300009177	Bacteria	2975
272	Ga0105237_10003670	3300009545	Bacteria	18091
273	Ga0105237_10006549	3300009545	Bacteria	12884
274	Ga0105237_10300450	3300009545	Bacteria	1608
275	Ga0105238_10005070	3300009551	Bacteria	13018
276	Ga0105238_10005281	3300009551	Bacteria	12773
277	Ga0105238_10012092	3300009551	Bacteria	8698
278	Ga0105249_10123365	3300009553	Unclassified	2464
279	Ga0105249_10202209	3300009553	Bacteria	1945
280	Ga0105249_10243253	3300009553	Bacteria	1780
281	Ga0105239_10023690	3300010375	Bacteria	6758
282	Ga0157373_10000137	3300013100	Bacteria	57817
283	Ga0157373_10002476	3300013100	Bacteria	14066
284	Ga0157373_10061881	3300013100	Bacteria	2651
285	Ga0157371_10000098	3300013102	Bacteria	134017
286	Ga0157371_10000810	3300013102	Bacteria	35896
287	Ga0157371_10001396	3300013102	Bacteria	25235
288	Ga0157370_10066413	3300013104	Bacteria	3411
289	Ga0157370_10071761	3300013104	Bacteria	3267
290	Ga0157369_10000908	3300013105	Bacteria	37806
291	Ga0157369_10015817	3300013105	Bacteria	8498
292	Ga0157369_10076302	3300013105	Bacteria	3592
293	Ga0157369_10171371	3300013105	Bacteria	2287
294	Ga0157374_10074958	3300013296	Bacteria	3197
295	Ga0157374_10084327	3300013296	Bacteria	3020
296	Ga0157374_10126992	3300013296	Bacteria	2465
297	Ga0157374_10164759	3300013296	Bacteria	2160
298	Ga0157378_10020681	3300013297	Bacteria	5788
299	Ga0157378_10122788	3300013297	Bacteria	2396
300	Ga0157378_10186247	3300013297	Bacteria	1955
301	Ga0163162_10000137	3300013306	Bacteria	66670
302	Ga0163162_10002499	3300013306	Bacteria	17379
303	Ga0163162_10110469	3300013306	Bacteria	2846
304	Ga0163162_10449607	3300013306	Bacteria	1420
305	Ga0157372_10001580	3300013307	Bacteria	24846
306	Ga0157372_10003163	3300013307	Bacteria	17748
307	Ga0157372_10073975	3300013307	Bacteria	3841
308	Ga0157372_10117836	3300013307	Bacteria	3046
309	Ga0157375_10015373	3300013308	Bacteria	6848
310	Ga0157375_10018429	3300013308	Bacteria	6331
311	Ga0157375_10050643	3300013308	Bacteria	4074
312	Ga0157375_10054155	3300013308	Bacteria	3950
313	Ga0157375_10171180	3300013308	Bacteria	2319
314	Ga0157375_10182735	3300013308	Bacteria	2249
315	Ga0157375_10238961	3300013308	Bacteria	1976
316	Ga0157375_10444390	3300013308	Bacteria	1462
317	Ga0163163_10006514	3300014325	Bacteria	10219
318	Ga0163163_10025084	3300014325	Bacteria	5680
319	Ga0163163_10028116	3300014325	Bacteria	5396
320	Ga0163163_10050974	3300014325	Bacteria	4079
321	Ga0163163_10163109	3300014325	Bacteria	2275
322	Ga0163163_10166800	3300014325	Bacteria	2248
323	Ga0157380_10000839	3300014326	Bacteria	19235
324	Ga0157380_10005948	3300014326	Bacteria	8538
325	Ga0157380_10349020	3300014326	Bacteria	1384
326	Ga0157379_10008008	3300014968	Bacteria	9167
327	Ga0157379_10008663	3300014968	Bacteria	8859
328	Ga0157379_10045070	3300014968	Bacteria	3937
329	Ga0157376_10007545	3300014969	Bacteria	7775
330	Ga0157376_10101313	3300014969	Bacteria	2517
331	Ga0157376_10192791	3300014969	Bacteria	1870
332	Ga0182006_1000802	3300015261	Bacteria	21095
333	Ga0182006_1002512	3300015261	Bacteria	9972
334	Ga0182006_1042024	3300015261	Bacteria	1792
335	Ga0182005_1001888	3300015265	Bacteria	7937
336	Ga0163161_10005416	3300017792	Bacteria	8860
337	Ga0163161_10006725	3300017792	Bacteria	7953
338	Ga0163161_10046297	3300017792	Bacteria	3138
339	Ga0163161_10169961	3300017792	Bacteria	1666
340	Ga0163161_10208328	3300017792	Bacteria	1509
341	Ga0213872_10000547	3300021361	Bacteria	29250
342	Ga0213872_10011103	3300021361	Bacteria	4269
343	Ga0209760_100073	3300025207	Bacteria	81377
344	Ga0209784_100001	3300025224	Bacteria	3600592
345	Ga0209566_100001	3300025225	Bacteria	3600765
346	Ga0209674_100002	3300025226	Bacteria	3600592
347	Ga0209672_100040	3300025228	Bacteria	278858
348	Ga0209147_100048	3300025229	Bacteria	278858
349	Ga0209563_100002	3300025230	Bacteria	2045675
350	Ga0209563_101267	3300025230	Bacteria	6915
351	Ga0207427_100032	3300025231	Bacteria	349939
352	Ga0209437_100001	3300025233	Bacteria	2045675
353	Ga0209258_100070	3300025242	Bacteria	278858
354	Ga0209258_100072	3300025242	Bacteria	274355
355	Ga0207425_1000290	3300025245	Bacteria	36693
356	Ga0207425_1001488	3300025245	Bacteria	9731
357	Ga0209677_100002	3300025253	Bacteria	2045675
358	Ga0209148_1000284	3300025254	Bacteria	77768
359	Ga0209759_1002338	3300025256	Bacteria	8493
360	Ga0209129_1000202	3300025258	Bacteria	72795
361	Ga0209129_1002187	3300025258	Bacteria	9834
362	Ga0209565_1000086	3300025263	Bacteria	152204
363	Ga0209455_1000053	3300025272	Bacteria	365949
364	Ga0209455_1000178	3300025272	Bacteria	104960
365	Ga0209673_1027486	3300025273	Bacteria	1849
366	Ga0209130_1001292	3300025284	Bacteria	17284
367	Ga0209130_1002441	3300025284	Bacteria	9309
368	Ga0209675_1000402	3300025291	Bacteria	35747
369	Ga0209675_1000510	3300025291	Bacteria	28831
370	Ga0209675_1001661	3300025291	Bacteria	12382
371	Ga0209675_1001682	3300025291	Bacteria	12287
372	Ga0209675_1001812	3300025291	Bacteria	11647
373	Ga0209675_1002042	3300025291	Bacteria	10779
374	Ga0209675_1007616	3300025291	Bacteria	4117
375	Ga0209676_1000004	3300025292	Bacteria	1138360
376	Ga0209676_1000172	3300025292	Bacteria	153664
377	Ga0209676_1002972	3300025292	Bacteria	11032
378	Ga0209676_1006353	3300025292	Bacteria	5856
379	Ga0209025_1000013	3300025294	Bacteria	871757
380	Ga0209025_1000059	3300025294	Bacteria	305480
381	Ga0209025_1000432	3300025294	Bacteria	82875
382	Ga0209025_1000550	3300025294	Bacteria	70073
383	Ga0209025_1005956	3300025294	Bacteria	9704
384	Ga0209025_1016904	3300025294	Bacteria	4256
385	Ga0209564_1000009	3300025295	Bacteria	950196
386	Ga0209564_1000814	3300025295	Bacteria	42501
387	Ga0209564_1002095	3300025295	Bacteria	17070
388	Ga0209758_1000014	3300025297	Bacteria	871757
389	Ga0209758_1004631	3300025297	Bacteria	11269
390	Ga0209050_1000002	3300025298	Bacteria	1792849
391	Ga0209050_1000082	3300025298	Bacteria	266864
392	Ga0209050_1000155	3300025298	Bacteria	159095
393	Ga0209050_1000509	3300025298	Bacteria	65792
394	Ga0209050_1004407	3300025298	Bacteria	9528
395	Ga0209256_1000045	3300025299	Bacteria	325506
396	Ga0209256_1000086	3300025299	Bacteria	218837
397	Ga0209256_1003909	3300025299	Bacteria	9850
398	Ga0207426_1000264	3300025302	Bacteria	110747
399	Ga0209051_1000002	3300025303	Bacteria	1631846
400	Ga0209051_1000029	3300025303	Bacteria	403675
401	Ga0209051_1000074	3300025303	Bacteria	208667
402	Ga0209051_1000096	3300025303	Bacteria	167399
403	Ga0209051_1004380	3300025303	Bacteria	8737
404	Ga0209051_1008091	3300025303	Bacteria	5624
405	Ga0209051_1014887	3300025303	Bacteria	3608
406	Ga0209257_1000002	3300025304	Bacteria	1767052
407	Ga0209257_1000030	3300025304	Bacteria	689812
408	Ga0209257_1000072	3300025304	Bacteria	332791
409	Ga0209257_1011021	3300025304	Bacteria	4436
410	Ga0209257_1014976	3300025304	Bacteria	3272
411	Ga0207656_10059155	3300025321	Bacteria	1676
412	Ga0207696_1000045	3300025711	Bacteria	296484
413	Ga0207696_1000062	3300025711	Bacteria	239603
414	Ga0207696_1000092	3300025711	Bacteria	185473
415	Ga0207696_1000148	3300025711	Bacteria	120559
416	Ga0207696_1000704	3300025711	Bacteria	22843
417	Ga0207696_1005296	3300025711	Bacteria	5369
418	Ga0207655_1000037	3300025728	Bacteria	354473
419	Ga0207655_1000077	3300025728	Bacteria	219418
420	Ga0207655_1000586	3300025728	Bacteria	44995
421	Ga0207655_1002032	3300025728	Bacteria	17099
422	Ga0207655_1047304	3300025728	Bacteria	1776
423	Ga0207713_1000030	3300025735	Bacteria	284027
424	Ga0207713_1000268	3300025735	Bacteria	64095
425	Ga0207713_1008648	3300025735	Bacteria	5828
426	Ga0207713_1008864	3300025735	Bacteria	5731
427	Ga0207713_1010821	3300025735	Bacteria	5015
428	Ga0207713_1015925	3300025735	Bacteria	3838
429	Ga0207682_10058797	3300025893	Bacteria	1605
430	Ga0207682_10069584	3300025893	Bacteria	1489
431	Ga0207710_10018994	3300025900	Bacteria	2930
432	Ga0207688_10062210	3300025901	Bacteria	2104
433	Ga0207699_10119174	3300025906	Bacteria	1704
434	Ga0207645_10000468	3300025907	Bacteria	33440
435	Ga0207645_10004586	3300025907	Bacteria	10186
436	Ga0207645_10016918	3300025907	Bacteria	4818
437	Ga0207643_10006014	3300025908	Bacteria	6486
438	Ga0207643_10015442	3300025908	Bacteria	4157
439	Ga0207643_10075807	3300025908	Bacteria	1942
440	Ga0207705_10005321	3300025909	Bacteria	9626
441	Ga0207705_10019376	3300025909	Bacteria	4865
442	Ga0207684_10003208	3300025910	Bacteria	16056
443	Ga0207707_10108878	3300025912	Bacteria	2422
444	Ga0207695_10012724	3300025913	Bacteria	10075
445	Ga0207695_10060070	3300025913	Bacteria	3938
446	Ga0207695_10155919	3300025913	Bacteria	2218
447	Ga0207671_10019667	3300025914	Bacteria	5158
448	Ga0207663_10037006	3300025916	Bacteria	2939
449	Ga0207660_10046395	3300025917	Bacteria	3066
450	Ga0207657_10001611	3300025919	Bacteria	24269
451	Ga0207657_10057506	3300025919	Bacteria	3351
452	Ga0207657_10145989	3300025919	Bacteria	1929
453	Ga0207649_10005495	3300025920	Bacteria	6859
454	Ga0207649_10041242	3300025920	Bacteria	2810
455	Ga0207652_10032527	3300025921	Bacteria	4386
456	Ga0207681_10004880	3300025923	Bacteria	8243
457	Ga0207681_10053201	3300025923	Bacteria	2748
458	Ga0207681_10061402	3300025923	Bacteria	2583
459	Ga0207681_10079199	3300025923	Bacteria	2314
460	Ga0207694_10082071	3300025924	Bacteria	2533
461	Ga0207659_10001686	3300025926	Bacteria	13110
462	Ga0207659_10002585	3300025926	Bacteria	10782
463	Ga0207659_10004217	3300025926	Bacteria	8684
464	Ga0207659_10010497	3300025926	Bacteria	5821
465	Ga0207659_10091312	3300025926	Bacteria	2275
466	Ga0207659_10119384	3300025926	Bacteria	2018
467	Ga0207687_10019909	3300025927	Bacteria	4450
468	Ga0207700_10057847	3300025928	Bacteria	2925
469	Ga0207664_10000845	3300025929	Bacteria	20762
470	Ga0207644_10013225	3300025931	Bacteria	5497
471	Ga0207644_10017104	3300025931	Bacteria	4890
472	Ga0207644_10114271	3300025931	Bacteria	2045
473	Ga0207690_10000957	3300025932	Bacteria	18474
474	Ga0207706_10000267	3300025933	Bacteria	56832
475	Ga0207706_10000373	3300025933	Bacteria	48683
476	Ga0207706_10114852	3300025933	Bacteria	2368
477	Ga0207706_10164785	3300025933	Bacteria	1948
478	Ga0207686_10008277	3300025934	Bacteria	5611
479	Ga0207670_10058486	3300025936	Bacteria	2619
480	Ga0207669_10004206	3300025937	Bacteria	6313
481	Ga0207669_10033360	3300025937	Bacteria	2904
482	Ga0207704_10011257	3300025938	Bacteria	4399
483	Ga0207691_10005382	3300025940	Bacteria	12356
484	Ga0207691_10007985	3300025940	Bacteria	10177
485	Ga0207691_10009253	3300025940	Bacteria	9454
486	Ga0207691_10065193	3300025940	Bacteria	3298
487	Ga0207691_10107771	3300025940	Bacteria	2480
488	Ga0207691_10182061	3300025940	Bacteria	1836
489	Ga0207711_10009261	3300025941	Bacteria	8222
490	Ga0207689_10000946	3300025942	Bacteria	27914
491	Ga0207689_10016503	3300025942	Bacteria	6251
492	Ga0207689_10093628	3300025942	Bacteria	2468
493	Ga0207661_10104728	3300025944	Bacteria	2382
494	Ga0207679_10002182	3300025945	Bacteria	12111
495	Ga0207679_10005820	3300025945	Bacteria	7741
496	Ga0207679_10009054	3300025945	Bacteria	6360
497	Ga0207679_10050694	3300025945	Bacteria	3035
498	Ga0207679_10094040	3300025945	Bacteria	2326
499	Ga0207667_10003714	3300025949	Bacteria	18825
500	Ga0207667_10009983	3300025949	Bacteria	11135
501	Ga0207667_10025544	3300025949	Bacteria	6465
502	Ga0207667_10029593	3300025949	Bacteria	5938
503	Ga0207667_10036538	3300025949	Bacteria	5264
504	Ga0207667_10044449	3300025949	Bacteria	4706
505	Ga0207667_10068650	3300025949	Bacteria	3690
506	Ga0207667_10303755	3300025949	Bacteria	1630
507	Ga0207651_10012045	3300025960	Bacteria	4872
508	Ga0207651_10057090	3300025960	Bacteria	2690
509	Ga0207668_10018656	3300025972	Bacteria	4372
510	Ga0207658_10005947	3300025986	Bacteria	8331
511	Ga0207677_10017121	3300026023	Bacteria	4312
512	Ga0207703_10000292	3300026035	Bacteria	54983
513	Ga0207703_10010840	3300026035	Bacteria	7110
514	Ga0207703_10011310	3300026035	Bacteria	6941
515	Ga0207639_10004592	3300026041	Bacteria	9289
516	Ga0207639_10189791	3300026041	Bacteria	1754
517	Ga0207678_10001480	3300026067	Bacteria	21540
518	Ga0207678_10007229	3300026067	Bacteria	9844
519	Ga0207678_10045241	3300026067	Bacteria	3807
520	Ga0207678_10053947	3300026067	Bacteria	3463
521	Ga0207708_10013707	3300026075	Bacteria	6058
522	Ga0207702_10014131	3300026078	Bacteria	6631
523	Ga0207641_10001732	3300026088	Bacteria	21075
524	Ga0207641_10039784	3300026088	Bacteria	3933
525	Ga0207641_10071647	3300026088	Bacteria	2982
526	Ga0207641_10091135	3300026088	Bacteria	2667
527	Ga0207648_10001002	3300026089	Bacteria	31804
528	Ga0207648_10001331	3300026089	Bacteria	27452
529	Ga0207648_10046333	3300026089	Bacteria	3812
530	Ga0207676_10001008	3300026095	Bacteria	21634
531	Ga0207676_10003531	3300026095	Bacteria	11065
532	Ga0207676_10200618	3300026095	Bacteria	1762
533	Ga0207674_10015916	3300026116	Bacteria	8242
534	Ga0207675_100001191	3300026118	Bacteria	25904
535	Ga0207675_100001273	3300026118	Bacteria	25223
536	Ga0207675_100023734	3300026118	Bacteria	5706
537	Ga0207683_10000909	3300026121	Bacteria	27226
538	Ga0207683_10006288	3300026121	Bacteria	10178
539	Ga0207683_10085584	3300026121	Bacteria	2802
540	Ga0207698_10015973	3300026142	Bacteria	5048
541	Ga0207698_10019002	3300026142	Bacteria	4693
542	Ga0207698_10104047	3300026142	Bacteria	2361
543	Ga0209281_1000055	3300027111	Bacteria	308297
544	Ga0209281_1000457	3300027111	Bacteria	57515
545	Ga0209389_1000013	3300027296	Bacteria	208890
546	Ga0209371_1000925	3300027312	Bacteria	23086
547	Ga0209984_1004684	3300027424	Bacteria	1620
548	Ga0209995_1004132	3300027471	Bacteria	2317
549	Ga0209968_1005641	3300027526	Bacteria	1881
550	Ga0209999_1001555	3300027543	Bacteria	3943
551	Ga0209982_1000876	3300027552	Bacteria	3956
552	Ga0209970_1000847	3300027614	Bacteria	5388
553	Ga0210002_1000558	3300027617	Bacteria	5041
554	Ga0209983_1000556	3300027665	Bacteria	8083
555	Ga0209983_1001365	3300027665	Bacteria	5429
556	Ga0209282_1000050	3300027666	Bacteria	109312
557	Ga0209971_1000082	3300027682	Bacteria	29071
558	Ga0209966_1008824	3300027695	Bacteria	1793
559	Ga0209998_10002270	3300027717	Bacteria	4446
560	Ga0209974_10001729	3300027876	Bacteria	7928
561	Ga0207428_10000992	3300027907	Bacteria	31455
562	Ga0207428_10004342	3300027907	Bacteria	13543
563	Ga0207428_10011268	3300027907	Bacteria	7921
564	Ga0207428_10016608	3300027907	Bacteria	6329
565	Ga0268266_10062015	3300028379	Bacteria	3225
566	Ga0268265_10001824	3300028380	Bacteria	17021
567	Ga0268265_10018234	3300028380	Bacteria	4861
568	Ga0268265_10029642	3300028380	Bacteria	3931
569	Ga0268265_10049510	3300028380	Bacteria	3160
570	Ga0268264_10000854	3300028381	Bacteria	32463
571	Ga0268264_10052211	3300028381	Bacteria	3408
572	Ga0268264_10114441	3300028381	Bacteria	2368
573	Ga0268264_10158294	3300028381	Bacteria	2037
574	Ga0307517_10001421	3300028786	Bacteria	40285
575	Ga0307517_10053861	3300028786	Bacteria	3996
576	Ga0307515_10000051	3300028794	Bacteria	272100
577	Ga0307515_10000160	3300028794	Bacteria	164789
578	Ga0307515_10000553	3300028794	Bacteria	88277
579	Ga0307515_10002899	3300028794	Bacteria	36444
580	Ga0307515_10010645	3300028794	Bacteria	17584
581	Ga0307515_10028520	3300028794	Bacteria	9485
582	Ga0307515_10123822	3300028794	Bacteria	2905
583	Ga0307515_10130408	3300028794	Bacteria	2774
584	Ga0265338_10000087	3300028800	Bacteria	174926
585	Ga0268256_1000778	3300030500	Bacteria	23086
586	Ga0307512_10148134	3300030522	Bacteria	1413
587	Ga0265339_10002938	3300031249	Bacteria	12049
588	Ga0265331_10015541	3300031250	Bacteria	4016
589	Ga0265327_10002703	3300031251	Bacteria	18190
590	Ga0265327_10016598	3300031251	Bacteria	4665
591	Ga0307513_10009007	3300031456	Bacteria	12663
592	Ga0307513_10022772	3300031456	Bacteria	7351
593	Ga0307513_10049252	3300031456	Bacteria	4565
594	Ga0307513_10168364	3300031456	Bacteria	2072
595	Ga0307513_10189803	3300031456	Bacteria	1908
596	Ga0307509_10000403	3300031507	Bacteria	72510
597	Ga0307509_10016969	3300031507	Bacteria	8397
598	Ga0307509_10044444	3300031507	Bacteria	4800
599	Ga0307509_10062217	3300031507	Bacteria	3936
600	Ga0307408_100004395	3300031548	Bacteria	9568
601	Ga0307408_100012741	3300031548	Bacteria	5576
602	Ga0307408_100021397	3300031548	Bacteria	4377
603	Ga0307508_10000371	3300031616	Bacteria	54514
604	Ga0307508_10004767	3300031616	Bacteria	13094
605	Ga0307508_10014131	3300031616	Bacteria	7284
606	Ga0307508_10039482	3300031616	Bacteria	4240
607	Ga0307514_10000348	3300031649	Bacteria	107998
608	Ga0307514_10001949	3300031649	Bacteria	22562
609	Ga0307514_10030577	3300031649	Bacteria	4322
610	Ga0265314_10003832	3300031711	Bacteria	14357
611	Ga0265342_10002165	3300031712	Bacteria	17313
612	Ga0307516_10000012	3300031730	Bacteria	224120
613	Ga0307516_10002101	3300031730	Bacteria	27049
614	Ga0307516_10017072	3300031730	Bacteria	7578
615	Ga0307516_10029620	3300031730	Bacteria	5533
616	Ga0307516_10078573	3300031730	Bacteria	3146
617	Ga0307405_10005948	3300031731	Bacteria	5952
618	Ga0307413_10002484	3300031824	Bacteria	7508
619	Ga0307413_10007430	3300031824	Bacteria	5091
620	Ga0307413_10032890	3300031824	Bacteria	2945
621	Ga0307410_10000247	3300031852	Bacteria	20437
622	Ga0307406_10014176	3300031901	Bacteria	4581
623	Ga0307406_10146121	3300031901	Bacteria	1680
624	Ga0307407_10021464	3300031903	Bacteria	3330
625	Ga0307407_10023775	3300031903	Bacteria	3202
626	Ga0307412_10061476	3300031911	Bacteria	2525
627	Ga0307409_100000408	3300031995	Bacteria	18252
628	Ga0307409_100033564	3300031995	Bacteria	3736
629	Ga0307416_100002565	3300032002	Bacteria	10488
630	Ga0307416_100013354	3300032002	Bacteria	5578
631	Ga0307414_10021327	3300032004	Bacteria	4062
632	Ga0307411_10000701	3300032005	Bacteria	12315
633	Ga0307411_10019099	3300032005	Bacteria	3949
634	Ga0307415_100001299	3300032126	Bacteria	11797
635	Ga0307415_100080342	3300032126	Bacteria	2326
636	Ga0316583_10000771	3300032133	Bacteria	10056
637	Ga0373943_0083992	3300035170	Bacteria	1638
638	Ga0373931_0084917	3300035691	Bacteria	1754
639	Ga0373927_0052521	3300035695	Bacteria	2637
640	Ga0373937_0062386	3300036401	Bacteria	3427
641	Ga0373937_0062450	3300036401	Bacteria	3425
642	Ga0395900_0043040	3300037418	Bacteria	4653
643	Ga0395898_0141685	3300037466	Bacteria	2302
644	Ga0395905_0006102	3300037471	Bacteria	12176
645	Ga0395905_0141978	3300037471	Bacteria	2259
646	Ga0395901_0208689	3300038443	Bacteria	2045
647	Ga0400483_130367	3300039062	Bacteria	9061
648	Ga0436365_1827493	3300039437	Bacteria	5148
649	Ga0436361_0335889	3300039447	Bacteria	24833
650	Ga0436361_0527730	3300039447	Bacteria	33218
651	Ga0439432_011805	3300042006	Bacteria	3002
652	Ga0439432_011811	3300042006	Bacteria	3001
653	Ga0450902_000817	3300042137	Bacteria	4044
654	Ga0439435_0001509	3300042436	Bacteria	4334
655	Ga0439460_0022593	3300042461	Bacteria	1727
656	Ga0466982_0063647	3300044672	Bacteria	2272
657	Ga0466966_0000986	3300044684	Bacteria	18259
658	Ga0466966_0031392	3300044684	Bacteria	3445
659	Ga0466961_0037087	3300044693	Bacteria	3128
660	Ga0466963_0010609	3300044694	Bacteria	5585
661	Ga0466970_0012874	3300044765	Bacteria	4283
662	Ga0466958_0002781	3300045836	Bacteria	8892
663	Ga0495617_000003	3300046452	Bacteria	541914
664	Ga0495617_004420	3300046452	Bacteria	5116
665	Ga0495627_000007	3300046453	Bacteria	575915
666	Ga0495627_000682	3300046453	Bacteria	26048
667	Ga0495627_002054	3300046453	Bacteria	10272
668	Ga0495627_013434	3300046453	Bacteria	2880
669	Ga0495592_0008157	3300046454	Bacteria	7867
670	Ga0495592_0028266	3300046454	Bacteria	4248
671	Ga0495603_0007368	3300046455	Bacteria	6617
672	Ga0495590_0000008	3300046457	Bacteria	330520
673	Ga0495590_0001342	3300046457	Bacteria	10711
674	Ga0495591_000021	3300046458	Bacteria	203554
675	Ga0495591_000043	3300046458	Bacteria	148885
676	Ga0495591_000336	3300046458	Bacteria	42037
677	Ga0495591_000625	3300046458	Bacteria	26342
678	Ga0495591_000888	3300046458	Bacteria	20936
679	Ga0495591_001022	3300046458	Bacteria	18918
680	Ga0495591_001144	3300046458	Bacteria	17423
681	Ga0495591_001739	3300046458	Bacteria	12977
682	Ga0495591_002453	3300046458	Bacteria	10314
683	Ga0495591_005302	3300046458	Bacteria	6004
684	Ga0495591_014039	3300046458	Bacteria	2899
685	Ga0495591_014645	3300046458	Bacteria	2806
686	Ga0495629_0000143	3300046459	Bacteria	63075
687	Ga0495638_0000417	3300046460	Bacteria	51723
688	Ga0495638_0000704	3300046460	Bacteria	36222
689	Ga0495638_0000823	3300046460	Bacteria	32706
690	Ga0495638_0002051	3300046460	Bacteria	17119
691	Ga0495638_0002805	3300046460	Bacteria	13953
692	Ga0495638_0002937	3300046460	Bacteria	13618
693	Ga0495638_0005823	3300046460	Bacteria	9067
694	Ga0495638_0014189	3300046460	Bacteria	5393
695	Ga0495638_0014401	3300046460	Bacteria	5346
696	Ga0495638_0024622	3300046460	Bacteria	3921
697	Ga0495638_0072728	3300046460	Bacteria	2100
698	Ga0495653_0000002	3300046463	Bacteria	507262
699	Ga0495653_0000737	3300046463	Bacteria	24985
700	Ga0495653_0028571	3300046463	Bacteria	4459
701	Ga0495650_0000088	3300046471	Bacteria	234769
702	Ga0495650_0000101	3300046471	Bacteria	212903
703	Ga0495650_0000126	3300046471	Bacteria	178143
704	Ga0495650_0000457	3300046471	Bacteria	63668
705	Ga0495650_0000653	3300046471	Bacteria	45690
706	Ga0495650_0001898	3300046471	Bacteria	18542
707	Ga0495650_0004658	3300046471	Bacteria	9269
708	Ga0495650_0005941	3300046471	Bacteria	7748
709	Ga0495650_0006777	3300046471	Bacteria	7073
710	Ga0495650_0012107	3300046471	Bacteria	4664
711	Ga0495650_0012187	3300046471	Bacteria	4642
712	Ga0495650_0012293	3300046471	Bacteria	4613
713	Ga0495650_0032191	3300046471	Bacteria	2348
714	Ga0495580_0005144	3300046472	Bacteria	10879
715	Ga0495580_0122801	3300046472	Bacteria	1803
716	Ga0495605_0000068	3300046474	Bacteria	137743
717	Ga0495605_0001774	3300046474	Bacteria	13838
718	Ga0495605_0001929	3300046474	Bacteria	13188
719	Ga0495605_0009365	3300046474	Bacteria	5503
720	Ga0495605_0011859	3300046474	Bacteria	4848
721	Ga0495605_0032237	3300046474	Bacteria	2668
722	Ga0495605_0036316	3300046474	Bacteria	2485
723	Ga0495605_0077350	3300046474	Bacteria	1561
724	Ga0495584_0000019	3300046491	Bacteria	140608
725	Ga0495584_0000025	3300046491	Bacteria	116731
726	Ga0495584_0000624	3300046491	Bacteria	23659
727	Ga0495584_0000877	3300046491	Bacteria	19419
728	Ga0495584_0001021	3300046491	Bacteria	17475
729	Ga0495584_0004728	3300046491	Bacteria	7289
730	Ga0495584_0006746	3300046491	Bacteria	6001
731	Ga0495584_0010403	3300046491	Bacteria	4780
732	Ga0495584_0027050	3300046491	Bacteria	2906
733	Ga0495584_0079252	3300046491	Bacteria	1652
734	Ga0495585_0000998	3300046492	Bacteria	23668
735	Ga0495585_0001283	3300046492	Bacteria	20031
736	Ga0495585_0001358	3300046492	Bacteria	19372
737	Ga0495585_0001928	3300046492	Bacteria	15514
738	Ga0495585_0003309	3300046492	Bacteria	10940
739	Ga0495585_0003537	3300046492	Bacteria	10501
740	Ga0495585_0004600	3300046492	Bacteria	8916
741	Ga0495585_0014693	3300046492	Bacteria	4554
742	Ga0495585_0019453	3300046492	Bacteria	3914
743	Ga0495585_0023582	3300046492	Bacteria	3531
744	Ga0495585_0076906	3300046492	Bacteria	1812
745	Ga0495585_0083963	3300046492	Bacteria	1723
746	Ga0495596_0000099	3300046500	Bacteria	61455
747	Ga0495596_0000127	3300046500	Bacteria	52593
748	Ga0495596_0000209	3300046500	Bacteria	40288
749	Ga0495596_0002177	3300046500	Bacteria	10681
750	Ga0495596_0004131	3300046500	Bacteria	7144
751	Ga0495596_0017843	3300046500	Bacteria	2932
752	Ga0495596_0029010	3300046500	Bacteria	2220
753	Ga0495596_0029874	3300046500	Bacteria	2183
754	Ga0495607_0000352	3300046501	Bacteria	47564
755	Ga0495607_0000368	3300046501	Bacteria	46393
756	Ga0495607_0001668	3300046501	Bacteria	19208
757	Ga0495607_0002057	3300046501	Bacteria	16829
758	Ga0495607_0002927	3300046501	Bacteria	13448
759	Ga0495607_0003152	3300046501	Bacteria	12778
760	Ga0495607_0005221	3300046501	Bacteria	9348
761	Ga0495607_0005382	3300046501	Bacteria	9184
762	Ga0495607_0006849	3300046501	Bacteria	7952
763	Ga0495607_0012802	3300046501	Bacteria	5518
764	Ga0495607_0014040	3300046501	Bacteria	5229
765	Ga0495607_0015009	3300046501	Bacteria	5033
766	Ga0495607_0021242	3300046501	Bacteria	4086
767	Ga0495607_0043647	3300046501	Bacteria	2649
768	Ga0495607_0067994	3300046501	Bacteria	1999
769	Ga0495583_0000011	3300046506	Bacteria	350215
770	Ga0495583_0000160	3300046506	Bacteria	113560
771	Ga0495583_0000418	3300046506	Bacteria	64708
772	Ga0495583_0000512	3300046506	Bacteria	55428
773	Ga0495583_0001029	3300046506	Bacteria	31649
774	Ga0495583_0002850	3300046506	Bacteria	14065
775	Ga0495583_0004680	3300046506	Bacteria	9645
776	Ga0495583_0005137	3300046506	Bacteria	9018
777	Ga0495583_0005456	3300046506	Bacteria	8638
778	Ga0495583_0005474	3300046506	Bacteria	8617
779	Ga0495583_0007072	3300046506	Bacteria	7172
780	Ga0495583_0012001	3300046506	Bacteria	4935
781	Ga0495606_0000001	3300046507	Bacteria	592123
782	Ga0495606_0001902	3300046507	Bacteria	25982
783	Ga0495606_0002347	3300046507	Bacteria	22246
784	Ga0495606_0002406	3300046507	Bacteria	21855
785	Ga0495606_0002910	3300046507	Bacteria	18924
786	Ga0495606_0002999	3300046507	Bacteria	18536
787	Ga0495606_0009348	3300046507	Bacteria	8307
788	Ga0495606_0030173	3300046507	Bacteria	3791
789	Ga0495606_0036401	3300046507	Bacteria	3352
790	Ga0495606_0042104	3300046507	Bacteria	3057
791	Ga0495608_0008161	3300046511	Bacteria	7354
792	Ga0495610_0000003	3300046512	Bacteria	1203910
793	Ga0495610_0000395	3300046512	Bacteria	45218
794	Ga0495610_0000887	3300046512	Bacteria	27802
795	Ga0495610_0001043	3300046512	Bacteria	25456
796	Ga0495610_0001982	3300046512	Bacteria	17467
797	Ga0495610_0002865	3300046512	Bacteria	14003
798	Ga0495610_0005195	3300046512	Bacteria	9323
799	Ga0495610_0008661	3300046512	Bacteria	6552
800	Ga0495610_0023615	3300046512	Bacteria	3336
801	Ga0495610_0028586	3300046512	Bacteria	2946
802	Ga0495610_0078003	3300046512	Bacteria	1528
803	Ga0495616_0000107	3300046513	Bacteria	72253
804	Ga0495616_0000150	3300046513	Bacteria	60876
805	Ga0495616_0000781	3300046513	Bacteria	23271
806	Ga0495616_0000877	3300046513	Bacteria	21821
807	Ga0495616_0002131	3300046513	Bacteria	13258
808	Ga0495616_0004691	3300046513	Bacteria	8574
809	Ga0495616_0006525	3300046513	Bacteria	7047
810	Ga0495616_0014784	3300046513	Bacteria	4358
811	Ga0495616_0027435	3300046513	Bacteria	3021
812	Ga0495616_0027898	3300046513	Bacteria	2992
813	Ga0495616_0031615	3300046513	Bacteria	2770
814	Ga0495616_0072900	3300046513	Bacteria	1657
815	Ga0495620_0000012	3300046515	Bacteria	166395
816	Ga0495620_0000986	3300046515	Bacteria	17570
817	Ga0495620_0000993	3300046515	Bacteria	17529
818	Ga0495620_0008654	3300046515	Bacteria	5454
819	Ga0495620_0014900	3300046515	Bacteria	3940
820	Ga0495620_0019074	3300046515	Bacteria	3384
821	Ga0495620_0036013	3300046515	Bacteria	2218
822	Ga0495628_0058276	3300046516	Bacteria	3035
823	Ga0495630_0004736	3300046517	Bacteria	9544
824	Ga0495630_0017595	3300046517	Bacteria	5238
825	Ga0495631_0000002	3300046518	Bacteria	178694
826	Ga0495631_0000337	3300046518	Bacteria	32281
827	Ga0495631_0000620	3300046518	Bacteria	23340
828	Ga0495631_0000897	3300046518	Bacteria	18601
829	Ga0495631_0003605	3300046518	Bacteria	8447
830	Ga0495631_0006109	3300046518	Bacteria	6249
831	Ga0495631_0008943	3300046518	Bacteria	5023
832	Ga0495631_0016039	3300046518	Bacteria	3580
833	Ga0495631_0025187	3300046518	Bacteria	2741
834	Ga0495631_0030003	3300046518	Bacteria	2469
835	Ga0495632_0000109	3300046519	Bacteria	85257
836	Ga0495632_0000115	3300046519	Bacteria	81715
837	Ga0495632_0000931	3300046519	Bacteria	25651
838	Ga0495632_0000967	3300046519	Bacteria	25076
839	Ga0495632_0001225	3300046519	Bacteria	21785
840	Ga0495632_0003632	3300046519	Bacteria	10840
841	Ga0495632_0003889	3300046519	Bacteria	10378
842	Ga0495632_0004000	3300046519	Bacteria	10199
843	Ga0495632_0011853	3300046519	Bacteria	5068
844	Ga0495632_0024464	3300046519	Bacteria	3206
845	Ga0495632_0039499	3300046519	Bacteria	2382
846	Ga0495632_0070612	3300046519	Bacteria	1679
847	Ga0495637_0000009	3300046520	Bacteria	402028
848	Ga0495637_0000092	3300046520	Bacteria	70294
849	Ga0495637_0000631	3300046520	Bacteria	24776
850	Ga0495637_0000776	3300046520	Bacteria	21501
851	Ga0495637_0001491	3300046520	Bacteria	13719
852	Ga0495637_0001973	3300046520	Bacteria	11596
853	Ga0495637_0003511	3300046520	Bacteria	8310
854	Ga0495637_0004339	3300046520	Bacteria	7360
855	Ga0495637_0004641	3300046520	Bacteria	7096
856	Ga0495637_0020118	3300046520	Bacteria	3075
857	Ga0495637_0020948	3300046520	Bacteria	2999
858	Ga0495637_0034209	3300046520	Bacteria	2227
859	Ga0495643_0000029	3300046522	Bacteria	261028
860	Ga0495643_0000049	3300046522	Bacteria	212242
861	Ga0495643_0000240	3300046522	Bacteria	82228
862	Ga0495643_0001116	3300046522	Bacteria	26592
863	Ga0495643_0001396	3300046522	Bacteria	22518
864	Ga0495643_0002003	3300046522	Bacteria	16992
865	Ga0495643_0003017	3300046522	Bacteria	12656
866	Ga0495643_0005104	3300046522	Bacteria	8976
867	Ga0495643_0005771	3300046522	Bacteria	8281
868	Ga0495643_0006904	3300046522	Bacteria	7392
869	Ga0495643_0015927	3300046522	Bacteria	4429
870	Ga0495643_0020328	3300046522	Bacteria	3829
871	Ga0495643_0020672	3300046522	Bacteria	3791
872	Ga0495643_0020791	3300046522	Bacteria	3777
873	Ga0495643_0030034	3300046522	Bacteria	3038
874	Ga0495643_0051783	3300046522	Bacteria	2207
875	Ga0495644_0003569	3300046523	Bacteria	6143
876	Ga0495644_0003900	3300046523	Bacteria	5873
877	Ga0495644_0004161	3300046523	Bacteria	5689
878	Ga0495644_0005824	3300046523	Bacteria	4813
879	Ga0495644_0010725	3300046523	Bacteria	3530
880	Ga0495644_0011164	3300046523	Bacteria	3462
881	Ga0495644_0025293	3300046523	Bacteria	2254
882	Ga0495644_0036483	3300046523	Bacteria	1854
883	Ga0495648_0000328	3300046524	Bacteria	52422
884	Ga0495648_0005227	3300046524	Bacteria	10854
885	Ga0495648_0008489	3300046524	Bacteria	8078
886	Ga0495648_0011625	3300046524	Bacteria	6613
887	Ga0495648_0013713	3300046524	Bacteria	5973
888	Ga0495648_0017655	3300046524	Bacteria	5090
889	Ga0495648_0031225	3300046524	Bacteria	3510
890	Ga0495666_0000087	3300046526	Bacteria	37303
891	Ga0495642_0000611	3300046528	Bacteria	17994
892	Ga0495642_0001974	3300046528	Bacteria	8606
893	Ga0495642_0006547	3300046528	Bacteria	4470
894	Ga0495642_0008864	3300046528	Bacteria	3848
895	Ga0495654_0000577	3300046530	Bacteria	29498
896	Ga0495654_0000954	3300046530	Bacteria	21390
897	Ga0495654_0001110	3300046530	Bacteria	19434
898	Ga0495654_0001246	3300046530	Bacteria	17989
899	Ga0495654_0001396	3300046530	Bacteria	16732
900	Ga0495654_0004294	3300046530	Bacteria	8503
901	Ga0495654_0007840	3300046530	Bacteria	5937
902	Ga0495654_0015392	3300046530	Bacteria	4061
903	Ga0495654_0017671	3300046530	Bacteria	3744
904	Ga0495654_0029464	3300046530	Bacteria	2799
905	Ga0495654_0040998	3300046530	Bacteria	2304
906	Ga0495665_0011548	3300046531	Bacteria	4781
907	Ga0495609_0000016	3300046538	Bacteria	312882
908	Ga0495609_0000289	3300046538	Bacteria	46396
909	Ga0495609_0000647	3300046538	Bacteria	27112
910	Ga0495609_0002277	3300046538	Bacteria	11964
911	Ga0495609_0006304	3300046538	Bacteria	6070
912	Ga0495609_0007418	3300046538	Bacteria	5481
913	Ga0495609_0007771	3300046538	Bacteria	5314
914	Ga0495609_0015289	3300046538	Bacteria	3594
915	Ga0495609_0033742	3300046538	Bacteria	2323
916	Ga0495621_0007507	3300046539	Bacteria	3232
917	Ga0495597_0000002	3300046542	Bacteria	420382
918	Ga0495597_0000762	3300046542	Bacteria	25455
919	Ga0495597_0002619	3300046542	Bacteria	11197
920	Ga0495597_0003973	3300046542	Bacteria	8314
921	Ga0495597_0004276	3300046542	Bacteria	7898
922	Ga0495597_0017009	3300046542	Bacteria	3428
923	Ga0495622_0000092	3300046557	Bacteria	80637
924	Ga0495622_0046540	3300046557	Bacteria	2015
925	Ga0495633_0000181	3300046558	Bacteria	82164
926	Ga0495633_0000925	3300046558	Bacteria	24854
927	Ga0495633_0000985	3300046558	Bacteria	23374
928	Ga0495633_0004718	3300046558	Bacteria	8568
929	Ga0495633_0008132	3300046558	Bacteria	5948
930	Ga0495633_0011865	3300046558	Bacteria	4668
931	Ga0495633_0012823	3300046558	Bacteria	4440
932	Ga0495633_0013358	3300046558	Bacteria	4331
933	Ga0495633_0060113	3300046558	Bacteria	1781
934	Ga0495667_0000871	3300046559	Bacteria	19518
935	Ga0495656_0001367	3300046615	Bacteria	7975
936	Ga0495656_0011981	3300046615	Bacteria	3191
937	Ga0495668_0000095	3300046616	Bacteria	141321
938	Ga0495668_0000160	3300046616	Bacteria	101615
939	Ga0495668_0000437	3300046616	Bacteria	53630
940	Ga0495668_0000467	3300046616	Bacteria	51372
941	Ga0495668_0001331	3300046616	Bacteria	24318
942	Ga0495668_0004203	3300046616	Bacteria	10382
943	Ga0495668_0011694	3300046616	Bacteria	5242
944	Ga0495611_0000300	3300046648	Bacteria	33540
945	Ga0495611_0001383	3300046648	Bacteria	12156
946	Ga0495611_0007118	3300046648	Bacteria	4751
947	Ga0495611_0024893	3300046648	Bacteria	2605
948	Ga0495611_0042884	3300046648	Bacteria	2021
949	Ga0495611_0088582	3300046648	Bacteria	1429
950	Ga0495611_0102007	3300046648	Bacteria	1333
951	Ga0495625_0000016	3300046660	Bacteria	311353
952	Ga0495625_0000056	3300046660	Bacteria	186024
953	Ga0495625_0000806	3300046660	Bacteria	43441
954	Ga0495625_0001360	3300046660	Bacteria	30078
955	Ga0495625_0001545	3300046660	Bacteria	27479
956	Ga0495625_0002678	3300046660	Bacteria	18948
957	Ga0495625_0003129	3300046660	Bacteria	16904
958	Ga0495625_0003315	3300046660	Bacteria	16227
959	Ga0495625_0004222	3300046660	Bacteria	13693
960	Ga0495625_0005525	3300046660	Bacteria	11491
961	Ga0495625_0008089	3300046660	Bacteria	9019
962	Ga0495625_0010171	3300046660	Bacteria	7810
963	Ga0495625_0039863	3300046660	Bacteria	3428
964	Ga0495661_0000001	3300046665	Bacteria	898372
965	Ga0495661_0000051	3300046665	Bacteria	140353
966	Ga0495661_0000132	3300046665	Bacteria	90465
967	Ga0495661_0000399	3300046665	Bacteria	46198
968	Ga0495661_0001634	3300046665	Bacteria	18297
969	Ga0495661_0003685	3300046665	Bacteria	11251
970	Ga0495661_0003773	3300046665	Bacteria	11091
971	Ga0495661_0018529	3300046665	Bacteria	4577
972	Ga0495661_0023575	3300046665	Bacteria	3993
973	Ga0495661_0024205	3300046665	Bacteria	3931
974	Ga0495661_0026769	3300046665	Bacteria	3710
975	Ga0495661_0028703	3300046665	Bacteria	3558
976	Ga0495657_0010750	3300046675	Bacteria	6877
977	Ga0495599_0010289	3300046678	Bacteria	5723
978	Ga0495623_0029158	3300046679	Bacteria	3552
979	Ga0495646_0017861	3300046680	Bacteria	4495
980	Ga0495646_0082030	3300046680	Bacteria	1877
981	Ga0495647_0005917	3300046681	Bacteria	4026
982	Ga0495658_0020477	3300046683	Bacteria	3471
983	Ga0495669_0000304	3300046684	Bacteria	27214
984	Ga0495669_0010668	3300046684	Bacteria	3887
985	Ga0495613_0016452	3300046689	Bacteria	5508
986	Ga0495613_0025973	3300046689	Bacteria	4363
987	Ga0495613_0097097	3300046689	Bacteria	2130
988	Ga0495624_0004313	3300046690	Bacteria	10436
989	Ga0495624_0027119	3300046690	Bacteria	3753
990	Ga0495670_0000045	3300046691	Bacteria	66604
991	Ga0495670_0000363	3300046691	Bacteria	21609
992	Ga0495670_0001189	3300046691	Bacteria	12630
993	Ga0495670_0005476	3300046691	Bacteria	6230
994	Ga0495670_0013225	3300046691	Bacteria	4059
995	Ga0495670_0025801	3300046691	Bacteria	2908
996	Ga0495670_0065507	3300046691	Bacteria	1831
997	Ga0495671_0000010	3300046692	Bacteria	368641
998	Ga0495671_0000173	3300046692	Bacteria	57337
999	Ga0495671_0000239	3300046692	Bacteria	47493
1000	Ga0495671_0004172	3300046692	Bacteria	8703
1001	Ga0495671_0006764	3300046692	Bacteria	6598
1002	Ga0495671_0007333	3300046692	Bacteria	6295
1003	Ga0495671_0015018	3300046692	Bacteria	4159
1004	Ga0495671_0026337	3300046692	Bacteria	3016
1005	Ga0495671_0074732	3300046692	Bacteria	1662
1006	Ga0495649_0000028	3300046694	Bacteria	163229
1007	Ga0495649_0000599	3300046694	Bacteria	30033
1008	Ga0495649_0000715	3300046694	Bacteria	27013
1009	Ga0495649_0001446	3300046694	Bacteria	17897
1010	Ga0495649_0001670	3300046694	Bacteria	16484
1011	Ga0495649_0001951	3300046694	Bacteria	14992
1012	Ga0495649_0002277	3300046694	Bacteria	13638
1013	Ga0495649_0002849	3300046694	Bacteria	12004
1014	Ga0495649_0002941	3300046694	Bacteria	11752
1015	Ga0495649_0003140	3300046694	Bacteria	11316
1016	Ga0495649_0006019	3300046694	Bacteria	7593
1017	Ga0495649_0006666	3300046694	Bacteria	7168
1018	Ga0495649_0007295	3300046694	Bacteria	6763
1019	Ga0495649_0014673	3300046694	Bacteria	4481
1020	Ga0495649_0026396	3300046694	Bacteria	3229
1021	Ga0495649_0029147	3300046694	Bacteria	3056
1022	Ga0495649_0030882	3300046694	Bacteria	2956
1023	Ga0495649_0034023	3300046694	Bacteria	2804
1024	Ga0495649_0050705	3300046694	Bacteria	2251
1025	Ga0495589_0000004	3300046794	Bacteria	439891
1026	Ga0495589_0000235	3300046794	Bacteria	46396
1027	Ga0495589_0000677	3300046794	Bacteria	22275
1028	Ga0495589_0001207	3300046794	Bacteria	15394
1029	Ga0495589_0001619	3300046794	Bacteria	12916
1030	Ga0495589_0001804	3300046794	Bacteria	12165
1031	Ga0495589_0002249	3300046794	Bacteria	10841
1032	Ga0495589_0003546	3300046794	Bacteria	8439
1033	Ga0495589_0016339	3300046794	Bacteria	3815
1034	Ga0495589_0017957	3300046794	Bacteria	3628
1035	Ga0495660_0000010	3300046810	Bacteria	370769
1036	Ga0495660_0000057	3300046810	Bacteria	133310
1037	Ga0495660_0000075	3300046810	Bacteria	106495
1038	Ga0495660_0001881	3300046810	Bacteria	13798
1039	Ga0495660_0003711	3300046810	Bacteria	9375
1040	Ga0495660_0004195	3300046810	Bacteria	8759
1041	Ga0495660_0005766	3300046810	Bacteria	7397
1042	Ga0495660_0006681	3300046810	Bacteria	6812
1043	Ga0495660_0011203	3300046810	Bacteria	5206
1044	Ga0495660_0012041	3300046810	Bacteria	5017
1045	Ga0495660_0012344	3300046810	Bacteria	4957
1046	Ga0495660_0045397	3300046810	Bacteria	2412
1047	Ga0495660_0046239	3300046810	Bacteria	2387
1048	Ga0495636_0003514	3300047318	Bacteria	6075
1049	Ga0495636_0013102	3300047318	Bacteria	3289
1050	Ga0495674_0010986	3300047319	Bacteria	8554
1051	Ga0495674_0017521	3300047319	Bacteria	6667
1052	Ga0495674_0099593	3300047319	Bacteria	2474
1053	Ga0495674_0132643	3300047319	Bacteria	2098
1054	Ga0495672_0000005	3300047320	Bacteria	593294
1055	Ga0495672_0000047	3300047320	Bacteria	246926
1056	Ga0495672_0000055	3300047320	Bacteria	229428
1057	Ga0495672_0000334	3300047320	Bacteria	61678
1058	Ga0495672_0002009	3300047320	Bacteria	19202
1059	Ga0495672_0005289	3300047320	Bacteria	10274
1060	Ga0495672_0017601	3300047320	Bacteria	4777
1061	Ga0495672_0024355	3300047320	Bacteria	3901
1062	Ga0495672_0042442	3300047320	Bacteria	2743
1063	Ga0495676_0000001	3300047321	Bacteria	624167
1064	Ga0495676_0062942	3300047321	Bacteria	2894
1065	Ga0495676_0111992	3300047321	Bacteria	2001
1066	Ga0495683_0000037	3300047323	Bacteria	140632
1067	Ga0495683_0000047	3300047323	Bacteria	126770
1068	Ga0495683_0000146	3300047323	Bacteria	69465
1069	Ga0495683_0003931	3300047323	Bacteria	8551
1070	Ga0495683_0009297	3300047323	Bacteria	5235
1071	Ga0495683_0012721	3300047323	Bacteria	4415
1072	Ga0495683_0015499	3300047323	Bacteria	3966
1073	Ga0495683_0038373	3300047323	Bacteria	2425
1074	Ga0495687_000018	3300047443	Bacteria	342973
1075	Ga0495687_000164	3300047443	Bacteria	99940
1076	Ga0495687_000515	3300047443	Bacteria	46396
1077	Ga0495687_008684	3300047443	Bacteria	5784
1078	Ga0495687_015188	3300047443	Bacteria	3926
1079	Ga0495687_017678	3300047443	Bacteria	3545
1080	Ga0495687_022425	3300047443	Bacteria	3030
1081	Ga0495677_0000092	3300047445	Bacteria	46179
1082	Ga0495677_0000451	3300047445	Bacteria	17521
1083	Ga0495677_0001493	3300047445	Bacteria	9408
1084	Ga0495677_0003540	3300047445	Bacteria	6059
1085	Ga0495677_0005345	3300047445	Bacteria	4872
1086	Ga0495677_0011408	3300047445	Bacteria	3252
1087	Ga0495679_000012	3300047446	Bacteria	319098
1088	Ga0495679_000088	3300047446	Bacteria	84788
1089	Ga0495679_001020	3300047446	Bacteria	17183
1090	Ga0495679_002742	3300047446	Bacteria	8770
1091	Ga0495679_003463	3300047446	Bacteria	7571
1092	Ga0495679_005399	3300047446	Bacteria	5665
1093	Ga0495679_006610	3300047446	Bacteria	4960
1094	Ga0495685_022136	3300047447	Bacteria	2187
1095	Ga0495673_0000003	3300047469	Bacteria	1491337
1096	Ga0495673_0000008	3300047469	Bacteria	752462
1097	Ga0495673_0000016	3300047469	Bacteria	580643
1098	Ga0495673_0000093	3300047469	Bacteria	185841
1099	Ga0495673_0000162	3300047469	Bacteria	114710
1100	Ga0495673_0001188	3300047469	Bacteria	21896
1101	Ga0495673_0001457	3300047469	Bacteria	18814
1102	Ga0495673_0004585	3300047469	Bacteria	8610
1103	Ga0495673_0007284	3300047469	Bacteria	6386
1104	Ga0495681_0002691	3300047470	Bacteria	12586
1105	Ga0495681_0003125	3300047470	Bacteria	11611
1106	Ga0495681_0003492	3300047470	Bacteria	10934
1107	Ga0495681_0006137	3300047470	Bacteria	7934
1108	Ga0495681_0009425	3300047470	Bacteria	6017
1109	Ga0495681_0013981	3300047470	Bacteria	4628
1110	Ga0495681_0022708	3300047470	Bacteria	3350
1111	Ga0495681_0030631	3300047470	Bacteria	2736
1112	Ga0495681_0043961	3300047470	Bacteria	2151
1113	Ga0495681_0052679	3300047470	Bacteria	1907
1114	Ga0495684_0010971	3300047471	Bacteria	7003
1115	Ga0495684_0030064	3300047471	Bacteria	4171
1116	Ga0495686_0001728	3300047472	Bacteria	22458
1117	Ga0495686_0002819	3300047472	Bacteria	15756
1118	Ga0495686_0003021	3300047472	Bacteria	14945
1119	Ga0495686_0004888	3300047472	Bacteria	10803
1120	Ga0495686_0026108	3300047472	Bacteria	3823
1121	Ga0495686_0122045	3300047472	Bacteria	1552
1122	Ga0495593_0000374	3300047673	Bacteria	24676
1123	Ga0495593_0007742	3300047673	Bacteria	6263
1124	Ga0495602_0049253	3300048088	Bacteria	3775
1125	Ga0495602_0152763	3300048088	Bacteria	1812
1126	Ga0495626_0000002	3300048091	Bacteria	436012
1127	Ga0495626_0000011	3300048091	Bacteria	260928
1128	Ga0495626_0000242	3300048091	Bacteria	63298
1129	Ga0495626_0000329	3300048091	Bacteria	50091
1130	Ga0495626_0001002	3300048091	Bacteria	24295
1131	Ga0495626_0001800	3300048091	Bacteria	16188
1132	Ga0495626_0002151	3300048091	Bacteria	14225
1133	Ga0495626_0002508	3300048091	Bacteria	12660
1134	Ga0495626_0005164	3300048091	Bacteria	7742
1135	Ga0495626_0013186	3300048091	Bacteria	4305
1136	Ga0495626_0020995	3300048091	Bacteria	3247
1137	Ga0496101_0000093	3300048904	Bacteria	95734
1138	Ga0496101_0018225	3300048904	Bacteria	4771
1139	Ga0496102_0000771	3300048905	Bacteria	31181
1140	Ga0496102_0006587	3300048905	Bacteria	9920
1141	Ga0496102_0014777	3300048905	Bacteria	6790
1142	Ga0496103_0008670	3300048906	Bacteria	6039
1143	Ga0496103_0027070	3300048906	Bacteria	3473
1144	Ga0496105_0180318	3300048908	Bacteria	1730
1145	Ga0496106_0004513	3300048909	Bacteria	10312
1146	Ga0496108_0076570	3300048911	Bacteria	2828
1147	Ga0496109_0022323	3300048912	Bacteria	5605
1148	Ga0496109_0051231	3300048912	Bacteria	3760
1149	Ga0496109_0064284	3300048912	Bacteria	3358
1150	Ga0496109_0344383	3300048912	Bacteria	1408
1151	Ga0496110_0082588	3300048913	Bacteria	2866
1152	Ga0496110_0094647	3300048913	Bacteria	2675
1153	Ga0496112_0114194	3300048915	Bacteria	2671
1154	Ga0496113_0053960	3300048916	Bacteria	3007
1155	Ga0496113_0062684	3300048916	Bacteria	2808
1156	Ga0496114_0001183	3300048917	Bacteria	19768
1157	Ga0496114_0009373	3300048917	Bacteria	7772
1158	Ga0496114_0031119	3300048917	Bacteria	4390
1159	Ga0496114_0112233	3300048917	Bacteria	2336
1160	Ga0496115_0155001	3300048918	Bacteria	1892
1161	Ga0496116_0000048	3300048919	Bacteria	314562
1162	Ga0496116_0000148	3300048919	Bacteria	142458
1163	Ga0496116_0005353	3300048919	Bacteria	11950
1164	Ga0496116_0005625	3300048919	Bacteria	11543
1165	Ga0496116_0063076	3300048919	Bacteria	2389
1166	Ga0496117_0004160	3300048920	Bacteria	16172
1167	Ga0496117_0006664	3300048920	Bacteria	11576
1168	Ga0496117_0048040	3300048920	Bacteria	3053
1169	Ga0496117_0053166	3300048920	Bacteria	2848
1170	Ga0496118_0000345	3300048921	Bacteria	78809
1171	Ga0496118_0000796	3300048921	Bacteria	50371
1172	Ga0496118_0003581	3300048921	Bacteria	19339
1173	Ga0496118_0063872	3300048921	Bacteria	2706
1174	Ga0496118_0080195	3300048921	Bacteria	2298
1175	Ga0496119_0000808	3300048922	Bacteria	41909
1176	Ga0496119_0055698	3300048922	Bacteria	2400
1177	Ga0496120_0000367	3300048923	Bacteria	73343
1178	Ga0496120_0000921	3300048923	Bacteria	40877
1179	Ga0496121_0017024	3300048924	Bacteria	7459
1180	Ga0496121_0018632	3300048924	Bacteria	6989
1181	Ga0496121_0029822	3300048924	Bacteria	5028
1182	Ga0496121_0080509	3300048924	Bacteria	2582
1183	Ga0496122_0000086	3300048925	Bacteria	207993
1184	Ga0496122_0004024	3300048925	Bacteria	18691
1185	Ga0496122_0006880	3300048925	Bacteria	12872
1186	Ga0496122_0007948	3300048925	Bacteria	11603
1187	Ga0496122_0016368	3300048925	Bacteria	7021
1188	Ga0496122_0054052	3300048925	Bacteria	3020
1189	Ga0496123_0000021	3300048926	Bacteria	378760
1190	Ga0496123_0001070	3300048926	Bacteria	41381
1191	Ga0496123_0001605	3300048926	Bacteria	30644
1192	Ga0496123_0006390	3300048926	Bacteria	11432
1193	Ga0496123_0033423	3300048926	Bacteria	3701
1194	Ga0496123_0040540	3300048926	Bacteria	3241
1195	Ga0496124_0000092	3300048927	Bacteria	189213
1196	Ga0496124_0003502	3300048927	Bacteria	19122
1197	Ga0496124_0005256	3300048927	Bacteria	14652
1198	Ga0496124_0012508	3300048927	Bacteria	8370
1199	Ga0496124_0015010	3300048927	Bacteria	7456
1200	Ga0496124_0016414	3300048927	Bacteria	7041
1201	Ga0496124_0070746	3300048927	Bacteria	2893
1202	Ga0496124_0077405	3300048927	Bacteria	2743
1203	Ga0496125_0000103	3300048928	Bacteria	201675
1204	Ga0496125_0004245	3300048928	Bacteria	16699
1205	Ga0496125_0025674	3300048928	Bacteria	5388
1206	Ga0496125_0056898	3300048928	Bacteria	3172
1207	Ga0496125_0107294	3300048928	Bacteria	2035
1208	Ga0496125_0159868	3300048928	Bacteria	1532
1209	Ga0496125_0162873	3300048928	Bacteria	1512
1210	Ga0496126_0000229	3300048929	Bacteria	120333
1211	Ga0496126_0011608	3300048929	Bacteria	9092
1212	Ga0496126_0013643	3300048929	Bacteria	8248
1213	Ga0496126_0202550	3300048929	Bacteria	1675
1214	Ga0466983_0069369	3300048986	Bacteria	2957
1215	Ga0495678_000025	3300049459	Bacteria	227891
1216	Ga0495678_000060	3300049459	Bacteria	142851
1217	Ga0495678_000151	3300049459	Bacteria	83926
1218	Ga0495678_000266	3300049459	Bacteria	57869
1219	Ga0495678_000478	3300049459	Bacteria	39768
1220	Ga0495678_001641	3300049459	Bacteria	17019
1221	Ga0495678_002616	3300049459	Bacteria	12014
1222	Ga0495678_002767	3300049459	Bacteria	11464
1223	Ga0495678_003319	3300049459	Bacteria	10030
1224	Ga0495678_004566	3300049459	Bacteria	7963
1225	Ga0495678_004778	3300049459	Bacteria	7715
1226	Ga0495678_007715	3300049459	Bacteria	5546
1227	Ga0495678_020431	3300049459	Bacteria	2932
1228	Ga0495678_030577	3300049459	Bacteria	2252
1229	Ga0495682_0000003	3300049460	Bacteria	515787
1230	Ga0495682_0000035	3300049460	Bacteria	126349
1231	Ga0495682_0007453	3300049460	Bacteria	4349
1232	Ga0501034_0000248	3300049571	Bacteria	99691
1233	Ga0501036_0016324	3300049572	Bacteria	6203
1234	Ga0501038_0072246	3300049574	Bacteria	2924
1235	Ga0501038_0112754	3300049574	Bacteria	2251
1236	Ga0501038_0169232	3300049574	Bacteria	1770
1237	Ga0501042_0001360	3300049578	Bacteria	14337
1238	Ga0501043_0000815	3300049579	Bacteria	27722
1239	Ga0501046_0121027	3300049580	Bacteria	1991
1240	Ga0501048_0135599	3300049582	Bacteria	1740
1241	Ga0501071_0005046	3300049587	Bacteria	8444
1242	Ga0501072_0006006	3300049588	Bacteria	9257
1243	Ga0501072_0026532	3300049588	Bacteria	4517
1244	Ga0501075_0000451	3300049591	Bacteria	24474
1245	Ga0501076_0023117	3300049592	Bacteria	4787
1246	Ga0501076_0029291	3300049592	Bacteria	4281
1247	Ga0501229_002563	3300049706	Bacteria	2144
1248	Ga0501079_0008926	3300049741	Bacteria	7592
1249	Ga0501080_0030281	3300049742	Bacteria	5042
1250	Ga0501081_0003568	3300049743	Bacteria	9946
1251	Ga0501081_0023535	3300049743	Bacteria	4129
1252	Ga0501262_000404	3300049759	Bacteria	5207
1253	Ga0501044_0034195	3300049823	Bacteria	5333
1254	Ga0501045_0046277	3300049824	Bacteria	3168
1255	nmdc:mga03683_16330_c1	3300050489	Bacteria	2786
1256	nmdc:mga03683_18954_c1	3300050489	Bacteria	2622
1257	nmdc:mga03683_3366_c1	3300050489	Bacteria	5145
1258	nmdc:mga03n38_6245_c1	3300050490	Bacteria	4125
1259	nmdc:mga00v17_195_c1	3300050491	Bacteria	36325
1260	nmdc:mga0yw44_6111_c1	3300050492	Bacteria	5781
1261	nmdc:mga0k408_535_c1	3300050493	Bacteria	20913
1262	nmdc:mga0k408_57471_c1	3300050493	Bacteria	2258
1263	nmdc:mga0k408_641_c2	3300050493	Bacteria	18568
1264	nmdc:mga06z11_98320_c1	3300050494	Bacteria	1601
1265	nmdc:mga07m45_22675_c1	3300050496	Bacteria	3430
1266	nmdc:mga09592_147827_c1	3300050508	Bacteria	2026
1267	nmdc:mga09592_74588_c1	3300050508	Bacteria	2883
1268	nmdc:mga06r32_140222_c1	3300050510	Bacteria	1939
1269	nmdc:mga06r32_18816_c1	3300050510	Bacteria	6329
1270	nmdc:mga06r32_59951_c1	3300050510	Bacteria	3661
1271	nmdc:mga08y16_118494_c1	3300050511	Bacteria	2755
1272	nmdc:mga08y16_2717_c1	3300050511	Bacteria	18147
1273	nmdc:mga08y16_28513_c1	3300050511	Bacteria	5886
1274	nmdc:mga08y16_37696_c1	3300050511	Bacteria	5075
1275	nmdc:mga0n895_35364_c1	3300050512	Bacteria	4816
1276	nmdc:mga0rr50_161422_c1	3300050513	Bacteria	1819
1277	nmdc:mga0a205_52836_c1	3300050515	Bacteria	3921
1278	Ga0495601_0032215	3300053077	Bacteria	3262
1279	Ga0500610_0001170	3300053079	Bacteria	8670
1280	Ga0500610_0007937	3300053079	Bacteria	4590
1281	Ga0500635_0003734	3300053080	Bacteria	3856
1282	Ga0495619_0116488	3300053085	Bacteria	1829
1283	Ga0500578_0182860	3300053086	Bacteria	1291
1284	Ga0500646_0011239	3300053090	Bacteria	2301
1285	Ga0500646_0014393	3300053090	Bacteria	2053
1286	Ga0500646_0052341	3300053090	Bacteria	1181
1287	Ga0500583_0000962	3300053092	Bacteria	8195
1288	Ga0500651_0000087	3300053093	Bacteria	59423
1289	Ga0500554_001438	3300053102	Bacteria	4605
1290	Ga0500562_002673	3300053108	Bacteria	4436
1291	Ga0500571_000055	3300053110	Bacteria	35434
1292	Ga0500572_001061	3300053111	Bacteria	8155
1293	Ga0500572_006018	3300053111	Bacteria	2766
1294	Ga0500593_000202	3300053117	Bacteria	24296
1295	Ga0500595_000128	3300053119	Bacteria	49404
1296	Ga0500597_035002	3300053120	Bacteria	2088
1297	Ga0500607_000181	3300053121	Bacteria	56273
1298	Ga0500608_017594	3300053122	Bacteria	3249
1299	Ga0500614_000785	3300053123	Bacteria	8045
1300	Ga0500618_001383	3300053125	Bacteria	10943
1301	Ga0500621_000008	3300053126	Bacteria	174056
1302	Ga0500658_0002013	3300053134	Bacteria	7936
1303	Ga0500658_0002588	3300053134	Bacteria	6994
1304	Ga0500658_0005057	3300053134	Bacteria	4906
1305	Ga0500659_0000263	3300053135	Bacteria	32514
1306	Ga0500568_0000916	3300053139	Bacteria	20348
1307	Ga0500568_0001952	3300053139	Bacteria	12638
1308	Ga0500568_0009293	3300053139	Bacteria	4681
1309	Ga0500568_0019905	3300053139	Bacteria	2910
1310	Ga0500586_000762	3300053145	Bacteria	6612
1311	Ga0500586_002953	3300053145	Bacteria	3943
1312	Ga0500603_005795	3300053150	Bacteria	2671
1313	Ga0500604_0000011	3300053151	Bacteria	104892
1314	Ga0500616_0000123	3300053153	Bacteria	140214
1315	Ga0500616_0013757	3300053153	Bacteria	4680
1316	Ga0500616_0031742	3300053153	Bacteria	2891
1317	Ga0500616_0048736	3300053153	Bacteria	2244
1318	Ga0500627_0014048	3300053158	Bacteria	3057
1319	Ga0500634_0000022	3300053161	Bacteria	95424
1320	Ga0500637_0071806	3300053178	Bacteria	1991
1321	Ga0500645_000986	3300053730	Bacteria	16095
1322	Ga0501084_0010088	3300054114	Bacteria	7806
1323	Ga0501084_0018155	3300054114	Bacteria	5858
1324	Ga0530510_0000849	3300061734	Bacteria	20164

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300053086	Ga0500578_0182860	Ga0500578_0182860_11_1078	339
2	3300053090	Ga0500646_0052341	Ga0500646_0052341_44_1162	354
3	3300046648	Ga0495611_0102007	Ga0495611_0102007_153_1319	366
4	3300046648	Ga0495611_0088582	Ga0495611_0088582_14_1126	370
5	3300048928	Ga0496125_0162873	Ga0496125_0162873_38_1225	376
6	3300049706	Ga0501229_002563	Ga0501229_002563_21_1196	379
7	3300046491	Ga0495584_0079252	Ga0495584_0079252_39_1181	380
8	3300046523	Ga0495644_0036483	Ga0495644_0036483_654_1796	380
9	3300046524	Ga0495648_0013713	Ga0495648_0013713_4793_5935	380
10	3300025913	Ga0207695_10060070	Ga0207695_100600703	393
11	3300009093	Ga0105240_10018292	Ga0105240_100182927	395
12	3300025916	Ga0207663_10037006	Ga0207663_100370062	396
13	3300050510	nmdc:mga06r32_140222_c1	nmdc:mga06r32_140222_c1_363_1634	403
14	3300050512	nmdc:mga0n895_35364_c1	nmdc:mga0n895_35364_c1_146_1417	403
15	3300050513	nmdc:mga0rr50_161422_c1	nmdc:mga0rr50_161422_c1_463_1734	403
16	3300053122	Ga0500608_017594	Ga0500608_017594_1896_3182	405
17	3300031730	Ga0307516_10000012	Ga0307516_1000001214	407
18	3300046528	Ga0495642_0001974	Ga0495642_0001974_2958_4271	407
19	3300047445	Ga0495677_0003540	Ga0495677_0003540_4150_5463	407
20	3300046471	Ga0495650_0004658	Ga0495650_0004658_2874_4142	408
21	3300013104	Ga0157370_10071761	Ga0157370_100717612	409
22	3300046506	Ga0495583_0007072	Ga0495583_0007072_1468_2784	409
23	3300048927	Ga0496124_0003502	Ga0496124_0003502_4936_6195	409
24	3300025291	Ga0209675_1001812	Ga0209675_10018122	410
25	iso_pu_bacteria	2582581293	2585199334	410
26	iso_pu_bacteria	2888373701	2888378605	410
27	3300009545	Ga0105237_10003670	Ga0105237_100036702	411
28	3300009551	Ga0105238_10005070	Ga0105238_1000507013	411
29	3300025914	Ga0207671_10019667	Ga0207671_100196672	411
30	3300025924	Ga0207694_10082071	Ga0207694_100820712	411
31	3300025949	Ga0207667_10009983	Ga0207667_100099839	411
32	3300028794	Ga0307515_10010645	Ga0307515_1001064514	411
33	3300031730	Ga0307516_10017072	Ga0307516_100170725	411
34	3300046471	Ga0495650_0000653	Ga0495650_0000653_2051_3340	411
35	3300046501	Ga0495607_0005382	Ga0495607_0005382_5731_7047	411
36	3300046522	Ga0495643_0005771	Ga0495643_0005771_1415_2731	411
37	3300046524	Ga0495648_0017655	Ga0495648_0017655_1183_2499	411
38	3300046660	Ga0495625_0005525	Ga0495625_0005525_1873_3162	411
39	3300046665	Ga0495661_0003685	Ga0495661_0003685_4941_6257	411
40	3300006871	Ga0075434_100212816	Ga0075434_1002128162	412
41	3300009098	Ga0105245_10382042	Ga0105245_103820421	412
42	3300053139	Ga0500568_0001952	Ga0500568_0001952_4505_5800	412
43	iso_pu_bacteria	2738541297	2738829758	412
44	iso_pu_bacteria	2738541357	2739153554	412
45	iso_pu_bacteria	2738543003	2739195474	412
46	iso_pu_bacteria	2738543026	2739321950	412
47	iso_pu_bacteria	2738543029	2739340191	412
48	iso_pu_bacteria	2857564685	2857567039	412
49	3300003784	Ga0055534_1000858	Ga0055534_100085812	413
50	3300005354	Ga0070675_100142998	Ga0070675_1001429982	413
51	3300005441	Ga0070700_100129467	Ga0070700_1001294672	413
52	3300005459	Ga0068867_100116158	Ga0068867_1001161582	413
53	3300005549	Ga0070704_100032938	Ga0070704_1000329381	413
54	3300005844	Ga0068862_100030834	Ga0068862_1000308342	413
55	3300009094	Ga0111539_10431393	Ga0111539_104313932	413
56	3300009553	Ga0105249_10202209	Ga0105249_102022092	413
57	3300025284	Ga0209130_1001292	Ga0209130_100129213	413
58	3300025291	Ga0209675_1001682	Ga0209675_10016824	413
59	3300025291	Ga0209675_1007616	Ga0209675_10076162	413
60	3300025292	Ga0209676_1006353	Ga0209676_10063536	413
61	3300025303	Ga0209051_1014887	Ga0209051_10148874	413
62	3300025304	Ga0209257_1014976	Ga0209257_10149764	413
63	3300026089	Ga0207648_10046333	Ga0207648_100463332	413
64	3300026142	Ga0207698_10019002	Ga0207698_100190022	413
65	3300028380	Ga0268265_10049510	Ga0268265_100495102	413
66	3300039062	Ga0400483_130367	Ga0400483_130367_609_1889	413
67	iso_pu_bacteria	2513237165	2514042727	413
68	iso_pu_bacteria	2904439833	2904440015	413
69	iso_pu_bacteria	2904530477	2904531037	413
70	iso_pu_bacteria	2904584206	2904587318	413
71	iso_pu_bacteria	2904589729	2904592647	413
72	iso_pu_bacteria	2904601388	2904604571	413
73	iso_pu_bacteria	2919046199	2919050343	413
74	iso_pu_bacteria	2919079590	2919082392	413
75	3300027695	Ga0209966_1008824	Ga0209966_10088242	414
76	3300053730	Ga0500645_000986	Ga0500645_000986_11182_12438	414
77	iso_pu_bacteria	2599185169	2599411537	414
78	iso_pu_bacteria	2600255254	2601524790	414
79	iso_pu_bacteria	2600255255	2601529944	414
80	iso_pu_bacteria	2600255280	2601616778	414
81	iso_pu_bacteria	2600255281	2601621500	414
82	iso_pu_bacteria	2600255288	2601649896	414
83	iso_pu_bacteria	2600255289	2601654824	414
84	iso_pu_bacteria	2600255290	2601659903	414
85	iso_pu_bacteria	2600255300	2601707567	414
86	iso_pu_bacteria	2600255301	2601712588	414
87	iso_pu_bacteria	2600255302	2601718084	414
88	iso_pu_bacteria	2600255304	2601728012	414
89	iso_pu_bacteria	2600255305	2601733029	414
90	iso_pu_bacteria	2600255306	2601737202	414
91	iso_pu_bacteria	2600255307	2601741619	414
92	iso_pu_bacteria	2600255309	2601752519	414
93	iso_pu_bacteria	2600255392	2602019909	414
94	iso_pu_bacteria	2602042103	2603840439	414
95	iso_pu_bacteria	2602042104	2603845516	414
96	iso_pu_bacteria	2602042105	2603850590	414
97	iso_pu_bacteria	2602042106	2603855656	414
98	iso_pu_bacteria	2602042110	2603872895	414
99	iso_pu_bacteria	2603880178	2606050418	414
100	iso_pu_bacteria	2603880202	2606148100	414
101	iso_pu_bacteria	2603880211	2606177965	414
102	iso_pu_bacteria	2636415599	2637222671	414
103	iso_pu_bacteria	2675903046	2676409057	414
104	iso_pu_bacteria	2738543012	2739246634	414
105	iso_pu_bacteria	2775507074	2777021017	414
106	iso_pu_bacteria	2842711865	2842715387	414
107	iso_pu_bacteria	2884086401	2884088787	414
108	iso_pu_bacteria	2885266251	2885267961	414
109	iso_pu_bacteria	2904513164	2904516415	414
110	iso_pu_bacteria	2969079654	2969079700	414
111	iso_pu_bacteria	2984559226	2984562137	414
112	iso_pu_bacteria	2984595703	2984600201	414
113	3300006846	Ga0075430_100156694	Ga0075430_1001566942	415
114	3300006847	Ga0075431_100051549	Ga0075431_1000515492	415
115	3300046463	Ga0495653_0000002	Ga0495653_0000002_295867_297147	415
116	3300047472	Ga0495686_0122045	Ga0495686_0122045_45_1331	415
117	3300048912	Ga0496109_0064284	Ga0496109_0064284_528_1877	415
118	3300048913	Ga0496110_0094647	Ga0496110_0094647_998_2347	415
119	3300048925	Ga0496122_0016368	Ga0496122_0016368_4468_5748	415
120	3300048926	Ga0496123_0033423	Ga0496123_0033423_385_1665	415
121	3300050510	nmdc:mga06r32_18816_c1	nmdc:mga06r32_18816_c1_1897_3165	415
122	3300053153	Ga0500616_0013757	Ga0500616_0013757_2610_3896	415
123	iso_pu_bacteria	2511231025	2511382952	415
124	iso_pu_bacteria	2511231035	2511437203	415
125	iso_pu_bacteria	2515154123	2515687859	415
126	iso_pu_bacteria	2599185214	2599624800	415
127	iso_pu_bacteria	2599185226	2599672812	415
128	iso_pu_bacteria	2599185227	2599682738	415
129	iso_pu_bacteria	2599185229	2599694421	415
130	iso_pu_bacteria	2643221644	2644243913	415
131	iso_pu_bacteria	2643221658	2644329134	415
132	iso_pu_bacteria	2738541277	2738721064	415
133	iso_pu_bacteria	2738541307	2738885746	415
134	iso_pu_bacteria	2738543013	2739249153	415
135	iso_pu_bacteria	2738543019	2739280263	415
136	iso_pu_bacteria	2765235838	2765570808	415
137	iso_pu_bacteria	2831265667	2831265860	415
138	iso_pu_bacteria	2839094727	2839099486	415
139	iso_pu_bacteria	2857553236	2857554548	415
140	iso_pu_bacteria	2876601092	2876603870	415
141	iso_pu_bacteria	2885198086	2885203510	415
142	iso_pu_bacteria	2885211737	2885217140	415
143	iso_pu_bacteria	2897803580	2897809489	415
144	iso_pu_bacteria	2928070936	2928074841	415
145	iso_pu_bacteria	2928084124	2928088990	415
146	iso_pu_bacteria	2945909444	2945911469	415
147	iso_pu_bacteria	2945945610	2945948457	415
148	iso_pu_bacteria	2945984333	2945986190	415
149	iso_pu_bacteria	8016733728	8016735564	415
150	iso_pu_bacteria	8019499862	8019501048	415
151	iso_pu_bacteria	8047673197	8047678373	415
152	3300003771	Ga0055526_1000029	Ga0055526_100002976	416
153	3300005290	Ga0065712_10003084	Ga0065712_100030843	416
154	3300005330	Ga0070690_100017995	Ga0070690_1000179954	416
155	3300005331	Ga0070670_100018510	Ga0070670_1000185103	416
156	3300005335	Ga0070666_10018832	Ga0070666_100188323	416
157	3300005338	Ga0068868_100006003	Ga0068868_1000060032	416
158	3300005340	Ga0070689_100007130	Ga0070689_1000071306	416
159	3300005347	Ga0070668_100016173	Ga0070668_1000161732	416
160	3300005354	Ga0070675_100029569	Ga0070675_1000295694	416
161	3300005364	Ga0070673_100058066	Ga0070673_1000580663	416
162	3300005367	Ga0070667_100011654	Ga0070667_1000116545	416
163	3300005441	Ga0070700_100016149	Ga0070700_1000161494	416
164	3300005457	Ga0070662_100010589	Ga0070662_1000105896	416
165	3300005459	Ga0068867_100059777	Ga0068867_1000597772	416
166	3300005564	Ga0070664_100001174	Ga0070664_10000117417	416
167	3300005617	Ga0068859_100019898	Ga0068859_1000198985	416
168	3300005618	Ga0068864_100173034	Ga0068864_1001730341	416
169	3300005834	Ga0068851_10080112	Ga0068851_100801122	416
170	3300005840	Ga0068870_10003062	Ga0068870_100030623	416
171	3300005842	Ga0068858_100054907	Ga0068858_1000549073	416
172	3300005844	Ga0068862_100003593	Ga0068862_1000035937	416
173	3300006051	Ga0075364_10058324	Ga0075364_100583242	416
174	3300006844	Ga0075428_100010377	Ga0075428_1000103775	416
175	3300006844	Ga0075428_100368748	Ga0075428_1003687481	416
176	3300006846	Ga0075430_100119123	Ga0075430_1001191232	416
177	3300006847	Ga0075431_100082765	Ga0075431_1000827656	416
178	3300006871	Ga0075434_100044153	Ga0075434_1000441534	416
179	3300006931	Ga0097620_100019898	Ga0097620_1000198985	416
180	3300009094	Ga0111539_10007019	Ga0111539_100070194	416
181	3300009094	Ga0111539_10034297	Ga0111539_100342977	416
182	3300009098	Ga0105245_10015387	Ga0105245_100153875	416
183	3300009101	Ga0105247_10001278	Ga0105247_100012783	416
184	3300009147	Ga0114129_10117177	Ga0114129_101171772	416
185	3300009147	Ga0114129_10512887	Ga0114129_105128872	416
186	3300009177	Ga0105248_10060967	Ga0105248_100609672	416
187	3300009177	Ga0105248_10119350	Ga0105248_101193502	416
188	3300013105	Ga0157369_10171371	Ga0157369_101713711	416
189	3300013296	Ga0157374_10084327	Ga0157374_100843272	416
190	3300013306	Ga0163162_10449607	Ga0163162_104496071	416
191	3300013308	Ga0157375_10015373	Ga0157375_100153733	416
192	3300014325	Ga0163163_10006514	Ga0163163_100065144	416
193	3300014326	Ga0157380_10000839	Ga0157380_100008393	416
194	3300014326	Ga0157380_10005948	Ga0157380_100059487	416
195	3300014968	Ga0157379_10045070	Ga0157379_100450702	416
196	3300017792	Ga0163161_10208328	Ga0163161_102083281	416
197	3300021361	Ga0213872_10011103	Ga0213872_100111032	416
198	3300025295	Ga0209564_1000009	Ga0209564_100000957	416
199	3300025900	Ga0207710_10018994	Ga0207710_100189942	416
200	3300025907	Ga0207645_10000468	Ga0207645_1000046817	416
201	3300025908	Ga0207643_10075807	Ga0207643_100758071	416
202	3300025917	Ga0207660_10046395	Ga0207660_100463953	416
203	3300025923	Ga0207681_10053201	Ga0207681_100532012	416
204	3300025926	Ga0207659_10004217	Ga0207659_100042172	416
205	3300025931	Ga0207644_10114271	Ga0207644_101142712	416
206	3300025933	Ga0207706_10000373	Ga0207706_1000037322	416
207	3300025937	Ga0207669_10033360	Ga0207669_100333602	416
208	3300025945	Ga0207679_10094040	Ga0207679_100940402	416
209	3300025972	Ga0207668_10018656	Ga0207668_100186562	416
210	3300026075	Ga0207708_10013707	Ga0207708_100137076	416
211	3300026089	Ga0207648_10001331	Ga0207648_1000133117	416
212	3300026118	Ga0207675_100001273	Ga0207675_10000127315	416
213	3300027424	Ga0209984_1004684	Ga0209984_10046841	416
214	3300027526	Ga0209968_1005641	Ga0209968_10056411	416
215	3300027543	Ga0209999_1001555	Ga0209999_10015555	416
216	3300027552	Ga0209982_1000876	Ga0209982_10008765	416
217	3300027614	Ga0209970_1000847	Ga0209970_10008472	416
218	3300027617	Ga0210002_1000558	Ga0210002_10005586	416
219	3300027665	Ga0209983_1001365	Ga0209983_10013653	416
220	3300027682	Ga0209971_1000082	Ga0209971_100008215	416
221	3300027717	Ga0209998_10002270	Ga0209998_100022703	416
222	3300027876	Ga0209974_10001729	Ga0209974_100017292	416
223	3300027907	Ga0207428_10016608	Ga0207428_100166085	416
224	3300028381	Ga0268264_10052211	Ga0268264_100522113	416
225	3300028794	Ga0307515_10123822	Ga0307515_101238222	416
226	3300031251	Ga0265327_10002703	Ga0265327_1000270313	416
227	3300036401	Ga0373937_0062386	Ga0373937_0062386_2026_3321	416
228	3300038443	Ga0395901_0208689	Ga0395901_0208689_525_1832	416
229	3300042436	Ga0439435_0001509	Ga0439435_0001509_1511_2803	416
230	3300042461	Ga0439460_0022593	Ga0439460_0022593_325_1617	416
231	3300046452	Ga0495617_000003	Ga0495617_000003_110021_111304	416
232	3300046460	Ga0495638_0000704	Ga0495638_0000704_20664_21971	416
233	3300046471	Ga0495650_0000457	Ga0495650_0000457_48423_49706	416
234	3300046474	Ga0495605_0000068	Ga0495605_0000068_82589_83881	416
235	3300046492	Ga0495585_0003309	Ga0495585_0003309_4515_5798	416
236	3300046507	Ga0495606_0000001	Ga0495606_0000001_141623_142906	416
237	3300046512	Ga0495610_0000003	Ga0495610_0000003_801944_803227	416
238	3300046522	Ga0495643_0020791	Ga0495643_0020791_559_1869	416
239	3300046524	Ga0495648_0000328	Ga0495648_0000328_19520_20803	416
240	3300046524	Ga0495648_0005227	Ga0495648_0005227_4622_5905	416
241	3300046530	Ga0495654_0029464	Ga0495654_0029464_1161_2444	416
242	3300046538	Ga0495609_0000647	Ga0495609_0000647_17184_18494	416
243	3300046539	Ga0495621_0007507	Ga0495621_0007507_1779_3074	416
244	3300046558	Ga0495633_0008132	Ga0495633_0008132_3801_5084	416
245	3300046558	Ga0495633_0012823	Ga0495633_0012823_1807_3090	416
246	3300046558	Ga0495633_0060113	Ga0495633_0060113_332_1627	416
247	3300046616	Ga0495668_0000095	Ga0495668_0000095_8865_10148	416
248	3300046616	Ga0495668_0000437	Ga0495668_0000437_4535_5818	416
249	3300046660	Ga0495625_0008089	Ga0495625_0008089_6985_8292	416
250	3300046665	Ga0495661_0018529	Ga0495661_0018529_3111_4394	416
251	3300046681	Ga0495647_0005917	Ga0495647_0005917_1948_3243	416
252	3300046692	Ga0495671_0000010	Ga0495671_0000010_45104_46387	416
253	3300046692	Ga0495671_0026337	Ga0495671_0026337_1222_2505	416
254	3300046810	Ga0495660_0005766	Ga0495660_0005766_2300_3583	416
255	3300047469	Ga0495673_0000003	Ga0495673_0000003_1122891_1124174	416
256	3300047469	Ga0495673_0000016	Ga0495673_0000016_397574_398857	416
257	3300047470	Ga0495681_0013981	Ga0495681_0013981_798_2108	416
258	3300048908	Ga0496105_0180318	Ga0496105_0180318_204_1493	416
259	3300048912	Ga0496109_0051231	Ga0496109_0051231_156_1445	416
260	3300048915	Ga0496112_0114194	Ga0496112_0114194_779_2068	416
261	3300048916	Ga0496113_0053960	Ga0496113_0053960_1142_2440	416
262	3300048916	Ga0496113_0062684	Ga0496113_0062684_1212_2501	416
263	3300048917	Ga0496114_0112233	Ga0496114_0112233_584_1873	416
264	3300048918	Ga0496115_0155001	Ga0496115_0155001_264_1553	416
265	3300048919	Ga0496116_0063076	Ga0496116_0063076_463_1746	416
266	3300048929	Ga0496126_0013643	Ga0496126_0013643_4645_5928	416
267	3300049574	Ga0501038_0112754	Ga0501038_0112754_497_1792	416
268	3300049578	Ga0501042_0001360	Ga0501042_0001360_667_1962	416
269	3300049580	Ga0501046_0121027	Ga0501046_0121027_309_1604	416
270	3300049582	Ga0501048_0135599	Ga0501048_0135599_56_1363	416
271	3300049588	Ga0501072_0026532	Ga0501072_0026532_2424_3719	416
272	3300049592	Ga0501076_0023117	Ga0501076_0023117_693_1988	416
273	3300049743	Ga0501081_0003568	Ga0501081_0003568_1615_2910	416
274	3300050508	nmdc:mga09592_147827_c1	nmdc:mga09592_147827_c1_197_1486	416
275	3300050508	nmdc:mga09592_74588_c1	nmdc:mga09592_74588_c1_876_2168	416
276	3300050510	nmdc:mga06r32_59951_c1	nmdc:mga06r32_59951_c1_773_2065	416
277	3300050511	nmdc:mga08y16_37696_c1	nmdc:mga08y16_37696_c1_3534_4826	416
278	3300050515	nmdc:mga0a205_52836_c1	nmdc:mga0a205_52836_c1_1408_2721	416
279	3300053090	Ga0500646_0011239	Ga0500646_0011239_623_1912	416
280	3300053092	Ga0500583_0000962	Ga0500583_0000962_3713_5008	416
281	3300053111	Ga0500572_001061	Ga0500572_001061_3156_4466	416
282	3300053120	Ga0500597_035002	Ga0500597_035002_413_1723	416
283	3300053139	Ga0500568_0000916	Ga0500568_0000916_10666_11955	416
284	3300053139	Ga0500568_0019905	Ga0500568_0019905_473_1771	416
285	3300053145	Ga0500586_002953	Ga0500586_002953_1733_3016	416
286	3300053151	Ga0500604_0000011	Ga0500604_0000011_90313_91602	416
287	3300053153	Ga0500616_0000123	Ga0500616_0000123_111391_112680	416
288	3300053153	Ga0500616_0031742	Ga0500616_0031742_180_1478	416
289	3300054114	Ga0501084_0018155	Ga0501084_0018155_4081_5376	416
290	iso_pu_bacteria	2501025502	2501083542	416
291	iso_pu_bacteria	2508501071	2508852116	416
292	iso_pu_bacteria	2510917013	2511087627	416
293	iso_pu_bacteria	2511231006	2511265332	416
294	iso_pu_bacteria	2511231008	2511280482	416
295	iso_pu_bacteria	2511231012	2511299815	416
296	iso_pu_bacteria	2511231021	2511358578	416
297	iso_pu_bacteria	2511231022	2511362490	416
298	iso_pu_bacteria	2511231023	2511368636	416
299	iso_pu_bacteria	2511231031	2511414197	416
300	iso_pu_bacteria	2515154189	2516023852	416
301	iso_pu_bacteria	2643221565	2643843685	416
302	iso_pu_bacteria	2667528173	2671110734	416
303	iso_pu_bacteria	2806310673	2807177977	416
304	iso_pu_bacteria	2856287931	2856294560	416
305	iso_pu_bacteria	2857357740	2857367933	416
306	iso_pu_bacteria	2883087390	2883088208	416
307	iso_pu_bacteria	2904474040	2904479161	416
308	iso_pu_bacteria	2904504865	2904508937	416
309	iso_pu_bacteria	2919150387	2919155465	416
310	iso_pu_bacteria	2927143783	2927148879	416
311	iso_pu_bacteria	3007619802	3007622834	416
312	iso_pu_bacteria	640753048	640937634	416
313	iso_pu_bacteria	8055878733	8055879207	416
314	iso_pu_bacteria	8056177738	8056182468	416
315	3300003187	JGI25151J46595_10000545	JGI25151J46595_1000054518	417
316	3300003771	Ga0055526_1000336	Ga0055526_100033619	417
317	3300003771	Ga0055526_1004371	Ga0055526_10043711	417
318	3300003773	Ga0055537_1006490	Ga0055537_10064904	417
319	3300003775	Ga0055524_1004746	Ga0055524_10047463	417
320	3300003784	Ga0055534_1000341	Ga0055534_100034110	417
321	3300003784	Ga0055534_1000777	Ga0055534_10007777	417
322	3300005330	Ga0070690_100155360	Ga0070690_1001553601	417
323	3300005331	Ga0070670_100005621	Ga0070670_1000056219	417
324	3300005333	Ga0070677_10041730	Ga0070677_100417302	417
325	3300005335	Ga0070666_10117540	Ga0070666_101175401	417
326	3300005340	Ga0070689_100065581	Ga0070689_1000655813	417
327	3300005340	Ga0070689_100145098	Ga0070689_1001450982	417
328	3300005353	Ga0070669_100090041	Ga0070669_1000900412	417
329	3300005354	Ga0070675_100003706	Ga0070675_1000037066	417
330	3300005354	Ga0070675_100022106	Ga0070675_1000221063	417
331	3300005356	Ga0070674_100029162	Ga0070674_1000291623	417
332	3300005364	Ga0070673_100002395	Ga0070673_10000239510	417
333	3300005471	Ga0070698_100053957	Ga0070698_1000539572	417
334	3300005543	Ga0070672_100047779	Ga0070672_1000477792	417
335	3300005543	Ga0070672_100105229	Ga0070672_1001052291	417
336	3300005544	Ga0070686_100098217	Ga0070686_1000982171	417
337	3300005564	Ga0070664_100015701	Ga0070664_1000157013	417
338	3300005617	Ga0068859_100041445	Ga0068859_1000414454	417
339	3300005618	Ga0068864_100000610	Ga0068864_10000061026	417
340	3300005840	Ga0068870_10006663	Ga0068870_100066634	417
341	3300006844	Ga0075428_100034006	Ga0075428_1000340064	417
342	3300006844	Ga0075428_100379620	Ga0075428_1003796202	417
343	3300006880	Ga0075429_100197686	Ga0075429_1001976862	417
344	3300006914	Ga0075436_100040861	Ga0075436_1000408612	417
345	3300006931	Ga0097620_100041444	Ga0097620_1000414442	417
346	3300009094	Ga0111539_10254536	Ga0111539_102545362	417
347	3300009147	Ga0114129_10076380	Ga0114129_100763804	417
348	3300009176	Ga0105242_10016387	Ga0105242_100163873	417
349	3300009553	Ga0105249_10123365	Ga0105249_101233652	417
350	3300013296	Ga0157374_10164759	Ga0157374_101647592	417
351	3300013297	Ga0157378_10122788	Ga0157378_101227882	417
352	3300013308	Ga0157375_10444390	Ga0157375_104443901	417
353	3300014325	Ga0163163_10166800	Ga0163163_101668002	417
354	3300014326	Ga0157380_10349020	Ga0157380_103490201	417
355	3300014969	Ga0157376_10192791	Ga0157376_101927911	417
356	3300015261	Ga0182006_1000802	Ga0182006_10008029	417
357	3300021361	Ga0213872_10000547	Ga0213872_1000054721	417
358	3300025263	Ga0209565_1000086	Ga0209565_1000086114	417
359	3300025273	Ga0209673_1027486	Ga0209673_10274861	417
360	3300025291	Ga0209675_1000402	Ga0209675_100040210	417
361	3300025291	Ga0209675_1000510	Ga0209675_100051017	417
362	3300025291	Ga0209675_1001661	Ga0209675_10016616	417
363	3300025294	Ga0209025_1000059	Ga0209025_1000059173	417
364	3300025295	Ga0209564_1000814	Ga0209564_100081420	417
365	3300025295	Ga0209564_1002095	Ga0209564_10020958	417
366	3300025299	Ga0209256_1003909	Ga0209256_10039097	417
367	3300025893	Ga0207682_10069584	Ga0207682_100695841	417
368	3300025908	Ga0207643_10015442	Ga0207643_100154424	417
369	3300025923	Ga0207681_10079199	Ga0207681_100791992	417
370	3300025926	Ga0207659_10001686	Ga0207659_100016865	417
371	3300025926	Ga0207659_10002585	Ga0207659_100025857	417
372	3300025926	Ga0207659_10010497	Ga0207659_100104977	417
373	3300025926	Ga0207659_10119384	Ga0207659_101193842	417
374	3300025934	Ga0207686_10008277	Ga0207686_100082773	417
375	3300025937	Ga0207669_10004206	Ga0207669_100042064	417
376	3300025940	Ga0207691_10005382	Ga0207691_1000538210	417
377	3300025945	Ga0207679_10002182	Ga0207679_100021828	417
378	3300026095	Ga0207676_10200618	Ga0207676_102006182	417
379	3300027907	Ga0207428_10000992	Ga0207428_1000099217	417
380	3300028380	Ga0268265_10029642	Ga0268265_100296421	417
381	3300031548	Ga0307408_100021397	Ga0307408_1000213973	417
382	3300031824	Ga0307413_10032890	Ga0307413_100328902	417
383	3300039447	Ga0436361_0527730	Ga0436361_0527730_29362_30669	417
384	3300044672	Ga0466982_0063647	Ga0466982_0063647_662_1996	417
385	3300044765	Ga0466970_0012874	Ga0466970_0012874_920_2254	417
386	3300046472	Ga0495580_0122801	Ga0495580_0122801_32_1294	417
387	3300046542	Ga0495597_0000762	Ga0495597_0000762_7011_8384	417
388	3300046616	Ga0495668_0000160	Ga0495668_0000160_78010_79320	417
389	3300046689	Ga0495613_0025973	Ga0495613_0025973_921_2183	417
390	3300047318	Ga0495636_0013102	Ga0495636_0013102_854_2131	417
391	3300047469	Ga0495673_0000008	Ga0495673_0000008_434433_435731	417
392	3300047471	Ga0495684_0030064	Ga0495684_0030064_2544_3806	417
393	3300050511	nmdc:mga08y16_28513_c1	nmdc:mga08y16_28513_c1_3941_5227	417
394	3300053090	Ga0500646_0014393	Ga0500646_0014393_478_1743	417
395	3300053102	Ga0500554_001438	Ga0500554_001438_155_1420	417
396	3300053111	Ga0500572_006018	Ga0500572_006018_469_1734	417
397	3300053119	Ga0500595_000128	Ga0500595_000128_5030_6295	417
398	3300053123	Ga0500614_000785	Ga0500614_000785_1168_2433	417
399	3300053161	Ga0500634_0000022	Ga0500634_0000022_76514_77809	417
400	3300053178	Ga0500637_0071806	Ga0500637_0071806_113_1378	417
401	3300003187	JGI25151J46595_10023724	JGI25151J46595_100237242	418
402	3300005262	Ga0065165_1000864	Ga0065165_100086426	418
403	3300005327	Ga0070658_10037808	Ga0070658_100378082	418
404	3300005330	Ga0070690_100000582	Ga0070690_10000058219	418
405	3300005331	Ga0070670_100000908	Ga0070670_1000009083	418
406	3300005338	Ga0068868_100007388	Ga0068868_1000073883	418
407	3300005355	Ga0070671_100056568	Ga0070671_1000565683	418
408	3300005364	Ga0070673_100002894	Ga0070673_1000028949	418
409	3300005543	Ga0070672_100010424	Ga0070672_1000104246	418
410	3300005563	Ga0068855_100006069	Ga0068855_1000060698	418
411	3300005563	Ga0068855_100010543	Ga0068855_1000105439	418
412	3300005564	Ga0070664_100014017	Ga0070664_1000140176	418
413	3300005616	Ga0068852_100009549	Ga0068852_1000095496	418
414	3300005618	Ga0068864_100003181	Ga0068864_1000031813	418
415	3300005834	Ga0068851_10047877	Ga0068851_100478772	418
416	3300005841	Ga0068863_100029681	Ga0068863_1000296811	418
417	3300005842	Ga0068858_100078123	Ga0068858_1000781232	418
418	3300006195	Ga0075366_10002623	Ga0075366_100026234	418
419	3300006237	Ga0097621_100033043	Ga0097621_1000330435	418
420	3300006237	Ga0097621_100192502	Ga0097621_1001925022	418
421	3300006358	Ga0068871_100018685	Ga0068871_1000186857	418
422	3300006948	Ga0099826_10000011	Ga0099826_10000011173	418
423	3300009011	Ga0105251_10000034	Ga0105251_1000003425	418
424	3300009036	Ga0105244_10000879	Ga0105244_1000087920	418
425	3300009036	Ga0105244_10011482	Ga0105244_100114822	418
426	3300009092	Ga0105250_10000051	Ga0105250_1000005156	418
427	3300009092	Ga0105250_10000063	Ga0105250_1000006322	418
428	3300009092	Ga0105250_10027849	Ga0105250_100278492	418
429	3300009093	Ga0105240_10005568	Ga0105240_100055688	418
430	3300009094	Ga0111539_10004431	Ga0111539_1000443117	418
431	3300009094	Ga0111539_10073901	Ga0111539_100739012	418
432	3300009177	Ga0105248_10021815	Ga0105248_100218153	418
433	3300009551	Ga0105238_10005281	Ga0105238_1000528111	418
434	3300013105	Ga0157369_10000908	Ga0157369_1000090821	418
435	3300013296	Ga0157374_10126992	Ga0157374_101269923	418
436	3300013306	Ga0163162_10002499	Ga0163162_100024996	418
437	3300013307	Ga0157372_10001580	Ga0157372_1000158021	418
438	3300013308	Ga0157375_10018429	Ga0157375_100184294	418
439	3300014325	Ga0163163_10028116	Ga0163163_100281163	418
440	3300014325	Ga0163163_10050974	Ga0163163_100509743	418
441	3300014325	Ga0163163_10163109	Ga0163163_101631092	418
442	3300014969	Ga0157376_10101313	Ga0157376_101013131	418
443	3300025294	Ga0209025_1000550	Ga0209025_100055050	418
444	3300025299	Ga0209256_1000086	Ga0209256_100008698	418
445	3300025303	Ga0209051_1004380	Ga0209051_10043809	418
446	3300025711	Ga0207696_1000045	Ga0207696_1000045193	418
447	3300025711	Ga0207696_1000092	Ga0207696_1000092105	418
448	3300025728	Ga0207655_1000077	Ga0207655_1000077118	418
449	3300025728	Ga0207655_1002032	Ga0207655_100203217	418
450	3300025735	Ga0207713_1000030	Ga0207713_1000030183	418
451	3300025735	Ga0207713_1008648	Ga0207713_10086482	418
452	3300025909	Ga0207705_10019376	Ga0207705_100193763	418
453	3300025913	Ga0207695_10012724	Ga0207695_100127246	418
454	3300025940	Ga0207691_10009253	Ga0207691_100092539	418
455	3300025945	Ga0207679_10005820	Ga0207679_100058207	418
456	3300025949	Ga0207667_10025544	Ga0207667_100255445	418
457	3300026035	Ga0207703_10011310	Ga0207703_100113107	418
458	3300026088	Ga0207641_10039784	Ga0207641_100397841	418
459	3300026142	Ga0207698_10015973	Ga0207698_100159737	418
460	3300027312	Ga0209371_1000925	Ga0209371_10009257	418
461	3300027471	Ga0209995_1004132	Ga0209995_10041322	418
462	3300027665	Ga0209983_1000556	Ga0209983_10005566	418
463	3300027666	Ga0209282_1000050	Ga0209282_10000507	418
464	3300027907	Ga0207428_10011268	Ga0207428_100112682	418
465	3300030500	Ga0268256_1000778	Ga0268256_10007787	418
466	3300031507	Ga0307509_10000403	Ga0307509_100004038	418
467	3300031548	Ga0307408_100004395	Ga0307408_1000043956	418
468	3300031731	Ga0307405_10005948	Ga0307405_100059482	418
469	3300031824	Ga0307413_10007430	Ga0307413_100074305	418
470	3300031852	Ga0307410_10000247	Ga0307410_1000024710	418
471	3300031901	Ga0307406_10146121	Ga0307406_101461212	418
472	3300031903	Ga0307407_10021464	Ga0307407_100214642	418
473	3300031995	Ga0307409_100000408	Ga0307409_1000004085	418
474	3300032002	Ga0307416_100002565	Ga0307416_1000025659	418
475	3300032005	Ga0307411_10019099	Ga0307411_100190993	418
476	3300032126	Ga0307415_100001299	Ga0307415_1000012994	418
477	3300035170	Ga0373943_0083992	Ga0373943_0083992_78_1382	418
478	3300036401	Ga0373937_0062450	Ga0373937_0062450_591_1895	418
479	3300037418	Ga0395900_0043040	Ga0395900_0043040_2765_4057	418
480	3300037466	Ga0395898_0141685	Ga0395898_0141685_839_2155	418
481	3300037471	Ga0395905_0006102	Ga0395905_0006102_1701_3239	418
482	3300037471	Ga0395905_0141978	Ga0395905_0141978_501_1817	418
483	3300046454	Ga0495592_0028266	Ga0495592_0028266_34_1320	418
484	3300046474	Ga0495605_0032237	Ga0495605_0032237_30_1346	418
485	3300046492	Ga0495585_0000998	Ga0495585_0000998_9471_10727	418
486	3300046492	Ga0495585_0019453	Ga0495585_0019453_1090_2394	418
487	3300046500	Ga0495596_0000099	Ga0495596_0000099_31757_33061	418
488	3300046500	Ga0495596_0000127	Ga0495596_0000127_39626_40951	418
489	3300046500	Ga0495596_0004131	Ga0495596_0004131_2412_3728	418
490	3300046501	Ga0495607_0001668	Ga0495607_0001668_5120_6421	418
491	3300046501	Ga0495607_0002057	Ga0495607_0002057_6431_7687	418
492	3300046506	Ga0495583_0000011	Ga0495583_0000011_178582_179904	418
493	3300046506	Ga0495583_0012001	Ga0495583_0012001_1676_2992	418
494	3300046507	Ga0495606_0009348	Ga0495606_0009348_2416_3729	418
495	3300046511	Ga0495608_0008161	Ga0495608_0008161_3508_4794	418
496	3300046512	Ga0495610_0000395	Ga0495610_0000395_31532_32857	418
497	3300046512	Ga0495610_0005195	Ga0495610_0005195_4237_5550	418
498	3300046513	Ga0495616_0000150	Ga0495616_0000150_4749_6065	418
499	3300046513	Ga0495616_0004691	Ga0495616_0004691_3947_5272	418
500	3300046518	Ga0495631_0000337	Ga0495631_0000337_8871_10187	418
501	3300046519	Ga0495632_0001225	Ga0495632_0001225_19110_20411	418
502	3300046522	Ga0495643_0000029	Ga0495643_0000029_184933_186189	418
503	3300046522	Ga0495643_0000240	Ga0495643_0000240_1562_2875	418
504	3300046522	Ga0495643_0003017	Ga0495643_0003017_4545_5861	418
505	3300046522	Ga0495643_0006904	Ga0495643_0006904_2976_4370	418
506	3300046523	Ga0495644_0003569	Ga0495644_0003569_1406_2722	418
507	3300046523	Ga0495644_0011164	Ga0495644_0011164_833_2137	418
508	3300046528	Ga0495642_0008864	Ga0495642_0008864_2369_3763	418
509	3300046538	Ga0495609_0002277	Ga0495609_0002277_1544_2869	418
510	3300046558	Ga0495633_0000181	Ga0495633_0000181_45607_46926	418
511	3300046558	Ga0495633_0004718	Ga0495633_0004718_5548_6861	418
512	3300046559	Ga0495667_0000871	Ga0495667_0000871_12379_13665	418
513	3300046660	Ga0495625_0003315	Ga0495625_0003315_1547_2860	418
514	3300046665	Ga0495661_0000051	Ga0495661_0000051_69785_71041	418
515	3300046665	Ga0495661_0001634	Ga0495661_0001634_4938_6263	418
516	3300046665	Ga0495661_0026769	Ga0495661_0026769_1525_2919	418
517	3300046675	Ga0495657_0010750	Ga0495657_0010750_415_1701	418
518	3300046683	Ga0495658_0020477	Ga0495658_0020477_397_1701	418
519	3300046684	Ga0495669_0010668	Ga0495669_0010668_1579_2883	418
520	3300046689	Ga0495613_0016452	Ga0495613_0016452_2121_3407	418
521	3300046691	Ga0495670_0000363	Ga0495670_0000363_8114_9418	418
522	3300046691	Ga0495670_0065507	Ga0495670_0065507_507_1811	418
523	3300046692	Ga0495671_0000239	Ga0495671_0000239_41130_42455	418
524	3300046694	Ga0495649_0006019	Ga0495649_0006019_4365_5678	418
525	3300046694	Ga0495649_0006666	Ga0495649_0006666_601_1917	418
526	3300046694	Ga0495649_0014673	Ga0495649_0014673_2481_3806	418
527	3300046794	Ga0495589_0002249	Ga0495589_0002249_4987_6303	418
528	3300046810	Ga0495660_0046239	Ga0495660_0046239_509_1822	418
529	3300047319	Ga0495674_0132643	Ga0495674_0132643_597_1883	418
530	3300047320	Ga0495672_0000005	Ga0495672_0000005_243087_244400	418
531	3300047320	Ga0495672_0000334	Ga0495672_0000334_18598_19911	418
532	3300047320	Ga0495672_0005289	Ga0495672_0005289_6901_8226	418
533	3300047323	Ga0495683_0009297	Ga0495683_0009297_136_1392	418
534	3300047443	Ga0495687_008684	Ga0495687_008684_887_2281	418
535	3300047445	Ga0495677_0011408	Ga0495677_0011408_261_1577	418
536	3300047447	Ga0495685_022136	Ga0495685_022136_158_1483	418
537	3300048906	Ga0496103_0027070	Ga0496103_0027070_1597_2913	418
538	3300048917	Ga0496114_0001183	Ga0496114_0001183_12807_14129	418
539	3300048919	Ga0496116_0005625	Ga0496116_0005625_2254_3579	418
540	3300048921	Ga0496118_0003581	Ga0496118_0003581_12637_13959	418
541	3300048924	Ga0496121_0018632	Ga0496121_0018632_5153_6478	418
542	3300048925	Ga0496122_0004024	Ga0496122_0004024_5181_6506	418
543	3300048925	Ga0496122_0007948	Ga0496122_0007948_10015_11271	418
544	3300048926	Ga0496123_0001070	Ga0496123_0001070_32783_34039	418
545	3300048926	Ga0496123_0001605	Ga0496123_0001605_17216_18541	418
546	3300048928	Ga0496125_0056898	Ga0496125_0056898_906_2231	418
547	3300048928	Ga0496125_0107294	Ga0496125_0107294_703_2025	418
548	3300048929	Ga0496126_0011608	Ga0496126_0011608_2801_4063	418
549	3300049459	Ga0495678_000060	Ga0495678_000060_107231_108547	418
550	3300049459	Ga0495678_000478	Ga0495678_000478_4654_5967	418
551	3300049459	Ga0495678_003319	Ga0495678_003319_4014_5327	418
552	3300049460	Ga0495682_0000035	Ga0495682_0000035_69242_70558	418
553	3300050493	nmdc:mga0k408_57471_c1	nmdc:mga0k408_57471_c1_798_2057	418
554	3300050494	nmdc:mga06z11_98320_c1	nmdc:mga06z11_98320_c1_123_1382	418
555	3300050511	nmdc:mga08y16_118494_c1	nmdc:mga08y16_118494_c1_1046_2350	418
556	3300050511	nmdc:mga08y16_2717_c1	nmdc:mga08y16_2717_c1_1226_2563	418
557	3300053077	Ga0495601_0032215	Ga0495601_0032215_104_1408	418
558	3300053085	Ga0495619_0116488	Ga0495619_0116488_226_1512	418
559	3300053125	Ga0500618_001383	Ga0500618_001383_6830_8086	418
560	3300053145	Ga0500586_000762	Ga0500586_000762_3906_5219	418
561	3300002773	JGI25152J39213_1000240	JGI25152J39213_100024020	419
562	3300002774	JGI25150J39212_1000170	JGI25150J39212_100017020	419
563	3300003187	JGI25151J46595_10000109	JGI25151J46595_1000010915	419
564	3300003187	JGI25151J46595_10000577	JGI25151J46595_1000057726	419
565	3300003187	JGI25151J46595_10003021	JGI25151J46595_100030216	419
566	3300003215	JGI25153J46596_10000084	JGI25153J46596_1000008415	419
567	3300003215	JGI25153J46596_10002993	JGI25153J46596_100029936	419
568	3300003758	Ga0055532_1000314	Ga0055532_100031415	419
569	3300003760	Ga0055527_1000055	Ga0055527_100005568	419
570	3300003761	Ga0055535_1000047	Ga0055535_1000047132	419
571	3300003761	Ga0055535_1000083	Ga0055535_100008368	419
572	3300003763	Ga0055529_1000193	Ga0055529_100019324	419
573	3300003775	Ga0055524_1001147	Ga0055524_10011475	419
574	3300003784	Ga0055534_1001653	Ga0055534_10016536	419
575	3300003791	Ga0055530_10000311	Ga0055530_100003119	419
576	3300003792	Ga0055540_1000016	Ga0055540_100001683	419
577	3300005262	Ga0065165_1001101	Ga0065165_100110122	419
578	3300005327	Ga0070658_10001821	Ga0070658_1000182115	419
579	3300005327	Ga0070658_10246183	Ga0070658_102461832	419
580	3300005328	Ga0070676_10024965	Ga0070676_100249653	419
581	3300005330	Ga0070690_100016117	Ga0070690_1000161172	419
582	3300005331	Ga0070670_100002568	Ga0070670_1000025685	419
583	3300005331	Ga0070670_100080798	Ga0070670_1000807982	419
584	3300005333	Ga0070677_10056831	Ga0070677_100568311	419
585	3300005334	Ga0068869_100000152	Ga0068869_10000015221	419
586	3300005334	Ga0068869_100004158	Ga0068869_1000041582	419
587	3300005335	Ga0070666_10001894	Ga0070666_1000189414	419
588	3300005335	Ga0070666_10006463	Ga0070666_100064636	419
589	3300005336	Ga0070680_100011969	Ga0070680_1000119693	419
590	3300005338	Ga0068868_100016726	Ga0068868_1000167263	419
591	3300005338	Ga0068868_100044836	Ga0068868_1000448363	419
592	3300005339	Ga0070660_100004251	Ga0070660_1000042512	419
593	3300005339	Ga0070660_100064750	Ga0070660_1000647502	419
594	3300005344	Ga0070661_100008324	Ga0070661_1000083244	419
595	3300005344	Ga0070661_100014865	Ga0070661_1000148654	419
596	3300005347	Ga0070668_100003108	Ga0070668_1000031086	419
597	3300005347	Ga0070668_100005618	Ga0070668_1000056189	419
598	3300005347	Ga0070668_100056880	Ga0070668_1000568802	419
599	3300005353	Ga0070669_100004064	Ga0070669_1000040646	419
600	3300005353	Ga0070669_100011061	Ga0070669_1000110613	419
601	3300005354	Ga0070675_100015089	Ga0070675_1000150892	419
602	3300005354	Ga0070675_100024237	Ga0070675_1000242372	419
603	3300005354	Ga0070675_100033225	Ga0070675_1000332252	419
604	3300005355	Ga0070671_100001263	Ga0070671_1000012636	419
605	3300005355	Ga0070671_100010636	Ga0070671_1000106367	419
606	3300005355	Ga0070671_100012077	Ga0070671_1000120772	419
607	3300005355	Ga0070671_100025426	Ga0070671_1000254262	419
608	3300005364	Ga0070673_100021127	Ga0070673_1000211276	419
609	3300005366	Ga0070659_100007556	Ga0070659_1000075561	419
610	3300005367	Ga0070667_100000813	Ga0070667_10000081324	419
611	3300005367	Ga0070667_100089163	Ga0070667_1000891633	419
612	3300005434	Ga0070709_10066415	Ga0070709_100664152	419
613	3300005435	Ga0070714_100003478	Ga0070714_10000347810	419
614	3300005436	Ga0070713_100012223	Ga0070713_1000122236	419
615	3300005444	Ga0070694_100148703	Ga0070694_1001487031	419
616	3300005445	Ga0070708_100008063	Ga0070708_1000080632	419
617	3300005455	Ga0070663_100078397	Ga0070663_1000783972	419
618	3300005456	Ga0070678_100054923	Ga0070678_1000549233	419
619	3300005456	Ga0070678_100134420	Ga0070678_1001344202	419
620	3300005457	Ga0070662_100000546	Ga0070662_10000054616	419
621	3300005457	Ga0070662_100134504	Ga0070662_1001345041	419
622	3300005458	Ga0070681_10150106	Ga0070681_101501062	419
623	3300005459	Ga0068867_100070184	Ga0068867_1000701843	419
624	3300005466	Ga0070685_10050527	Ga0070685_100505272	419
625	3300005467	Ga0070706_100003229	Ga0070706_1000032299	419
626	3300005468	Ga0070707_100023650	Ga0070707_1000236507	419
627	3300005518	Ga0070699_100006702	Ga0070699_1000067029	419
628	3300005530	Ga0070679_100012454	Ga0070679_1000124546	419
629	3300005530	Ga0070679_100143207	Ga0070679_1001432072	419
630	3300005530	Ga0070679_100168645	Ga0070679_1001686452	419
631	3300005535	Ga0070684_100077822	Ga0070684_1000778221	419
632	3300005536	Ga0070697_100031579	Ga0070697_1000315792	419
633	3300005539	Ga0068853_100022170	Ga0068853_1000221704	419
634	3300005539	Ga0068853_100142387	Ga0068853_1001423872	419
635	3300005539	Ga0068853_100184548	Ga0068853_1001845481	419
636	3300005543	Ga0070672_100059394	Ga0070672_1000593942	419
637	3300005543	Ga0070672_100082070	Ga0070672_1000820702	419
638	3300005543	Ga0070672_100218789	Ga0070672_1002187891	419
639	3300005548	Ga0070665_100017168	Ga0070665_1000171688	419
640	3300005549	Ga0070704_100122960	Ga0070704_1001229602	419
641	3300005563	Ga0068855_100001533	Ga0068855_10000153316	419
642	3300005563	Ga0068855_100020137	Ga0068855_1000201376	419
643	3300005563	Ga0068855_100031660	Ga0068855_1000316604	419
644	3300005563	Ga0068855_100066866	Ga0068855_1000668664	419
645	3300005563	Ga0068855_100164637	Ga0068855_1001646371	419
646	3300005564	Ga0070664_100001978	Ga0070664_10000197814	419
647	3300005564	Ga0070664_100216785	Ga0070664_1002167852	419
648	3300005577	Ga0068857_100014270	Ga0068857_1000142704	419
649	3300005578	Ga0068854_100077382	Ga0068854_1000773822	419
650	3300005614	Ga0068856_100000409	Ga0068856_10000040912	419
651	3300005614	Ga0068856_100036467	Ga0068856_1000364672	419
652	3300005614	Ga0068856_100106106	Ga0068856_1001061062	419
653	3300005615	Ga0070702_100067851	Ga0070702_1000678512	419
654	3300005616	Ga0068852_100003141	Ga0068852_1000031416	419
655	3300005616	Ga0068852_100063791	Ga0068852_1000637912	419
656	3300005616	Ga0068852_100170539	Ga0068852_1001705391	419
657	3300005617	Ga0068859_100000697	Ga0068859_10000069729	419
658	3300005617	Ga0068859_100023535	Ga0068859_1000235354	419
659	3300005618	Ga0068864_100001811	Ga0068864_10000181112	419
660	3300005618	Ga0068864_100008666	Ga0068864_1000086662	419
661	3300005618	Ga0068864_100082541	Ga0068864_1000825413	419
662	3300005618	Ga0068864_100083661	Ga0068864_1000836612	419
663	3300005719	Ga0068861_100001626	Ga0068861_1000016263	419
664	3300005834	Ga0068851_10046128	Ga0068851_100461282	419
665	3300005841	Ga0068863_100000894	Ga0068863_10000089417	419
666	3300005841	Ga0068863_100047003	Ga0068863_1000470034	419
667	3300005842	Ga0068858_100038510	Ga0068858_1000385105	419
668	3300005843	Ga0068860_100002661	Ga0068860_1000026613	419
669	3300005843	Ga0068860_100018313	Ga0068860_1000183131	419
670	3300005843	Ga0068860_100157398	Ga0068860_1001573982	419
671	3300005844	Ga0068862_100001435	Ga0068862_1000014357	419
672	3300005844	Ga0068862_100012376	Ga0068862_1000123763	419
673	3300005844	Ga0068862_100086224	Ga0068862_1000862242	419
674	3300006038	Ga0075365_10001917	Ga0075365_100019179	419
675	3300006048	Ga0075363_100004230	Ga0075363_1000042303	419
676	3300006051	Ga0075364_10086189	Ga0075364_100861891	419
677	3300006058	Ga0075432_10000250	Ga0075432_1000025016	419
678	3300006177	Ga0075362_10006104	Ga0075362_100061041	419
679	3300006177	Ga0075362_10054484	Ga0075362_100544841	419
680	3300006195	Ga0075366_10017464	Ga0075366_100174641	419
681	3300006195	Ga0075366_10027525	Ga0075366_100275252	419
682	3300006237	Ga0097621_100001636	Ga0097621_1000016365	419
683	3300006353	Ga0075370_10003026	Ga0075370_100030268	419
684	3300006358	Ga0068871_100020437	Ga0068871_1000204372	419
685	3300006358	Ga0068871_100042747	Ga0068871_1000427473	419
686	3300006844	Ga0075428_100167541	Ga0075428_1001675411	419
687	3300006931	Ga0097620_100000697	Ga0097620_10000069729	419
688	3300006931	Ga0097620_100023534	Ga0097620_1000235344	419
689	3300006946	Ga0079104_1000198	Ga0079104_100019810	419
690	3300009092	Ga0105250_10006149	Ga0105250_100061494	419
691	3300009093	Ga0105240_10178519	Ga0105240_101785192	419
692	3300009093	Ga0105240_10186560	Ga0105240_101865602	419
693	3300009101	Ga0105247_10006956	Ga0105247_100069566	419
694	3300009177	Ga0105248_10003189	Ga0105248_100031892	419
695	3300009545	Ga0105237_10006549	Ga0105237_100065497	419
696	3300009545	Ga0105237_10300450	Ga0105237_103004501	419
697	3300009551	Ga0105238_10012092	Ga0105238_100120926	419
698	3300009553	Ga0105249_10243253	Ga0105249_102432532	419
699	3300010375	Ga0105239_10023690	Ga0105239_100236904	419
700	3300013100	Ga0157373_10000137	Ga0157373_1000013746	419
701	3300013100	Ga0157373_10002476	Ga0157373_1000247616	419
702	3300013100	Ga0157373_10061881	Ga0157373_100618812	419
703	3300013102	Ga0157371_10000810	Ga0157371_1000081033	419
704	3300013102	Ga0157371_10001396	Ga0157371_1000139618	419
705	3300013104	Ga0157370_10066413	Ga0157370_100664133	419
706	3300013105	Ga0157369_10015817	Ga0157369_100158174	419
707	3300013105	Ga0157369_10076302	Ga0157369_100763024	419
708	3300013296	Ga0157374_10074958	Ga0157374_100749582	419
709	3300013297	Ga0157378_10020681	Ga0157378_100206814	419
710	3300013297	Ga0157378_10186247	Ga0157378_101862472	419
711	3300013307	Ga0157372_10003163	Ga0157372_100031636	419
712	3300013307	Ga0157372_10073975	Ga0157372_100739752	419
713	3300013307	Ga0157372_10117836	Ga0157372_101178363	419
714	3300013308	Ga0157375_10050643	Ga0157375_100506432	419
715	3300013308	Ga0157375_10054155	Ga0157375_100541553	419
716	3300013308	Ga0157375_10171180	Ga0157375_101711802	419
717	3300013308	Ga0157375_10182735	Ga0157375_101827352	419
718	3300013308	Ga0157375_10238961	Ga0157375_102389611	419
719	3300014325	Ga0163163_10025084	Ga0163163_100250846	419
720	3300014968	Ga0157379_10008008	Ga0157379_100080085	419
721	3300014968	Ga0157379_10008663	Ga0157379_100086632	419
722	3300014969	Ga0157376_10007545	Ga0157376_100075457	419
723	3300015261	Ga0182006_1042024	Ga0182006_10420242	419
724	3300025228	Ga0209672_100040	Ga0209672_10004067	419
725	3300025229	Ga0209147_100048	Ga0209147_10004867	419
726	3300025242	Ga0209258_100070	Ga0209258_10007067	419
727	3300025242	Ga0209258_100072	Ga0209258_100072140	419
728	3300025245	Ga0207425_1000290	Ga0207425_100029016	419
729	3300025245	Ga0207425_1001488	Ga0207425_10014885	419
730	3300025254	Ga0209148_1000284	Ga0209148_100028415	419
731	3300025256	Ga0209759_1002338	Ga0209759_10023382	419
732	3300025258	Ga0209129_1000202	Ga0209129_100020216	419
733	3300025258	Ga0209129_1002187	Ga0209129_10021876	419
734	3300025272	Ga0209455_1000053	Ga0209455_1000053220	419
735	3300025272	Ga0209455_1000178	Ga0209455_100017821	419
736	3300025284	Ga0209130_1002441	Ga0209130_10024416	419
737	3300025291	Ga0209675_1002042	Ga0209675_10020427	419
738	3300025292	Ga0209676_1000004	Ga0209676_1000004749	419
739	3300025292	Ga0209676_1000172	Ga0209676_100017213	419
740	3300025294	Ga0209025_1000013	Ga0209025_100001316	419
741	3300025294	Ga0209025_1000432	Ga0209025_100043258	419
742	3300025294	Ga0209025_1005956	Ga0209025_10059566	419
743	3300025294	Ga0209025_1016904	Ga0209025_10169044	419
744	3300025297	Ga0209758_1000014	Ga0209758_100001416	419
745	3300025297	Ga0209758_1004631	Ga0209758_10046316	419
746	3300025298	Ga0209050_1000002	Ga0209050_10000021259	419
747	3300025298	Ga0209050_1000082	Ga0209050_1000082122	419
748	3300025298	Ga0209050_1000509	Ga0209050_100050956	419
749	3300025298	Ga0209050_1004407	Ga0209050_10044076	419
750	3300025299	Ga0209256_1000045	Ga0209256_100004565	419
751	3300025302	Ga0207426_1000264	Ga0207426_1000264105	419
752	3300025303	Ga0209051_1000002	Ga0209051_10000021029	419
753	3300025303	Ga0209051_1000029	Ga0209051_1000029122	419
754	3300025303	Ga0209051_1000074	Ga0209051_1000074176	419
755	3300025303	Ga0209051_1000096	Ga0209051_1000096156	419
756	3300025304	Ga0209257_1000002	Ga0209257_10000021170	419
757	3300025304	Ga0209257_1000030	Ga0209257_1000030115	419
758	3300025304	Ga0209257_1000072	Ga0209257_1000072177	419
759	3300025304	Ga0209257_1011021	Ga0209257_10110212	419
760	3300025321	Ga0207656_10059155	Ga0207656_100591552	419
761	3300025711	Ga0207696_1000062	Ga0207696_100006279	419
762	3300025728	Ga0207655_1047304	Ga0207655_10473042	419
763	3300025735	Ga0207713_1010821	Ga0207713_10108215	419
764	3300025893	Ga0207682_10058797	Ga0207682_100587972	419
765	3300025901	Ga0207688_10062210	Ga0207688_100622102	419
766	3300025906	Ga0207699_10119174	Ga0207699_101191741	419
767	3300025907	Ga0207645_10004586	Ga0207645_100045863	419
768	3300025907	Ga0207645_10016918	Ga0207645_100169185	419
769	3300025908	Ga0207643_10006014	Ga0207643_100060147	419
770	3300025909	Ga0207705_10005321	Ga0207705_100053216	419
771	3300025910	Ga0207684_10003208	Ga0207684_100032084	419
772	3300025912	Ga0207707_10108878	Ga0207707_101088781	419
773	3300025913	Ga0207695_10155919	Ga0207695_101559192	419
774	3300025919	Ga0207657_10001611	Ga0207657_1000161112	419
775	3300025919	Ga0207657_10057506	Ga0207657_100575063	419
776	3300025919	Ga0207657_10145989	Ga0207657_101459892	419
777	3300025920	Ga0207649_10005495	Ga0207649_100054956	419
778	3300025920	Ga0207649_10041242	Ga0207649_100412422	419
779	3300025921	Ga0207652_10032527	Ga0207652_100325273	419
780	3300025923	Ga0207681_10004880	Ga0207681_100048806	419
781	3300025923	Ga0207681_10061402	Ga0207681_100614022	419
782	3300025926	Ga0207659_10091312	Ga0207659_100913122	419
783	3300025927	Ga0207687_10019909	Ga0207687_100199093	419
784	3300025928	Ga0207700_10057847	Ga0207700_100578472	419
785	3300025929	Ga0207664_10000845	Ga0207664_1000084518	419
786	3300025931	Ga0207644_10013225	Ga0207644_100132255	419
787	3300025931	Ga0207644_10017104	Ga0207644_100171042	419
788	3300025932	Ga0207690_10000957	Ga0207690_1000095711	419
789	3300025933	Ga0207706_10000267	Ga0207706_1000026741	419
790	3300025933	Ga0207706_10114852	Ga0207706_101148522	419
791	3300025933	Ga0207706_10164785	Ga0207706_101647852	419
792	3300025936	Ga0207670_10058486	Ga0207670_100584862	419
793	3300025938	Ga0207704_10011257	Ga0207704_100112573	419
794	3300025940	Ga0207691_10007985	Ga0207691_100079853	419
795	3300025940	Ga0207691_10065193	Ga0207691_100651933	419
796	3300025940	Ga0207691_10107771	Ga0207691_101077712	419
797	3300025940	Ga0207691_10182061	Ga0207691_101820612	419
798	3300025941	Ga0207711_10009261	Ga0207711_100092614	419
799	3300025942	Ga0207689_10000946	Ga0207689_1000094612	419
800	3300025942	Ga0207689_10016503	Ga0207689_100165036	419
801	3300025942	Ga0207689_10093628	Ga0207689_100936281	419
802	3300025944	Ga0207661_10104728	Ga0207661_101047282	419
803	3300025945	Ga0207679_10009054	Ga0207679_100090543	419
804	3300025945	Ga0207679_10050694	Ga0207679_100506942	419
805	3300025949	Ga0207667_10003714	Ga0207667_1000371412	419
806	3300025949	Ga0207667_10029593	Ga0207667_100295933	419
807	3300025949	Ga0207667_10036538	Ga0207667_100365382	419
808	3300025949	Ga0207667_10044449	Ga0207667_100444494	419
809	3300025949	Ga0207667_10068650	Ga0207667_100686503	419
810	3300025949	Ga0207667_10303755	Ga0207667_103037552	419
811	3300025960	Ga0207651_10012045	Ga0207651_100120455	419
812	3300025960	Ga0207651_10057090	Ga0207651_100570901	419
813	3300025986	Ga0207658_10005947	Ga0207658_100059475	419
814	3300026023	Ga0207677_10017121	Ga0207677_100171215	419
815	3300026035	Ga0207703_10000292	Ga0207703_1000029243	419
816	3300026035	Ga0207703_10010840	Ga0207703_100108402	419
817	3300026041	Ga0207639_10004592	Ga0207639_100045929	419
818	3300026041	Ga0207639_10189791	Ga0207639_101897911	419
819	3300026067	Ga0207678_10001480	Ga0207678_1000148011	419
820	3300026067	Ga0207678_10007229	Ga0207678_100072293	419
821	3300026067	Ga0207678_10045241	Ga0207678_100452414	419
822	3300026067	Ga0207678_10053947	Ga0207678_100539472	419
823	3300026078	Ga0207702_10014131	Ga0207702_100141312	419
824	3300026088	Ga0207641_10001732	Ga0207641_100017327	419
825	3300026088	Ga0207641_10071647	Ga0207641_100716472	419
826	3300026088	Ga0207641_10091135	Ga0207641_100911352	419
827	3300026089	Ga0207648_10001002	Ga0207648_1000100212	419
828	3300026095	Ga0207676_10001008	Ga0207676_1000100810	419
829	3300026095	Ga0207676_10003531	Ga0207676_100035318	419
830	3300026116	Ga0207674_10015916	Ga0207674_100159167	419
831	3300026118	Ga0207675_100001191	Ga0207675_10000119123	419
832	3300026118	Ga0207675_100023734	Ga0207675_1000237343	419
833	3300026121	Ga0207683_10000909	Ga0207683_1000090928	419
834	3300026121	Ga0207683_10006288	Ga0207683_100062889	419
835	3300026121	Ga0207683_10085584	Ga0207683_100855843	419
836	3300026142	Ga0207698_10104047	Ga0207698_101040472	419
837	3300027111	Ga0209281_1000457	Ga0209281_100045710	419
838	3300027907	Ga0207428_10004342	Ga0207428_100043423	419
839	3300028379	Ga0268266_10062015	Ga0268266_100620154	419
840	3300028380	Ga0268265_10001824	Ga0268265_1000182410	419
841	3300028380	Ga0268265_10018234	Ga0268265_100182341	419
842	3300028381	Ga0268264_10000854	Ga0268264_1000085418	419
843	3300028381	Ga0268264_10114441	Ga0268264_101144412	419
844	3300028381	Ga0268264_10158294	Ga0268264_101582942	419
845	3300028786	Ga0307517_10001421	Ga0307517_1000142112	419
846	3300028794	Ga0307515_10000051	Ga0307515_1000005129	419
847	3300028794	Ga0307515_10000160	Ga0307515_10000160137	419
848	3300028794	Ga0307515_10000553	Ga0307515_1000055333	419
849	3300028794	Ga0307515_10002899	Ga0307515_1000289926	419
850	3300028794	Ga0307515_10028520	Ga0307515_100285204	419
851	3300028794	Ga0307515_10130408	Ga0307515_101304083	419
852	3300030522	Ga0307512_10148134	Ga0307512_101481341	419
853	3300031249	Ga0265339_10002938	Ga0265339_1000293813	419
854	3300031250	Ga0265331_10015541	Ga0265331_100155412	419
855	3300031251	Ga0265327_10016598	Ga0265327_100165984	419
856	3300031456	Ga0307513_10009007	Ga0307513_100090079	419
857	3300031456	Ga0307513_10022772	Ga0307513_100227724	419
858	3300031456	Ga0307513_10049252	Ga0307513_100492523	419
859	3300031456	Ga0307513_10168364	Ga0307513_101683642	419
860	3300031507	Ga0307509_10016969	Ga0307509_100169693	419
861	3300031507	Ga0307509_10044444	Ga0307509_100444444	419
862	3300031507	Ga0307509_10062217	Ga0307509_100622174	419
863	3300031548	Ga0307408_100012741	Ga0307408_1000127415	419
864	3300031616	Ga0307508_10000371	Ga0307508_1000037125	419
865	3300031616	Ga0307508_10004767	Ga0307508_100047676	419
866	3300031616	Ga0307508_10014131	Ga0307508_100141317	419
867	3300031616	Ga0307508_10039482	Ga0307508_100394822	419
868	3300031649	Ga0307514_10000348	Ga0307514_1000034842	419
869	3300031649	Ga0307514_10001949	Ga0307514_100019494	419
870	3300031649	Ga0307514_10030577	Ga0307514_100305776	419
871	3300031711	Ga0265314_10003832	Ga0265314_1000383214	419
872	3300031712	Ga0265342_10002165	Ga0265342_100021655	419
873	3300031730	Ga0307516_10002101	Ga0307516_1000210112	419
874	3300031730	Ga0307516_10029620	Ga0307516_100296202	419
875	3300031730	Ga0307516_10078573	Ga0307516_100785732	419
876	3300031824	Ga0307413_10002484	Ga0307413_100024847	419
877	3300031901	Ga0307406_10014176	Ga0307406_100141764	419
878	3300031903	Ga0307407_10023775	Ga0307407_100237754	419
879	3300031911	Ga0307412_10061476	Ga0307412_100614763	419
880	3300031995	Ga0307409_100033564	Ga0307409_1000335642	419
881	3300032002	Ga0307416_100013354	Ga0307416_1000133544	419
882	3300032004	Ga0307414_10021327	Ga0307414_100213273	419
883	3300032005	Ga0307411_10000701	Ga0307411_100007013	419
884	3300032126	Ga0307415_100080342	Ga0307415_1000803423	419
885	3300032133	Ga0316583_10000771	Ga0316583_100007716	419
886	3300035691	Ga0373931_0084917	Ga0373931_0084917_269_1561	419
887	3300035695	Ga0373927_0052521	Ga0373927_0052521_518_1795	419
888	3300039437	Ga0436365_1827493	Ga0436365_1827493_2049_3338	419
889	3300039447	Ga0436361_0335889	Ga0436361_0335889_3498_4781	419
890	3300044684	Ga0466966_0000986	Ga0466966_0000986_1356_2672	419
891	3300044684	Ga0466966_0031392	Ga0466966_0031392_1493_2797	419
892	3300044693	Ga0466961_0037087	Ga0466961_0037087_720_2036	419
893	3300044694	Ga0466963_0010609	Ga0466963_0010609_1015_2331	419
894	3300045836	Ga0466958_0002781	Ga0466958_0002781_4553_5875	419
895	3300046453	Ga0495627_000007	Ga0495627_000007_352776_354098	419
896	3300046454	Ga0495592_0008157	Ga0495592_0008157_5042_6346	419
897	3300046457	Ga0495590_0000008	Ga0495590_0000008_33270_34592	419
898	3300046458	Ga0495591_000043	Ga0495591_000043_103114_104436	419
899	3300046458	Ga0495591_001022	Ga0495591_001022_10340_11599	419
900	3300046459	Ga0495629_0000143	Ga0495629_0000143_2389_3690	419
901	3300046460	Ga0495638_0014401	Ga0495638_0014401_1824_3125	419
902	3300046463	Ga0495653_0000737	Ga0495653_0000737_21009_22310	419
903	3300046471	Ga0495650_0000088	Ga0495650_0000088_78843_80102	419
904	3300046471	Ga0495650_0001898	Ga0495650_0001898_2640_3941	419
905	3300046471	Ga0495650_0005941	Ga0495650_0005941_1101_2405	419
906	3300046471	Ga0495650_0012187	Ga0495650_0012187_763_2058	419
907	3300046472	Ga0495580_0005144	Ga0495580_0005144_1460_2761	419
908	3300046474	Ga0495605_0011859	Ga0495605_0011859_642_1958	419
909	3300046474	Ga0495605_0036316	Ga0495605_0036316_911_2248	419
910	3300046474	Ga0495605_0077350	Ga0495605_0077350_161_1486	419
911	3300046491	Ga0495584_0000025	Ga0495584_0000025_34507_35829	419
912	3300046491	Ga0495584_0006746	Ga0495584_0006746_3410_4747	419
913	3300046491	Ga0495584_0010403	Ga0495584_0010403_785_2101	419
914	3300046492	Ga0495585_0014693	Ga0495585_0014693_1080_2417	419
915	3300046492	Ga0495585_0076906	Ga0495585_0076906_393_1718	419
916	3300046500	Ga0495596_0017843	Ga0495596_0017843_1436_2758	419
917	3300046500	Ga0495596_0029010	Ga0495596_0029010_296_1633	419
918	3300046501	Ga0495607_0000368	Ga0495607_0000368_41443_42759	419
919	3300046501	Ga0495607_0002927	Ga0495607_0002927_2138_3454	419
920	3300046501	Ga0495607_0005221	Ga0495607_0005221_2446_3705	419
921	3300046501	Ga0495607_0021242	Ga0495607_0021242_229_1551	419
922	3300046501	Ga0495607_0043647	Ga0495607_0043647_874_2211	419
923	3300046506	Ga0495583_0000160	Ga0495583_0000160_27486_28823	419
924	3300046506	Ga0495583_0000418	Ga0495583_0000418_11305_12582	419
925	3300046506	Ga0495583_0000512	Ga0495583_0000512_20288_21610	419
926	3300046506	Ga0495583_0004680	Ga0495583_0004680_3525_4847	419
927	3300046506	Ga0495583_0005456	Ga0495583_0005456_1448_2749	419
928	3300046507	Ga0495606_0001902	Ga0495606_0001902_19646_20905	419
929	3300046507	Ga0495606_0002406	Ga0495606_0002406_11249_12565	419
930	3300046507	Ga0495606_0002910	Ga0495606_0002910_11093_12394	419
931	3300046507	Ga0495606_0042104	Ga0495606_0042104_544_1821	419
932	3300046512	Ga0495610_0002865	Ga0495610_0002865_2424_3746	419
933	3300046512	Ga0495610_0078003	Ga0495610_0078003_59_1345	419
934	3300046513	Ga0495616_0000107	Ga0495616_0000107_46556_47881	419
935	3300046513	Ga0495616_0000877	Ga0495616_0000877_14473_15759	419
936	3300046513	Ga0495616_0002131	Ga0495616_0002131_3635_4951	419
937	3300046513	Ga0495616_0006525	Ga0495616_0006525_5275_6591	419
938	3300046513	Ga0495616_0014784	Ga0495616_0014784_2583_3920	419
939	3300046515	Ga0495620_0019074	Ga0495620_0019074_282_1583	419
940	3300046516	Ga0495628_0058276	Ga0495628_0058276_379_1680	419
941	3300046517	Ga0495630_0004736	Ga0495630_0004736_1882_3183	419
942	3300046517	Ga0495630_0017595	Ga0495630_0017595_1124_2416	419
943	3300046518	Ga0495631_0000620	Ga0495631_0000620_20800_22086	419
944	3300046518	Ga0495631_0000897	Ga0495631_0000897_3262_4584	419
945	3300046518	Ga0495631_0003605	Ga0495631_0003605_2576_3913	419
946	3300046518	Ga0495631_0025187	Ga0495631_0025187_222_1547	419
947	3300046519	Ga0495632_0000109	Ga0495632_0000109_79414_80739	419
948	3300046519	Ga0495632_0000115	Ga0495632_0000115_4563_5879	419
949	3300046519	Ga0495632_0003632	Ga0495632_0003632_1229_2557	419
950	3300046519	Ga0495632_0011853	Ga0495632_0011853_3641_4948	419
951	3300046520	Ga0495637_0000009	Ga0495637_0000009_305738_307060	419
952	3300046520	Ga0495637_0020118	Ga0495637_0020118_22_1329	419
953	3300046520	Ga0495637_0034209	Ga0495637_0034209_147_1433	419
954	3300046522	Ga0495643_0001116	Ga0495643_0001116_4618_5940	419
955	3300046522	Ga0495643_0001396	Ga0495643_0001396_16610_17938	419
956	3300046522	Ga0495643_0005104	Ga0495643_0005104_2398_3714	419
957	3300046522	Ga0495643_0020672	Ga0495643_0020672_1151_2473	419
958	3300046523	Ga0495644_0003900	Ga0495644_0003900_3357_4679	419
959	3300046523	Ga0495644_0005824	Ga0495644_0005824_1080_2417	419
960	3300046523	Ga0495644_0010725	Ga0495644_0010725_2106_3428	419
961	3300046528	Ga0495642_0000611	Ga0495642_0000611_12147_13472	419
962	3300046528	Ga0495642_0006547	Ga0495642_0006547_390_1727	419
963	3300046530	Ga0495654_0000954	Ga0495654_0000954_12551_13810	419
964	3300046531	Ga0495665_0011548	Ga0495665_0011548_1694_2995	419
965	3300046538	Ga0495609_0000289	Ga0495609_0000289_41446_42762	419
966	3300046538	Ga0495609_0006304	Ga0495609_0006304_1335_2657	419
967	3300046538	Ga0495609_0007418	Ga0495609_0007418_1150_2475	419
968	3300046538	Ga0495609_0015289	Ga0495609_0015289_1479_2816	419
969	3300046538	Ga0495609_0033742	Ga0495609_0033742_77_1378	419
970	3300046557	Ga0495622_0000092	Ga0495622_0000092_12101_13429	419
971	3300046558	Ga0495633_0000925	Ga0495633_0000925_4227_5549	419
972	3300046558	Ga0495633_0013358	Ga0495633_0013358_1040_2377	419
973	3300046615	Ga0495656_0001367	Ga0495656_0001367_5115_6431	419
974	3300046615	Ga0495656_0011981	Ga0495656_0011981_1109_2425	419
975	3300046616	Ga0495668_0004203	Ga0495668_0004203_4451_5767	419
976	3300046648	Ga0495611_0007118	Ga0495611_0007118_2579_3901	419
977	3300046648	Ga0495611_0024893	Ga0495611_0024893_727_2064	419
978	3300046648	Ga0495611_0042884	Ga0495611_0042884_591_1892	419
979	3300046660	Ga0495625_0000056	Ga0495625_0000056_169071_170378	419
980	3300046660	Ga0495625_0010171	Ga0495625_0010171_2836_4113	419
981	3300046660	Ga0495625_0039863	Ga0495625_0039863_1329_2630	419
982	3300046665	Ga0495661_0000132	Ga0495661_0000132_85863_87179	419
983	3300046665	Ga0495661_0000399	Ga0495661_0000399_3635_4951	419
984	3300046665	Ga0495661_0028703	Ga0495661_0028703_1077_2378	419
985	3300046678	Ga0495599_0010289	Ga0495599_0010289_3187_4488	419
986	3300046680	Ga0495646_0017861	Ga0495646_0017861_2307_3608	419
987	3300046680	Ga0495646_0082030	Ga0495646_0082030_143_1468	419
988	3300046684	Ga0495669_0000304	Ga0495669_0000304_13112_14437	419
989	3300046689	Ga0495613_0097097	Ga0495613_0097097_173_1474	419
990	3300046690	Ga0495624_0004313	Ga0495624_0004313_3342_4643	419
991	3300046690	Ga0495624_0027119	Ga0495624_0027119_1514_2806	419
992	3300046691	Ga0495670_0005476	Ga0495670_0005476_257_1582	419
993	3300046692	Ga0495671_0006764	Ga0495671_0006764_2881_4188	419
994	3300046694	Ga0495649_0000028	Ga0495649_0000028_107196_108518	419
995	3300046694	Ga0495649_0000599	Ga0495649_0000599_20323_21600	419
996	3300046694	Ga0495649_0000715	Ga0495649_0000715_20982_22310	419
997	3300046694	Ga0495649_0001951	Ga0495649_0001951_9582_10841	419
998	3300046694	Ga0495649_0002941	Ga0495649_0002941_4878_6179	419
999	3300046694	Ga0495649_0003140	Ga0495649_0003140_6579_7886	419
1000	3300046694	Ga0495649_0029147	Ga0495649_0029147_335_1651	419
1001	3300046794	Ga0495589_0000235	Ga0495589_0000235_3635_4951	419
1002	3300046794	Ga0495589_0001804	Ga0495589_0001804_3731_5047	419
1003	3300046810	Ga0495660_0000010	Ga0495660_0000010_76076_77335	419
1004	3300046810	Ga0495660_0000057	Ga0495660_0000057_55916_57232	419
1005	3300046810	Ga0495660_0006681	Ga0495660_0006681_770_2086	419
1006	3300046810	Ga0495660_0011203	Ga0495660_0011203_3710_5026	419
1007	3300046810	Ga0495660_0012041	Ga0495660_0012041_3370_4707	419
1008	3300046810	Ga0495660_0012344	Ga0495660_0012344_2562_3884	419
1009	3300047318	Ga0495636_0003514	Ga0495636_0003514_650_1978	419
1010	3300047319	Ga0495674_0010986	Ga0495674_0010986_1460_2761	419
1011	3300047319	Ga0495674_0017521	Ga0495674_0017521_2026_3327	419
1012	3300047319	Ga0495674_0099593	Ga0495674_0099593_122_1423	419
1013	3300047320	Ga0495672_0000047	Ga0495672_0000047_166648_167907	419
1014	3300047320	Ga0495672_0000055	Ga0495672_0000055_103066_104388	419
1015	3300047321	Ga0495676_0062942	Ga0495676_0062942_300_1592	419
1016	3300047321	Ga0495676_0111992	Ga0495676_0111992_307_1566	419
1017	3300047323	Ga0495683_0000047	Ga0495683_0000047_89855_91177	419
1018	3300047323	Ga0495683_0003931	Ga0495683_0003931_2655_3992	419
1019	3300047323	Ga0495683_0015499	Ga0495683_0015499_1596_2897	419
1020	3300047323	Ga0495683_0038373	Ga0495683_0038373_131_1432	419
1021	3300047443	Ga0495687_000018	Ga0495687_000018_186664_187980	419
1022	3300047443	Ga0495687_000164	Ga0495687_000164_21976_23292	419
1023	3300047443	Ga0495687_000515	Ga0495687_000515_3635_4951	419
1024	3300047443	Ga0495687_015188	Ga0495687_015188_242_1543	419
1025	3300047443	Ga0495687_017678	Ga0495687_017678_384_1685	419
1026	3300047443	Ga0495687_022425	Ga0495687_022425_1095_2402	419
1027	3300047445	Ga0495677_0000092	Ga0495677_0000092_3635_4951	419
1028	3300047445	Ga0495677_0000451	Ga0495677_0000451_14024_15346	419
1029	3300047445	Ga0495677_0001493	Ga0495677_0001493_12_1334	419
1030	3300047445	Ga0495677_0005345	Ga0495677_0005345_2822_4138	419
1031	3300047446	Ga0495679_000012	Ga0495679_000012_314972_316273	419
1032	3300047446	Ga0495679_002742	Ga0495679_002742_6862_8199	419
1033	3300047469	Ga0495673_0000162	Ga0495673_0000162_29724_30983	419
1034	3300047470	Ga0495681_0009425	Ga0495681_0009425_1079_2416	419
1035	3300047470	Ga0495681_0022708	Ga0495681_0022708_700_2022	419
1036	3300047470	Ga0495681_0030631	Ga0495681_0030631_332_1642	419
1037	3300047472	Ga0495686_0001728	Ga0495686_0001728_18426_19733	419
1038	3300047673	Ga0495593_0007742	Ga0495593_0007742_2489_3790	419
1039	3300048088	Ga0495602_0049253	Ga0495602_0049253_2383_3693	419
1040	3300048088	Ga0495602_0152763	Ga0495602_0152763_173_1474	419
1041	3300048091	Ga0495626_0000011	Ga0495626_0000011_222301_223617	419
1042	3300048091	Ga0495626_0001002	Ga0495626_0001002_3635_4951	419
1043	3300048091	Ga0495626_0002508	Ga0495626_0002508_7686_8996	419
1044	3300048091	Ga0495626_0005164	Ga0495626_0005164_1709_3031	419
1045	3300048091	Ga0495626_0013186	Ga0495626_0013186_739_2040	419
1046	3300048091	Ga0495626_0020995	Ga0495626_0020995_1472_2794	419
1047	3300048904	Ga0496101_0000093	Ga0496101_0000093_48715_49974	419
1048	3300048904	Ga0496101_0018225	Ga0496101_0018225_1062_2387	419
1049	3300048905	Ga0496102_0000771	Ga0496102_0000771_24206_25507	419
1050	3300048905	Ga0496102_0006587	Ga0496102_0006587_877_2178	419
1051	3300048905	Ga0496102_0014777	Ga0496102_0014777_2247_3548	419
1052	3300048906	Ga0496103_0008670	Ga0496103_0008670_180_1481	419
1053	3300048909	Ga0496106_0004513	Ga0496106_0004513_2483_3784	419
1054	3300048911	Ga0496108_0076570	Ga0496108_0076570_586_1887	419
1055	3300048912	Ga0496109_0022323	Ga0496109_0022323_3364_4665	419
1056	3300048912	Ga0496109_0344383	Ga0496109_0344383_41_1342	419
1057	3300048913	Ga0496110_0082588	Ga0496110_0082588_1462_2778	419
1058	3300048917	Ga0496114_0009373	Ga0496114_0009373_3565_4866	419
1059	3300048917	Ga0496114_0031119	Ga0496114_0031119_1859_3160	419
1060	3300048919	Ga0496116_0000148	Ga0496116_0000148_53591_54850	419
1061	3300048919	Ga0496116_0005353	Ga0496116_0005353_1384_2688	419
1062	3300048920	Ga0496117_0048040	Ga0496117_0048040_123_1424	419
1063	3300048921	Ga0496118_0063872	Ga0496118_0063872_1031_2332	419
1064	3300048922	Ga0496119_0000808	Ga0496119_0000808_37305_38564	419
1065	3300048923	Ga0496120_0000367	Ga0496120_0000367_32178_33437	419
1066	3300048923	Ga0496120_0000921	Ga0496120_0000921_9815_11074	419
1067	3300048924	Ga0496121_0017024	Ga0496121_0017024_1678_2979	419
1068	3300048924	Ga0496121_0029822	Ga0496121_0029822_1324_2628	419
1069	3300048925	Ga0496122_0006880	Ga0496122_0006880_4356_5672	419
1070	3300048925	Ga0496122_0054052	Ga0496122_0054052_1290_2549	419
1071	3300048926	Ga0496123_0006390	Ga0496123_0006390_4406_5722	419
1072	3300048926	Ga0496123_0040540	Ga0496123_0040540_1432_2718	419
1073	3300048927	Ga0496124_0015010	Ga0496124_0015010_3551_4810	419
1074	3300048927	Ga0496124_0016414	Ga0496124_0016414_2138_3454	419
1075	3300048927	Ga0496124_0070746	Ga0496124_0070746_129_1445	419
1076	3300048927	Ga0496124_0077405	Ga0496124_0077405_187_1497	419
1077	3300048928	Ga0496125_0004245	Ga0496125_0004245_6294_7592	419
1078	3300048928	Ga0496125_0159868	Ga0496125_0159868_73_1359	419
1079	3300048929	Ga0496126_0202550	Ga0496126_0202550_187_1473	419
1080	3300048986	Ga0466983_0069369	Ga0466983_0069369_1602_2906	419
1081	3300049459	Ga0495678_000025	Ga0495678_000025_103954_105276	419
1082	3300049459	Ga0495678_000151	Ga0495678_000151_52423_53682	419
1083	3300049459	Ga0495678_000266	Ga0495678_000266_41052_42368	419
1084	3300049459	Ga0495678_004566	Ga0495678_004566_3248_4585	419
1085	3300049459	Ga0495678_020431	Ga0495678_020431_854_2155	419
1086	3300049459	Ga0495678_030577	Ga0495678_030577_904_2235	419
1087	3300049460	Ga0495682_0000003	Ga0495682_0000003_363888_365147	419
1088	3300049572	Ga0501036_0016324	Ga0501036_0016324_2319_3623	419
1089	3300049574	Ga0501038_0072246	Ga0501038_0072246_1365_2669	419
1090	3300049579	Ga0501043_0000815	Ga0501043_0000815_282_1610	419
1091	3300049587	Ga0501071_0005046	Ga0501071_0005046_3742_5046	419
1092	3300049588	Ga0501072_0006006	Ga0501072_0006006_3478_4782	419
1093	3300049591	Ga0501075_0000451	Ga0501075_0000451_2128_3432	419
1094	3300049592	Ga0501076_0029291	Ga0501076_0029291_2100_3404	419
1095	3300049741	Ga0501079_0008926	Ga0501079_0008926_1169_2473	419
1096	3300049742	Ga0501080_0030281	Ga0501080_0030281_364_1668	419
1097	3300049743	Ga0501081_0023535	Ga0501081_0023535_2508_3812	419
1098	3300049759	Ga0501262_000404	Ga0501262_000404_762_2078	419
1099	3300049823	Ga0501044_0034195	Ga0501044_0034195_2454_3749	419
1100	3300049824	Ga0501045_0046277	Ga0501045_0046277_1394_2689	419
1101	3300050489	nmdc:mga03683_18954_c1	nmdc:mga03683_18954_c1_1128_2414	419
1102	3300050489	nmdc:mga03683_3366_c1	nmdc:mga03683_3366_c1_3694_5001	419
1103	3300050490	nmdc:mga03n38_6245_c1	nmdc:mga03n38_6245_c1_2258_3565	419
1104	3300050491	nmdc:mga00v17_195_c1	nmdc:mga00v17_195_c1_19624_20931	419
1105	3300050492	nmdc:mga0yw44_6111_c1	nmdc:mga0yw44_6111_c1_3049_4356	419
1106	3300050493	nmdc:mga0k408_535_c1	nmdc:mga0k408_535_c1_1142_2449	419
1107	3300050493	nmdc:mga0k408_641_c2	nmdc:mga0k408_641_c2_2449_3756	419
1108	3300050496	nmdc:mga07m45_22675_c1	nmdc:mga07m45_22675_c1_218_1537	419
1109	3300053079	Ga0500610_0001170	Ga0500610_0001170_1795_3102	419
1110	3300053079	Ga0500610_0007937	Ga0500610_0007937_1228_2535	419
1111	3300053080	Ga0500635_0003734	Ga0500635_0003734_127_1407	419
1112	3300053093	Ga0500651_0000087	Ga0500651_0000087_52111_53397	419
1113	3300053108	Ga0500562_002673	Ga0500562_002673_693_2009	419
1114	3300053110	Ga0500571_000055	Ga0500571_000055_5870_7156	419
1115	3300053117	Ga0500593_000202	Ga0500593_000202_1576_2883	419
1116	3300053121	Ga0500607_000181	Ga0500607_000181_14484_15791	419
1117	3300053126	Ga0500621_000008	Ga0500621_000008_102480_103739	419
1118	3300053134	Ga0500658_0002013	Ga0500658_0002013_1160_2446	419
1119	3300053134	Ga0500658_0002588	Ga0500658_0002588_1160_2446	419
1120	3300053134	Ga0500658_0005057	Ga0500658_0005057_215_1522	419
1121	3300053139	Ga0500568_0009293	Ga0500568_0009293_1103_2389	419
1122	3300053150	Ga0500603_005795	Ga0500603_005795_201_1481	419
1123	3300053153	Ga0500616_0048736	Ga0500616_0048736_574_1878	419
1124	3300053158	Ga0500627_0014048	Ga0500627_0014048_1162_2469	419
1125	3300054114	Ga0501084_0010088	Ga0501084_0010088_3491_4795	419
1126	3300061734	Ga0530510_0000849	Ga0530510_0000849_9858_11162	419
1127	3300002737	JGI25162J39368_1000478	JGI25162J39368_100047811	420
1128	3300002771	JGI25163J39215_1000393	JGI25163J39215_10003934	420
1129	3300002772	JGI25164J39214_1000325	JGI25164J39214_100032511	420
1130	3300003751	Ga0055538_1000235	Ga0055538_100023511	420
1131	3300003752	Ga0055539_1000270	Ga0055539_100027011	420
1132	3300003756	Ga0055533_1000261	Ga0055533_100026111	420
1133	3300003759	Ga0055525_1000362	Ga0055525_100036211	420
1134	3300003841	Ga0055541_1000170	Ga0055541_100017011	420
1135	3300005288	Ga0065714_10090107	Ga0065714_100901072	420
1136	3300005289	Ga0065704_10001152	Ga0065704_100011523	420
1137	3300005841	Ga0068863_100094355	Ga0068863_1000943552	420
1138	3300006051	Ga0075364_10164813	Ga0075364_101648132	420
1139	3300006058	Ga0075432_10003230	Ga0075432_100032304	420
1140	3300006177	Ga0075362_10022301	Ga0075362_100223014	420
1141	3300006914	Ga0075436_100021766	Ga0075436_1000217662	420
1142	3300006944	Ga0099823_1000045	Ga0099823_100004550	420
1143	3300006946	Ga0079104_1000276	Ga0079104_100027650	420
1144	3300009011	Ga0105251_10001981	Ga0105251_1000198119	420
1145	3300009036	Ga0105244_10000460	Ga0105244_1000046012	420
1146	3300009036	Ga0105244_10002332	Ga0105244_100023322	420
1147	3300009036	Ga0105244_10017178	Ga0105244_100171782	420
1148	3300009092	Ga0105250_10000073	Ga0105250_1000007331	420
1149	3300009092	Ga0105250_10017275	Ga0105250_100172752	420
1150	3300013102	Ga0157371_10000098	Ga0157371_1000009816	420
1151	3300013306	Ga0163162_10000137	Ga0163162_1000013755	420
1152	3300013306	Ga0163162_10110469	Ga0163162_101104692	420
1153	3300015261	Ga0182006_1002512	Ga0182006_10025124	420
1154	3300015265	Ga0182005_1001888	Ga0182005_10018887	420
1155	3300017792	Ga0163161_10005416	Ga0163161_100054163	420
1156	3300017792	Ga0163161_10006725	Ga0163161_100067257	420
1157	3300017792	Ga0163161_10046297	Ga0163161_100462972	420
1158	3300017792	Ga0163161_10169961	Ga0163161_101699612	420
1159	3300025207	Ga0209760_100073	Ga0209760_10007360	420
1160	3300025224	Ga0209784_100001	Ga0209784_1000011514	420
1161	3300025225	Ga0209566_100001	Ga0209566_1000011514	420
1162	3300025226	Ga0209674_100002	Ga0209674_1000021514	420
1163	3300025230	Ga0209563_100002	Ga0209563_10000249	420
1164	3300025230	Ga0209563_101267	Ga0209563_1012673	420
1165	3300025231	Ga0207427_100032	Ga0207427_10003249	420
1166	3300025233	Ga0209437_100001	Ga0209437_10000149	420
1167	3300025253	Ga0209677_100002	Ga0209677_10000249	420
1168	3300025292	Ga0209676_1002972	Ga0209676_10029727	420
1169	3300025298	Ga0209050_1000155	Ga0209050_100015553	420
1170	3300025303	Ga0209051_1008091	Ga0209051_10080915	420
1171	3300025711	Ga0207696_1000148	Ga0207696_100014840	420
1172	3300025711	Ga0207696_1000704	Ga0207696_100070411	420
1173	3300025711	Ga0207696_1005296	Ga0207696_10052962	420
1174	3300025728	Ga0207655_1000037	Ga0207655_1000037112	420
1175	3300025728	Ga0207655_1000586	Ga0207655_100058614	420
1176	3300025735	Ga0207713_1000268	Ga0207713_10002689	420
1177	3300025735	Ga0207713_1008864	Ga0207713_10088644	420
1178	3300025735	Ga0207713_1015925	Ga0207713_10159252	420
1179	3300027111	Ga0209281_1000055	Ga0209281_100005576	420
1180	3300027296	Ga0209389_1000013	Ga0209389_1000013180	420
1181	3300028786	Ga0307517_10053861	Ga0307517_100538613	420
1182	3300028800	Ga0265338_10000087	Ga0265338_10000087141	420
1183	3300031456	Ga0307513_10189803	Ga0307513_101898032	420
1184	3300042006	Ga0439432_011805	Ga0439432_011805_966_2294	420
1185	3300042006	Ga0439432_011811	Ga0439432_011811_1133_2395	420
1186	3300042137	Ga0450902_000817	Ga0450902_000817_144_1478	420
1187	3300046452	Ga0495617_004420	Ga0495617_004420_837_2099	420
1188	3300046453	Ga0495627_000682	Ga0495627_000682_19191_20453	420
1189	3300046453	Ga0495627_002054	Ga0495627_002054_6251_7513	420
1190	3300046453	Ga0495627_013434	Ga0495627_013434_1180_2442	420
1191	3300046455	Ga0495603_0007368	Ga0495603_0007368_4887_6149	420
1192	3300046457	Ga0495590_0001342	Ga0495590_0001342_3533_4867	420
1193	3300046458	Ga0495591_000021	Ga0495591_000021_142820_144154	420
1194	3300046458	Ga0495591_000336	Ga0495591_000336_11833_13101	420
1195	3300046458	Ga0495591_000625	Ga0495591_000625_21665_22993	420
1196	3300046458	Ga0495591_000888	Ga0495591_000888_5907_7169	420
1197	3300046458	Ga0495591_001144	Ga0495591_001144_8181_9443	420
1198	3300046458	Ga0495591_001739	Ga0495591_001739_1661_2923	420
1199	3300046458	Ga0495591_002453	Ga0495591_002453_1514_2842	420
1200	3300046458	Ga0495591_005302	Ga0495591_005302_1042_2304	420
1201	3300046458	Ga0495591_014039	Ga0495591_014039_681_2015	420
1202	3300046458	Ga0495591_014645	Ga0495591_014645_764_2026	420
1203	3300046460	Ga0495638_0000417	Ga0495638_0000417_12330_13592	420
1204	3300046460	Ga0495638_0000823	Ga0495638_0000823_22074_23336	420
1205	3300046460	Ga0495638_0002051	Ga0495638_0002051_10217_11479	420
1206	3300046460	Ga0495638_0002805	Ga0495638_0002805_356_1618	420
1207	3300046460	Ga0495638_0002937	Ga0495638_0002937_5507_6769	420
1208	3300046460	Ga0495638_0005823	Ga0495638_0005823_6125_7387	420
1209	3300046460	Ga0495638_0014189	Ga0495638_0014189_690_1952	420
1210	3300046460	Ga0495638_0024622	Ga0495638_0024622_977_2239	420
1211	3300046460	Ga0495638_0072728	Ga0495638_0072728_595_1857	420
1212	3300046463	Ga0495653_0028571	Ga0495653_0028571_520_1782	420
1213	3300046471	Ga0495650_0000101	Ga0495650_0000101_90566_91837	420
1214	3300046471	Ga0495650_0000126	Ga0495650_0000126_139572_140834	420
1215	3300046471	Ga0495650_0006777	Ga0495650_0006777_4401_5663	420
1216	3300046471	Ga0495650_0012107	Ga0495650_0012107_561_1823	420
1217	3300046471	Ga0495650_0012293	Ga0495650_0012293_441_1703	420
1218	3300046471	Ga0495650_0032191	Ga0495650_0032191_289_1551	420
1219	3300046474	Ga0495605_0001774	Ga0495605_0001774_8767_10029	420
1220	3300046474	Ga0495605_0001929	Ga0495605_0001929_6196_7458	420
1221	3300046474	Ga0495605_0009365	Ga0495605_0009365_3138_4400	420
1222	3300046491	Ga0495584_0000019	Ga0495584_0000019_35394_36656	420
1223	3300046491	Ga0495584_0000624	Ga0495584_0000624_14354_15616	420
1224	3300046491	Ga0495584_0000877	Ga0495584_0000877_6800_8062	420
1225	3300046491	Ga0495584_0001021	Ga0495584_0001021_515_1777	420
1226	3300046491	Ga0495584_0004728	Ga0495584_0004728_732_1994	420
1227	3300046491	Ga0495584_0027050	Ga0495584_0027050_526_1797	420
1228	3300046492	Ga0495585_0001283	Ga0495585_0001283_12984_14246	420
1229	3300046492	Ga0495585_0001358	Ga0495585_0001358_8346_9608	420
1230	3300046492	Ga0495585_0001928	Ga0495585_0001928_7625_8887	420
1231	3300046492	Ga0495585_0003537	Ga0495585_0003537_1481_2752	420
1232	3300046492	Ga0495585_0004600	Ga0495585_0004600_4637_5899	420
1233	3300046492	Ga0495585_0023582	Ga0495585_0023582_2064_3326	420
1234	3300046492	Ga0495585_0083963	Ga0495585_0083963_364_1626	420
1235	3300046500	Ga0495596_0000209	Ga0495596_0000209_5712_6974	420
1236	3300046500	Ga0495596_0002177	Ga0495596_0002177_4340_5602	420
1237	3300046500	Ga0495596_0029874	Ga0495596_0029874_725_1996	420
1238	3300046501	Ga0495607_0000352	Ga0495607_0000352_17444_18712	420
1239	3300046501	Ga0495607_0003152	Ga0495607_0003152_5922_7184	420
1240	3300046501	Ga0495607_0006849	Ga0495607_0006849_328_1662	420
1241	3300046501	Ga0495607_0012802	Ga0495607_0012802_3253_4515	420
1242	3300046501	Ga0495607_0014040	Ga0495607_0014040_2892_4154	420
1243	3300046501	Ga0495607_0015009	Ga0495607_0015009_1327_2589	420
1244	3300046501	Ga0495607_0067994	Ga0495607_0067994_403_1665	420
1245	3300046506	Ga0495583_0001029	Ga0495583_0001029_16619_17890	420
1246	3300046506	Ga0495583_0002850	Ga0495583_0002850_7214_8476	420
1247	3300046506	Ga0495583_0005137	Ga0495583_0005137_3286_4548	420
1248	3300046506	Ga0495583_0005474	Ga0495583_0005474_5662_6924	420
1249	3300046507	Ga0495606_0002347	Ga0495606_0002347_7824_9086	420
1250	3300046507	Ga0495606_0002999	Ga0495606_0002999_946_2208	420
1251	3300046507	Ga0495606_0030173	Ga0495606_0030173_2301_3563	420
1252	3300046507	Ga0495606_0036401	Ga0495606_0036401_1787_3049	420
1253	3300046512	Ga0495610_0000887	Ga0495610_0000887_8770_10032	420
1254	3300046512	Ga0495610_0001043	Ga0495610_0001043_5669_6931	420
1255	3300046512	Ga0495610_0001982	Ga0495610_0001982_8543_9805	420
1256	3300046512	Ga0495610_0008661	Ga0495610_0008661_1624_2886	420
1257	3300046512	Ga0495610_0023615	Ga0495610_0023615_1328_2599	420
1258	3300046512	Ga0495610_0028586	Ga0495610_0028586_969_2231	420
1259	3300046513	Ga0495616_0000781	Ga0495616_0000781_15934_17196	420
1260	3300046513	Ga0495616_0027435	Ga0495616_0027435_618_1880	420
1261	3300046513	Ga0495616_0027898	Ga0495616_0027898_1596_2867	420
1262	3300046513	Ga0495616_0031615	Ga0495616_0031615_824_2086	420
1263	3300046513	Ga0495616_0072900	Ga0495616_0072900_164_1426	420
1264	3300046515	Ga0495620_0000012	Ga0495620_0000012_11118_12380	420
1265	3300046515	Ga0495620_0000986	Ga0495620_0000986_7293_8621	420
1266	3300046515	Ga0495620_0000993	Ga0495620_0000993_4705_5967	420
1267	3300046515	Ga0495620_0008654	Ga0495620_0008654_2674_3945	420
1268	3300046515	Ga0495620_0014900	Ga0495620_0014900_192_1526	420
1269	3300046515	Ga0495620_0036013	Ga0495620_0036013_774_2036	420
1270	3300046518	Ga0495631_0000002	Ga0495631_0000002_89598_90860	420
1271	3300046518	Ga0495631_0006109	Ga0495631_0006109_4327_5598	420
1272	3300046518	Ga0495631_0008943	Ga0495631_0008943_1604_2938	420
1273	3300046518	Ga0495631_0016039	Ga0495631_0016039_922_2184	420
1274	3300046518	Ga0495631_0030003	Ga0495631_0030003_183_1445	420
1275	3300046519	Ga0495632_0000931	Ga0495632_0000931_5595_6857	420
1276	3300046519	Ga0495632_0000967	Ga0495632_0000967_16814_18076	420
1277	3300046519	Ga0495632_0003889	Ga0495632_0003889_2866_4128	420
1278	3300046519	Ga0495632_0004000	Ga0495632_0004000_4854_6116	420
1279	3300046519	Ga0495632_0024464	Ga0495632_0024464_1326_2588	420
1280	3300046519	Ga0495632_0039499	Ga0495632_0039499_1009_2271	420
1281	3300046519	Ga0495632_0070612	Ga0495632_0070612_104_1366	420
1282	3300046520	Ga0495637_0000092	Ga0495637_0000092_34989_36260	420
1283	3300046520	Ga0495637_0000631	Ga0495637_0000631_22866_24128	420
1284	3300046520	Ga0495637_0000776	Ga0495637_0000776_14711_15973	420
1285	3300046520	Ga0495637_0001491	Ga0495637_0001491_11938_13200	420
1286	3300046520	Ga0495637_0001973	Ga0495637_0001973_3121_4383	420
1287	3300046520	Ga0495637_0003511	Ga0495637_0003511_5110_6378	420
1288	3300046520	Ga0495637_0004339	Ga0495637_0004339_2727_3989	420
1289	3300046520	Ga0495637_0004641	Ga0495637_0004641_2435_3697	420
1290	3300046520	Ga0495637_0020948	Ga0495637_0020948_1569_2831	420
1291	3300046522	Ga0495643_0000049	Ga0495643_0000049_25898_27238	420
1292	3300046522	Ga0495643_0002003	Ga0495643_0002003_10135_11397	420
1293	3300046522	Ga0495643_0015927	Ga0495643_0015927_2399_3670	420
1294	3300046522	Ga0495643_0020328	Ga0495643_0020328_1342_2604	420
1295	3300046522	Ga0495643_0030034	Ga0495643_0030034_1575_2837	420
1296	3300046522	Ga0495643_0051783	Ga0495643_0051783_403_1665	420
1297	3300046523	Ga0495644_0004161	Ga0495644_0004161_87_1349	420
1298	3300046523	Ga0495644_0025293	Ga0495644_0025293_724_1986	420
1299	3300046524	Ga0495648_0008489	Ga0495648_0008489_5596_6858	420
1300	3300046524	Ga0495648_0011625	Ga0495648_0011625_977_2248	420
1301	3300046524	Ga0495648_0031225	Ga0495648_0031225_1984_3246	420
1302	3300046526	Ga0495666_0000087	Ga0495666_0000087_8072_9334	420
1303	3300046530	Ga0495654_0000577	Ga0495654_0000577_16867_18129	420
1304	3300046530	Ga0495654_0001110	Ga0495654_0001110_7562_8824	420
1305	3300046530	Ga0495654_0001246	Ga0495654_0001246_9998_11260	420
1306	3300046530	Ga0495654_0001396	Ga0495654_0001396_5401_6663	420
1307	3300046530	Ga0495654_0004294	Ga0495654_0004294_4218_5546	420
1308	3300046530	Ga0495654_0007840	Ga0495654_0007840_3619_4881	420
1309	3300046530	Ga0495654_0015392	Ga0495654_0015392_960_2222	420
1310	3300046530	Ga0495654_0017671	Ga0495654_0017671_1363_2625	420
1311	3300046530	Ga0495654_0040998	Ga0495654_0040998_369_1631	420
1312	3300046538	Ga0495609_0000016	Ga0495609_0000016_48146_49417	420
1313	3300046538	Ga0495609_0007771	Ga0495609_0007771_1233_2495	420
1314	3300046542	Ga0495597_0000002	Ga0495597_0000002_300714_301982	420
1315	3300046542	Ga0495597_0002619	Ga0495597_0002619_9891_11153	420
1316	3300046542	Ga0495597_0003973	Ga0495597_0003973_1472_2806	420
1317	3300046542	Ga0495597_0004276	Ga0495597_0004276_2486_3748	420
1318	3300046542	Ga0495597_0017009	Ga0495597_0017009_733_1995	420
1319	3300046557	Ga0495622_0046540	Ga0495622_0046540_215_1486	420
1320	3300046558	Ga0495633_0000985	Ga0495633_0000985_6170_7432	420
1321	3300046558	Ga0495633_0011865	Ga0495633_0011865_2074_3336	420
1322	3300046616	Ga0495668_0000467	Ga0495668_0000467_18351_19613	420
1323	3300046616	Ga0495668_0001331	Ga0495668_0001331_8120_9382	420
1324	3300046616	Ga0495668_0011694	Ga0495668_0011694_2151_3413	420
1325	3300046648	Ga0495611_0000300	Ga0495611_0000300_18573_19835	420
1326	3300046648	Ga0495611_0001383	Ga0495611_0001383_4328_5599	420
1327	3300046660	Ga0495625_0000016	Ga0495625_0000016_57778_59049	420
1328	3300046660	Ga0495625_0000806	Ga0495625_0000806_12174_13436	420
1329	3300046660	Ga0495625_0001360	Ga0495625_0001360_19367_20629	420
1330	3300046660	Ga0495625_0001545	Ga0495625_0001545_10022_11284	420
1331	3300046660	Ga0495625_0002678	Ga0495625_0002678_13392_14726	420
1332	3300046660	Ga0495625_0003129	Ga0495625_0003129_9741_11003	420
1333	3300046660	Ga0495625_0004222	Ga0495625_0004222_4179_5507	420
1334	3300046665	Ga0495661_0000001	Ga0495661_0000001_792859_794130	420
1335	3300046665	Ga0495661_0003773	Ga0495661_0003773_4239_5501	420
1336	3300046665	Ga0495661_0023575	Ga0495661_0023575_209_1543	420
1337	3300046665	Ga0495661_0024205	Ga0495661_0024205_1907_3169	420
1338	3300046679	Ga0495623_0029158	Ga0495623_0029158_627_1889	420
1339	3300046691	Ga0495670_0000045	Ga0495670_0000045_14519_15781	420
1340	3300046691	Ga0495670_0001189	Ga0495670_0001189_7167_8495	420
1341	3300046691	Ga0495670_0013225	Ga0495670_0013225_270_1532	420
1342	3300046691	Ga0495670_0025801	Ga0495670_0025801_529_1791	420
1343	3300046692	Ga0495671_0000173	Ga0495671_0000173_10315_11577	420
1344	3300046692	Ga0495671_0004172	Ga0495671_0004172_5556_6818	420
1345	3300046692	Ga0495671_0007333	Ga0495671_0007333_1467_2729	420
1346	3300046692	Ga0495671_0015018	Ga0495671_0015018_1805_3067	420
1347	3300046692	Ga0495671_0074732	Ga0495671_0074732_126_1388	420
1348	3300046694	Ga0495649_0001446	Ga0495649_0001446_491_1753	420
1349	3300046694	Ga0495649_0001670	Ga0495649_0001670_12357_13619	420
1350	3300046694	Ga0495649_0002277	Ga0495649_0002277_4216_5550	420
1351	3300046694	Ga0495649_0002849	Ga0495649_0002849_8074_9336	420
1352	3300046694	Ga0495649_0007295	Ga0495649_0007295_3338_4600	420
1353	3300046694	Ga0495649_0026396	Ga0495649_0026396_1955_3217	420
1354	3300046694	Ga0495649_0030882	Ga0495649_0030882_1164_2435	420
1355	3300046694	Ga0495649_0034023	Ga0495649_0034023_1451_2785	420
1356	3300046694	Ga0495649_0050705	Ga0495649_0050705_888_2150	420
1357	3300046794	Ga0495589_0000004	Ga0495589_0000004_137228_138490	420
1358	3300046794	Ga0495589_0000677	Ga0495589_0000677_4587_5849	420
1359	3300046794	Ga0495589_0001207	Ga0495589_0001207_3981_5243	420
1360	3300046794	Ga0495589_0001619	Ga0495589_0001619_8718_9980	420
1361	3300046794	Ga0495589_0003546	Ga0495589_0003546_5684_6946	420
1362	3300046794	Ga0495589_0016339	Ga0495589_0016339_1295_2557	420
1363	3300046794	Ga0495589_0017957	Ga0495589_0017957_160_1494	420
1364	3300046810	Ga0495660_0000075	Ga0495660_0000075_68776_70038	420
1365	3300046810	Ga0495660_0001881	Ga0495660_0001881_5101_6363	420
1366	3300046810	Ga0495660_0003711	Ga0495660_0003711_2819_4081	420
1367	3300046810	Ga0495660_0004195	Ga0495660_0004195_7282_8544	420
1368	3300046810	Ga0495660_0045397	Ga0495660_0045397_144_1406	420
1369	3300047320	Ga0495672_0002009	Ga0495672_0002009_5988_7250	420
1370	3300047320	Ga0495672_0017601	Ga0495672_0017601_2003_3271	420
1371	3300047320	Ga0495672_0024355	Ga0495672_0024355_2291_3553	420
1372	3300047320	Ga0495672_0042442	Ga0495672_0042442_739_2001	420
1373	3300047321	Ga0495676_0000001	Ga0495676_0000001_191731_193002	420
1374	3300047323	Ga0495683_0000037	Ga0495683_0000037_89939_91201	420
1375	3300047323	Ga0495683_0000146	Ga0495683_0000146_51419_52747	420
1376	3300047323	Ga0495683_0012721	Ga0495683_0012721_2341_3603	420
1377	3300047446	Ga0495679_000088	Ga0495679_000088_3612_4883	420
1378	3300047446	Ga0495679_001020	Ga0495679_001020_7864_9126	420
1379	3300047446	Ga0495679_003463	Ga0495679_003463_873_2135	420
1380	3300047446	Ga0495679_005399	Ga0495679_005399_3432_4694	420
1381	3300047446	Ga0495679_006610	Ga0495679_006610_2624_3886	420
1382	3300047469	Ga0495673_0000093	Ga0495673_0000093_99287_100549	420
1383	3300047469	Ga0495673_0001188	Ga0495673_0001188_10130_11401	420
1384	3300047469	Ga0495673_0001457	Ga0495673_0001457_12740_14002	420
1385	3300047469	Ga0495673_0004585	Ga0495673_0004585_4952_6223	420
1386	3300047469	Ga0495673_0007284	Ga0495673_0007284_4269_5531	420
1387	3300047470	Ga0495681_0002691	Ga0495681_0002691_7775_9046	420
1388	3300047470	Ga0495681_0003125	Ga0495681_0003125_4803_6065	420
1389	3300047470	Ga0495681_0003492	Ga0495681_0003492_3929_5191	420
1390	3300047470	Ga0495681_0006137	Ga0495681_0006137_3318_4580	420
1391	3300047470	Ga0495681_0043961	Ga0495681_0043961_867_2129	420
1392	3300047470	Ga0495681_0052679	Ga0495681_0052679_277_1539	420
1393	3300047471	Ga0495684_0010971	Ga0495684_0010971_1479_2741	420
1394	3300047472	Ga0495686_0002819	Ga0495686_0002819_6829_8091	420
1395	3300047472	Ga0495686_0003021	Ga0495686_0003021_2295_3623	420
1396	3300047472	Ga0495686_0004888	Ga0495686_0004888_3955_5217	420
1397	3300047472	Ga0495686_0026108	Ga0495686_0026108_347_1618	420
1398	3300047673	Ga0495593_0000374	Ga0495593_0000374_8211_9473	420
1399	3300048091	Ga0495626_0000002	Ga0495626_0000002_256657_257928	420
1400	3300048091	Ga0495626_0000242	Ga0495626_0000242_32124_33458	420
1401	3300048091	Ga0495626_0000329	Ga0495626_0000329_12940_14202	420
1402	3300048091	Ga0495626_0001800	Ga0495626_0001800_4132_5394	420
1403	3300048091	Ga0495626_0002151	Ga0495626_0002151_3192_4454	420
1404	3300048919	Ga0496116_0000048	Ga0496116_0000048_18978_20240	420
1405	3300048920	Ga0496117_0004160	Ga0496117_0004160_7035_8297	420
1406	3300048920	Ga0496117_0006664	Ga0496117_0006664_2549_3811	420
1407	3300048920	Ga0496117_0053166	Ga0496117_0053166_11_1273	420
1408	3300048921	Ga0496118_0000345	Ga0496118_0000345_70699_71961	420
1409	3300048921	Ga0496118_0000796	Ga0496118_0000796_22578_23840	420
1410	3300048921	Ga0496118_0080195	Ga0496118_0080195_280_1542	420
1411	3300048922	Ga0496119_0055698	Ga0496119_0055698_260_1522	420
1412	3300048924	Ga0496121_0080509	Ga0496121_0080509_581_1843	420
1413	3300048925	Ga0496122_0000086	Ga0496122_0000086_65584_66846	420
1414	3300048926	Ga0496123_0000021	Ga0496123_0000021_65730_66992	420
1415	3300048927	Ga0496124_0000092	Ga0496124_0000092_107287_108549	420
1416	3300048927	Ga0496124_0005256	Ga0496124_0005256_5645_6979	420
1417	3300048927	Ga0496124_0012508	Ga0496124_0012508_5380_6651	420
1418	3300048928	Ga0496125_0000103	Ga0496125_0000103_12740_14002	420
1419	3300048928	Ga0496125_0025674	Ga0496125_0025674_1481_2743	420
1420	3300048929	Ga0496126_0000229	Ga0496126_0000229_11621_12883	420
1421	3300049459	Ga0495678_001641	Ga0495678_001641_15435_16769	420
1422	3300049459	Ga0495678_002616	Ga0495678_002616_3582_4844	420
1423	3300049459	Ga0495678_002767	Ga0495678_002767_7438_8700	420
1424	3300049459	Ga0495678_004778	Ga0495678_004778_1292_2563	420
1425	3300049459	Ga0495678_007715	Ga0495678_007715_2726_3988	420
1426	3300049460	Ga0495682_0007453	Ga0495682_0007453_1693_2955	420
1427	3300049571	Ga0501034_0000248	Ga0501034_0000248_41083_42345	420
1428	3300049574	Ga0501038_0169232	Ga0501038_0169232_453_1715	420
1429	3300050489	nmdc:mga03683_16330_c1	nmdc:mga03683_16330_c1_1161_2468	420
1430	3300053135	Ga0500659_0000263	Ga0500659_0000263_25341_26603	420

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07746

LigA

Aromatic-ring-opening dioxygenase LigAB, LigA subunit

398

484

0.99 PF02900

LigB

Catalytic LigB subunit of aromatic ring-opening dioxygenase

80

349

0.94 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3wrb-assembly1.cif.gz_A	crystal structure of the anaerobic h124f desb-gallate complex	0.9719	3	410
3wrc-assembly1.cif.gz_A	crystal structure of the anaerobic desb-protocatechuate (pca) complex	0.9707	3	413
3wpm-assembly1.cif.gz_A	crystal structure of the anaerobic desb-gallate complex by co-crystallization	0.9699	3	414
3wrb-assembly1.cif.gz_A	crystal structure of the anaerobic h124f desb-gallate complex	0.9673	3	410
3wku-assembly1.cif.gz_B	crystal structure of the anaerobic desb-gallate complex	0.9668	3	406

ID	Description	Score	Start	End	Superfamily
3wraB02	Mainly Alpha;Orthogonal Bundle;Protocatechuate 4,5-dioxygenase; Chain A;Dioxygenase LigAB, LigA subunit	0.989	307	404	1.10.700.10
3wr8A02	Mainly Alpha;Orthogonal Bundle;Protocatechuate 4,5-dioxygenase; Chain A;Dioxygenase LigAB, LigA subunit	0.9888	307	407	1.10.700.10
3wkuA02	Mainly Alpha;Orthogonal Bundle;Protocatechuate 4,5-dioxygenase; Chain A;Dioxygenase LigAB, LigA subunit	0.981	307	412	1.10.700.10
3wpmB02	Mainly Alpha;Orthogonal Bundle;Protocatechuate 4,5-dioxygenase; Chain A;Dioxygenase LigAB, LigA subunit	0.981	307	406	1.10.700.10
3wrcA01	Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like	0.98	3	304	3.40.830.10

ID	Description	Score	Start	End	GO Terms
AF-A0A0L0MIH1-F1-model_v4	Protocatechuate 4,5-dioxygenase beta chain (EC 1.13.11.8)	0.9931	1	276	GO:0008198 GO:0018579
AF-F0GGW5-F1-model_v4	Protocatechuate 4,5-dioxygenase (EC 1.13.11.8)	0.993	1	278	GO:0008198 GO:0018579
AF-A0A7C2JVF1-F1-model_v4	Gallate dioxygenase (EC 1.13.11.57)	0.993	1	251	GO:0008198 GO:0036238
AF-A0A537B2W7-F1-model_v4	Protocatechuate 3,4-dioxygenase	0.9924	1	235	GO:0008198 GO:0051213
AF-A0A7X2RX81-F1-model_v4	Gallate dioxygenase (EC 1.13.11.57)	0.992	1	417	GO:0008198 GO:0036238

Feature Viewer

pLDDT	pTM	Quality
93.18	0.91	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F493899

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF07746

LigA

Aromatic-ring-opening dioxygenase LigAB, LigA subunit

398

484

0.99

PF02900

LigB

Catalytic LigB subunit of aromatic ring-opening dioxygenase

80

349

0.94

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map