F493782

General Info

Members Datasets Scaffolds Average Seq Length
1415 376 2830 320

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10055580|Ga0105240_100555803
Length 379
Sequence MAIFFMVLSSCVGPAISSDRPAAEGLGRQRIAVNLLGTSPHGAGRPGTSDRPVAFTTLKAEVKTRELIIIGGGPAGYTAALYAARADLEPLVIEGFQWGGQLMITSDVENYPGYADGVMGPEMMSDFRRQAERFGAEFITDDVTKVDFSEQPHRVFVGDDEYTARAVIIATGATARFLGIPSEEKHKGRGVSACATCDAAFFRDKDVYVVGGGDSAFEEALFLTKFASHVHLVHRRDEFRASRIMVDRADRNEKLDYVLNAVVDEIIGDVKVEGLRLRSTVTDETWEVPADGLFVAIGHDPSTALFVDHLDHDDQGYLVTSPGSTATNIPGVFAAGDVQDHTYRQAITAAGSGCMAALDAERFLASLEGHPGTALTAGR

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
175 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
176 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
177 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
180 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
181 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
182 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
183 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
184 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
185 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
186 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
189 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
195 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
196 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
197 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
198 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
199 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
200 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
201 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
208 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
219 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
220 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
221 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
222 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
223 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
224 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
225 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
226 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
227 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
228 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
229 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
230 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
231 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
232 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
233 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
234 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
235 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
236 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
237 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
238 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
239 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
240 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
241 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
242 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
248 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
249 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
250 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
251 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
252 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
253 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
254 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
255 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
256 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
257 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
258 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
259 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
260 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
261 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
262 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
263 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
264 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
265 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
266 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
267 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
268 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
269 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
270 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
271 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
272 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
273 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
274 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
275 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
276 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
277 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
278 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
279 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
280 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
281 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
282 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
283 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
284 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
285 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
286 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
287 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
288 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
289 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
290 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
291 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
294 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
295 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
296 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
297 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
298 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
299 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
300 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
301 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
302 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
303 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
304 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
305 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
306 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
307 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
308 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
309 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
310 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
311 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
312 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
313 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
314 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
315 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
316 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
317 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
318 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
319 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
336 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
337 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
338 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
339 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
340 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
341 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
342 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
343 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
344 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
345 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
346 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
347 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
348 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
349 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
350 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
353 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
354 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
355 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
356 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
357 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
358 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
359 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
360 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
361 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
362 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
363 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
364 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
365 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
366 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
367 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
368 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
369 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
370 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
371 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
372 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
373 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
374 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
375 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
376 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 2.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.13
Nodule 0
Rhizoplane 10.6
Rhizosphere 87.7
Stem 0
Stem Tuber 0
Unclassified 0.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10055580 3300009093 Bacteria 4956
2 JGI24738J21930_10004813 3300002075 Bacteria 3283
3 JGI25407J50210_10002464 3300003373 Bacteria 4359
4 Ga0070658_10016045 3300005327 Bacteria 5991
5 Ga0070658_10034579 3300005327 Bacteria 4066
6 Ga0070658_10089110 3300005327 Bacteria 2541
7 Ga0070658_10238552 3300005327 Bacteria 1541
8 Ga0070683_100003672 3300005329 Bacteria 12516
9 Ga0070683_100047809 3300005329 Bacteria 3954
10 Ga0070683_100076195 3300005329 Bacteria 3135
11 Ga0070683_100177274 3300005329 Bacteria 2023
12 Ga0070680_100003014 3300005336 Bacteria 12499
13 Ga0070680_100026345 3300005336 Bacteria 4650
14 Ga0070680_100033482 3300005336 Bacteria 4143
15 Ga0070680_100039991 3300005336 Bacteria 3795
16 Ga0070680_100046229 3300005336 Bacteria 3540
17 Ga0070682_100001154 3300005337 Bacteria 15085
18 Ga0070682_100007677 3300005337 Bacteria 6077
19 Ga0070682_100086954 3300005337 Bacteria 2037
20 Ga0070660_100003891 3300005339 Bacteria 10317
21 Ga0070660_100028566 3300005339 Bacteria 4174
22 Ga0070660_100048434 3300005339 Bacteria 3264
23 Ga0070660_100122221 3300005339 Bacteria 2078
24 Ga0070660_100336603 3300005339 Bacteria 1241
25 Ga0070689_100010453 3300005340 Bacteria 6615
26 Ga0070691_10001490 3300005341 Bacteria 10050
27 Ga0070661_100014347 3300005344 Bacteria 5581
28 Ga0070661_100042605 3300005344 Bacteria 3314
29 Ga0070661_100087400 3300005344 Bacteria 2306
30 Ga0070692_10001185 3300005345 Bacteria 9221
31 Ga0070668_100276978 3300005347 Bacteria 1400
32 Ga0070668_100373723 3300005347 Bacteria 1211
33 Ga0070669_100295841 3300005353 Bacteria 1301
34 Ga0070675_100006250 3300005354 Bacteria 9140
35 Ga0070671_100054537 3300005355 Bacteria 3324
36 Ga0070671_100102254 3300005355 Bacteria 2404
37 Ga0070671_100279533 3300005355 Bacteria 1419
38 Ga0070674_100006216 3300005356 Bacteria 6951
39 Ga0070674_100007050 3300005356 Bacteria 6608
40 Ga0070674_100055396 3300005356 Bacteria 2746
41 Ga0070674_100115142 3300005356 Bacteria 1981
42 Ga0070673_100004299 3300005364 Bacteria 8997
43 Ga0070673_100196375 3300005364 Bacteria 1736
44 Ga0070673_100244424 3300005364 Bacteria 1562
45 Ga0070688_100074382 3300005365 Bacteria 2182
46 Ga0070659_100001847 3300005366 Bacteria 15221
47 Ga0070659_100047410 3300005366 Bacteria 3370
48 Ga0070659_100053595 3300005366 Bacteria 3175
49 Ga0070667_100131229 3300005367 Bacteria 2187
50 Ga0070667_100155197 3300005367 Bacteria 2013
51 Ga0070667_100355532 3300005367 Bacteria 1327
52 Ga0070714_100009702 3300005435 Bacteria 7582
53 Ga0070714_100087305 3300005435 Bacteria 2727
54 Ga0070714_100150039 3300005435 Bacteria 2100
55 Ga0070714_100181520 3300005435 Bacteria 1915
56 Ga0070713_100002387 3300005436 Bacteria 12248
57 Ga0070713_100022139 3300005436 Bacteria 4906
58 Ga0070713_100022174 3300005436 Bacteria 4903
59 Ga0070713_100106551 3300005436 Bacteria 2437
60 Ga0070713_100170654 3300005436 Bacteria 1949
61 Ga0070710_10002369 3300005437 Bacteria 8922
62 Ga0070710_10004604 3300005437 Bacteria 6520
63 Ga0070710_10093515 3300005437 Bacteria 1777
64 Ga0070710_10135845 3300005437 Bacteria 1503
65 Ga0070711_100021791 3300005439 Bacteria 4147
66 Ga0070711_100049950 3300005439 Bacteria 2866
67 Ga0070694_100279111 3300005444 Bacteria 1273
68 Ga0070708_100201715 3300005445 Bacteria 1862
69 Ga0070663_100077065 3300005455 Bacteria 2440
70 Ga0070678_100022013 3300005456 Bacteria 4214
71 Ga0070678_100071075 3300005456 Bacteria 2604
72 Ga0070662_100014193 3300005457 Bacteria 5316
73 Ga0070662_100032861 3300005457 Bacteria 3649
74 Ga0070681_10013997 3300005458 Bacteria 7984
75 Ga0070681_10016356 3300005458 Bacteria 7404
76 Ga0070681_10023730 3300005458 Bacteria 6173
77 Ga0070681_10053838 3300005458 Bacteria 4010
78 Ga0070681_10394122 3300005458 Bacteria 1296
79 Ga0068867_100009456 3300005459 Bacteria 6873
80 Ga0068867_100090407 3300005459 Bacteria 2323
81 Ga0068867_100106689 3300005459 Bacteria 2146
82 Ga0068867_100271941 3300005459 Bacteria 1386
83 Ga0070706_100025393 3300005467 Bacteria 5451
84 Ga0070706_100102851 3300005467 Bacteria 2656
85 Ga0070706_100154233 3300005467 Bacteria 2144
86 Ga0070707_100008855 3300005468 Bacteria 9332
87 Ga0070707_100129005 3300005468 Bacteria 2458
88 Ga0070698_100000472 3300005471 Bacteria 42620
89 Ga0070698_100001742 3300005471 Bacteria 24266
90 Ga0070698_100012860 3300005471 Bacteria 8863
91 Ga0070698_100022411 3300005471 Bacteria 6608
92 Ga0070698_100082519 3300005471 Bacteria 3206
93 Ga0070698_100143501 3300005471 Bacteria 2338
94 Ga0070699_100026853 3300005518 Bacteria 4967
95 Ga0070699_100108344 3300005518 Bacteria 2438
96 Ga0070699_100119828 3300005518 Bacteria 2313
97 Ga0070679_100002682 3300005530 Bacteria 16215
98 Ga0070679_100010105 3300005530 Bacteria 8944
99 Ga0070679_100015262 3300005530 Bacteria 7380
100 Ga0070679_100060606 3300005530 Bacteria 3770
101 Ga0070679_100091769 3300005530 Bacteria 3025
102 Ga0070679_100206925 3300005530 Bacteria 1926
103 Ga0070679_100621161 3300005530 Bacteria 1024
104 Ga0070684_100002494 3300005535 Bacteria 13557
105 Ga0070684_100009589 3300005535 Bacteria 7630
106 Ga0070684_100021102 3300005535 Bacteria 5412
107 Ga0070684_100022528 3300005535 Bacteria 5255
108 Ga0070684_100044309 3300005535 Bacteria 3848
109 Ga0070684_100162758 3300005535 Bacteria 2025
110 Ga0070697_100028193 3300005536 Bacteria 4496
111 Ga0070697_100302970 3300005536 Bacteria 1374
112 Ga0068853_100013517 3300005539 Bacteria 6668
113 Ga0068853_100081711 3300005539 Bacteria 2830
114 Ga0070672_100065196 3300005543 Bacteria 2880
115 Ga0070686_100192428 3300005544 Bacteria 1457
116 Ga0070695_100042730 3300005545 Bacteria 2879
117 Ga0070693_100009457 3300005547 Bacteria 4848
118 Ga0070693_100010362 3300005547 Bacteria 4670
119 Ga0070693_100038476 3300005547 Bacteria 2674
120 Ga0070665_100056061 3300005548 Bacteria 3952
121 Ga0070704_100128218 3300005549 Bacteria 1961
122 Ga0068855_100029321 3300005563 Bacteria 6580
123 Ga0068855_100046564 3300005563 Bacteria 5126
124 Ga0068855_100107411 3300005563 Bacteria 3206
125 Ga0068855_100124516 3300005563 Bacteria 2948
126 Ga0068855_100135714 3300005563 Bacteria 2807
127 Ga0068857_100085160 3300005577 Bacteria 2825
128 Ga0068854_100005175 3300005578 Bacteria 8223
129 Ga0068854_100019060 3300005578 Bacteria 4617
130 Ga0068856_100184171 3300005614 Bacteria 2102
131 Ga0068856_100322675 3300005614 Bacteria 1562
132 Ga0070702_100062138 3300005615 Bacteria 2177
133 Ga0068852_100072149 3300005616 Bacteria 3034
134 Ga0068852_100084248 3300005616 Bacteria 2829
135 Ga0068852_100110738 3300005616 Bacteria 2495
136 Ga0068852_100182380 3300005616 Bacteria 1975
137 Ga0068866_10015588 3300005718 Bacteria 3379
138 Ga0068866_10019659 3300005718 Bacteria 3080
139 Ga0068861_100013608 3300005719 Bacteria 5696
140 Ga0068861_100086224 3300005719 Bacteria 2468
141 Ga0068870_10231683 3300005840 Bacteria 1136
142 Ga0068863_100059691 3300005841 Bacteria 3609
143 Ga0068858_100155850 3300005842 Bacteria 2149
144 Ga0068858_100255878 3300005842 Bacteria 1664
145 Ga0068860_100123490 3300005843 Bacteria 2481
146 Ga0068860_100152182 3300005843 Bacteria 2228
147 Ga0068860_100226779 3300005843 Bacteria 1815
148 Ga0068862_100263267 3300005844 Bacteria 1575
149 Ga0081455_10002893 3300005937 Bacteria 20164
150 Ga0081455_10006617 3300005937 Bacteria 12401
151 Ga0081455_10007185 3300005937 Bacteria 11770
152 Ga0081455_10012039 3300005937 Bacteria 8655
153 Ga0081455_10029777 3300005937 Bacteria 4972
154 Ga0081455_10044856 3300005937 Bacteria 3851
155 Ga0081455_10049104 3300005937 Bacteria 3640
156 Ga0081455_10091421 3300005937 Bacteria 2464
157 Ga0081455_10109191 3300005937 Bacteria 2202
158 Ga0081455_10133880 3300005937 Bacteria 1934
159 Ga0081538_10000012 3300005981 Bacteria 153046
160 Ga0081538_10000205 3300005981 Bacteria 65480
161 Ga0081538_10001091 3300005981 Bacteria 28734
162 Ga0081538_10001170 3300005981 Bacteria 27708
163 Ga0081538_10009350 3300005981 Bacteria 8195
164 Ga0081538_10010785 3300005981 Bacteria 7467
165 Ga0081538_10040029 3300005981 Bacteria 2995
166 Ga0081538_10098834 3300005981 Bacteria 1477
167 Ga0081540_1004192 3300005983 Bacteria 11087
168 Ga0081540_1006685 3300005983 Bacteria 8340
169 Ga0081539_10001511 3300005985 Bacteria 39181
170 Ga0081539_10001867 3300005985 Bacteria 33100
171 Ga0081539_10014792 3300005985 Bacteria 5733
172 Ga0070717_10004071 3300006028 Bacteria 10544
173 Ga0070717_10005336 3300006028 Bacteria 9370
174 Ga0070717_10008478 3300006028 Bacteria 7677
175 Ga0070717_10022452 3300006028 Bacteria 4986
176 Ga0070717_10114763 3300006028 Bacteria 2301
177 Ga0070717_10331987 3300006028 Bacteria 1356
178 Ga0075365_10050801 3300006038 Bacteria 2736
179 Ga0075365_10119624 3300006038 Bacteria 1816
180 Ga0075363_100158018 3300006048 Bacteria 1283
181 Ga0075364_10003473 3300006051 Bacteria 8969
182 Ga0075364_10008474 3300006051 Bacteria 6149
183 Ga0075364_10171756 3300006051 Bacteria 1465
184 Ga0075432_10015158 3300006058 Bacteria 2628
185 Ga0075432_10047605 3300006058 Bacteria 1507
186 Ga0070715_10000223 3300006163 Bacteria 13556
187 Ga0070716_100005561 3300006173 Bacteria 6118
188 Ga0070716_100051755 3300006173 Bacteria 2336
189 Ga0070716_100086655 3300006173 Bacteria 1884
190 Ga0070716_100150625 3300006173 Bacteria 1496
191 Ga0070712_100053783 3300006175 Bacteria 2812
192 Ga0075367_10197620 3300006178 Bacteria 1256
193 Ga0075366_10188846 3300006195 Bacteria 1252
194 Ga0097621_100122420 3300006237 Bacteria 2208
195 Ga0068871_100031259 3300006358 Bacteria 4197
196 Ga0075428_100000881 3300006844 Bacteria 31588
197 Ga0075428_100145687 3300006844 Bacteria 2574
198 Ga0075428_100204957 3300006844 Bacteria 2131
199 Ga0075430_100010050 3300006846 Bacteria 8007
200 Ga0075430_100138194 3300006846 Bacteria 2029
201 Ga0075430_100227031 3300006846 Bacteria 1549
202 Ga0075431_100029898 3300006847 Bacteria 5609
203 Ga0075431_100140313 3300006847 Bacteria 2491
204 Ga0075431_100145995 3300006847 Bacteria 2438
205 Ga0075431_100201835 3300006847 Bacteria 2034
206 Ga0075433_10001982 3300006852 Bacteria 15402
207 Ga0075433_10005692 3300006852 Bacteria 9798
208 Ga0075433_10079051 3300006852 Bacteria 2898
209 Ga0075434_100005232 3300006871 Bacteria 11788
210 Ga0075434_100010926 3300006871 Bacteria 8537
211 Ga0075434_100016151 3300006871 Bacteria 7174
212 Ga0075434_100047760 3300006871 Bacteria 4247
213 Ga0075434_100075796 3300006871 Bacteria 3358
214 Ga0075429_100002453 3300006880 Bacteria 15606
215 Ga0075429_100012763 3300006880 Bacteria 7288
216 Ga0075429_100016341 3300006880 Bacteria 6432
217 Ga0068865_100001102 3300006881 Bacteria 15595
218 Ga0068865_100067166 3300006881 Bacteria 2532
219 Ga0068865_100073362 3300006881 Bacteria 2434
220 Ga0068865_100082917 3300006881 Bacteria 2306
221 Ga0068865_100112570 3300006881 Bacteria 2010
222 Ga0075436_100004569 3300006914 Bacteria 9474
223 Ga0075436_100007624 3300006914 Bacteria 7394
224 Ga0075435_100002576 3300007076 Bacteria 12093
225 Ga0075435_100003349 3300007076 Bacteria 10858
226 Ga0075435_100098257 3300007076 Bacteria 2423
227 Ga0075435_100116723 3300007076 Bacteria 2224
228 Ga0105240_10027857 3300009093 Bacteria 7392
229 Ga0105240_10041896 3300009093 Bacteria 5839
230 Ga0105240_10066726 3300009093 Bacteria 4462
231 Ga0105240_10155567 3300009093 Bacteria 2719
232 Ga0105240_10179582 3300009093 Bacteria 2499
233 Ga0105240_10223643 3300009093 Bacteria 2191
234 Ga0105240_10343080 3300009093 Bacteria 1696
235 Ga0105240_10452039 3300009093 Bacteria 1437
236 Ga0111539_10005140 3300009094 Bacteria 16966
237 Ga0111539_10014417 3300009094 Bacteria 9865
238 Ga0111539_10289463 3300009094 Bacteria 1906
239 Ga0111539_10290287 3300009094 Bacteria 1903
240 Ga0111539_10314413 3300009094 Bacteria 1823
241 Ga0111539_10384773 3300009094 Bacteria 1633
242 Ga0105245_10015258 3300009098 Bacteria 6694
243 Ga0105245_10018003 3300009098 Bacteria 6170
244 Ga0105245_10032641 3300009098 Bacteria 4609
245 Ga0105245_10092679 3300009098 Bacteria 2782
246 Ga0105245_10207348 3300009098 Bacteria 1885
247 Ga0105245_10268117 3300009098 Bacteria 1664
248 Ga0105245_10495005 3300009098 Bacteria 1238
249 Ga0114129_10002158 3300009147 Bacteria 27126
250 Ga0114129_10097354 3300009147 Bacteria 4073
251 Ga0114129_10147476 3300009147 Bacteria 3222
252 Ga0114129_10377196 3300009147 Bacteria 1874
253 Ga0105243_10001674 3300009148 Bacteria 19173
254 Ga0105243_10007507 3300009148 Bacteria 8380
255 Ga0105243_10043286 3300009148 Bacteria 3529
256 Ga0105243_10086132 3300009148 Bacteria 2576
257 Ga0105243_10131094 3300009148 Bacteria 2126
258 Ga0105241_10130208 3300009174 Bacteria 2036
259 Ga0105242_10160950 3300009176 Bacteria 1965
260 Ga0105242_10302628 3300009176 Bacteria 1460
261 Ga0105242_10320360 3300009176 Bacteria 1422
262 Ga0105248_10178837 3300009177 Bacteria 2391
263 Ga0105248_10251936 3300009177 Bacteria 1987
264 Ga0105248_10560927 3300009177 Bacteria 1288
265 Ga0105237_10133570 3300009545 Bacteria 2477
266 Ga0105237_10176025 3300009545 Bacteria 2139
267 Ga0105238_10017502 3300009551 Bacteria 7286
268 Ga0105249_10007414 3300009553 Bacteria 9569
269 Ga0105249_10013589 3300009553 Bacteria 7193
270 Ga0105249_10342739 3300009553 Bacteria 1512
271 Ga0105239_10013948 3300010375 Bacteria 8922
272 Ga0105239_10020380 3300010375 Bacteria 7315
273 Ga0105239_10063871 3300010375 Bacteria 4042
274 Ga0105239_10146444 3300010375 Bacteria 2634
275 Ga0105239_10385004 3300010375 Bacteria 1586
276 Ga0105246_10026923 3300011119 Bacteria 3762
277 Ga0105246_10047578 3300011119 Bacteria 2930
278 Ga0105246_10354495 3300011119 Bacteria 1203
279 Ga0157373_10200948 3300013100 Bacteria 1405
280 Ga0157370_10031456 3300013104 Bacteria 5190
281 Ga0157370_10042692 3300013104 Bacteria 4368
282 Ga0157370_10044790 3300013104 Bacteria 4249
283 Ga0157370_10052706 3300013104 Bacteria 3883
284 Ga0157370_10145851 3300013104 Bacteria 2204
285 Ga0157370_10261974 3300013104 Bacteria 1598
286 Ga0157369_10002166 3300013105 Bacteria 23672
287 Ga0157369_10005648 3300013105 Bacteria 14534
288 Ga0157369_10007096 3300013105 Bacteria 12920
289 Ga0157369_10030268 3300013105 Bacteria 5972
290 Ga0157369_10070311 3300013105 Bacteria 3761
291 Ga0157369_10162046 3300013105 Bacteria 2361
292 Ga0157369_10175111 3300013105 Bacteria 2259
293 Ga0157369_10188014 3300013105 Bacteria 2171
294 Ga0157369_10320631 3300013105 Bacteria 1611
295 Ga0157374_10021783 3300013296 Bacteria 5708
296 Ga0157374_10077349 3300013296 Bacteria 3149
297 Ga0157374_10102677 3300013296 Bacteria 2743
298 Ga0157374_10377676 3300013296 Bacteria 1411
299 Ga0157378_10005680 3300013297 Bacteria 10916
300 Ga0157378_10209805 3300013297 Bacteria 1846
301 Ga0163162_10013965 3300013306 Bacteria 7849
302 Ga0163162_10080684 3300013306 Bacteria 3322
303 Ga0157372_10005776 3300013307 Bacteria 13182
304 Ga0157372_10426644 3300013307 Bacteria 1545
305 Ga0157375_10047986 3300013308 Bacteria 4174
306 Ga0163163_10010439 3300014325 Bacteria 8355
307 Ga0157380_10003284 3300014326 Bacteria 11084
308 Ga0157380_10505591 3300014326 Bacteria 1175
309 Ga0182008_10003056 3300014497 Bacteria 10276
310 Ga0157377_10016525 3300014745 Bacteria 3797
311 Ga0157379_10007742 3300014968 Bacteria 9304
312 Ga0157379_10011001 3300014968 Bacteria 7890
313 Ga0157379_10062950 3300014968 Bacteria 3317
314 Ga0157376_10081159 3300014969 Bacteria 2784
315 Ga0157376_10398389 3300014969 Bacteria 1330
316 Ga0197907_10066705 3300020069 Bacteria 4788
317 Ga0197907_10406384 3300020069 Bacteria 3282
318 Ga0197907_10589986 3300020069 Bacteria 3146
319 Ga0197907_10762704 3300020069 Bacteria 2661
320 Ga0206356_10072031 3300020070 Bacteria 4819
321 Ga0206356_10246559 3300020070 Bacteria 1259
322 Ga0206356_10770587 3300020070 Bacteria 1734
323 Ga0206356_11853397 3300020070 Bacteria 2730
324 Ga0206349_1962268 3300020075 Bacteria 1221
325 Ga0206352_11055655 3300020078 Bacteria 1169
326 Ga0206350_11051890 3300020080 Bacteria 1244
327 Ga0206350_11490151 3300020080 Bacteria 1283
328 Ga0206354_10052620 3300020081 Bacteria 1653
329 Ga0206354_10075868 3300020081 Bacteria 1831
330 Ga0206354_10378407 3300020081 Bacteria 3217
331 Ga0206354_10823254 3300020081 Bacteria 2474
332 Ga0206354_10928650 3300020081 Bacteria 3337
333 Ga0206353_10050633 3300020082 Bacteria 2024
334 Ga0206353_10328476 3300020082 Bacteria 5830
335 Ga0206353_10337916 3300020082 Bacteria 4762
336 Ga0206353_10902253 3300020082 Bacteria 1805
337 Ga0206353_11349432 3300020082 Bacteria 4280
338 Ga0206353_11456732 3300020082 Bacteria 1527
339 Ga0154015_1653186 3300020610 Bacteria 1350
340 Ga0213876_10008372 3300021384 Bacteria 5597
341 Ga0224712_10036199 3300022467 Bacteria 1827
342 Ga0224712_10057349 3300022467 Bacteria 1539
343 Ga0224712_10060366 3300022467 Bacteria 1509
344 Ga0224712_10060459 3300022467 Bacteria 1508
345 Ga0224712_10068235 3300022467 Bacteria 1437
346 Ga0224712_10091385 3300022467 Bacteria 1275
347 Ga0207692_10009309 3300025898 Bacteria 4096
348 Ga0207692_10061903 3300025898 Bacteria 1941
349 Ga0207642_10004636 3300025899 Bacteria 4441
350 Ga0207710_10035176 3300025900 Bacteria 2204
351 Ga0207688_10001633 3300025901 Bacteria 11834
352 Ga0207688_10048617 3300025901 Bacteria 2370
353 Ga0207699_10025004 3300025906 Bacteria 3273
354 Ga0207699_10029643 3300025906 Bacteria 3053
355 Ga0207699_10083633 3300025906 Bacteria 1986
356 Ga0207705_10064990 3300025909 Bacteria 2637
357 Ga0207705_10096065 3300025909 Bacteria 2175
358 Ga0207684_10029946 3300025910 Bacteria 4634
359 Ga0207684_10131952 3300025910 Bacteria 2144
360 Ga0207684_10197302 3300025910 Bacteria 1736
361 Ga0207654_10161075 3300025911 Bacteria 1450
362 Ga0207707_10001918 3300025912 Bacteria 18906
363 Ga0207707_10014107 3300025912 Bacteria 6963
364 Ga0207707_10068293 3300025912 Bacteria 3097
365 Ga0207707_10070389 3300025912 Bacteria 3048
366 Ga0207707_10158121 3300025912 Bacteria 1981
367 Ga0207707_10167554 3300025912 Bacteria 1920
368 Ga0207695_10071373 3300025913 Bacteria 3547
369 Ga0207695_10075586 3300025913 Bacteria 3427
370 Ga0207695_10141155 3300025913 Bacteria 2357
371 Ga0207695_10194970 3300025913 Bacteria 1942
372 Ga0207693_10004473 3300025915 Bacteria 11820
373 Ga0207693_10008397 3300025915 Bacteria 8449
374 Ga0207693_10016529 3300025915 Bacteria 5896
375 Ga0207693_10024908 3300025915 Bacteria 4746
376 Ga0207663_10003098 3300025916 Bacteria 8067
377 Ga0207663_10009226 3300025916 Bacteria 5204
378 Ga0207663_10013008 3300025916 Bacteria 4512
379 Ga0207663_10020518 3300025916 Bacteria 3743
380 Ga0207660_10019997 3300025917 Bacteria 4486
381 Ga0207660_10041731 3300025917 Bacteria 3216
382 Ga0207662_10017739 3300025918 Bacteria 4030
383 Ga0207657_10000500 3300025919 Bacteria 41333
384 Ga0207657_10001046 3300025919 Bacteria 29314
385 Ga0207657_10001931 3300025919 Bacteria 22381
386 Ga0207657_10014505 3300025919 Bacteria 7685
387 Ga0207657_10019153 3300025919 Bacteria 6508
388 Ga0207657_10022973 3300025919 Bacteria 5818
389 Ga0207657_10056995 3300025919 Bacteria 3370
390 Ga0207657_10069854 3300025919 Bacteria 2978
391 Ga0207649_10011519 3300025920 Bacteria 4878
392 Ga0207649_10024948 3300025920 Bacteria 3480
393 Ga0207652_10005399 3300025921 Bacteria 10370
394 Ga0207652_10151714 3300025921 Bacteria 2075
395 Ga0207646_10036601 3300025922 Bacteria 4429
396 Ga0207646_10080638 3300025922 Bacteria 2910
397 Ga0207694_10112758 3300025924 Bacteria 2164
398 Ga0207687_10031842 3300025927 Bacteria 3568
399 Ga0207687_10048253 3300025927 Bacteria 2955
400 Ga0207687_10096767 3300025927 Bacteria 2164
401 Ga0207687_10106529 3300025927 Bacteria 2073
402 Ga0207700_10005417 3300025928 Bacteria 7631
403 Ga0207700_10017243 3300025928 Bacteria 4819
404 Ga0207700_10034302 3300025928 Bacteria 3642
405 Ga0207700_10067327 3300025928 Bacteria 2741
406 Ga0207700_10233285 3300025928 Bacteria 1565
407 Ga0207664_10010163 3300025929 Bacteria 6642
408 Ga0207664_10026028 3300025929 Bacteria 4416
409 Ga0207664_10036943 3300025929 Bacteria 3777
410 Ga0207664_10059801 3300025929 Bacteria 3036
411 Ga0207664_10069742 3300025929 Bacteria 2827
412 Ga0207664_10075061 3300025929 Bacteria 2733
413 Ga0207664_10075416 3300025929 Bacteria 2727
414 Ga0207664_10086846 3300025929 Bacteria 2556
415 Ga0207664_10170476 3300025929 Bacteria 1862
416 Ga0207664_10231227 3300025929 Bacteria 1607
417 Ga0207644_10328402 3300025931 Bacteria 1238
418 Ga0207690_10025161 3300025932 Bacteria 3733
419 Ga0207690_10246022 3300025932 Bacteria 1379
420 Ga0207706_10010685 3300025933 Bacteria 8386
421 Ga0207706_10010784 3300025933 Bacteria 8342
422 Ga0207686_10030588 3300025934 Bacteria 3189
423 Ga0207686_10063426 3300025934 Bacteria 2350
424 Ga0207686_10089203 3300025934 Bacteria 2032
425 Ga0207686_10117078 3300025934 Bacteria 1807
426 Ga0207686_10147019 3300025934 Bacteria 1636
427 Ga0207709_10031676 3300025935 Bacteria 3091
428 Ga0207709_10051738 3300025935 Bacteria 2519
429 Ga0207709_10096258 3300025935 Bacteria 1947
430 Ga0207669_10049721 3300025937 Bacteria 2501
431 Ga0207669_10087587 3300025937 Bacteria 2017
432 Ga0207704_10243875 3300025938 Bacteria 1344
433 Ga0207665_10000322 3300025939 Bacteria 33292
434 Ga0207665_10001706 3300025939 Bacteria 14770
435 Ga0207691_10020470 3300025940 Bacteria 6254
436 Ga0207691_10058732 3300025940 Bacteria 3498
437 Ga0207711_10313235 3300025941 Bacteria 1449
438 Ga0207661_10021882 3300025944 Bacteria 4800
439 Ga0207661_10031932 3300025944 Bacteria 4074
440 Ga0207661_10043389 3300025944 Bacteria 3549
441 Ga0207661_10048769 3300025944 Bacteria 3367
442 Ga0207661_10051930 3300025944 Bacteria 3273
443 Ga0207661_10064740 3300025944 Bacteria 2965
444 Ga0207661_10068729 3300025944 Bacteria 2886
445 Ga0207661_10111791 3300025944 Bacteria 2311
446 Ga0207661_10160152 3300025944 Bacteria 1952
447 Ga0207661_10184040 3300025944 Bacteria 1827
448 Ga0207679_10178806 3300025945 Bacteria 1753
449 Ga0207667_10047297 3300025949 Bacteria 4554
450 Ga0207667_10066238 3300025949 Bacteria 3765
451 Ga0207667_10310229 3300025949 Bacteria 1611
452 Ga0207712_10058174 3300025961 Bacteria 2731
453 Ga0207712_10096319 3300025961 Bacteria 2190
454 Ga0207668_10059614 3300025972 Bacteria 2675
455 Ga0207640_10046445 3300025981 Bacteria 2794
456 Ga0207640_10087061 3300025981 Bacteria 2152
457 Ga0207658_10012227 3300025986 Bacteria 5859
458 Ga0207658_10185529 3300025986 Bacteria 1725
459 Ga0207677_10034516 3300026023 Bacteria 3276
460 Ga0207677_10044953 3300026023 Bacteria 2947
461 Ga0207677_10276846 3300026023 Bacteria 1375
462 Ga0207639_10304653 3300026041 Bacteria 1409
463 Ga0207639_10359622 3300026041 Bacteria 1302
464 Ga0207702_10124768 3300026078 Bacteria 2309
465 Ga0207702_10137771 3300026078 Bacteria 2204
466 Ga0207702_10181145 3300026078 Bacteria 1940
467 Ga0207702_10230346 3300026078 Bacteria 1731
468 Ga0207641_10071166 3300026088 Bacteria 2991
469 Ga0207648_10003355 3300026089 Bacteria 16835
470 Ga0207648_10083321 3300026089 Bacteria 2789
471 Ga0207648_10136115 3300026089 Bacteria 2164
472 Ga0207648_10188205 3300026089 Bacteria 1829
473 Ga0207676_10302980 3300026095 Bacteria 1460
474 Ga0207674_10030547 3300026116 Bacteria 5663
475 Ga0207674_10155408 3300026116 Bacteria 2243
476 Ga0207675_100003338 3300026118 Bacteria 15706
477 Ga0207675_100032560 3300026118 Bacteria 4856
478 Ga0207675_100104995 3300026118 Bacteria 2662
479 Ga0207675_100132972 3300026118 Bacteria 2359
480 Ga0207683_10000907 3300026121 Bacteria 27236
481 Ga0207683_10011436 3300026121 Bacteria 7574
482 Ga0207698_10184467 3300026142 Bacteria 1852
483 Ga0209998_10005198 3300027717 Bacteria 2732
484 Ga0207428_10000934 3300027907 Bacteria 32465
485 Ga0207428_10014460 3300027907 Bacteria 6857
486 Ga0207428_10021196 3300027907 Bacteria 5504
487 Ga0207428_10044392 3300027907 Bacteria 3586
488 Ga0207428_10076046 3300027907 Bacteria 2630
489 Ga0207428_10253317 3300027907 Bacteria 1312
490 Ga0268266_10332648 3300028379 Bacteria 1424
491 Ga0268264_10375064 3300028381 Bacteria 1361
492 Ga0265319_1022969 3300028563 Bacteria 2265
493 Ga0265334_10002668 3300028573 Bacteria 8254
494 Ga0265318_10000541 3300028577 Bacteria 26937
495 Ga0265336_10002072 3300028666 Bacteria 8529
496 Ga0265336_10013520 3300028666 Bacteria 2720
497 Ga0265338_10006253 3300028800 Bacteria 15239
498 Ga0265338_10071584 3300028800 Bacteria 2965
499 Ga0265338_10114613 3300028800 Bacteria 2162
500 Ga0265338_10141275 3300028800 Bacteria 1885
501 Ga0265330_10041490 3300031235 Bacteria 2041
502 Ga0265330_10052226 3300031235 Bacteria 1790
503 Ga0265325_10000949 3300031241 Bacteria 20963
504 Ga0265325_10006154 3300031241 Bacteria 7323
505 Ga0265329_10009253 3300031242 Bacteria 3687
506 Ga0265340_10004475 3300031247 Bacteria 7804
507 Ga0265340_10042262 3300031247 Bacteria 2238
508 Ga0265340_10070651 3300031247 Bacteria 1656
509 Ga0265339_10035428 3300031249 Bacteria 2800
510 Ga0265339_10064018 3300031249 Bacteria 1973
511 Ga0265327_10003872 3300031251 Bacteria 13792
512 Ga0265327_10004853 3300031251 Bacteria 11647
513 Ga0265327_10009219 3300031251 Bacteria 7157
514 Ga0265327_10081428 3300031251 Bacteria 1598
515 Ga0265316_10053194 3300031344 Bacteria 3174
516 Ga0265313_10001261 3300031595 Bacteria 24080
517 Ga0265313_10005640 3300031595 Bacteria 9148
518 Ga0265314_10004635 3300031711 Bacteria 12648
519 Ga0265314_10176459 3300031711 Bacteria 1284
520 Ga0316576_10011101 3300031727 Bacteria 5884
521 Ga0316576_10070493 3300031727 Bacteria 2578
522 Ga0316576_10109392 3300031727 Bacteria 2071
523 Ga0316578_10000145 3300031728 Bacteria 18460
524 Ga0307405_10036764 3300031731 Bacteria 2937
525 Ga0307416_100031422 3300032002 Bacteria 3997
526 Ga0307416_100165558 3300032002 Bacteria 2050
527 Ga0307416_100325252 3300032002 Bacteria 1542
528 Ga0307414_10370958 3300032004 Bacteria 1234
529 Ga0307415_100073578 3300032126 Bacteria 2411
530 Ga0316580_10003428 3300032139 Bacteria 4500
531 Ga0373948_0009547 3300034817 Unclassified 1675
532 Ga0373958_0010740 3300034819 Bacteria 1533
533 Ga0373928_0009411 3300035084 Bacteria 1908
534 Ga0373934_0080067 3300035086 Bacteria 1312
535 Ga0373944_0005847 3300035089 Bacteria 3255
536 Ga0373944_0008755 3300035089 Bacteria 2735
537 Ga0373941_0039088 3300035115 Bacteria 1456
538 Ga0373943_0001492 3300035170 Bacteria 10602
539 Ga0373943_0011200 3300035170 Bacteria 4033
540 Ga0373931_0047821 3300035691 Bacteria 2265
541 Ga0373931_0064446 3300035691 Bacteria 1983
542 Ga0373935_0023337 3300035692 Bacteria 3801
543 Ga0373935_0167083 3300035692 Bacteria 1503
544 Ga0373933_0120765 3300035724 Bacteria 1641
545 Ga0373933_0131302 3300035724 Bacteria 1575
546 Ga0373947_0001675 3300035725 Bacteria 13561
547 Ga0373947_0004617 3300035725 Bacteria 8076
548 Ga0373947_0023617 3300035725 Bacteria 3579
549 Ga0373937_0020040 3300036401 Bacteria 5991
550 Ga0316582_0026980 3300036647 Bacteria 3464
551 Ga0316584_0000210 3300036712 Bacteria 28809
552 Ga0373925_0002352 3300037068 Bacteria 15188
553 Ga0395899_0002892 3300037312 Bacteria 13793
554 Ga0395899_0004853 3300037312 Bacteria 10477
555 Ga0395899_0006387 3300037312 Bacteria 9130
556 Ga0395899_0012260 3300037312 Bacteria 6565
557 Ga0395899_0051640 3300037312 Bacteria 3050
558 Ga0395899_0067382 3300037312 Bacteria 2626
559 Ga0395900_0003129 3300037418 Bacteria 17953
560 Ga0395900_0006147 3300037418 Bacteria 12532
561 Ga0395900_0010590 3300037418 Bacteria 9429
562 Ga0395900_0015326 3300037418 Bacteria 7814
563 Ga0395900_0032766 3300037418 Bacteria 5344
564 Ga0395900_0051474 3300037418 Bacteria 4242
565 Ga0395900_0057081 3300037418 Bacteria 4019
566 Ga0395900_0059150 3300037418 Bacteria 3945
567 Ga0395900_0060264 3300037418 Bacteria 3906
568 Ga0395900_0073144 3300037418 Bacteria 3524
569 Ga0395900_0106957 3300037418 Bacteria 2874
570 Ga0395900_0247194 3300037418 Bacteria 1786
571 Ga0395900_0285013 3300037418 Bacteria 1642
572 Ga0395898_0001406 3300037466 Bacteria 34311
573 Ga0395898_0002816 3300037466 Bacteria 19946
574 Ga0395898_0006113 3300037466 Bacteria 12907
575 Ga0395898_0014630 3300037466 Bacteria 8057
576 Ga0395898_0021048 3300037466 Bacteria 6617
577 Ga0395898_0027384 3300037466 Bacteria 5723
578 Ga0395898_0028358 3300037466 Bacteria 5611
579 Ga0395898_0032012 3300037466 Bacteria 5249
580 Ga0395898_0051521 3300037466 Bacteria 4025
581 Ga0395898_0059980 3300037466 Bacteria 3699
582 Ga0395898_0092008 3300037466 Bacteria 2917
583 Ga0395898_0105290 3300037466 Bacteria 2705
584 Ga0395898_0117019 3300037466 Bacteria 2554
585 Ga0395898_0267610 3300037466 Bacteria 1630
586 Ga0395898_0427411 3300037466 Bacteria 1262
587 Ga0395905_0000786 3300037471 Bacteria 41747
588 Ga0395905_0012807 3300037471 Bacteria 8064
589 Ga0395905_0016305 3300037471 Bacteria 7060
590 Ga0395905_0032268 3300037471 Bacteria 4925
591 Ga0395905_0072168 3300037471 Bacteria 3237
592 Ga0395905_0076779 3300037471 Bacteria 3130
593 Ga0395905_0084025 3300037471 Bacteria 2982
594 Ga0395905_0115141 3300037471 Bacteria 2526
595 Ga0395905_0157922 3300037471 Bacteria 2132
596 Ga0395905_0257888 3300037471 Bacteria 1628
597 Ga0395905_0336185 3300037471 Bacteria 1401
598 Ga0395901_0003238 3300038443 Bacteria 16375
599 Ga0395901_0003793 3300038443 Bacteria 15221
600 Ga0395901_0007737 3300038443 Bacteria 10840
601 Ga0395901_0007808 3300038443 Bacteria 10795
602 Ga0395901_0019406 3300038443 Bacteria 6951
603 Ga0395901_0019981 3300038443 Bacteria 6852
604 Ga0395901_0024522 3300038443 Bacteria 6192
605 Ga0395901_0027511 3300038443 Bacteria 5843
606 Ga0395901_0028742 3300038443 Bacteria 5720
607 Ga0395901_0044951 3300038443 Bacteria 4582
608 Ga0395901_0052533 3300038443 Bacteria 4235
609 Ga0395901_0053752 3300038443 Bacteria 4185
610 Ga0395901_0101385 3300038443 Bacteria 3021
611 Ga0395901_0143034 3300038443 Bacteria 2514
612 Ga0395901_0160781 3300038443 Bacteria 2359
613 Ga0395901_0163814 3300038443 Bacteria 2335
614 Ga0395901_0171832 3300038443 Bacteria 2274
615 Ga0395901_0259934 3300038443 Bacteria 1807
616 Ga0395901_0404868 3300038443 Bacteria 1401
617 Ga0395901_0430990 3300038443 Bacteria 1351
618 Ga0395901_0589880 3300038443 Bacteria 1122
619 Ga0436365_1041009 3300039437 Bacteria 1713
620 Ga0436365_1159630 3300039437 Bacteria 2699
621 Ga0436365_1203947 3300039437 Bacteria 1586
622 Ga0436365_1437009 3300039437 Bacteria 13547
623 Ga0436365_1674627 3300039437 Bacteria 2828
624 Ga0436360_0070085 3300039438 Bacteria 4621
625 Ga0436363_1684106 3300039450 Bacteria 2425
626 Ga0439453_0012174 3300041408 Bacteria 1445
627 Ga0439461_0008158 3300041410 Bacteria 1871
628 Ga0451853_1423526 3300041512 Bacteria 1316
629 Ga0439433_0001766 3300041999 Bacteria 4487
630 Ga0439442_018737 3300042002 Bacteria 1431
631 Ga0439448_0044030 3300042005 Bacteria 1450
632 Ga0439462_0017785 3300042015 Bacteria 1842
633 Ga0439446_0004319 3300042156 Bacteria 3598
634 Ga0451577_0037639 3300042876 Bacteria 4354
635 Ga0466969_0002202 3300044656 Bacteria 10416
636 Ga0453683_0011143 3300044673 Bacteria 5943
637 Ga0453683_0012532 3300044673 Bacteria 5555
638 Ga0466965_0015015 3300044683 Bacteria 3674
639 Ga0466966_0018779 3300044684 Bacteria 4555
640 Ga0466961_0007507 3300044693 Bacteria 6936
641 Ga0466961_0028228 3300044693 Bacteria 3608
642 Ga0466961_0029817 3300044693 Bacteria 3505
643 Ga0466961_0042190 3300044693 Bacteria 2924
644 Ga0466961_0052448 3300044693 Bacteria 2603
645 Ga0466961_0183711 3300044693 Bacteria 1298
646 Ga0466963_0000430 3300044694 Bacteria 19359
647 Ga0466963_0001559 3300044694 Bacteria 12424
648 Ga0466963_0003053 3300044694 Bacteria 9480
649 Ga0466963_0006703 3300044694 Bacteria 6838
650 Ga0466963_0007066 3300044694 Bacteria 6685
651 Ga0466963_0008450 3300044694 Bacteria 6170
652 Ga0466963_0008744 3300044694 Bacteria 6080
653 Ga0466963_0010043 3300044694 Bacteria 5723
654 Ga0466963_0010163 3300044694 Bacteria 5690
655 Ga0466963_0011078 3300044694 Bacteria 5483
656 Ga0466963_0016280 3300044694 Bacteria 4621
657 Ga0466963_0017063 3300044694 Bacteria 4522
658 Ga0466963_0017321 3300044694 Bacteria 4490
659 Ga0466963_0018744 3300044694 Bacteria 4331
660 Ga0466963_0037144 3300044694 Bacteria 3179
661 Ga0466963_0039571 3300044694 Bacteria 3088
662 Ga0466963_0052899 3300044694 Bacteria 2695
663 Ga0466963_0078307 3300044694 Bacteria 2234
664 Ga0466963_0083433 3300044694 Bacteria 2167
665 Ga0466963_0140249 3300044694 Bacteria 1674
666 Ga0466964_0001644 3300044706 Bacteria 7724
667 Ga0466964_0004155 3300044706 Bacteria 5324
668 Ga0466964_0004602 3300044706 Bacteria 5101
669 Ga0466964_0013552 3300044706 Bacteria 3093
670 Ga0466964_0020056 3300044706 Bacteria 2573
671 Ga0466964_0027950 3300044706 Bacteria 2218
672 Ga0466964_0097470 3300044706 Bacteria 1290
673 Ga0453684_0128288 3300044712 Bacteria 3048
674 Ga0466971_0000571 3300044719 Bacteria 14575
675 Ga0466971_0003068 3300044719 Bacteria 7102
676 Ga0466968_0001242 3300044735 Bacteria 9053
677 Ga0466968_0001271 3300044735 Bacteria 8983
678 Ga0466968_0005848 3300044735 Bacteria 4618
679 Ga0466968_0014588 3300044735 Bacteria 3106
680 Ga0466968_0016358 3300044735 Bacteria 2952
681 Ga0466970_0005446 3300044765 Bacteria 6315
682 Ga0466970_0056479 3300044765 Bacteria 2098
683 Ga0466957_0005254 3300044842 Bacteria 7251
684 Ga0466957_0008394 3300044842 Bacteria 5873
685 Ga0466957_0010147 3300044842 Bacteria 5390
686 Ga0466957_0010946 3300044842 Bacteria 5216
687 Ga0466957_0015241 3300044842 Bacteria 4489
688 Ga0466957_0020548 3300044842 Bacteria 3886
689 Ga0466957_0024346 3300044842 Bacteria 3582
690 Ga0466957_0027194 3300044842 Bacteria 3398
691 Ga0466957_0050273 3300044842 Bacteria 2536
692 Ga0466957_0142476 3300044842 Bacteria 1545
693 Ga0466960_0007597 3300044901 Bacteria 4413
694 Ga0466960_0009601 3300044901 Bacteria 3994
695 Ga0466959_0000479 3300045049 Bacteria 23287
696 Ga0466959_0034099 3300045049 Bacteria 3766
697 Ga0466959_0044815 3300045049 Bacteria 3258
698 Ga0466959_0056480 3300045049 Bacteria 2864
699 Ga0466959_0065876 3300045049 Bacteria 2628
700 Ga0466959_0148052 3300045049 Bacteria 1656
701 Ga0466959_0153122 3300045049 Bacteria 1624
702 Ga0451576_0252855 3300045051 Bacteria 1842
703 Ga0451576_0266539 3300045051 Bacteria 1790
704 Ga0466958_0001620 3300045836 Bacteria 10837
705 Ga0466958_0002869 3300045836 Bacteria 8782
706 Ga0466958_0008231 3300045836 Bacteria 5775
707 Ga0466958_0008855 3300045836 Bacteria 5591
708 Ga0466958_0012290 3300045836 Bacteria 4848
709 Ga0466958_0020188 3300045836 Bacteria 3884
710 Ga0466958_0025054 3300045836 Bacteria 3514
711 Ga0466958_0038479 3300045836 Bacteria 2870
712 Ga0466958_0048445 3300045836 Bacteria 2568
713 Ga0466958_0060024 3300045836 Bacteria 2314
714 Ga0466958_0114145 3300045836 Bacteria 1687
715 Ga0466958_0116083 3300045836 Bacteria 1673
716 Ga0466958_0251484 3300045836 Bacteria 1130
717 Ga0466967_0002221 3300045976 Bacteria 11944
718 Ga0466967_0002496 3300045976 Bacteria 11486
719 Ga0466967_0006144 3300045976 Bacteria 8454
720 Ga0466967_0006258 3300045976 Bacteria 8394
721 Ga0466967_0008012 3300045976 Bacteria 7697
722 Ga0466967_0010163 3300045976 Bacteria 7039
723 Ga0466967_0013224 3300045976 Bacteria 6364
724 Ga0466967_0015777 3300045976 Bacteria 5934
725 Ga0466967_0025288 3300045976 Bacteria 4894
726 Ga0466967_0028405 3300045976 Bacteria 4669
727 Ga0466967_0030656 3300045976 Bacteria 4516
728 Ga0466967_0036182 3300045976 Bacteria 4212
729 Ga0466967_0041940 3300045976 Bacteria 3950
730 Ga0466967_0043843 3300045976 Bacteria 3876
731 Ga0466967_0045632 3300045976 Bacteria 3808
732 Ga0466967_0049750 3300045976 Bacteria 3667
733 Ga0466967_0049997 3300045976 Bacteria 3659
734 Ga0466967_0053383 3300045976 Bacteria 3551
735 Ga0466967_0057898 3300045976 Bacteria 3423
736 Ga0466967_0058407 3300045976 Bacteria 3410
737 Ga0466967_0073861 3300045976 Bacteria 3060
738 Ga0466967_0085779 3300045976 Bacteria 2851
739 Ga0466967_0105828 3300045976 Bacteria 2577
740 Ga0466967_0116544 3300045976 Bacteria 2461
741 Ga0466967_0122778 3300045976 Bacteria 2402
742 Ga0466967_0146681 3300045976 Bacteria 2201
743 Ga0466967_0150267 3300045976 Bacteria 2176
744 Ga0466967_0170935 3300045976 Bacteria 2045
745 Ga0466967_0173080 3300045976 Bacteria 2032
746 Ga0466967_0183041 3300045976 Bacteria 1977
747 Ga0466967_0184918 3300045976 Bacteria 1967
748 Ga0466967_0199870 3300045976 Bacteria 1892
749 Ga0466967_0201895 3300045976 Bacteria 1883
750 Ga0466967_0261006 3300045976 Bacteria 1657
751 Ga0466967_0379309 3300045976 Bacteria 1372
752 Ga0466967_0596433 3300045976 Bacteria 1090
753 Ga0466967_0789713 3300045976 Bacteria 942
754 Ga0495592_0000125 3300046454 Bacteria 68045
755 Ga0495592_0020342 3300046454 Bacteria 5048
756 Ga0495592_0041170 3300046454 Bacteria 3462
757 Ga0495592_0171125 3300046454 Bacteria 1487
758 Ga0495592_0204192 3300046454 Bacteria 1332
759 Ga0495603_0002588 3300046455 Bacteria 10676
760 Ga0495603_0003187 3300046455 Bacteria 9759
761 Ga0495603_0060076 3300046455 Bacteria 2246
762 Ga0495603_0072196 3300046455 Bacteria 2028
763 Ga0495603_0076174 3300046455 Bacteria 1969
764 Ga0495603_0105830 3300046455 Bacteria 1642
765 Ga0495629_0004786 3300046459 Bacteria 10148
766 Ga0495629_0129220 3300046459 Bacteria 1760
767 Ga0495629_0136817 3300046459 Bacteria 1705
768 Ga0495629_0164767 3300046459 Bacteria 1539
769 Ga0495629_0215737 3300046459 Bacteria 1324
770 Ga0495629_0265684 3300046459 Bacteria 1179
771 Ga0495641_0000455 3300046461 Bacteria 34086
772 Ga0495641_0003498 3300046461 Bacteria 11713
773 Ga0495651_0000104 3300046462 Bacteria 61716
774 Ga0495651_0002454 3300046462 Bacteria 14323
775 Ga0495651_0023417 3300046462 Bacteria 4801
776 Ga0495651_0051543 3300046462 Bacteria 3172
777 Ga0495653_0004604 3300046463 Bacteria 11155
778 Ga0495653_0005005 3300046463 Bacteria 10755
779 Ga0495653_0025029 3300046463 Bacteria 4802
780 Ga0495653_0086897 3300046463 Bacteria 2297
781 Ga0495653_0192707 3300046463 Bacteria 1389
782 Ga0495582_0008896 3300046473 Bacteria 5540
783 Ga0495582_0009208 3300046473 Bacteria 5446
784 Ga0495582_0035419 3300046473 Bacteria 2745
785 Ga0495582_0139131 3300046473 Bacteria 1375
786 Ga0495582_0169684 3300046473 Bacteria 1242
787 Ga0495605_0018697 3300046474 Bacteria 3709
788 Ga0495605_0106923 3300046474 Bacteria 1280
789 Ga0495639_0000871 3300046475 Bacteria 13644
790 Ga0495662_0018674 3300046476 Bacteria 3356
791 Ga0495662_0103207 3300046476 Bacteria 1395
792 Ga0495664_0025767 3300046477 Bacteria 3424
793 Ga0495664_0126694 3300046477 Bacteria 1545
794 Ga0495584_0036926 3300046491 Bacteria 2468
795 Ga0495584_0038990 3300046491 Bacteria 2401
796 Ga0495594_0000352 3300046499 Bacteria 23103
797 Ga0495596_0059302 3300046500 Bacteria 1492
798 Ga0495607_0043294 3300046501 Bacteria 2663
799 Ga0495608_0000595 3300046511 Bacteria 24865
800 Ga0495608_0013071 3300046511 Bacteria 5760
801 Ga0495608_0017819 3300046511 Bacteria 4909
802 Ga0495608_0025993 3300046511 Bacteria 3995
803 Ga0495608_0084370 3300046511 Bacteria 2060
804 Ga0495608_0094446 3300046511 Bacteria 1932
805 Ga0495618_0006629 3300046514 Bacteria 7016
806 Ga0495618_0013492 3300046514 Bacteria 4970
807 Ga0495618_0050218 3300046514 Bacteria 2635
808 Ga0495628_0000040 3300046516 Bacteria 104506
809 Ga0495628_0008773 3300046516 Bacteria 8653
810 Ga0495628_0008875 3300046516 Bacteria 8601
811 Ga0495628_0040955 3300046516 Bacteria 3698
812 Ga0495628_0219966 3300046516 Bacteria 1426
813 Ga0495628_0262752 3300046516 Bacteria 1286
814 Ga0495630_0003720 3300046517 Bacteria 10634
815 Ga0495630_0017698 3300046517 Bacteria 5225
816 Ga0495630_0019912 3300046517 Bacteria 4939
817 Ga0495630_0027300 3300046517 Bacteria 4233
818 Ga0495630_0045027 3300046517 Bacteria 3297
819 Ga0495630_0080951 3300046517 Bacteria 2451
820 Ga0495630_0089104 3300046517 Bacteria 2330
821 Ga0495630_0116135 3300046517 Bacteria 2028
822 Ga0495630_0123402 3300046517 Bacteria 1965
823 Ga0495630_0159142 3300046517 Bacteria 1719
824 Ga0495630_0189550 3300046517 Bacteria 1569
825 Ga0495644_0099866 3300046523 Bacteria 1098
826 Ga0495666_0007047 3300046526 Bacteria 5648
827 Ga0495666_0015658 3300046526 Bacteria 3776
828 Ga0495652_0000298 3300046529 Bacteria 59074
829 Ga0495652_0093106 3300046529 Bacteria 2461
830 Ga0495652_0110145 3300046529 Bacteria 2215
831 Ga0495652_0115375 3300046529 Bacteria 2152
832 Ga0495652_0126607 3300046529 Bacteria 2028
833 Ga0495665_0002244 3300046531 Bacteria 10458
834 Ga0495665_0074768 3300046531 Bacteria 1784
835 Ga0495640_0001758 3300046533 Bacteria 17170
836 Ga0495640_0044379 3300046533 Bacteria 3091
837 Ga0495640_0058395 3300046533 Bacteria 2631
838 Ga0495640_0061616 3300046533 Bacteria 2547
839 Ga0495640_0084847 3300046533 Bacteria 2099
840 Ga0495640_0110951 3300046533 Bacteria 1793
841 Ga0495587_0000212 3300046536 Bacteria 43340
842 Ga0495587_0025540 3300046536 Bacteria 3610
843 Ga0495587_0032844 3300046536 Bacteria 3135
844 Ga0495587_0061580 3300046536 Bacteria 2199
845 Ga0495609_0035401 3300046538 Bacteria 2260
846 Ga0495609_0049744 3300046538 Bacteria 1870
847 Ga0495645_0000035 3300046543 Bacteria 102305
848 Ga0495645_0072687 3300046543 Bacteria 2478
849 Ga0495645_0084403 3300046543 Bacteria 2274
850 Ga0495645_0161612 3300046543 Bacteria 1548
851 Ga0495622_0029075 3300046557 Bacteria 2582
852 Ga0495667_0025972 3300046559 Bacteria 3945
853 Ga0495667_0029233 3300046559 Bacteria 3709
854 Ga0495667_0133415 3300046559 Bacteria 1601
855 Ga0495656_0003461 3300046615 Bacteria 5338
856 Ga0495634_0022140 3300046642 Bacteria 4480
857 Ga0495634_0089748 3300046642 Bacteria 1997
858 Ga0495634_0175114 3300046642 Bacteria 1346
859 Ga0495611_0030048 3300046648 Bacteria 2387
860 Ga0495635_0031027 3300046663 Bacteria 3713
861 Ga0495635_0128027 3300046663 Bacteria 1731
862 Ga0495659_0003008 3300046664 Bacteria 5407
863 Ga0495661_0113819 3300046665 Bacteria 1504
864 Ga0495588_0001261 3300046674 Bacteria 10856
865 Ga0495657_0002891 3300046675 Bacteria 14255
866 Ga0495657_0044094 3300046675 Bacteria 3037
867 Ga0495657_0047828 3300046675 Bacteria 2889
868 Ga0495657_0048638 3300046675 Bacteria 2859
869 Ga0495599_0000009 3300046678 Bacteria 217299
870 Ga0495599_0096758 3300046678 Bacteria 1840
871 Ga0495599_0170355 3300046678 Bacteria 1344
872 Ga0495599_0282386 3300046678 Bacteria 1005
873 Ga0495623_0001465 3300046679 Bacteria 15981
874 Ga0495623_0032031 3300046679 Bacteria 3380
875 Ga0495623_0063824 3300046679 Bacteria 2305
876 Ga0495646_0006560 3300046680 Bacteria 7385
877 Ga0495646_0019252 3300046680 Bacteria 4324
878 Ga0495647_0027036 3300046681 Bacteria 2106
879 Ga0495647_0039174 3300046681 Bacteria 1795
880 Ga0495658_0000943 3300046683 Bacteria 15496
881 Ga0495658_0004844 3300046683 Bacteria 6603
882 Ga0495658_0150261 3300046683 Bacteria 1430
883 Ga0495613_0001715 3300046689 Bacteria 16689
884 Ga0495613_0005719 3300046689 Bacteria 9321
885 Ga0495613_0089060 3300046689 Bacteria 2236
886 Ga0495613_0158948 3300046689 Bacteria 1608
887 Ga0495613_0228359 3300046689 Bacteria 1305
888 Ga0495613_0254173 3300046689 Bacteria 1226
889 Ga0495624_0056006 3300046690 Bacteria 2482
890 Ga0495670_0065612 3300046691 Bacteria 1830
891 Ga0495670_0088604 3300046691 Bacteria 1582
892 Ga0495589_0142309 3300046794 Bacteria 1148
893 Ga0495600_0018215 3300046809 Bacteria 4471
894 Ga0495600_0022173 3300046809 Bacteria 4075
895 Ga0495600_0069166 3300046809 Bacteria 2307
896 Ga0495581_0000618 3300047315 Bacteria 18638
897 Ga0495581_0015527 3300047315 Bacteria 4421
898 Ga0495604_0000120 3300047317 Bacteria 66462
899 Ga0495604_0172875 3300047317 Bacteria 1517
900 Ga0495604_0175538 3300047317 Bacteria 1503
901 Ga0495674_0002761 3300047319 Bacteria 17035
902 Ga0495674_0031685 3300047319 Bacteria 4800
903 Ga0495674_0038281 3300047319 Bacteria 4306
904 Ga0495674_0040406 3300047319 Bacteria 4172
905 Ga0495674_0087891 3300047319 Bacteria 2659
906 Ga0495674_0115831 3300047319 Bacteria 2268
907 Ga0495674_0175200 3300047319 Bacteria 1788
908 Ga0495676_0006670 3300047321 Bacteria 10638
909 Ga0495676_0009347 3300047321 Bacteria 8934
910 Ga0495676_0143535 3300047321 Bacteria 1708
911 Ga0495680_0000280 3300047322 Bacteria 57136
912 Ga0495680_0002774 3300047322 Bacteria 17672
913 Ga0495680_0004409 3300047322 Bacteria 13460
914 Ga0495680_0008617 3300047322 Bacteria 9258
915 Ga0495680_0022786 3300047322 Bacteria 5215
916 Ga0495680_0032999 3300047322 Bacteria 4196
917 Ga0495680_0061497 3300047322 Bacteria 2889
918 Ga0495680_0105614 3300047322 Bacteria 2094
919 Ga0495680_0154818 3300047322 Bacteria 1668
920 Ga0495675_0000137 3300047444 Bacteria 50947
921 Ga0495675_0046463 3300047444 Bacteria 2764
922 Ga0495675_0109399 3300047444 Bacteria 1726
923 Ga0495677_0060035 3300047445 Bacteria 1409
924 Ga0495677_0142568 3300047445 Bacteria 920
925 Ga0495679_021229 3300047446 Bacteria 2247
926 Ga0495684_0003498 3300047471 Bacteria 12285
927 Ga0495684_0003793 3300047471 Bacteria 11780
928 Ga0495684_0013160 3300047471 Bacteria 6384
929 Ga0495684_0028726 3300047471 Bacteria 4270
930 Ga0495684_0043393 3300047471 Bacteria 3443
931 Ga0495684_0096425 3300047471 Bacteria 2238
932 Ga0495684_0142305 3300047471 Bacteria 1798
933 Ga0495593_0003213 3300047673 Bacteria 9801
934 Ga0495602_0001635 3300048088 Bacteria 22289
935 Ga0495602_0025218 3300048088 Bacteria 5755
936 Ga0495602_0038656 3300048088 Bacteria 4409
937 Ga0495602_0099776 3300048088 Bacteria 2386
938 Ga0495602_0118124 3300048088 Bacteria 2139
939 Ga0495602_0126326 3300048088 Bacteria 2048
940 Ga0495614_0015578 3300048089 Bacteria 3314
941 Ga0496100_0009180 3300048903 Bacteria 5548
942 Ga0496100_0024253 3300048903 Bacteria 3697
943 Ga0496100_0050713 3300048903 Bacteria 2690
944 Ga0496100_0087301 3300048903 Bacteria 2120
945 Ga0496100_0087517 3300048903 Bacteria 2118
946 Ga0496100_0143041 3300048903 Bacteria 1697
947 Ga0496100_0143662 3300048903 Bacteria 1694
948 Ga0496101_0020105 3300048904 Bacteria 4566
949 Ga0496101_0042290 3300048904 Bacteria 3252
950 Ga0496101_0047319 3300048904 Bacteria 3087
951 Ga0496101_0057734 3300048904 Bacteria 2808
952 Ga0496101_0059389 3300048904 Bacteria 2771
953 Ga0496101_0065916 3300048904 Bacteria 2640
954 Ga0496101_0075050 3300048904 Bacteria 2488
955 Ga0496101_0081026 3300048904 Bacteria 2399
956 Ga0496101_0082217 3300048904 Bacteria 2383
957 Ga0496102_0013736 3300048905 Bacteria 7022
958 Ga0496102_0015401 3300048905 Bacteria 6659
959 Ga0496102_0050155 3300048905 Bacteria 3799
960 Ga0496102_0056157 3300048905 Bacteria 3591
961 Ga0496102_0060977 3300048905 Bacteria 3451
962 Ga0496102_0128722 3300048905 Bacteria 2368
963 Ga0496102_0144504 3300048905 Bacteria 2232
964 Ga0496102_0278908 3300048905 Bacteria 1575
965 Ga0496102_0441322 3300048905 Bacteria 1221
966 Ga0496103_0015177 3300048906 Bacteria 4579
967 Ga0496103_0018176 3300048906 Bacteria 4216
968 Ga0496103_0041829 3300048906 Bacteria 2818
969 Ga0496103_0042171 3300048906 Bacteria 2807
970 Ga0496103_0156346 3300048906 Bacteria 1462
971 Ga0496104_0000288 3300048907 Bacteria 44366
972 Ga0496104_0002201 3300048907 Bacteria 16866
973 Ga0496104_0003018 3300048907 Bacteria 14496
974 Ga0496104_0008275 3300048907 Bacteria 9236
975 Ga0496104_0012649 3300048907 Bacteria 7598
976 Ga0496104_0012732 3300048907 Bacteria 7577
977 Ga0496104_0014445 3300048907 Bacteria 7133
978 Ga0496104_0098374 3300048907 Bacteria 2801
979 Ga0496104_0249842 3300048907 Bacteria 1686
980 Ga0496104_0495841 3300048907 Bacteria 1132
981 Ga0496104_0562447 3300048907 Bacteria 1051
982 Ga0496105_0001581 3300048908 Bacteria 16141
983 Ga0496105_0002146 3300048908 Bacteria 14289
984 Ga0496105_0002776 3300048908 Bacteria 12802
985 Ga0496105_0004733 3300048908 Bacteria 10271
986 Ga0496105_0004966 3300048908 Bacteria 10056
987 Ga0496105_0006879 3300048908 Bacteria 8754
988 Ga0496105_0007108 3300048908 Bacteria 8635
989 Ga0496105_0046089 3300048908 Bacteria 3599
990 Ga0496105_0047377 3300048908 Bacteria 3547
991 Ga0496105_0069465 3300048908 Bacteria 2911
992 Ga0496105_0073408 3300048908 Bacteria 2826
993 Ga0496105_0134161 3300048908 Bacteria 2040
994 Ga0496105_0317832 3300048908 Bacteria 1249
995 Ga0496106_0020665 3300048909 Bacteria 4888
996 Ga0496106_0046880 3300048909 Bacteria 3250
997 Ga0496106_0083964 3300048909 Bacteria 2450
998 Ga0496106_0116707 3300048909 Bacteria 2082
999 Ga0496106_0150046 3300048909 Bacteria 1838
1000 Ga0496106_0235753 3300048909 Bacteria 1462
1001 Ga0496107_0008952 3300048910 Bacteria 6937
1002 Ga0496107_0012664 3300048910 Bacteria 5891
1003 Ga0496107_0055230 3300048910 Bacteria 2868
1004 Ga0496107_0059556 3300048910 Bacteria 2763
1005 Ga0496107_0101876 3300048910 Bacteria 2105
1006 Ga0496107_0202545 3300048910 Bacteria 1475
1007 Ga0496108_0000488 3300048911 Bacteria 31704
1008 Ga0496108_0005783 3300048911 Bacteria 10018
1009 Ga0496108_0008358 3300048911 Bacteria 8396
1010 Ga0496108_0008784 3300048911 Bacteria 8191
1011 Ga0496108_0013131 3300048911 Bacteria 6751
1012 Ga0496108_0081342 3300048911 Bacteria 2745
1013 Ga0496108_0083028 3300048911 Bacteria 2717
1014 Ga0496109_0003085 3300048912 Bacteria 13897
1015 Ga0496109_0004872 3300048912 Bacteria 11208
1016 Ga0496109_0007811 3300048912 Bacteria 9061
1017 Ga0496109_0014579 3300048912 Bacteria 6839
1018 Ga0496109_0080298 3300048912 Bacteria 3005
1019 Ga0496109_0089324 3300048912 Bacteria 2848
1020 Ga0496109_0095735 3300048912 Bacteria 2749
1021 Ga0496109_0144396 3300048912 Bacteria 2226
1022 Ga0496109_0153872 3300048912 Bacteria 2154
1023 Ga0496109_0176924 3300048912 Bacteria 2003
1024 Ga0496109_0193260 3300048912 Bacteria 1912
1025 Ga0496109_0236387 3300048912 Bacteria 1719
1026 Ga0496109_0294386 3300048912 Bacteria 1530
1027 Ga0496109_0384129 3300048912 Bacteria 1326
1028 Ga0496109_0607902 3300048912 Bacteria 1030
1029 Ga0496110_0016414 3300048913 Bacteria 6182
1030 Ga0496110_0022355 3300048913 Bacteria 5369
1031 Ga0496110_0022538 3300048913 Bacteria 5348
1032 Ga0496110_0033713 3300048913 Bacteria 4432
1033 Ga0496110_0037483 3300048913 Bacteria 4214
1034 Ga0496110_0037654 3300048913 Bacteria 4204
1035 Ga0496110_0051079 3300048913 Bacteria 3633
1036 Ga0496110_0086044 3300048913 Bacteria 2806
1037 Ga0496110_0092493 3300048913 Bacteria 2706
1038 Ga0496110_0106849 3300048913 Bacteria 2512
1039 Ga0496110_0139601 3300048913 Bacteria 2191
1040 Ga0496110_0180958 3300048913 Bacteria 1914
1041 Ga0496111_0000604 3300048914 Bacteria 18917
1042 Ga0496111_0019304 3300048914 Bacteria 4732
1043 Ga0496111_0020875 3300048914 Bacteria 4566
1044 Ga0496111_0050050 3300048914 Bacteria 3012
1045 Ga0496111_0088342 3300048914 Bacteria 2270
1046 Ga0496111_0092557 3300048914 Bacteria 2216
1047 Ga0496111_0200123 3300048914 Bacteria 1485
1048 Ga0496112_0000715 3300048915 Bacteria 23054
1049 Ga0496112_0001042 3300048915 Bacteria 20421
1050 Ga0496112_0002767 3300048915 Bacteria 14230
1051 Ga0496112_0014719 3300048915 Bacteria 7273
1052 Ga0496112_0044861 3300048915 Bacteria 4332
1053 Ga0496112_0146187 3300048915 Bacteria 2332
1054 Ga0496112_0181306 3300048915 Bacteria 2070
1055 Ga0496112_0234523 3300048915 Bacteria 1789
1056 Ga0496112_0235780 3300048915 Bacteria 1783
1057 Ga0496112_0297927 3300048915 Bacteria 1558
1058 Ga0496113_0000904 3300048916 Bacteria 15662
1059 Ga0496113_0089995 3300048916 Bacteria 2363
1060 Ga0496113_0149401 3300048916 Bacteria 1842
1061 Ga0496114_0002005 3300048917 Bacteria 15475
1062 Ga0496114_0002698 3300048917 Bacteria 13561
1063 Ga0496114_0005403 3300048917 Bacteria 9990
1064 Ga0496114_0009509 3300048917 Bacteria 7714
1065 Ga0496114_0014287 3300048917 Bacteria 6370
1066 Ga0496114_0033577 3300048917 Bacteria 4229
1067 Ga0496114_0052280 3300048917 Bacteria 3403
1068 Ga0496114_0086337 3300048917 Bacteria 2659
1069 Ga0496114_0128642 3300048917 Bacteria 2185
1070 Ga0496114_0140860 3300048917 Bacteria 2088
1071 Ga0496114_0141978 3300048917 Bacteria 2080
1072 Ga0496114_0217541 3300048917 Bacteria 1676
1073 Ga0496114_0233486 3300048917 Bacteria 1616
1074 Ga0496114_0249453 3300048917 Bacteria 1562
1075 Ga0496114_0277508 3300048917 Bacteria 1477
1076 Ga0496114_0337051 3300048917 Bacteria 1333
1077 Ga0496115_0000494 3300048918 Bacteria 31060
1078 Ga0496115_0002797 3300048918 Bacteria 12540
1079 Ga0496115_0007279 3300048918 Bacteria 8137
1080 Ga0496115_0019707 3300048918 Bacteria 5194
1081 Ga0496115_0043676 3300048918 Bacteria 3575
1082 Ga0496115_0077080 3300048918 Bacteria 2710
1083 Ga0496115_0091187 3300048918 Bacteria 2490
1084 Ga0496115_0092657 3300048918 Bacteria 2470
1085 Ga0496115_0099542 3300048918 Bacteria 2382
1086 Ga0496115_0112872 3300048918 Bacteria 2233
1087 Ga0496115_0158560 3300048918 Bacteria 1870
1088 Ga0496115_0174156 3300048918 Bacteria 1779
1089 Ga0496115_0208850 3300048918 Bacteria 1613
1090 Ga0496115_0312521 3300048918 Bacteria 1286
1091 Ga0501307_008991 3300049162 Bacteria 1134
1092 Ga0501031_0002608 3300049568 Bacteria 11480
1093 Ga0501031_0006204 3300049568 Bacteria 7799
1094 Ga0501031_0029371 3300049568 Bacteria 3586
1095 Ga0501031_0039144 3300049568 Bacteria 3093
1096 Ga0501031_0166877 3300049568 Bacteria 1439
1097 Ga0501031_0343713 3300049568 Bacteria 966
1098 Ga0501032_0001008 3300049569 Bacteria 22721
1099 Ga0501032_0098395 3300049569 Bacteria 1938
1100 Ga0501033_0002030 3300049570 Bacteria 17598
1101 Ga0501033_0089834 3300049570 Bacteria 2247
1102 Ga0501033_0093848 3300049570 Bacteria 2194
1103 Ga0501033_0131363 3300049570 Bacteria 1814
1104 Ga0501033_0272644 3300049570 Bacteria 1196
1105 Ga0501034_0006109 3300049571 Bacteria 12994
1106 Ga0501034_0010389 3300049571 Bacteria 9702
1107 Ga0501034_0045662 3300049571 Bacteria 4426
1108 Ga0501034_0102207 3300049571 Bacteria 2859
1109 Ga0501034_0138299 3300049571 Bacteria 2416
1110 Ga0501034_0143406 3300049571 Bacteria 2367
1111 Ga0501036_0000259 3300049572 Bacteria 36044
1112 Ga0501036_0005680 3300049572 Bacteria 10117
1113 Ga0501036_0042308 3300049572 Bacteria 3857
1114 Ga0501036_0067581 3300049572 Bacteria 3024
1115 Ga0501036_0118044 3300049572 Bacteria 2240
1116 Ga0501036_0176340 3300049572 Bacteria 1800
1117 Ga0501037_0000205 3300049573 Bacteria 53176
1118 Ga0501037_0030488 3300049573 Bacteria 3985
1119 Ga0501037_0048820 3300049573 Bacteria 3100
1120 Ga0501037_0061840 3300049573 Bacteria 2731
1121 Ga0501037_0327783 3300049573 Bacteria 1059
1122 Ga0501038_0000771 3300049574 Bacteria 28416
1123 Ga0501038_0009846 3300049574 Bacteria 8750
1124 Ga0501038_0057309 3300049574 Bacteria 3345
1125 Ga0501038_0071914 3300049574 Bacteria 2932
1126 Ga0501038_0115083 3300049574 Bacteria 2223
1127 Ga0501038_0310496 3300049574 Bacteria 1236
1128 Ga0501039_0000149 3300049575 Bacteria 47666
1129 Ga0501039_0008886 3300049575 Bacteria 7655
1130 Ga0501039_0010904 3300049575 Bacteria 6926
1131 Ga0501039_0043125 3300049575 Bacteria 3485
1132 Ga0501039_0091230 3300049575 Bacteria 2374
1133 Ga0501039_0138075 3300049575 Bacteria 1915
1134 Ga0501039_0411486 3300049575 Bacteria 1062
1135 Ga0501040_0001153 3300049576 Bacteria 16813
1136 Ga0501040_0003109 3300049576 Bacteria 10759
1137 Ga0501040_0006410 3300049576 Bacteria 7642
1138 Ga0501040_0018389 3300049576 Bacteria 4640
1139 Ga0501040_0021630 3300049576 Bacteria 4298
1140 Ga0501040_0024737 3300049576 Bacteria 4032
1141 Ga0501040_0043845 3300049576 Bacteria 3049
1142 Ga0501040_0064922 3300049576 Bacteria 2514
1143 Ga0501040_0067524 3300049576 Bacteria 2464
1144 Ga0501040_0141097 3300049576 Bacteria 1697
1145 Ga0501040_0316681 3300049576 Bacteria 1116
1146 Ga0501041_0000092 3300049577 Bacteria 36084
1147 Ga0501041_0000426 3300049577 Bacteria 21371
1148 Ga0501041_0003403 3300049577 Bacteria 9155
1149 Ga0501041_0005613 3300049577 Bacteria 7333
1150 Ga0501041_0008904 3300049577 Bacteria 5906
1151 Ga0501041_0047244 3300049577 Bacteria 2620
1152 Ga0501041_0090433 3300049577 Bacteria 1890
1153 Ga0501042_0001259 3300049578 Bacteria 14757
1154 Ga0501042_0001326 3300049578 Bacteria 14430
1155 Ga0501042_0005053 3300049578 Bacteria 8460
1156 Ga0501042_0014163 3300049578 Bacteria 5438
1157 Ga0501042_0016716 3300049578 Bacteria 5044
1158 Ga0501042_0028191 3300049578 Bacteria 3953
1159 Ga0501042_0124002 3300049578 Bacteria 1860
1160 Ga0501042_0132793 3300049578 Bacteria 1794
1161 Ga0501042_0339527 3300049578 Bacteria 1086
1162 Ga0501043_0000217 3300049579 Bacteria 52111
1163 Ga0501043_0020703 3300049579 Bacteria 5160
1164 Ga0501043_0067363 3300049579 Bacteria 2811
1165 Ga0501043_0073810 3300049579 Bacteria 2679
1166 Ga0501046_0001786 3300049580 Bacteria 20504
1167 Ga0501046_0003483 3300049580 Bacteria 14432
1168 Ga0501046_0031351 3300049580 Bacteria 4310
1169 Ga0501046_0051090 3300049580 Bacteria 3264
1170 Ga0501046_0098171 3300049580 Bacteria 2249
1171 Ga0501046_0228896 3300049580 Bacteria 1374
1172 Ga0501047_0001439 3300049581 Bacteria 23306
1173 Ga0501047_0011868 3300049581 Bacteria 8241
1174 Ga0501047_0090343 3300049581 Bacteria 2939
1175 Ga0501047_0109719 3300049581 Bacteria 2642
1176 Ga0501048_0000345 3300049582 Bacteria 32035
1177 Ga0501048_0005592 3300049582 Bacteria 9558
1178 Ga0501048_0014732 3300049582 Bacteria 5786
1179 Ga0501048_0037228 3300049582 Bacteria 3493
1180 Ga0501048_0041067 3300049582 Bacteria 3314
1181 Ga0501048_0042735 3300049582 Bacteria 3244
1182 Ga0501048_0062206 3300049582 Bacteria 2642
1183 Ga0501048_0168068 3300049582 Bacteria 1553
1184 Ga0501048_0321511 3300049582 Bacteria 1102
1185 Ga0501067_0001525 3300049583 Bacteria 12613
1186 Ga0501067_0003105 3300049583 Bacteria 9168
1187 Ga0501067_0035182 3300049583 Bacteria 2781
1188 Ga0501067_0055144 3300049583 Bacteria 2202
1189 Ga0501067_0100244 3300049583 Bacteria 1609
1190 Ga0501067_0103576 3300049583 Bacteria 1581
1191 Ga0501068_0000158 3300049584 Bacteria 31187
1192 Ga0501068_0007257 3300049584 Bacteria 6138
1193 Ga0501068_0010420 3300049584 Bacteria 5223
1194 Ga0501068_0024871 3300049584 Bacteria 3519
1195 Ga0501068_0039784 3300049584 Bacteria 2820
1196 Ga0501068_0122887 3300049584 Bacteria 1620
1197 Ga0501068_0178950 3300049584 Bacteria 1341
1198 Ga0501069_0004840 3300049585 Bacteria 6972
1199 Ga0501069_0005068 3300049585 Bacteria 6831
1200 Ga0501069_0011257 3300049585 Bacteria 4743
1201 Ga0501069_0012646 3300049585 Bacteria 4490
1202 Ga0501069_0016981 3300049585 Bacteria 3911
1203 Ga0501069_0041440 3300049585 Bacteria 2545
1204 Ga0501069_0055477 3300049585 Bacteria 2208
1205 Ga0501069_0146039 3300049585 Bacteria 1358
1206 Ga0501070_0007733 3300049586 Bacteria 9110
1207 Ga0501070_0021479 3300049586 Bacteria 5415
1208 Ga0501070_0058859 3300049586 Bacteria 3185
1209 Ga0501070_0074282 3300049586 Bacteria 2814
1210 Ga0501070_0131558 3300049586 Bacteria 2066
1211 Ga0501070_0139422 3300049586 Bacteria 2002
1212 Ga0501070_0359629 3300049586 Bacteria 1181
1213 Ga0501071_0000097 3300049587 Bacteria 33417
1214 Ga0501071_0008697 3300049587 Bacteria 6719
1215 Ga0501071_0012044 3300049587 Bacteria 5847
1216 Ga0501071_0015914 3300049587 Bacteria 5166
1217 Ga0501071_0020464 3300049587 Bacteria 4599
1218 Ga0501071_0023711 3300049587 Bacteria 4286
1219 Ga0501071_0024819 3300049587 Bacteria 4194
1220 Ga0501071_0033359 3300049587 Bacteria 3657
1221 Ga0501071_0037141 3300049587 Bacteria 3477
1222 Ga0501071_0113756 3300049587 Bacteria 2001
1223 Ga0501071_0134280 3300049587 Bacteria 1840
1224 Ga0501072_0000248 3300049588 Bacteria 39794
1225 Ga0501072_0005632 3300049588 Bacteria 9533
1226 Ga0501072_0007574 3300049588 Bacteria 8236
1227 Ga0501072_0042963 3300049588 Bacteria 3552
1228 Ga0501072_0072520 3300049588 Bacteria 2721
1229 Ga0501072_0078261 3300049588 Bacteria 2618
1230 Ga0501072_0201124 3300049588 Bacteria 1588
1231 Ga0501072_0207790 3300049588 Bacteria 1560
1232 Ga0501072_0351865 3300049588 Bacteria 1170
1233 Ga0501073_0004502 3300049589 Bacteria 10470
1234 Ga0501073_0020584 3300049589 Bacteria 4757
1235 Ga0501073_0075815 3300049589 Bacteria 2341
1236 Ga0501074_0003746 3300049590 Bacteria 10796
1237 Ga0501074_0007316 3300049590 Bacteria 7982
1238 Ga0501074_0007464 3300049590 Bacteria 7907
1239 Ga0501074_0017408 3300049590 Bacteria 5215
1240 Ga0501074_0024653 3300049590 Bacteria 4369
1241 Ga0501074_0036149 3300049590 Bacteria 3579
1242 Ga0501074_0041770 3300049590 Bacteria 3319
1243 Ga0501074_0047886 3300049590 Bacteria 3089
1244 Ga0501074_0207762 3300049590 Bacteria 1395
1245 Ga0501074_0232497 3300049590 Bacteria 1312
1246 Ga0501074_0290395 3300049590 Bacteria 1162
1247 Ga0501075_0000701 3300049591 Bacteria 20737
1248 Ga0501075_0000729 3300049591 Bacteria 20389
1249 Ga0501075_0006520 3300049591 Bacteria 8036
1250 Ga0501075_0017532 3300049591 Bacteria 5172
1251 Ga0501075_0039441 3300049591 Bacteria 3535
1252 Ga0501075_0071433 3300049591 Bacteria 2624
1253 Ga0501076_0000734 3300049592 Bacteria 21188
1254 Ga0501076_0008186 3300049592 Bacteria 7654
1255 Ga0501076_0010550 3300049592 Bacteria 6858
1256 Ga0501076_0015180 3300049592 Bacteria 5818
1257 Ga0501076_0015217 3300049592 Bacteria 5811
1258 Ga0501076_0023789 3300049592 Bacteria 4727
1259 Ga0501076_0042465 3300049592 Bacteria 3579
1260 Ga0501076_0047245 3300049592 Bacteria 3403
1261 Ga0501076_0191736 3300049592 Bacteria 1668
1262 Ga0501076_0202018 3300049592 Bacteria 1623
1263 Ga0501076_0223566 3300049592 Bacteria 1538
1264 Ga0501076_0439230 3300049592 Bacteria 1074
1265 Ga0501077_0000132 3300049593 Bacteria 40709
1266 Ga0501077_0004551 3300049593 Bacteria 8430
1267 Ga0501077_0005321 3300049593 Bacteria 7820
1268 Ga0501077_0010909 3300049593 Bacteria 5662
1269 Ga0501077_0015387 3300049593 Bacteria 4816
1270 Ga0501077_0024165 3300049593 Bacteria 3857
1271 Ga0501079_0002142 3300049741 Bacteria 14202
1272 Ga0501079_0003515 3300049741 Bacteria 11516
1273 Ga0501079_0003795 3300049741 Bacteria 11159
1274 Ga0501079_0008320 3300049741 Bacteria 7862
1275 Ga0501079_0009532 3300049741 Bacteria 7361
1276 Ga0501079_0063627 3300049741 Bacteria 2846
1277 Ga0501079_0065388 3300049741 Bacteria 2805
1278 Ga0501079_0075314 3300049741 Bacteria 2610
1279 Ga0501079_0092625 3300049741 Bacteria 2341
1280 Ga0501079_0114298 3300049741 Bacteria 2098
1281 Ga0501079_0122669 3300049741 Bacteria 2021
1282 Ga0501080_0005018 3300049742 Bacteria 11789
1283 Ga0501080_0013013 3300049742 Bacteria 7639
1284 Ga0501080_0019728 3300049742 Bacteria 6243
1285 Ga0501080_0057179 3300049742 Bacteria 3632
1286 Ga0501080_0067444 3300049742 Bacteria 3327
1287 Ga0501080_0095992 3300049742 Bacteria 2752
1288 Ga0501080_0195209 3300049742 Bacteria 1859
1289 Ga0501080_0203365 3300049742 Bacteria 1817
1290 Ga0501080_0333458 3300049742 Bacteria 1371
1291 Ga0501081_0000692 3300049743 Bacteria 19453
1292 Ga0501081_0000837 3300049743 Bacteria 18200
1293 Ga0501081_0002602 3300049743 Bacteria 11405
1294 Ga0501081_0008632 3300049743 Bacteria 6621
1295 Ga0501081_0018101 3300049743 Bacteria 4675
1296 Ga0501081_0019017 3300049743 Bacteria 4569
1297 Ga0501081_0050380 3300049743 Bacteria 2869
1298 Ga0501081_0172378 3300049743 Bacteria 1562
1299 Ga0501083_0000086 3300049744 Bacteria 63536
1300 Ga0501083_0000751 3300049744 Bacteria 21158
1301 Ga0501083_0022268 3300049744 Bacteria 4396
1302 Ga0501083_0061820 3300049744 Bacteria 2500
1303 Ga0501083_0068964 3300049744 Bacteria 2353
1304 Ga0501083_0154087 3300049744 Bacteria 1504
1305 Ga0501083_0291072 3300049744 Bacteria 1062
1306 Ga0501035_0000437 3300049822 Bacteria 46759
1307 Ga0501035_0190386 3300049822 Bacteria 1764
1308 Ga0501035_0193833 3300049822 Bacteria 1746
1309 Ga0501035_0204989 3300049822 Bacteria 1689
1310 Ga0501035_0245816 3300049822 Bacteria 1520
1311 Ga0501035_0253454 3300049822 Bacteria 1494
1312 Ga0501044_0001726 3300049823 Bacteria 25582
1313 Ga0501044_0085816 3300049823 Bacteria 3180
1314 Ga0501044_0154163 3300049823 Bacteria 2278
1315 Ga0501044_0505617 3300049823 Bacteria 1109
1316 Ga0501045_0005349 3300049824 Bacteria 8894
1317 Ga0501045_0007717 3300049824 Bacteria 7485
1318 Ga0501045_0011122 3300049824 Bacteria 6306
1319 Ga0501045_0015419 3300049824 Bacteria 5423
1320 Ga0501045_0028196 3300049824 Bacteria 4049
1321 Ga0501045_0028262 3300049824 Bacteria 4045
1322 Ga0501045_0047092 3300049824 Bacteria 3140
1323 Ga0501045_0050649 3300049824 Bacteria 3030
1324 Ga0501045_0054535 3300049824 Bacteria 2922
1325 nmdc:mga00v17_20992_c1 3300050491 Bacteria 3750
1326 nmdc:mga00v17_231455_c1 3300050491 Bacteria 1197
1327 nmdc:mga00v17_47034_c1 3300050491 Bacteria 2612
1328 nmdc:mga0yw44_18281_c1 3300050492 Bacteria 3834
1329 nmdc:mga0yw44_65818_c1 3300050492 Bacteria 2235
1330 nmdc:mga06z11_116254_c1 3300050494 Bacteria 1487
1331 nmdc:mga05p37_112741_c1 3300050507 Bacteria 3344
1332 nmdc:mga05p37_227216_c1 3300050507 Bacteria 2250
1333 nmdc:mga05p37_23364_c1 3300050507 Bacteria 7502
1334 nmdc:mga05p37_310914_c1 3300050507 Bacteria 1868
1335 nmdc:mga05p37_51716_c1 3300050507 Bacteria 5051
1336 nmdc:mga05p37_78159_c1 3300050507 Bacteria 4074
1337 nmdc:mga09592_10222_c1 3300050508 Bacteria 7636
1338 nmdc:mga09592_12706_c1 3300050508 Bacteria 6863
1339 nmdc:mga09592_61406_c1 3300050508 Bacteria 3179
1340 nmdc:mga0qj67_15282_c1 3300050509 Bacteria 5812
1341 nmdc:mga0qj67_155880_c1 3300050509 Bacteria 1853
1342 nmdc:mga0qj67_40913_c1 3300050509 Bacteria 3644
1343 nmdc:mga06r32_206997_c1 3300050510 Bacteria 1950
1344 nmdc:mga06r32_43886_c1 3300050510 Bacteria 4255
1345 nmdc:mga06r32_439664_c1 3300050510 Bacteria 1284
1346 nmdc:mga08y16_11874_c1 3300050511 Bacteria 9149
1347 nmdc:mga08y16_14378_c1 3300050511 Bacteria 8331
1348 nmdc:mga08y16_25511_c1 3300050511 Bacteria 6235
1349 nmdc:mga08y16_367559_c1 3300050511 Bacteria 1476
1350 nmdc:mga08y16_63375_c1 3300050511 Bacteria 3860
1351 nmdc:mga08y16_82262_c1 3300050511 Bacteria 3357
1352 nmdc:mga0n895_216489_c1 3300050512 Bacteria 1945
1353 nmdc:mga0n895_21900_c1 3300050512 Bacteria 5986
1354 nmdc:mga0n895_345629_c1 3300050512 Bacteria 1507
1355 nmdc:mga0n895_35200_c1 3300050512 Bacteria 4826
1356 nmdc:mga0rr50_10341_c1 3300050513 Bacteria 5917
1357 nmdc:mga0rr50_42906_c1 3300050513 Bacteria 3307
1358 nmdc:mga08x19_28488_c1 3300050514 Bacteria 3498
1359 nmdc:mga0a205_2180_c1 3300050515 Bacteria 17232
1360 nmdc:mga0a205_23779_c1 3300050515 Bacteria 5815
1361 nmdc:mga0a205_31410_c1 3300050515 Bacteria 5088
1362 nmdc:mga0a205_33265_c2 3300050515 Bacteria 3603
1363 Ga0495601_0000983 3300053077 Bacteria 15574
1364 Ga0495601_0032476 3300053077 Bacteria 3250
1365 Ga0495601_0087100 3300053077 Bacteria 2007
1366 Ga0495601_0113091 3300053077 Bacteria 1759
1367 Ga0495601_0115389 3300053077 Bacteria 1741
1368 Ga0495601_0196673 3300053077 Bacteria 1318
1369 Ga0495612_0009152 3300053078 Bacteria 4018
1370 Ga0495655_0029979 3300053083 Bacteria 1312
1371 Ga0495595_0036286 3300053084 Bacteria 2236
1372 Ga0495595_0047786 3300053084 Bacteria 1975
1373 Ga0495595_0122436 3300053084 Bacteria 1267
1374 Ga0495595_0168621 3300053084 Bacteria 1083
1375 Ga0495619_0004719 3300053085 Bacteria 8677
1376 Ga0495619_0008649 3300053085 Bacteria 6442
1377 Ga0495619_0023175 3300053085 Bacteria 3978
1378 Ga0495619_0025735 3300053085 Bacteria 3781
1379 Ga0495619_0031759 3300053085 Bacteria 3423
1380 Ga0495619_0078590 3300053085 Bacteria 2218
1381 Ga0495619_0122862 3300053085 Bacteria 1780
1382 Ga0500568_0001852 3300053139 Bacteria 13026
1383 Ga0500616_0000215 3300053153 Bacteria 91354
1384 Ga0501084_0000492 3300054114 Bacteria 30321
1385 Ga0501084_0005749 3300054114 Bacteria 10200
1386 Ga0501084_0013559 3300054114 Bacteria 6743
1387 Ga0501084_0015632 3300054114 Bacteria 6294
1388 Ga0501084_0027990 3300054114 Bacteria 4709
1389 Ga0501084_0046847 3300054114 Bacteria 3621
1390 Ga0501084_0168843 3300054114 Bacteria 1847
1391 Ga0501084_0208810 3300054114 Bacteria 1648
1392 Ga0501084_0209001 3300054114 Bacteria 1647
1393 Ga0501084_0363283 3300054114 Bacteria 1223
1394 Ga0590075_008777 3300059424 Bacteria 2418
1395 Ga0501082_0000139 3300060353 Bacteria 59897
1396 Ga0501082_0008363 3300060353 Bacteria 8925
1397 Ga0501082_0010188 3300060353 Bacteria 8095
1398 Ga0501082_0011909 3300060353 Bacteria 7478
1399 Ga0501082_0058794 3300060353 Bacteria 3312
1400 Ga0501082_0065507 3300060353 Bacteria 3129
1401 Ga0501082_0112269 3300060353 Bacteria 2360
1402 Ga0501082_0255885 3300060353 Bacteria 1523
1403 Ga0466962_0002601 3300061719 Bacteria 8576
1404 Ga0466962_0004184 3300061719 Bacteria 6916
1405 Ga0466962_0004907 3300061719 Bacteria 6434
1406 Ga0466962_0017606 3300061719 Bacteria 3440
1407 Ga0466962_0046896 3300061719 Bacteria 2065
1408 Ga0530510_0000086 3300061734 Bacteria 49340
1409 Ga0530510_0001228 3300061734 Bacteria 17096
1410 Ga0530510_0007446 3300061734 Bacteria 7620
1411 Ga0530510_0027645 3300061734 Bacteria 4065
1412 Ga0530510_0029265 3300061734 Bacteria 3953
1413 Ga0530510_0030125 3300061734 Bacteria 3896
1414 Ga0530510_0043266 3300061734 Bacteria 3253
1415 Ga0530510_0184062 3300061734 Bacteria 1549
1416 Ga0105240_10055580
1417 JGI24738J21930_10004813
1418 JGI25407J50210_10002464
1419 Ga0070658_10016045
1420 Ga0070658_10034579
1421 Ga0070658_10089110
1422 Ga0070658_10238552
1423 Ga0070683_100003672
1424 Ga0070683_100047809
1425 Ga0070683_100076195
1426 Ga0070683_100177274
1427 Ga0070680_100003014
1428 Ga0070680_100026345
1429 Ga0070680_100033482
1430 Ga0070680_100039991
1431 Ga0070680_100046229
1432 Ga0070682_100001154
1433 Ga0070682_100007677
1434 Ga0070682_100086954
1435 Ga0070660_100003891
1436 Ga0070660_100028566
1437 Ga0070660_100048434
1438 Ga0070660_100122221
1439 Ga0070660_100336603
1440 Ga0070689_100010453
1441 Ga0070691_10001490
1442 Ga0070661_100014347
1443 Ga0070661_100042605
1444 Ga0070661_100087400
1445 Ga0070692_10001185
1446 Ga0070668_100276978
1447 Ga0070668_100373723
1448 Ga0070669_100295841
1449 Ga0070675_100006250
1450 Ga0070671_100054537
1451 Ga0070671_100102254
1452 Ga0070671_100279533
1453 Ga0070674_100006216
1454 Ga0070674_100007050
1455 Ga0070674_100055396
1456 Ga0070674_100115142
1457 Ga0070673_100004299
1458 Ga0070673_100196375
1459 Ga0070673_100244424
1460 Ga0070688_100074382
1461 Ga0070659_100001847
1462 Ga0070659_100047410
1463 Ga0070659_100053595
1464 Ga0070667_100131229
1465 Ga0070667_100155197
1466 Ga0070667_100355532
1467 Ga0070714_100009702
1468 Ga0070714_100087305
1469 Ga0070714_100150039
1470 Ga0070714_100181520
1471 Ga0070713_100002387
1472 Ga0070713_100022139
1473 Ga0070713_100022174
1474 Ga0070713_100106551
1475 Ga0070713_100170654
1476 Ga0070710_10002369
1477 Ga0070710_10004604
1478 Ga0070710_10093515
1479 Ga0070710_10135845
1480 Ga0070711_100021791
1481 Ga0070711_100049950
1482 Ga0070694_100279111
1483 Ga0070708_100201715
1484 Ga0070663_100077065
1485 Ga0070678_100022013
1486 Ga0070678_100071075
1487 Ga0070662_100014193
1488 Ga0070662_100032861
1489 Ga0070681_10013997
1490 Ga0070681_10016356
1491 Ga0070681_10023730
1492 Ga0070681_10053838
1493 Ga0070681_10394122
1494 Ga0068867_100009456
1495 Ga0068867_100090407
1496 Ga0068867_100106689
1497 Ga0068867_100271941
1498 Ga0070706_100025393
1499 Ga0070706_100102851
1500 Ga0070706_100154233
1501 Ga0070707_100008855
1502 Ga0070707_100129005
1503 Ga0070698_100000472
1504 Ga0070698_100001742
1505 Ga0070698_100012860
1506 Ga0070698_100022411
1507 Ga0070698_100082519
1508 Ga0070698_100143501
1509 Ga0070699_100026853
1510 Ga0070699_100108344
1511 Ga0070699_100119828
1512 Ga0070679_100002682
1513 Ga0070679_100010105
1514 Ga0070679_100015262
1515 Ga0070679_100060606
1516 Ga0070679_100091769
1517 Ga0070679_100206925
1518 Ga0070679_100621161
1519 Ga0070684_100002494
1520 Ga0070684_100009589
1521 Ga0070684_100021102
1522 Ga0070684_100022528
1523 Ga0070684_100044309
1524 Ga0070684_100162758
1525 Ga0070697_100028193
1526 Ga0070697_100302970
1527 Ga0068853_100013517
1528 Ga0068853_100081711
1529 Ga0070672_100065196
1530 Ga0070686_100192428
1531 Ga0070695_100042730
1532 Ga0070693_100009457
1533 Ga0070693_100010362
1534 Ga0070693_100038476
1535 Ga0070665_100056061
1536 Ga0070704_100128218
1537 Ga0068855_100029321
1538 Ga0068855_100046564
1539 Ga0068855_100107411
1540 Ga0068855_100124516
1541 Ga0068855_100135714
1542 Ga0068857_100085160
1543 Ga0068854_100005175
1544 Ga0068854_100019060
1545 Ga0068856_100184171
1546 Ga0068856_100322675
1547 Ga0070702_100062138
1548 Ga0068852_100072149
1549 Ga0068852_100084248
1550 Ga0068852_100110738
1551 Ga0068852_100182380
1552 Ga0068866_10015588
1553 Ga0068866_10019659
1554 Ga0068861_100013608
1555 Ga0068861_100086224
1556 Ga0068870_10231683
1557 Ga0068863_100059691
1558 Ga0068858_100155850
1559 Ga0068858_100255878
1560 Ga0068860_100123490
1561 Ga0068860_100152182
1562 Ga0068860_100226779
1563 Ga0068862_100263267
1564 Ga0081455_10002893
1565 Ga0081455_10006617
1566 Ga0081455_10007185
1567 Ga0081455_10012039
1568 Ga0081455_10029777
1569 Ga0081455_10044856
1570 Ga0081455_10049104
1571 Ga0081455_10091421
1572 Ga0081455_10109191
1573 Ga0081455_10133880
1574 Ga0081538_10000012
1575 Ga0081538_10000205
1576 Ga0081538_10001091
1577 Ga0081538_10001170
1578 Ga0081538_10009350
1579 Ga0081538_10010785
1580 Ga0081538_10040029
1581 Ga0081538_10098834
1582 Ga0081540_1004192
1583 Ga0081540_1006685
1584 Ga0081539_10001511
1585 Ga0081539_10001867
1586 Ga0081539_10014792
1587 Ga0070717_10004071
1588 Ga0070717_10005336
1589 Ga0070717_10008478
1590 Ga0070717_10022452
1591 Ga0070717_10114763
1592 Ga0070717_10331987
1593 Ga0075365_10050801
1594 Ga0075365_10119624
1595 Ga0075363_100158018
1596 Ga0075364_10003473
1597 Ga0075364_10008474
1598 Ga0075364_10171756
1599 Ga0075432_10015158
1600 Ga0075432_10047605
1601 Ga0070715_10000223
1602 Ga0070716_100005561
1603 Ga0070716_100051755
1604 Ga0070716_100086655
1605 Ga0070716_100150625
1606 Ga0070712_100053783
1607 Ga0075367_10197620
1608 Ga0075366_10188846
1609 Ga0097621_100122420
1610 Ga0068871_100031259
1611 Ga0075428_100000881
1612 Ga0075428_100145687
1613 Ga0075428_100204957
1614 Ga0075430_100010050
1615 Ga0075430_100138194
1616 Ga0075430_100227031
1617 Ga0075431_100029898
1618 Ga0075431_100140313
1619 Ga0075431_100145995
1620 Ga0075431_100201835
1621 Ga0075433_10001982
1622 Ga0075433_10005692
1623 Ga0075433_10079051
1624 Ga0075434_100005232
1625 Ga0075434_100010926
1626 Ga0075434_100016151
1627 Ga0075434_100047760
1628 Ga0075434_100075796
1629 Ga0075429_100002453
1630 Ga0075429_100012763
1631 Ga0075429_100016341
1632 Ga0068865_100001102
1633 Ga0068865_100067166
1634 Ga0068865_100073362
1635 Ga0068865_100082917
1636 Ga0068865_100112570
1637 Ga0075436_100004569
1638 Ga0075436_100007624
1639 Ga0075435_100002576
1640 Ga0075435_100003349
1641 Ga0075435_100098257
1642 Ga0075435_100116723
1643 Ga0105240_10027857
1644 Ga0105240_10041896
1645 Ga0105240_10066726
1646 Ga0105240_10155567
1647 Ga0105240_10179582
1648 Ga0105240_10223643
1649 Ga0105240_10343080
1650 Ga0105240_10452039
1651 Ga0111539_10005140
1652 Ga0111539_10014417
1653 Ga0111539_10289463
1654 Ga0111539_10290287
1655 Ga0111539_10314413
1656 Ga0111539_10384773
1657 Ga0105245_10015258
1658 Ga0105245_10018003
1659 Ga0105245_10032641
1660 Ga0105245_10092679
1661 Ga0105245_10207348
1662 Ga0105245_10268117
1663 Ga0105245_10495005
1664 Ga0114129_10002158
1665 Ga0114129_10097354
1666 Ga0114129_10147476
1667 Ga0114129_10377196
1668 Ga0105243_10001674
1669 Ga0105243_10007507
1670 Ga0105243_10043286
1671 Ga0105243_10086132
1672 Ga0105243_10131094
1673 Ga0105241_10130208
1674 Ga0105242_10160950
1675 Ga0105242_10302628
1676 Ga0105242_10320360
1677 Ga0105248_10178837
1678 Ga0105248_10251936
1679 Ga0105248_10560927
1680 Ga0105237_10133570
1681 Ga0105237_10176025
1682 Ga0105238_10017502
1683 Ga0105249_10007414
1684 Ga0105249_10013589
1685 Ga0105249_10342739
1686 Ga0105239_10013948
1687 Ga0105239_10020380
1688 Ga0105239_10063871
1689 Ga0105239_10146444
1690 Ga0105239_10385004
1691 Ga0105246_10026923
1692 Ga0105246_10047578
1693 Ga0105246_10354495
1694 Ga0157373_10200948
1695 Ga0157370_10031456
1696 Ga0157370_10042692
1697 Ga0157370_10044790
1698 Ga0157370_10052706
1699 Ga0157370_10145851
1700 Ga0157370_10261974
1701 Ga0157369_10002166
1702 Ga0157369_10005648
1703 Ga0157369_10007096
1704 Ga0157369_10030268
1705 Ga0157369_10070311
1706 Ga0157369_10162046
1707 Ga0157369_10175111
1708 Ga0157369_10188014
1709 Ga0157369_10320631
1710 Ga0157374_10021783
1711 Ga0157374_10077349
1712 Ga0157374_10102677
1713 Ga0157374_10377676
1714 Ga0157378_10005680
1715 Ga0157378_10209805
1716 Ga0163162_10013965
1717 Ga0163162_10080684
1718 Ga0157372_10005776
1719 Ga0157372_10426644
1720 Ga0157375_10047986
1721 Ga0163163_10010439
1722 Ga0157380_10003284
1723 Ga0157380_10505591
1724 Ga0182008_10003056
1725 Ga0157377_10016525
1726 Ga0157379_10007742
1727 Ga0157379_10011001
1728 Ga0157379_10062950
1729 Ga0157376_10081159
1730 Ga0157376_10398389
1731 Ga0197907_10066705
1732 Ga0197907_10406384
1733 Ga0197907_10589986
1734 Ga0197907_10762704
1735 Ga0206356_10072031
1736 Ga0206356_10246559
1737 Ga0206356_10770587
1738 Ga0206356_11853397
1739 Ga0206349_1962268
1740 Ga0206352_11055655
1741 Ga0206350_11051890
1742 Ga0206350_11490151
1743 Ga0206354_10052620
1744 Ga0206354_10075868
1745 Ga0206354_10378407
1746 Ga0206354_10823254
1747 Ga0206354_10928650
1748 Ga0206353_10050633
1749 Ga0206353_10328476
1750 Ga0206353_10337916
1751 Ga0206353_10902253
1752 Ga0206353_11349432
1753 Ga0206353_11456732
1754 Ga0154015_1653186
1755 Ga0213876_10008372
1756 Ga0224712_10036199
1757 Ga0224712_10057349
1758 Ga0224712_10060366
1759 Ga0224712_10060459
1760 Ga0224712_10068235
1761 Ga0224712_10091385
1762 Ga0207692_10009309
1763 Ga0207692_10061903
1764 Ga0207642_10004636
1765 Ga0207710_10035176
1766 Ga0207688_10001633
1767 Ga0207688_10048617
1768 Ga0207699_10025004
1769 Ga0207699_10029643
1770 Ga0207699_10083633
1771 Ga0207705_10064990
1772 Ga0207705_10096065
1773 Ga0207684_10029946
1774 Ga0207684_10131952
1775 Ga0207684_10197302
1776 Ga0207654_10161075
1777 Ga0207707_10001918
1778 Ga0207707_10014107
1779 Ga0207707_10068293
1780 Ga0207707_10070389
1781 Ga0207707_10158121
1782 Ga0207707_10167554
1783 Ga0207695_10071373
1784 Ga0207695_10075586
1785 Ga0207695_10141155
1786 Ga0207695_10194970
1787 Ga0207693_10004473
1788 Ga0207693_10008397
1789 Ga0207693_10016529
1790 Ga0207693_10024908
1791 Ga0207663_10003098
1792 Ga0207663_10009226
1793 Ga0207663_10013008
1794 Ga0207663_10020518
1795 Ga0207660_10019997
1796 Ga0207660_10041731
1797 Ga0207662_10017739
1798 Ga0207657_10000500
1799 Ga0207657_10001046
1800 Ga0207657_10001931
1801 Ga0207657_10014505
1802 Ga0207657_10019153
1803 Ga0207657_10022973
1804 Ga0207657_10056995
1805 Ga0207657_10069854
1806 Ga0207649_10011519
1807 Ga0207649_10024948
1808 Ga0207652_10005399
1809 Ga0207652_10151714
1810 Ga0207646_10036601
1811 Ga0207646_10080638
1812 Ga0207694_10112758
1813 Ga0207687_10031842
1814 Ga0207687_10048253
1815 Ga0207687_10096767
1816 Ga0207687_10106529
1817 Ga0207700_10005417
1818 Ga0207700_10017243
1819 Ga0207700_10034302
1820 Ga0207700_10067327
1821 Ga0207700_10233285
1822 Ga0207664_10010163
1823 Ga0207664_10026028
1824 Ga0207664_10036943
1825 Ga0207664_10059801
1826 Ga0207664_10069742
1827 Ga0207664_10075061
1828 Ga0207664_10075416
1829 Ga0207664_10086846
1830 Ga0207664_10170476
1831 Ga0207664_10231227
1832 Ga0207644_10328402
1833 Ga0207690_10025161
1834 Ga0207690_10246022
1835 Ga0207706_10010685
1836 Ga0207706_10010784
1837 Ga0207686_10030588
1838 Ga0207686_10063426
1839 Ga0207686_10089203
1840 Ga0207686_10117078
1841 Ga0207686_10147019
1842 Ga0207709_10031676
1843 Ga0207709_10051738
1844 Ga0207709_10096258
1845 Ga0207669_10049721
1846 Ga0207669_10087587
1847 Ga0207704_10243875
1848 Ga0207665_10000322
1849 Ga0207665_10001706
1850 Ga0207691_10020470
1851 Ga0207691_10058732
1852 Ga0207711_10313235
1853 Ga0207661_10021882
1854 Ga0207661_10031932
1855 Ga0207661_10043389
1856 Ga0207661_10048769
1857 Ga0207661_10051930
1858 Ga0207661_10064740
1859 Ga0207661_10068729
1860 Ga0207661_10111791
1861 Ga0207661_10160152
1862 Ga0207661_10184040
1863 Ga0207679_10178806
1864 Ga0207667_10047297
1865 Ga0207667_10066238
1866 Ga0207667_10310229
1867 Ga0207712_10058174
1868 Ga0207712_10096319
1869 Ga0207668_10059614
1870 Ga0207640_10046445
1871 Ga0207640_10087061
1872 Ga0207658_10012227
1873 Ga0207658_10185529
1874 Ga0207677_10034516
1875 Ga0207677_10044953
1876 Ga0207677_10276846
1877 Ga0207639_10304653
1878 Ga0207639_10359622
1879 Ga0207702_10124768
1880 Ga0207702_10137771
1881 Ga0207702_10181145
1882 Ga0207702_10230346
1883 Ga0207641_10071166
1884 Ga0207648_10003355
1885 Ga0207648_10083321
1886 Ga0207648_10136115
1887 Ga0207648_10188205
1888 Ga0207676_10302980
1889 Ga0207674_10030547
1890 Ga0207674_10155408
1891 Ga0207675_100003338
1892 Ga0207675_100032560
1893 Ga0207675_100104995
1894 Ga0207675_100132972
1895 Ga0207683_10000907
1896 Ga0207683_10011436
1897 Ga0207698_10184467
1898 Ga0209998_10005198
1899 Ga0207428_10000934
1900 Ga0207428_10014460
1901 Ga0207428_10021196
1902 Ga0207428_10044392
1903 Ga0207428_10076046
1904 Ga0207428_10253317
1905 Ga0268266_10332648
1906 Ga0268264_10375064
1907 Ga0265319_1022969
1908 Ga0265334_10002668
1909 Ga0265318_10000541
1910 Ga0265336_10002072
1911 Ga0265336_10013520
1912 Ga0265338_10006253
1913 Ga0265338_10071584
1914 Ga0265338_10114613
1915 Ga0265338_10141275
1916 Ga0265330_10041490
1917 Ga0265330_10052226
1918 Ga0265325_10000949
1919 Ga0265325_10006154
1920 Ga0265329_10009253
1921 Ga0265340_10004475
1922 Ga0265340_10042262
1923 Ga0265340_10070651
1924 Ga0265339_10035428
1925 Ga0265339_10064018
1926 Ga0265327_10003872
1927 Ga0265327_10004853
1928 Ga0265327_10009219
1929 Ga0265327_10081428
1930 Ga0265316_10053194
1931 Ga0265313_10001261
1932 Ga0265313_10005640
1933 Ga0265314_10004635
1934 Ga0265314_10176459
1935 Ga0316576_10011101
1936 Ga0316576_10070493
1937 Ga0316576_10109392
1938 Ga0316578_10000145
1939 Ga0307405_10036764
1940 Ga0307416_100031422
1941 Ga0307416_100165558
1942 Ga0307416_100325252
1943 Ga0307414_10370958
1944 Ga0307415_100073578
1945 Ga0316580_10003428
1946 Ga0373948_0009547
1947 Ga0373958_0010740
1948 Ga0373928_0009411
1949 Ga0373934_0080067
1950 Ga0373944_0005847
1951 Ga0373944_0008755
1952 Ga0373941_0039088
1953 Ga0373943_0001492
1954 Ga0373943_0011200
1955 Ga0373931_0047821
1956 Ga0373931_0064446
1957 Ga0373935_0023337
1958 Ga0373935_0167083
1959 Ga0373933_0120765
1960 Ga0373933_0131302
1961 Ga0373947_0001675
1962 Ga0373947_0004617
1963 Ga0373947_0023617
1964 Ga0373937_0020040
1965 Ga0316582_0026980
1966 Ga0316584_0000210
1967 Ga0373925_0002352
1968 Ga0395899_0002892
1969 Ga0395899_0004853
1970 Ga0395899_0006387
1971 Ga0395899_0012260
1972 Ga0395899_0051640
1973 Ga0395899_0067382
1974 Ga0395900_0003129
1975 Ga0395900_0006147
1976 Ga0395900_0010590
1977 Ga0395900_0015326
1978 Ga0395900_0032766
1979 Ga0395900_0051474
1980 Ga0395900_0057081
1981 Ga0395900_0059150
1982 Ga0395900_0060264
1983 Ga0395900_0073144
1984 Ga0395900_0106957
1985 Ga0395900_0247194
1986 Ga0395900_0285013
1987 Ga0395898_0001406
1988 Ga0395898_0002816
1989 Ga0395898_0006113
1990 Ga0395898_0014630
1991 Ga0395898_0021048
1992 Ga0395898_0027384
1993 Ga0395898_0028358
1994 Ga0395898_0032012
1995 Ga0395898_0051521
1996 Ga0395898_0059980
1997 Ga0395898_0092008
1998 Ga0395898_0105290
1999 Ga0395898_0117019
2000 Ga0395898_0267610
2001 Ga0395898_0427411
2002 Ga0395905_0000786
2003 Ga0395905_0012807
2004 Ga0395905_0016305
2005 Ga0395905_0032268
2006 Ga0395905_0072168
2007 Ga0395905_0076779
2008 Ga0395905_0084025
2009 Ga0395905_0115141
2010 Ga0395905_0157922
2011 Ga0395905_0257888
2012 Ga0395905_0336185
2013 Ga0395901_0003238
2014 Ga0395901_0003793
2015 Ga0395901_0007737
2016 Ga0395901_0007808
2017 Ga0395901_0019406
2018 Ga0395901_0019981
2019 Ga0395901_0024522
2020 Ga0395901_0027511
2021 Ga0395901_0028742
2022 Ga0395901_0044951
2023 Ga0395901_0052533
2024 Ga0395901_0053752
2025 Ga0395901_0101385
2026 Ga0395901_0143034
2027 Ga0395901_0160781
2028 Ga0395901_0163814
2029 Ga0395901_0171832
2030 Ga0395901_0259934
2031 Ga0395901_0404868
2032 Ga0395901_0430990
2033 Ga0395901_0589880
2034 Ga0436365_1041009
2035 Ga0436365_1159630
2036 Ga0436365_1203947
2037 Ga0436365_1437009
2038 Ga0436365_1674627
2039 Ga0436360_0070085
2040 Ga0436363_1684106
2041 Ga0439453_0012174
2042 Ga0439461_0008158
2043 Ga0451853_1423526
2044 Ga0439433_0001766
2045 Ga0439442_018737
2046 Ga0439448_0044030
2047 Ga0439462_0017785
2048 Ga0439446_0004319
2049 Ga0451577_0037639
2050 Ga0466969_0002202
2051 Ga0453683_0011143
2052 Ga0453683_0012532
2053 Ga0466965_0015015
2054 Ga0466966_0018779
2055 Ga0466961_0007507
2056 Ga0466961_0028228
2057 Ga0466961_0029817
2058 Ga0466961_0042190
2059 Ga0466961_0052448
2060 Ga0466961_0183711
2061 Ga0466963_0000430
2062 Ga0466963_0001559
2063 Ga0466963_0003053
2064 Ga0466963_0006703
2065 Ga0466963_0007066
2066 Ga0466963_0008450
2067 Ga0466963_0008744
2068 Ga0466963_0010043
2069 Ga0466963_0010163
2070 Ga0466963_0011078
2071 Ga0466963_0016280
2072 Ga0466963_0017063
2073 Ga0466963_0017321
2074 Ga0466963_0018744
2075 Ga0466963_0037144
2076 Ga0466963_0039571
2077 Ga0466963_0052899
2078 Ga0466963_0078307
2079 Ga0466963_0083433
2080 Ga0466963_0140249
2081 Ga0466964_0001644
2082 Ga0466964_0004155
2083 Ga0466964_0004602
2084 Ga0466964_0013552
2085 Ga0466964_0020056
2086 Ga0466964_0027950
2087 Ga0466964_0097470
2088 Ga0453684_0128288
2089 Ga0466971_0000571
2090 Ga0466971_0003068
2091 Ga0466968_0001242
2092 Ga0466968_0001271
2093 Ga0466968_0005848
2094 Ga0466968_0014588
2095 Ga0466968_0016358
2096 Ga0466970_0005446
2097 Ga0466970_0056479
2098 Ga0466957_0005254
2099 Ga0466957_0008394
2100 Ga0466957_0010147
2101 Ga0466957_0010946
2102 Ga0466957_0015241
2103 Ga0466957_0020548
2104 Ga0466957_0024346
2105 Ga0466957_0027194
2106 Ga0466957_0050273
2107 Ga0466957_0142476
2108 Ga0466960_0007597
2109 Ga0466960_0009601
2110 Ga0466959_0000479
2111 Ga0466959_0034099
2112 Ga0466959_0044815
2113 Ga0466959_0056480
2114 Ga0466959_0065876
2115 Ga0466959_0148052
2116 Ga0466959_0153122
2117 Ga0451576_0252855
2118 Ga0451576_0266539
2119 Ga0466958_0001620
2120 Ga0466958_0002869
2121 Ga0466958_0008231
2122 Ga0466958_0008855
2123 Ga0466958_0012290
2124 Ga0466958_0020188
2125 Ga0466958_0025054
2126 Ga0466958_0038479
2127 Ga0466958_0048445
2128 Ga0466958_0060024
2129 Ga0466958_0114145
2130 Ga0466958_0116083
2131 Ga0466958_0251484
2132 Ga0466967_0002221
2133 Ga0466967_0002496
2134 Ga0466967_0006144
2135 Ga0466967_0006258
2136 Ga0466967_0008012
2137 Ga0466967_0010163
2138 Ga0466967_0013224
2139 Ga0466967_0015777
2140 Ga0466967_0025288
2141 Ga0466967_0028405
2142 Ga0466967_0030656
2143 Ga0466967_0036182
2144 Ga0466967_0041940
2145 Ga0466967_0043843
2146 Ga0466967_0045632
2147 Ga0466967_0049750
2148 Ga0466967_0049997
2149 Ga0466967_0053383
2150 Ga0466967_0057898
2151 Ga0466967_0058407
2152 Ga0466967_0073861
2153 Ga0466967_0085779
2154 Ga0466967_0105828
2155 Ga0466967_0116544
2156 Ga0466967_0122778
2157 Ga0466967_0146681
2158 Ga0466967_0150267
2159 Ga0466967_0170935
2160 Ga0466967_0173080
2161 Ga0466967_0183041
2162 Ga0466967_0184918
2163 Ga0466967_0199870
2164 Ga0466967_0201895
2165 Ga0466967_0261006
2166 Ga0466967_0379309
2167 Ga0466967_0596433
2168 Ga0466967_0789713
2169 Ga0495592_0000125
2170 Ga0495592_0020342
2171 Ga0495592_0041170
2172 Ga0495592_0171125
2173 Ga0495592_0204192
2174 Ga0495603_0002588
2175 Ga0495603_0003187
2176 Ga0495603_0060076
2177 Ga0495603_0072196
2178 Ga0495603_0076174
2179 Ga0495603_0105830
2180 Ga0495629_0004786
2181 Ga0495629_0129220
2182 Ga0495629_0136817
2183 Ga0495629_0164767
2184 Ga0495629_0215737
2185 Ga0495629_0265684
2186 Ga0495641_0000455
2187 Ga0495641_0003498
2188 Ga0495651_0000104
2189 Ga0495651_0002454
2190 Ga0495651_0023417
2191 Ga0495651_0051543
2192 Ga0495653_0004604
2193 Ga0495653_0005005
2194 Ga0495653_0025029
2195 Ga0495653_0086897
2196 Ga0495653_0192707
2197 Ga0495582_0008896
2198 Ga0495582_0009208
2199 Ga0495582_0035419
2200 Ga0495582_0139131
2201 Ga0495582_0169684
2202 Ga0495605_0018697
2203 Ga0495605_0106923
2204 Ga0495639_0000871
2205 Ga0495662_0018674
2206 Ga0495662_0103207
2207 Ga0495664_0025767
2208 Ga0495664_0126694
2209 Ga0495584_0036926
2210 Ga0495584_0038990
2211 Ga0495594_0000352
2212 Ga0495596_0059302
2213 Ga0495607_0043294
2214 Ga0495608_0000595
2215 Ga0495608_0013071
2216 Ga0495608_0017819
2217 Ga0495608_0025993
2218 Ga0495608_0084370
2219 Ga0495608_0094446
2220 Ga0495618_0006629
2221 Ga0495618_0013492
2222 Ga0495618_0050218
2223 Ga0495628_0000040
2224 Ga0495628_0008773
2225 Ga0495628_0008875
2226 Ga0495628_0040955
2227 Ga0495628_0219966
2228 Ga0495628_0262752
2229 Ga0495630_0003720
2230 Ga0495630_0017698
2231 Ga0495630_0019912
2232 Ga0495630_0027300
2233 Ga0495630_0045027
2234 Ga0495630_0080951
2235 Ga0495630_0089104
2236 Ga0495630_0116135
2237 Ga0495630_0123402
2238 Ga0495630_0159142
2239 Ga0495630_0189550
2240 Ga0495644_0099866
2241 Ga0495666_0007047
2242 Ga0495666_0015658
2243 Ga0495652_0000298
2244 Ga0495652_0093106
2245 Ga0495652_0110145
2246 Ga0495652_0115375
2247 Ga0495652_0126607
2248 Ga0495665_0002244
2249 Ga0495665_0074768
2250 Ga0495640_0001758
2251 Ga0495640_0044379
2252 Ga0495640_0058395
2253 Ga0495640_0061616
2254 Ga0495640_0084847
2255 Ga0495640_0110951
2256 Ga0495587_0000212
2257 Ga0495587_0025540
2258 Ga0495587_0032844
2259 Ga0495587_0061580
2260 Ga0495609_0035401
2261 Ga0495609_0049744
2262 Ga0495645_0000035
2263 Ga0495645_0072687
2264 Ga0495645_0084403
2265 Ga0495645_0161612
2266 Ga0495622_0029075
2267 Ga0495667_0025972
2268 Ga0495667_0029233
2269 Ga0495667_0133415
2270 Ga0495656_0003461
2271 Ga0495634_0022140
2272 Ga0495634_0089748
2273 Ga0495634_0175114
2274 Ga0495611_0030048
2275 Ga0495635_0031027
2276 Ga0495635_0128027
2277 Ga0495659_0003008
2278 Ga0495661_0113819
2279 Ga0495588_0001261
2280 Ga0495657_0002891
2281 Ga0495657_0044094
2282 Ga0495657_0047828
2283 Ga0495657_0048638
2284 Ga0495599_0000009
2285 Ga0495599_0096758
2286 Ga0495599_0170355
2287 Ga0495599_0282386
2288 Ga0495623_0001465
2289 Ga0495623_0032031
2290 Ga0495623_0063824
2291 Ga0495646_0006560
2292 Ga0495646_0019252
2293 Ga0495647_0027036
2294 Ga0495647_0039174
2295 Ga0495658_0000943
2296 Ga0495658_0004844
2297 Ga0495658_0150261
2298 Ga0495613_0001715
2299 Ga0495613_0005719
2300 Ga0495613_0089060
2301 Ga0495613_0158948
2302 Ga0495613_0228359
2303 Ga0495613_0254173
2304 Ga0495624_0056006
2305 Ga0495670_0065612
2306 Ga0495670_0088604
2307 Ga0495589_0142309
2308 Ga0495600_0018215
2309 Ga0495600_0022173
2310 Ga0495600_0069166
2311 Ga0495581_0000618
2312 Ga0495581_0015527
2313 Ga0495604_0000120
2314 Ga0495604_0172875
2315 Ga0495604_0175538
2316 Ga0495674_0002761
2317 Ga0495674_0031685
2318 Ga0495674_0038281
2319 Ga0495674_0040406
2320 Ga0495674_0087891
2321 Ga0495674_0115831
2322 Ga0495674_0175200
2323 Ga0495676_0006670
2324 Ga0495676_0009347
2325 Ga0495676_0143535
2326 Ga0495680_0000280
2327 Ga0495680_0002774
2328 Ga0495680_0004409
2329 Ga0495680_0008617
2330 Ga0495680_0022786
2331 Ga0495680_0032999
2332 Ga0495680_0061497
2333 Ga0495680_0105614
2334 Ga0495680_0154818
2335 Ga0495675_0000137
2336 Ga0495675_0046463
2337 Ga0495675_0109399
2338 Ga0495677_0060035
2339 Ga0495677_0142568
2340 Ga0495679_021229
2341 Ga0495684_0003498
2342 Ga0495684_0003793
2343 Ga0495684_0013160
2344 Ga0495684_0028726
2345 Ga0495684_0043393
2346 Ga0495684_0096425
2347 Ga0495684_0142305
2348 Ga0495593_0003213
2349 Ga0495602_0001635
2350 Ga0495602_0025218
2351 Ga0495602_0038656
2352 Ga0495602_0099776
2353 Ga0495602_0118124
2354 Ga0495602_0126326
2355 Ga0495614_0015578
2356 Ga0496100_0009180
2357 Ga0496100_0024253
2358 Ga0496100_0050713
2359 Ga0496100_0087301
2360 Ga0496100_0087517
2361 Ga0496100_0143041
2362 Ga0496100_0143662
2363 Ga0496101_0020105
2364 Ga0496101_0042290
2365 Ga0496101_0047319
2366 Ga0496101_0057734
2367 Ga0496101_0059389
2368 Ga0496101_0065916
2369 Ga0496101_0075050
2370 Ga0496101_0081026
2371 Ga0496101_0082217
2372 Ga0496102_0013736
2373 Ga0496102_0015401
2374 Ga0496102_0050155
2375 Ga0496102_0056157
2376 Ga0496102_0060977
2377 Ga0496102_0128722
2378 Ga0496102_0144504
2379 Ga0496102_0278908
2380 Ga0496102_0441322
2381 Ga0496103_0015177
2382 Ga0496103_0018176
2383 Ga0496103_0041829
2384 Ga0496103_0042171
2385 Ga0496103_0156346
2386 Ga0496104_0000288
2387 Ga0496104_0002201
2388 Ga0496104_0003018
2389 Ga0496104_0008275
2390 Ga0496104_0012649
2391 Ga0496104_0012732
2392 Ga0496104_0014445
2393 Ga0496104_0098374
2394 Ga0496104_0249842
2395 Ga0496104_0495841
2396 Ga0496104_0562447
2397 Ga0496105_0001581
2398 Ga0496105_0002146
2399 Ga0496105_0002776
2400 Ga0496105_0004733
2401 Ga0496105_0004966
2402 Ga0496105_0006879
2403 Ga0496105_0007108
2404 Ga0496105_0046089
2405 Ga0496105_0047377
2406 Ga0496105_0069465
2407 Ga0496105_0073408
2408 Ga0496105_0134161
2409 Ga0496105_0317832
2410 Ga0496106_0020665
2411 Ga0496106_0046880
2412 Ga0496106_0083964
2413 Ga0496106_0116707
2414 Ga0496106_0150046
2415 Ga0496106_0235753
2416 Ga0496107_0008952
2417 Ga0496107_0012664
2418 Ga0496107_0055230
2419 Ga0496107_0059556
2420 Ga0496107_0101876
2421 Ga0496107_0202545
2422 Ga0496108_0000488
2423 Ga0496108_0005783
2424 Ga0496108_0008358
2425 Ga0496108_0008784
2426 Ga0496108_0013131
2427 Ga0496108_0081342
2428 Ga0496108_0083028
2429 Ga0496109_0003085
2430 Ga0496109_0004872
2431 Ga0496109_0007811
2432 Ga0496109_0014579
2433 Ga0496109_0080298
2434 Ga0496109_0089324
2435 Ga0496109_0095735
2436 Ga0496109_0144396
2437 Ga0496109_0153872
2438 Ga0496109_0176924
2439 Ga0496109_0193260
2440 Ga0496109_0236387
2441 Ga0496109_0294386
2442 Ga0496109_0384129
2443 Ga0496109_0607902
2444 Ga0496110_0016414
2445 Ga0496110_0022355
2446 Ga0496110_0022538
2447 Ga0496110_0033713
2448 Ga0496110_0037483
2449 Ga0496110_0037654
2450 Ga0496110_0051079
2451 Ga0496110_0086044
2452 Ga0496110_0092493
2453 Ga0496110_0106849
2454 Ga0496110_0139601
2455 Ga0496110_0180958
2456 Ga0496111_0000604
2457 Ga0496111_0019304
2458 Ga0496111_0020875
2459 Ga0496111_0050050
2460 Ga0496111_0088342
2461 Ga0496111_0092557
2462 Ga0496111_0200123
2463 Ga0496112_0000715
2464 Ga0496112_0001042
2465 Ga0496112_0002767
2466 Ga0496112_0014719
2467 Ga0496112_0044861
2468 Ga0496112_0146187
2469 Ga0496112_0181306
2470 Ga0496112_0234523
2471 Ga0496112_0235780
2472 Ga0496112_0297927
2473 Ga0496113_0000904
2474 Ga0496113_0089995
2475 Ga0496113_0149401
2476 Ga0496114_0002005
2477 Ga0496114_0002698
2478 Ga0496114_0005403
2479 Ga0496114_0009509
2480 Ga0496114_0014287
2481 Ga0496114_0033577
2482 Ga0496114_0052280
2483 Ga0496114_0086337
2484 Ga0496114_0128642
2485 Ga0496114_0140860
2486 Ga0496114_0141978
2487 Ga0496114_0217541
2488 Ga0496114_0233486
2489 Ga0496114_0249453
2490 Ga0496114_0277508
2491 Ga0496114_0337051
2492 Ga0496115_0000494
2493 Ga0496115_0002797
2494 Ga0496115_0007279
2495 Ga0496115_0019707
2496 Ga0496115_0043676
2497 Ga0496115_0077080
2498 Ga0496115_0091187
2499 Ga0496115_0092657
2500 Ga0496115_0099542
2501 Ga0496115_0112872
2502 Ga0496115_0158560
2503 Ga0496115_0174156
2504 Ga0496115_0208850
2505 Ga0496115_0312521
2506 Ga0501307_008991
2507 Ga0501031_0002608
2508 Ga0501031_0006204
2509 Ga0501031_0029371
2510 Ga0501031_0039144
2511 Ga0501031_0166877
2512 Ga0501031_0343713
2513 Ga0501032_0001008
2514 Ga0501032_0098395
2515 Ga0501033_0002030
2516 Ga0501033_0089834
2517 Ga0501033_0093848
2518 Ga0501033_0131363
2519 Ga0501033_0272644
2520 Ga0501034_0006109
2521 Ga0501034_0010389
2522 Ga0501034_0045662
2523 Ga0501034_0102207
2524 Ga0501034_0138299
2525 Ga0501034_0143406
2526 Ga0501036_0000259
2527 Ga0501036_0005680
2528 Ga0501036_0042308
2529 Ga0501036_0067581
2530 Ga0501036_0118044
2531 Ga0501036_0176340
2532 Ga0501037_0000205
2533 Ga0501037_0030488
2534 Ga0501037_0048820
2535 Ga0501037_0061840
2536 Ga0501037_0327783
2537 Ga0501038_0000771
2538 Ga0501038_0009846
2539 Ga0501038_0057309
2540 Ga0501038_0071914
2541 Ga0501038_0115083
2542 Ga0501038_0310496
2543 Ga0501039_0000149
2544 Ga0501039_0008886
2545 Ga0501039_0010904
2546 Ga0501039_0043125
2547 Ga0501039_0091230
2548 Ga0501039_0138075
2549 Ga0501039_0411486
2550 Ga0501040_0001153
2551 Ga0501040_0003109
2552 Ga0501040_0006410
2553 Ga0501040_0018389
2554 Ga0501040_0021630
2555 Ga0501040_0024737
2556 Ga0501040_0043845
2557 Ga0501040_0064922
2558 Ga0501040_0067524
2559 Ga0501040_0141097
2560 Ga0501040_0316681
2561 Ga0501041_0000092
2562 Ga0501041_0000426
2563 Ga0501041_0003403
2564 Ga0501041_0005613
2565 Ga0501041_0008904
2566 Ga0501041_0047244
2567 Ga0501041_0090433
2568 Ga0501042_0001259
2569 Ga0501042_0001326
2570 Ga0501042_0005053
2571 Ga0501042_0014163
2572 Ga0501042_0016716
2573 Ga0501042_0028191
2574 Ga0501042_0124002
2575 Ga0501042_0132793
2576 Ga0501042_0339527
2577 Ga0501043_0000217
2578 Ga0501043_0020703
2579 Ga0501043_0067363
2580 Ga0501043_0073810
2581 Ga0501046_0001786
2582 Ga0501046_0003483
2583 Ga0501046_0031351
2584 Ga0501046_0051090
2585 Ga0501046_0098171
2586 Ga0501046_0228896
2587 Ga0501047_0001439
2588 Ga0501047_0011868
2589 Ga0501047_0090343
2590 Ga0501047_0109719
2591 Ga0501048_0000345
2592 Ga0501048_0005592
2593 Ga0501048_0014732
2594 Ga0501048_0037228
2595 Ga0501048_0041067
2596 Ga0501048_0042735
2597 Ga0501048_0062206
2598 Ga0501048_0168068
2599 Ga0501048_0321511
2600 Ga0501067_0001525
2601 Ga0501067_0003105
2602 Ga0501067_0035182
2603 Ga0501067_0055144
2604 Ga0501067_0100244
2605 Ga0501067_0103576
2606 Ga0501068_0000158
2607 Ga0501068_0007257
2608 Ga0501068_0010420
2609 Ga0501068_0024871
2610 Ga0501068_0039784
2611 Ga0501068_0122887
2612 Ga0501068_0178950
2613 Ga0501069_0004840
2614 Ga0501069_0005068
2615 Ga0501069_0011257
2616 Ga0501069_0012646
2617 Ga0501069_0016981
2618 Ga0501069_0041440
2619 Ga0501069_0055477
2620 Ga0501069_0146039
2621 Ga0501070_0007733
2622 Ga0501070_0021479
2623 Ga0501070_0058859
2624 Ga0501070_0074282
2625 Ga0501070_0131558
2626 Ga0501070_0139422
2627 Ga0501070_0359629
2628 Ga0501071_0000097
2629 Ga0501071_0008697
2630 Ga0501071_0012044
2631 Ga0501071_0015914
2632 Ga0501071_0020464
2633 Ga0501071_0023711
2634 Ga0501071_0024819
2635 Ga0501071_0033359
2636 Ga0501071_0037141
2637 Ga0501071_0113756
2638 Ga0501071_0134280
2639 Ga0501072_0000248
2640 Ga0501072_0005632
2641 Ga0501072_0007574
2642 Ga0501072_0042963
2643 Ga0501072_0072520
2644 Ga0501072_0078261
2645 Ga0501072_0201124
2646 Ga0501072_0207790
2647 Ga0501072_0351865
2648 Ga0501073_0004502
2649 Ga0501073_0020584
2650 Ga0501073_0075815
2651 Ga0501074_0003746
2652 Ga0501074_0007316
2653 Ga0501074_0007464
2654 Ga0501074_0017408
2655 Ga0501074_0024653
2656 Ga0501074_0036149
2657 Ga0501074_0041770
2658 Ga0501074_0047886
2659 Ga0501074_0207762
2660 Ga0501074_0232497
2661 Ga0501074_0290395
2662 Ga0501075_0000701
2663 Ga0501075_0000729
2664 Ga0501075_0006520
2665 Ga0501075_0017532
2666 Ga0501075_0039441
2667 Ga0501075_0071433
2668 Ga0501076_0000734
2669 Ga0501076_0008186
2670 Ga0501076_0010550
2671 Ga0501076_0015180
2672 Ga0501076_0015217
2673 Ga0501076_0023789
2674 Ga0501076_0042465
2675 Ga0501076_0047245
2676 Ga0501076_0191736
2677 Ga0501076_0202018
2678 Ga0501076_0223566
2679 Ga0501076_0439230
2680 Ga0501077_0000132
2681 Ga0501077_0004551
2682 Ga0501077_0005321
2683 Ga0501077_0010909
2684 Ga0501077_0015387
2685 Ga0501077_0024165
2686 Ga0501079_0002142
2687 Ga0501079_0003515
2688 Ga0501079_0003795
2689 Ga0501079_0008320
2690 Ga0501079_0009532
2691 Ga0501079_0063627
2692 Ga0501079_0065388
2693 Ga0501079_0075314
2694 Ga0501079_0092625
2695 Ga0501079_0114298
2696 Ga0501079_0122669
2697 Ga0501080_0005018
2698 Ga0501080_0013013
2699 Ga0501080_0019728
2700 Ga0501080_0057179
2701 Ga0501080_0067444
2702 Ga0501080_0095992
2703 Ga0501080_0195209
2704 Ga0501080_0203365
2705 Ga0501080_0333458
2706 Ga0501081_0000692
2707 Ga0501081_0000837
2708 Ga0501081_0002602
2709 Ga0501081_0008632
2710 Ga0501081_0018101
2711 Ga0501081_0019017
2712 Ga0501081_0050380
2713 Ga0501081_0172378
2714 Ga0501083_0000086
2715 Ga0501083_0000751
2716 Ga0501083_0022268
2717 Ga0501083_0061820
2718 Ga0501083_0068964
2719 Ga0501083_0154087
2720 Ga0501083_0291072
2721 Ga0501035_0000437
2722 Ga0501035_0190386
2723 Ga0501035_0193833
2724 Ga0501035_0204989
2725 Ga0501035_0245816
2726 Ga0501035_0253454
2727 Ga0501044_0001726
2728 Ga0501044_0085816
2729 Ga0501044_0154163
2730 Ga0501044_0505617
2731 Ga0501045_0005349
2732 Ga0501045_0007717
2733 Ga0501045_0011122
2734 Ga0501045_0015419
2735 Ga0501045_0028196
2736 Ga0501045_0028262
2737 Ga0501045_0047092
2738 Ga0501045_0050649
2739 Ga0501045_0054535
2740 nmdc:mga00v17_20992_c1
2741 nmdc:mga00v17_231455_c1
2742 nmdc:mga00v17_47034_c1
2743 nmdc:mga0yw44_18281_c1
2744 nmdc:mga0yw44_65818_c1
2745 nmdc:mga06z11_116254_c1
2746 nmdc:mga05p37_112741_c1
2747 nmdc:mga05p37_227216_c1
2748 nmdc:mga05p37_23364_c1
2749 nmdc:mga05p37_310914_c1
2750 nmdc:mga05p37_51716_c1
2751 nmdc:mga05p37_78159_c1
2752 nmdc:mga09592_10222_c1
2753 nmdc:mga09592_12706_c1
2754 nmdc:mga09592_61406_c1
2755 nmdc:mga0qj67_15282_c1
2756 nmdc:mga0qj67_155880_c1
2757 nmdc:mga0qj67_40913_c1
2758 nmdc:mga06r32_206997_c1
2759 nmdc:mga06r32_43886_c1
2760 nmdc:mga06r32_439664_c1
2761 nmdc:mga08y16_11874_c1
2762 nmdc:mga08y16_14378_c1
2763 nmdc:mga08y16_25511_c1
2764 nmdc:mga08y16_367559_c1
2765 nmdc:mga08y16_63375_c1
2766 nmdc:mga08y16_82262_c1
2767 nmdc:mga0n895_216489_c1
2768 nmdc:mga0n895_21900_c1
2769 nmdc:mga0n895_345629_c1
2770 nmdc:mga0n895_35200_c1
2771 nmdc:mga0rr50_10341_c1
2772 nmdc:mga0rr50_42906_c1
2773 nmdc:mga08x19_28488_c1
2774 nmdc:mga0a205_2180_c1
2775 nmdc:mga0a205_23779_c1
2776 nmdc:mga0a205_31410_c1
2777 nmdc:mga0a205_33265_c2
2778 Ga0495601_0000983
2779 Ga0495601_0032476
2780 Ga0495601_0087100
2781 Ga0495601_0113091
2782 Ga0495601_0115389
2783 Ga0495601_0196673
2784 Ga0495612_0009152
2785 Ga0495655_0029979
2786 Ga0495595_0036286
2787 Ga0495595_0047786
2788 Ga0495595_0122436
2789 Ga0495595_0168621
2790 Ga0495619_0004719
2791 Ga0495619_0008649
2792 Ga0495619_0023175
2793 Ga0495619_0025735
2794 Ga0495619_0031759
2795 Ga0495619_0078590
2796 Ga0495619_0122862
2797 Ga0500568_0001852
2798 Ga0500616_0000215
2799 Ga0501084_0000492
2800 Ga0501084_0005749
2801 Ga0501084_0013559
2802 Ga0501084_0015632
2803 Ga0501084_0027990
2804 Ga0501084_0046847
2805 Ga0501084_0168843
2806 Ga0501084_0208810
2807 Ga0501084_0209001
2808 Ga0501084_0363283
2809 Ga0590075_008777
2810 Ga0501082_0000139
2811 Ga0501082_0008363
2812 Ga0501082_0010188
2813 Ga0501082_0011909
2814 Ga0501082_0058794
2815 Ga0501082_0065507
2816 Ga0501082_0112269
2817 Ga0501082_0255885
2818 Ga0466962_0002601
2819 Ga0466962_0004184
2820 Ga0466962_0004907
2821 Ga0466962_0017606
2822 Ga0466962_0046896
2823 Ga0530510_0000086
2824 Ga0530510_0001228
2825 Ga0530510_0007446
2826 Ga0530510_0027645
2827 Ga0530510_0029265
2828 Ga0530510_0030125
2829 Ga0530510_0043266
2830 Ga0530510_0184062

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

206

284

0.93

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

65

353

0.89

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

115

336

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mh4-assembly1.cif.gz_A crystal structure of lactococcus lactis thioredoxin reductase (fr conformation) 0.9537 8 309
5mh4-assembly1.cif.gz_A crystal structure of lactococcus lactis thioredoxin reductase (fr conformation) 0.9445 8 309
1f6m-assembly1.cif.gz_A crystal structure of a complex between thioredoxin reductase, thioredoxin, and the nadp+ analog, aadp+ 0.9346 4 313
5u63-assembly1.cif.gz_A crystal structure of putative thioredoxin reductase from haemophilus influenzae 0.9288 6 310
4mif-assembly1.cif.gz_D pyranose 2-oxidase from phanerochaete chrysosporium, wild type from natural source 0.9266 8 36
ID Description Score Start End Superfamily
5uthA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9879 118 240 3.50.50.60
5uthA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9801 118 240 3.50.50.60
4zn0C02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9729 118 240 3.50.50.60
3f8rD02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9664 118 240 3.50.50.60
4ykgA03 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9626 118 240 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A3C0YJU2-F1-model_v4 deleted 0.9921 136 202
AF-K1UEN0-F1-model_v4 Protein containing Pyridine nucleotide-disulfide oxidoreductase, NAD-binding region domain protein (EC 1.-.-.-) 0.9853 141 207 GO:0016491
AF-A0A3D5UWY6-F1-model_v4 Thioredoxin-disulfide reductase 0.9847 143 231 GO:0016491
AF-A0A6B3EPH4-F1-model_v4 FAD-dependent oxidoreductase 0.9789 113 226 GO:0016668
AF-A0A7H4N4U0-F1-model_v4 Alkyl hydroperoxide reductase protein F (EC 1.8.1.-) 0.9745 120 202 GO:0016668

Map