F493782
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1415 | 376 | 2830 | 320 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10055580|Ga0105240_100555803 |
| Length | 379 |
| Sequence | MAIFFMVLSSCVGPAISSDRPAAEGLGRQRIAVNLLGTSPHGAGRPGTSDRPVAFTTLKAEVKTRELIIIGGGPAGYTAALYAARADLEPLVIEGFQWGGQLMITSDVENYPGYADGVMGPEMMSDFRRQAERFGAEFITDDVTKVDFSEQPHRVFVGDDEYTARAVIIATGATARFLGIPSEEKHKGRGVSACATCDAAFFRDKDVYVVGGGDSAFEEALFLTKFASHVHLVHRRDEFRASRIMVDRADRNEKLDYVLNAVVDEIIGDVKVEGLRLRSTVTDETWEVPADGLFVAIGHDPSTALFVDHLDHDDQGYLVTSPGSTATNIPGVFAAGDVQDHTYRQAITAAGSGCMAALDAERFLASLEGHPGTALTAGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 175 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 181 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 183 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 186 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 189 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 190 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 193 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 194 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 195 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 196 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 198 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 205 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 208 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 209 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 211 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 212 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 213 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 214 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 215 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 216 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 217 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 218 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 219 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 220 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 221 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 222 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 223 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 224 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 225 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 226 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 227 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 228 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 229 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 230 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 231 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 232 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 233 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 234 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 235 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 236 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 237 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 238 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 239 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 240 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 241 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 242 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 243 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 244 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 306 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 307 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 308 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 309 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 310 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 311 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 314 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 315 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 316 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 317 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 318 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 319 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 354 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 355 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 356 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 371 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 372 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 374 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 376 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.81 |
| Metatranscriptomes | 2.19 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.13 |
| Nodule | 0 |
| Rhizoplane | 10.6 |
| Rhizosphere | 87.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105240_10055580 | 3300009093 | Bacteria | 4956 |
| 2 | JGI24738J21930_10004813 | 3300002075 | Bacteria | 3283 |
| 3 | JGI25407J50210_10002464 | 3300003373 | Bacteria | 4359 |
| 4 | Ga0070658_10016045 | 3300005327 | Bacteria | 5991 |
| 5 | Ga0070658_10034579 | 3300005327 | Bacteria | 4066 |
| 6 | Ga0070658_10089110 | 3300005327 | Bacteria | 2541 |
| 7 | Ga0070658_10238552 | 3300005327 | Bacteria | 1541 |
| 8 | Ga0070683_100003672 | 3300005329 | Bacteria | 12516 |
| 9 | Ga0070683_100047809 | 3300005329 | Bacteria | 3954 |
| 10 | Ga0070683_100076195 | 3300005329 | Bacteria | 3135 |
| 11 | Ga0070683_100177274 | 3300005329 | Bacteria | 2023 |
| 12 | Ga0070680_100003014 | 3300005336 | Bacteria | 12499 |
| 13 | Ga0070680_100026345 | 3300005336 | Bacteria | 4650 |
| 14 | Ga0070680_100033482 | 3300005336 | Bacteria | 4143 |
| 15 | Ga0070680_100039991 | 3300005336 | Bacteria | 3795 |
| 16 | Ga0070680_100046229 | 3300005336 | Bacteria | 3540 |
| 17 | Ga0070682_100001154 | 3300005337 | Bacteria | 15085 |
| 18 | Ga0070682_100007677 | 3300005337 | Bacteria | 6077 |
| 19 | Ga0070682_100086954 | 3300005337 | Bacteria | 2037 |
| 20 | Ga0070660_100003891 | 3300005339 | Bacteria | 10317 |
| 21 | Ga0070660_100028566 | 3300005339 | Bacteria | 4174 |
| 22 | Ga0070660_100048434 | 3300005339 | Bacteria | 3264 |
| 23 | Ga0070660_100122221 | 3300005339 | Bacteria | 2078 |
| 24 | Ga0070660_100336603 | 3300005339 | Bacteria | 1241 |
| 25 | Ga0070689_100010453 | 3300005340 | Bacteria | 6615 |
| 26 | Ga0070691_10001490 | 3300005341 | Bacteria | 10050 |
| 27 | Ga0070661_100014347 | 3300005344 | Bacteria | 5581 |
| 28 | Ga0070661_100042605 | 3300005344 | Bacteria | 3314 |
| 29 | Ga0070661_100087400 | 3300005344 | Bacteria | 2306 |
| 30 | Ga0070692_10001185 | 3300005345 | Bacteria | 9221 |
| 31 | Ga0070668_100276978 | 3300005347 | Bacteria | 1400 |
| 32 | Ga0070668_100373723 | 3300005347 | Bacteria | 1211 |
| 33 | Ga0070669_100295841 | 3300005353 | Bacteria | 1301 |
| 34 | Ga0070675_100006250 | 3300005354 | Bacteria | 9140 |
| 35 | Ga0070671_100054537 | 3300005355 | Bacteria | 3324 |
| 36 | Ga0070671_100102254 | 3300005355 | Bacteria | 2404 |
| 37 | Ga0070671_100279533 | 3300005355 | Bacteria | 1419 |
| 38 | Ga0070674_100006216 | 3300005356 | Bacteria | 6951 |
| 39 | Ga0070674_100007050 | 3300005356 | Bacteria | 6608 |
| 40 | Ga0070674_100055396 | 3300005356 | Bacteria | 2746 |
| 41 | Ga0070674_100115142 | 3300005356 | Bacteria | 1981 |
| 42 | Ga0070673_100004299 | 3300005364 | Bacteria | 8997 |
| 43 | Ga0070673_100196375 | 3300005364 | Bacteria | 1736 |
| 44 | Ga0070673_100244424 | 3300005364 | Bacteria | 1562 |
| 45 | Ga0070688_100074382 | 3300005365 | Bacteria | 2182 |
| 46 | Ga0070659_100001847 | 3300005366 | Bacteria | 15221 |
| 47 | Ga0070659_100047410 | 3300005366 | Bacteria | 3370 |
| 48 | Ga0070659_100053595 | 3300005366 | Bacteria | 3175 |
| 49 | Ga0070667_100131229 | 3300005367 | Bacteria | 2187 |
| 50 | Ga0070667_100155197 | 3300005367 | Bacteria | 2013 |
| 51 | Ga0070667_100355532 | 3300005367 | Bacteria | 1327 |
| 52 | Ga0070714_100009702 | 3300005435 | Bacteria | 7582 |
| 53 | Ga0070714_100087305 | 3300005435 | Bacteria | 2727 |
| 54 | Ga0070714_100150039 | 3300005435 | Bacteria | 2100 |
| 55 | Ga0070714_100181520 | 3300005435 | Bacteria | 1915 |
| 56 | Ga0070713_100002387 | 3300005436 | Bacteria | 12248 |
| 57 | Ga0070713_100022139 | 3300005436 | Bacteria | 4906 |
| 58 | Ga0070713_100022174 | 3300005436 | Bacteria | 4903 |
| 59 | Ga0070713_100106551 | 3300005436 | Bacteria | 2437 |
| 60 | Ga0070713_100170654 | 3300005436 | Bacteria | 1949 |
| 61 | Ga0070710_10002369 | 3300005437 | Bacteria | 8922 |
| 62 | Ga0070710_10004604 | 3300005437 | Bacteria | 6520 |
| 63 | Ga0070710_10093515 | 3300005437 | Bacteria | 1777 |
| 64 | Ga0070710_10135845 | 3300005437 | Bacteria | 1503 |
| 65 | Ga0070711_100021791 | 3300005439 | Bacteria | 4147 |
| 66 | Ga0070711_100049950 | 3300005439 | Bacteria | 2866 |
| 67 | Ga0070694_100279111 | 3300005444 | Bacteria | 1273 |
| 68 | Ga0070708_100201715 | 3300005445 | Bacteria | 1862 |
| 69 | Ga0070663_100077065 | 3300005455 | Bacteria | 2440 |
| 70 | Ga0070678_100022013 | 3300005456 | Bacteria | 4214 |
| 71 | Ga0070678_100071075 | 3300005456 | Bacteria | 2604 |
| 72 | Ga0070662_100014193 | 3300005457 | Bacteria | 5316 |
| 73 | Ga0070662_100032861 | 3300005457 | Bacteria | 3649 |
| 74 | Ga0070681_10013997 | 3300005458 | Bacteria | 7984 |
| 75 | Ga0070681_10016356 | 3300005458 | Bacteria | 7404 |
| 76 | Ga0070681_10023730 | 3300005458 | Bacteria | 6173 |
| 77 | Ga0070681_10053838 | 3300005458 | Bacteria | 4010 |
| 78 | Ga0070681_10394122 | 3300005458 | Bacteria | 1296 |
| 79 | Ga0068867_100009456 | 3300005459 | Bacteria | 6873 |
| 80 | Ga0068867_100090407 | 3300005459 | Bacteria | 2323 |
| 81 | Ga0068867_100106689 | 3300005459 | Bacteria | 2146 |
| 82 | Ga0068867_100271941 | 3300005459 | Bacteria | 1386 |
| 83 | Ga0070706_100025393 | 3300005467 | Bacteria | 5451 |
| 84 | Ga0070706_100102851 | 3300005467 | Bacteria | 2656 |
| 85 | Ga0070706_100154233 | 3300005467 | Bacteria | 2144 |
| 86 | Ga0070707_100008855 | 3300005468 | Bacteria | 9332 |
| 87 | Ga0070707_100129005 | 3300005468 | Bacteria | 2458 |
| 88 | Ga0070698_100000472 | 3300005471 | Bacteria | 42620 |
| 89 | Ga0070698_100001742 | 3300005471 | Bacteria | 24266 |
| 90 | Ga0070698_100012860 | 3300005471 | Bacteria | 8863 |
| 91 | Ga0070698_100022411 | 3300005471 | Bacteria | 6608 |
| 92 | Ga0070698_100082519 | 3300005471 | Bacteria | 3206 |
| 93 | Ga0070698_100143501 | 3300005471 | Bacteria | 2338 |
| 94 | Ga0070699_100026853 | 3300005518 | Bacteria | 4967 |
| 95 | Ga0070699_100108344 | 3300005518 | Bacteria | 2438 |
| 96 | Ga0070699_100119828 | 3300005518 | Bacteria | 2313 |
| 97 | Ga0070679_100002682 | 3300005530 | Bacteria | 16215 |
| 98 | Ga0070679_100010105 | 3300005530 | Bacteria | 8944 |
| 99 | Ga0070679_100015262 | 3300005530 | Bacteria | 7380 |
| 100 | Ga0070679_100060606 | 3300005530 | Bacteria | 3770 |
| 101 | Ga0070679_100091769 | 3300005530 | Bacteria | 3025 |
| 102 | Ga0070679_100206925 | 3300005530 | Bacteria | 1926 |
| 103 | Ga0070679_100621161 | 3300005530 | Bacteria | 1024 |
| 104 | Ga0070684_100002494 | 3300005535 | Bacteria | 13557 |
| 105 | Ga0070684_100009589 | 3300005535 | Bacteria | 7630 |
| 106 | Ga0070684_100021102 | 3300005535 | Bacteria | 5412 |
| 107 | Ga0070684_100022528 | 3300005535 | Bacteria | 5255 |
| 108 | Ga0070684_100044309 | 3300005535 | Bacteria | 3848 |
| 109 | Ga0070684_100162758 | 3300005535 | Bacteria | 2025 |
| 110 | Ga0070697_100028193 | 3300005536 | Bacteria | 4496 |
| 111 | Ga0070697_100302970 | 3300005536 | Bacteria | 1374 |
| 112 | Ga0068853_100013517 | 3300005539 | Bacteria | 6668 |
| 113 | Ga0068853_100081711 | 3300005539 | Bacteria | 2830 |
| 114 | Ga0070672_100065196 | 3300005543 | Bacteria | 2880 |
| 115 | Ga0070686_100192428 | 3300005544 | Bacteria | 1457 |
| 116 | Ga0070695_100042730 | 3300005545 | Bacteria | 2879 |
| 117 | Ga0070693_100009457 | 3300005547 | Bacteria | 4848 |
| 118 | Ga0070693_100010362 | 3300005547 | Bacteria | 4670 |
| 119 | Ga0070693_100038476 | 3300005547 | Bacteria | 2674 |
| 120 | Ga0070665_100056061 | 3300005548 | Bacteria | 3952 |
| 121 | Ga0070704_100128218 | 3300005549 | Bacteria | 1961 |
| 122 | Ga0068855_100029321 | 3300005563 | Bacteria | 6580 |
| 123 | Ga0068855_100046564 | 3300005563 | Bacteria | 5126 |
| 124 | Ga0068855_100107411 | 3300005563 | Bacteria | 3206 |
| 125 | Ga0068855_100124516 | 3300005563 | Bacteria | 2948 |
| 126 | Ga0068855_100135714 | 3300005563 | Bacteria | 2807 |
| 127 | Ga0068857_100085160 | 3300005577 | Bacteria | 2825 |
| 128 | Ga0068854_100005175 | 3300005578 | Bacteria | 8223 |
| 129 | Ga0068854_100019060 | 3300005578 | Bacteria | 4617 |
| 130 | Ga0068856_100184171 | 3300005614 | Bacteria | 2102 |
| 131 | Ga0068856_100322675 | 3300005614 | Bacteria | 1562 |
| 132 | Ga0070702_100062138 | 3300005615 | Bacteria | 2177 |
| 133 | Ga0068852_100072149 | 3300005616 | Bacteria | 3034 |
| 134 | Ga0068852_100084248 | 3300005616 | Bacteria | 2829 |
| 135 | Ga0068852_100110738 | 3300005616 | Bacteria | 2495 |
| 136 | Ga0068852_100182380 | 3300005616 | Bacteria | 1975 |
| 137 | Ga0068866_10015588 | 3300005718 | Bacteria | 3379 |
| 138 | Ga0068866_10019659 | 3300005718 | Bacteria | 3080 |
| 139 | Ga0068861_100013608 | 3300005719 | Bacteria | 5696 |
| 140 | Ga0068861_100086224 | 3300005719 | Bacteria | 2468 |
| 141 | Ga0068870_10231683 | 3300005840 | Bacteria | 1136 |
| 142 | Ga0068863_100059691 | 3300005841 | Bacteria | 3609 |
| 143 | Ga0068858_100155850 | 3300005842 | Bacteria | 2149 |
| 144 | Ga0068858_100255878 | 3300005842 | Bacteria | 1664 |
| 145 | Ga0068860_100123490 | 3300005843 | Bacteria | 2481 |
| 146 | Ga0068860_100152182 | 3300005843 | Bacteria | 2228 |
| 147 | Ga0068860_100226779 | 3300005843 | Bacteria | 1815 |
| 148 | Ga0068862_100263267 | 3300005844 | Bacteria | 1575 |
| 149 | Ga0081455_10002893 | 3300005937 | Bacteria | 20164 |
| 150 | Ga0081455_10006617 | 3300005937 | Bacteria | 12401 |
| 151 | Ga0081455_10007185 | 3300005937 | Bacteria | 11770 |
| 152 | Ga0081455_10012039 | 3300005937 | Bacteria | 8655 |
| 153 | Ga0081455_10029777 | 3300005937 | Bacteria | 4972 |
| 154 | Ga0081455_10044856 | 3300005937 | Bacteria | 3851 |
| 155 | Ga0081455_10049104 | 3300005937 | Bacteria | 3640 |
| 156 | Ga0081455_10091421 | 3300005937 | Bacteria | 2464 |
| 157 | Ga0081455_10109191 | 3300005937 | Bacteria | 2202 |
| 158 | Ga0081455_10133880 | 3300005937 | Bacteria | 1934 |
| 159 | Ga0081538_10000012 | 3300005981 | Bacteria | 153046 |
| 160 | Ga0081538_10000205 | 3300005981 | Bacteria | 65480 |
| 161 | Ga0081538_10001091 | 3300005981 | Bacteria | 28734 |
| 162 | Ga0081538_10001170 | 3300005981 | Bacteria | 27708 |
| 163 | Ga0081538_10009350 | 3300005981 | Bacteria | 8195 |
| 164 | Ga0081538_10010785 | 3300005981 | Bacteria | 7467 |
| 165 | Ga0081538_10040029 | 3300005981 | Bacteria | 2995 |
| 166 | Ga0081538_10098834 | 3300005981 | Bacteria | 1477 |
| 167 | Ga0081540_1004192 | 3300005983 | Bacteria | 11087 |
| 168 | Ga0081540_1006685 | 3300005983 | Bacteria | 8340 |
| 169 | Ga0081539_10001511 | 3300005985 | Bacteria | 39181 |
| 170 | Ga0081539_10001867 | 3300005985 | Bacteria | 33100 |
| 171 | Ga0081539_10014792 | 3300005985 | Bacteria | 5733 |
| 172 | Ga0070717_10004071 | 3300006028 | Bacteria | 10544 |
| 173 | Ga0070717_10005336 | 3300006028 | Bacteria | 9370 |
| 174 | Ga0070717_10008478 | 3300006028 | Bacteria | 7677 |
| 175 | Ga0070717_10022452 | 3300006028 | Bacteria | 4986 |
| 176 | Ga0070717_10114763 | 3300006028 | Bacteria | 2301 |
| 177 | Ga0070717_10331987 | 3300006028 | Bacteria | 1356 |
| 178 | Ga0075365_10050801 | 3300006038 | Bacteria | 2736 |
| 179 | Ga0075365_10119624 | 3300006038 | Bacteria | 1816 |
| 180 | Ga0075363_100158018 | 3300006048 | Bacteria | 1283 |
| 181 | Ga0075364_10003473 | 3300006051 | Bacteria | 8969 |
| 182 | Ga0075364_10008474 | 3300006051 | Bacteria | 6149 |
| 183 | Ga0075364_10171756 | 3300006051 | Bacteria | 1465 |
| 184 | Ga0075432_10015158 | 3300006058 | Bacteria | 2628 |
| 185 | Ga0075432_10047605 | 3300006058 | Bacteria | 1507 |
| 186 | Ga0070715_10000223 | 3300006163 | Bacteria | 13556 |
| 187 | Ga0070716_100005561 | 3300006173 | Bacteria | 6118 |
| 188 | Ga0070716_100051755 | 3300006173 | Bacteria | 2336 |
| 189 | Ga0070716_100086655 | 3300006173 | Bacteria | 1884 |
| 190 | Ga0070716_100150625 | 3300006173 | Bacteria | 1496 |
| 191 | Ga0070712_100053783 | 3300006175 | Bacteria | 2812 |
| 192 | Ga0075367_10197620 | 3300006178 | Bacteria | 1256 |
| 193 | Ga0075366_10188846 | 3300006195 | Bacteria | 1252 |
| 194 | Ga0097621_100122420 | 3300006237 | Bacteria | 2208 |
| 195 | Ga0068871_100031259 | 3300006358 | Bacteria | 4197 |
| 196 | Ga0075428_100000881 | 3300006844 | Bacteria | 31588 |
| 197 | Ga0075428_100145687 | 3300006844 | Bacteria | 2574 |
| 198 | Ga0075428_100204957 | 3300006844 | Bacteria | 2131 |
| 199 | Ga0075430_100010050 | 3300006846 | Bacteria | 8007 |
| 200 | Ga0075430_100138194 | 3300006846 | Bacteria | 2029 |
| 201 | Ga0075430_100227031 | 3300006846 | Bacteria | 1549 |
| 202 | Ga0075431_100029898 | 3300006847 | Bacteria | 5609 |
| 203 | Ga0075431_100140313 | 3300006847 | Bacteria | 2491 |
| 204 | Ga0075431_100145995 | 3300006847 | Bacteria | 2438 |
| 205 | Ga0075431_100201835 | 3300006847 | Bacteria | 2034 |
| 206 | Ga0075433_10001982 | 3300006852 | Bacteria | 15402 |
| 207 | Ga0075433_10005692 | 3300006852 | Bacteria | 9798 |
| 208 | Ga0075433_10079051 | 3300006852 | Bacteria | 2898 |
| 209 | Ga0075434_100005232 | 3300006871 | Bacteria | 11788 |
| 210 | Ga0075434_100010926 | 3300006871 | Bacteria | 8537 |
| 211 | Ga0075434_100016151 | 3300006871 | Bacteria | 7174 |
| 212 | Ga0075434_100047760 | 3300006871 | Bacteria | 4247 |
| 213 | Ga0075434_100075796 | 3300006871 | Bacteria | 3358 |
| 214 | Ga0075429_100002453 | 3300006880 | Bacteria | 15606 |
| 215 | Ga0075429_100012763 | 3300006880 | Bacteria | 7288 |
| 216 | Ga0075429_100016341 | 3300006880 | Bacteria | 6432 |
| 217 | Ga0068865_100001102 | 3300006881 | Bacteria | 15595 |
| 218 | Ga0068865_100067166 | 3300006881 | Bacteria | 2532 |
| 219 | Ga0068865_100073362 | 3300006881 | Bacteria | 2434 |
| 220 | Ga0068865_100082917 | 3300006881 | Bacteria | 2306 |
| 221 | Ga0068865_100112570 | 3300006881 | Bacteria | 2010 |
| 222 | Ga0075436_100004569 | 3300006914 | Bacteria | 9474 |
| 223 | Ga0075436_100007624 | 3300006914 | Bacteria | 7394 |
| 224 | Ga0075435_100002576 | 3300007076 | Bacteria | 12093 |
| 225 | Ga0075435_100003349 | 3300007076 | Bacteria | 10858 |
| 226 | Ga0075435_100098257 | 3300007076 | Bacteria | 2423 |
| 227 | Ga0075435_100116723 | 3300007076 | Bacteria | 2224 |
| 228 | Ga0105240_10027857 | 3300009093 | Bacteria | 7392 |
| 229 | Ga0105240_10041896 | 3300009093 | Bacteria | 5839 |
| 230 | Ga0105240_10066726 | 3300009093 | Bacteria | 4462 |
| 231 | Ga0105240_10155567 | 3300009093 | Bacteria | 2719 |
| 232 | Ga0105240_10179582 | 3300009093 | Bacteria | 2499 |
| 233 | Ga0105240_10223643 | 3300009093 | Bacteria | 2191 |
| 234 | Ga0105240_10343080 | 3300009093 | Bacteria | 1696 |
| 235 | Ga0105240_10452039 | 3300009093 | Bacteria | 1437 |
| 236 | Ga0111539_10005140 | 3300009094 | Bacteria | 16966 |
| 237 | Ga0111539_10014417 | 3300009094 | Bacteria | 9865 |
| 238 | Ga0111539_10289463 | 3300009094 | Bacteria | 1906 |
| 239 | Ga0111539_10290287 | 3300009094 | Bacteria | 1903 |
| 240 | Ga0111539_10314413 | 3300009094 | Bacteria | 1823 |
| 241 | Ga0111539_10384773 | 3300009094 | Bacteria | 1633 |
| 242 | Ga0105245_10015258 | 3300009098 | Bacteria | 6694 |
| 243 | Ga0105245_10018003 | 3300009098 | Bacteria | 6170 |
| 244 | Ga0105245_10032641 | 3300009098 | Bacteria | 4609 |
| 245 | Ga0105245_10092679 | 3300009098 | Bacteria | 2782 |
| 246 | Ga0105245_10207348 | 3300009098 | Bacteria | 1885 |
| 247 | Ga0105245_10268117 | 3300009098 | Bacteria | 1664 |
| 248 | Ga0105245_10495005 | 3300009098 | Bacteria | 1238 |
| 249 | Ga0114129_10002158 | 3300009147 | Bacteria | 27126 |
| 250 | Ga0114129_10097354 | 3300009147 | Bacteria | 4073 |
| 251 | Ga0114129_10147476 | 3300009147 | Bacteria | 3222 |
| 252 | Ga0114129_10377196 | 3300009147 | Bacteria | 1874 |
| 253 | Ga0105243_10001674 | 3300009148 | Bacteria | 19173 |
| 254 | Ga0105243_10007507 | 3300009148 | Bacteria | 8380 |
| 255 | Ga0105243_10043286 | 3300009148 | Bacteria | 3529 |
| 256 | Ga0105243_10086132 | 3300009148 | Bacteria | 2576 |
| 257 | Ga0105243_10131094 | 3300009148 | Bacteria | 2126 |
| 258 | Ga0105241_10130208 | 3300009174 | Bacteria | 2036 |
| 259 | Ga0105242_10160950 | 3300009176 | Bacteria | 1965 |
| 260 | Ga0105242_10302628 | 3300009176 | Bacteria | 1460 |
| 261 | Ga0105242_10320360 | 3300009176 | Bacteria | 1422 |
| 262 | Ga0105248_10178837 | 3300009177 | Bacteria | 2391 |
| 263 | Ga0105248_10251936 | 3300009177 | Bacteria | 1987 |
| 264 | Ga0105248_10560927 | 3300009177 | Bacteria | 1288 |
| 265 | Ga0105237_10133570 | 3300009545 | Bacteria | 2477 |
| 266 | Ga0105237_10176025 | 3300009545 | Bacteria | 2139 |
| 267 | Ga0105238_10017502 | 3300009551 | Bacteria | 7286 |
| 268 | Ga0105249_10007414 | 3300009553 | Bacteria | 9569 |
| 269 | Ga0105249_10013589 | 3300009553 | Bacteria | 7193 |
| 270 | Ga0105249_10342739 | 3300009553 | Bacteria | 1512 |
| 271 | Ga0105239_10013948 | 3300010375 | Bacteria | 8922 |
| 272 | Ga0105239_10020380 | 3300010375 | Bacteria | 7315 |
| 273 | Ga0105239_10063871 | 3300010375 | Bacteria | 4042 |
| 274 | Ga0105239_10146444 | 3300010375 | Bacteria | 2634 |
| 275 | Ga0105239_10385004 | 3300010375 | Bacteria | 1586 |
| 276 | Ga0105246_10026923 | 3300011119 | Bacteria | 3762 |
| 277 | Ga0105246_10047578 | 3300011119 | Bacteria | 2930 |
| 278 | Ga0105246_10354495 | 3300011119 | Bacteria | 1203 |
| 279 | Ga0157373_10200948 | 3300013100 | Bacteria | 1405 |
| 280 | Ga0157370_10031456 | 3300013104 | Bacteria | 5190 |
| 281 | Ga0157370_10042692 | 3300013104 | Bacteria | 4368 |
| 282 | Ga0157370_10044790 | 3300013104 | Bacteria | 4249 |
| 283 | Ga0157370_10052706 | 3300013104 | Bacteria | 3883 |
| 284 | Ga0157370_10145851 | 3300013104 | Bacteria | 2204 |
| 285 | Ga0157370_10261974 | 3300013104 | Bacteria | 1598 |
| 286 | Ga0157369_10002166 | 3300013105 | Bacteria | 23672 |
| 287 | Ga0157369_10005648 | 3300013105 | Bacteria | 14534 |
| 288 | Ga0157369_10007096 | 3300013105 | Bacteria | 12920 |
| 289 | Ga0157369_10030268 | 3300013105 | Bacteria | 5972 |
| 290 | Ga0157369_10070311 | 3300013105 | Bacteria | 3761 |
| 291 | Ga0157369_10162046 | 3300013105 | Bacteria | 2361 |
| 292 | Ga0157369_10175111 | 3300013105 | Bacteria | 2259 |
| 293 | Ga0157369_10188014 | 3300013105 | Bacteria | 2171 |
| 294 | Ga0157369_10320631 | 3300013105 | Bacteria | 1611 |
| 295 | Ga0157374_10021783 | 3300013296 | Bacteria | 5708 |
| 296 | Ga0157374_10077349 | 3300013296 | Bacteria | 3149 |
| 297 | Ga0157374_10102677 | 3300013296 | Bacteria | 2743 |
| 298 | Ga0157374_10377676 | 3300013296 | Bacteria | 1411 |
| 299 | Ga0157378_10005680 | 3300013297 | Bacteria | 10916 |
| 300 | Ga0157378_10209805 | 3300013297 | Bacteria | 1846 |
| 301 | Ga0163162_10013965 | 3300013306 | Bacteria | 7849 |
| 302 | Ga0163162_10080684 | 3300013306 | Bacteria | 3322 |
| 303 | Ga0157372_10005776 | 3300013307 | Bacteria | 13182 |
| 304 | Ga0157372_10426644 | 3300013307 | Bacteria | 1545 |
| 305 | Ga0157375_10047986 | 3300013308 | Bacteria | 4174 |
| 306 | Ga0163163_10010439 | 3300014325 | Bacteria | 8355 |
| 307 | Ga0157380_10003284 | 3300014326 | Bacteria | 11084 |
| 308 | Ga0157380_10505591 | 3300014326 | Bacteria | 1175 |
| 309 | Ga0182008_10003056 | 3300014497 | Bacteria | 10276 |
| 310 | Ga0157377_10016525 | 3300014745 | Bacteria | 3797 |
| 311 | Ga0157379_10007742 | 3300014968 | Bacteria | 9304 |
| 312 | Ga0157379_10011001 | 3300014968 | Bacteria | 7890 |
| 313 | Ga0157379_10062950 | 3300014968 | Bacteria | 3317 |
| 314 | Ga0157376_10081159 | 3300014969 | Bacteria | 2784 |
| 315 | Ga0157376_10398389 | 3300014969 | Bacteria | 1330 |
| 316 | Ga0197907_10066705 | 3300020069 | Bacteria | 4788 |
| 317 | Ga0197907_10406384 | 3300020069 | Bacteria | 3282 |
| 318 | Ga0197907_10589986 | 3300020069 | Bacteria | 3146 |
| 319 | Ga0197907_10762704 | 3300020069 | Bacteria | 2661 |
| 320 | Ga0206356_10072031 | 3300020070 | Bacteria | 4819 |
| 321 | Ga0206356_10246559 | 3300020070 | Bacteria | 1259 |
| 322 | Ga0206356_10770587 | 3300020070 | Bacteria | 1734 |
| 323 | Ga0206356_11853397 | 3300020070 | Bacteria | 2730 |
| 324 | Ga0206349_1962268 | 3300020075 | Bacteria | 1221 |
| 325 | Ga0206352_11055655 | 3300020078 | Bacteria | 1169 |
| 326 | Ga0206350_11051890 | 3300020080 | Bacteria | 1244 |
| 327 | Ga0206350_11490151 | 3300020080 | Bacteria | 1283 |
| 328 | Ga0206354_10052620 | 3300020081 | Bacteria | 1653 |
| 329 | Ga0206354_10075868 | 3300020081 | Bacteria | 1831 |
| 330 | Ga0206354_10378407 | 3300020081 | Bacteria | 3217 |
| 331 | Ga0206354_10823254 | 3300020081 | Bacteria | 2474 |
| 332 | Ga0206354_10928650 | 3300020081 | Bacteria | 3337 |
| 333 | Ga0206353_10050633 | 3300020082 | Bacteria | 2024 |
| 334 | Ga0206353_10328476 | 3300020082 | Bacteria | 5830 |
| 335 | Ga0206353_10337916 | 3300020082 | Bacteria | 4762 |
| 336 | Ga0206353_10902253 | 3300020082 | Bacteria | 1805 |
| 337 | Ga0206353_11349432 | 3300020082 | Bacteria | 4280 |
| 338 | Ga0206353_11456732 | 3300020082 | Bacteria | 1527 |
| 339 | Ga0154015_1653186 | 3300020610 | Bacteria | 1350 |
| 340 | Ga0213876_10008372 | 3300021384 | Bacteria | 5597 |
| 341 | Ga0224712_10036199 | 3300022467 | Bacteria | 1827 |
| 342 | Ga0224712_10057349 | 3300022467 | Bacteria | 1539 |
| 343 | Ga0224712_10060366 | 3300022467 | Bacteria | 1509 |
| 344 | Ga0224712_10060459 | 3300022467 | Bacteria | 1508 |
| 345 | Ga0224712_10068235 | 3300022467 | Bacteria | 1437 |
| 346 | Ga0224712_10091385 | 3300022467 | Bacteria | 1275 |
| 347 | Ga0207692_10009309 | 3300025898 | Bacteria | 4096 |
| 348 | Ga0207692_10061903 | 3300025898 | Bacteria | 1941 |
| 349 | Ga0207642_10004636 | 3300025899 | Bacteria | 4441 |
| 350 | Ga0207710_10035176 | 3300025900 | Bacteria | 2204 |
| 351 | Ga0207688_10001633 | 3300025901 | Bacteria | 11834 |
| 352 | Ga0207688_10048617 | 3300025901 | Bacteria | 2370 |
| 353 | Ga0207699_10025004 | 3300025906 | Bacteria | 3273 |
| 354 | Ga0207699_10029643 | 3300025906 | Bacteria | 3053 |
| 355 | Ga0207699_10083633 | 3300025906 | Bacteria | 1986 |
| 356 | Ga0207705_10064990 | 3300025909 | Bacteria | 2637 |
| 357 | Ga0207705_10096065 | 3300025909 | Bacteria | 2175 |
| 358 | Ga0207684_10029946 | 3300025910 | Bacteria | 4634 |
| 359 | Ga0207684_10131952 | 3300025910 | Bacteria | 2144 |
| 360 | Ga0207684_10197302 | 3300025910 | Bacteria | 1736 |
| 361 | Ga0207654_10161075 | 3300025911 | Bacteria | 1450 |
| 362 | Ga0207707_10001918 | 3300025912 | Bacteria | 18906 |
| 363 | Ga0207707_10014107 | 3300025912 | Bacteria | 6963 |
| 364 | Ga0207707_10068293 | 3300025912 | Bacteria | 3097 |
| 365 | Ga0207707_10070389 | 3300025912 | Bacteria | 3048 |
| 366 | Ga0207707_10158121 | 3300025912 | Bacteria | 1981 |
| 367 | Ga0207707_10167554 | 3300025912 | Bacteria | 1920 |
| 368 | Ga0207695_10071373 | 3300025913 | Bacteria | 3547 |
| 369 | Ga0207695_10075586 | 3300025913 | Bacteria | 3427 |
| 370 | Ga0207695_10141155 | 3300025913 | Bacteria | 2357 |
| 371 | Ga0207695_10194970 | 3300025913 | Bacteria | 1942 |
| 372 | Ga0207693_10004473 | 3300025915 | Bacteria | 11820 |
| 373 | Ga0207693_10008397 | 3300025915 | Bacteria | 8449 |
| 374 | Ga0207693_10016529 | 3300025915 | Bacteria | 5896 |
| 375 | Ga0207693_10024908 | 3300025915 | Bacteria | 4746 |
| 376 | Ga0207663_10003098 | 3300025916 | Bacteria | 8067 |
| 377 | Ga0207663_10009226 | 3300025916 | Bacteria | 5204 |
| 378 | Ga0207663_10013008 | 3300025916 | Bacteria | 4512 |
| 379 | Ga0207663_10020518 | 3300025916 | Bacteria | 3743 |
| 380 | Ga0207660_10019997 | 3300025917 | Bacteria | 4486 |
| 381 | Ga0207660_10041731 | 3300025917 | Bacteria | 3216 |
| 382 | Ga0207662_10017739 | 3300025918 | Bacteria | 4030 |
| 383 | Ga0207657_10000500 | 3300025919 | Bacteria | 41333 |
| 384 | Ga0207657_10001046 | 3300025919 | Bacteria | 29314 |
| 385 | Ga0207657_10001931 | 3300025919 | Bacteria | 22381 |
| 386 | Ga0207657_10014505 | 3300025919 | Bacteria | 7685 |
| 387 | Ga0207657_10019153 | 3300025919 | Bacteria | 6508 |
| 388 | Ga0207657_10022973 | 3300025919 | Bacteria | 5818 |
| 389 | Ga0207657_10056995 | 3300025919 | Bacteria | 3370 |
| 390 | Ga0207657_10069854 | 3300025919 | Bacteria | 2978 |
| 391 | Ga0207649_10011519 | 3300025920 | Bacteria | 4878 |
| 392 | Ga0207649_10024948 | 3300025920 | Bacteria | 3480 |
| 393 | Ga0207652_10005399 | 3300025921 | Bacteria | 10370 |
| 394 | Ga0207652_10151714 | 3300025921 | Bacteria | 2075 |
| 395 | Ga0207646_10036601 | 3300025922 | Bacteria | 4429 |
| 396 | Ga0207646_10080638 | 3300025922 | Bacteria | 2910 |
| 397 | Ga0207694_10112758 | 3300025924 | Bacteria | 2164 |
| 398 | Ga0207687_10031842 | 3300025927 | Bacteria | 3568 |
| 399 | Ga0207687_10048253 | 3300025927 | Bacteria | 2955 |
| 400 | Ga0207687_10096767 | 3300025927 | Bacteria | 2164 |
| 401 | Ga0207687_10106529 | 3300025927 | Bacteria | 2073 |
| 402 | Ga0207700_10005417 | 3300025928 | Bacteria | 7631 |
| 403 | Ga0207700_10017243 | 3300025928 | Bacteria | 4819 |
| 404 | Ga0207700_10034302 | 3300025928 | Bacteria | 3642 |
| 405 | Ga0207700_10067327 | 3300025928 | Bacteria | 2741 |
| 406 | Ga0207700_10233285 | 3300025928 | Bacteria | 1565 |
| 407 | Ga0207664_10010163 | 3300025929 | Bacteria | 6642 |
| 408 | Ga0207664_10026028 | 3300025929 | Bacteria | 4416 |
| 409 | Ga0207664_10036943 | 3300025929 | Bacteria | 3777 |
| 410 | Ga0207664_10059801 | 3300025929 | Bacteria | 3036 |
| 411 | Ga0207664_10069742 | 3300025929 | Bacteria | 2827 |
| 412 | Ga0207664_10075061 | 3300025929 | Bacteria | 2733 |
| 413 | Ga0207664_10075416 | 3300025929 | Bacteria | 2727 |
| 414 | Ga0207664_10086846 | 3300025929 | Bacteria | 2556 |
| 415 | Ga0207664_10170476 | 3300025929 | Bacteria | 1862 |
| 416 | Ga0207664_10231227 | 3300025929 | Bacteria | 1607 |
| 417 | Ga0207644_10328402 | 3300025931 | Bacteria | 1238 |
| 418 | Ga0207690_10025161 | 3300025932 | Bacteria | 3733 |
| 419 | Ga0207690_10246022 | 3300025932 | Bacteria | 1379 |
| 420 | Ga0207706_10010685 | 3300025933 | Bacteria | 8386 |
| 421 | Ga0207706_10010784 | 3300025933 | Bacteria | 8342 |
| 422 | Ga0207686_10030588 | 3300025934 | Bacteria | 3189 |
| 423 | Ga0207686_10063426 | 3300025934 | Bacteria | 2350 |
| 424 | Ga0207686_10089203 | 3300025934 | Bacteria | 2032 |
| 425 | Ga0207686_10117078 | 3300025934 | Bacteria | 1807 |
| 426 | Ga0207686_10147019 | 3300025934 | Bacteria | 1636 |
| 427 | Ga0207709_10031676 | 3300025935 | Bacteria | 3091 |
| 428 | Ga0207709_10051738 | 3300025935 | Bacteria | 2519 |
| 429 | Ga0207709_10096258 | 3300025935 | Bacteria | 1947 |
| 430 | Ga0207669_10049721 | 3300025937 | Bacteria | 2501 |
| 431 | Ga0207669_10087587 | 3300025937 | Bacteria | 2017 |
| 432 | Ga0207704_10243875 | 3300025938 | Bacteria | 1344 |
| 433 | Ga0207665_10000322 | 3300025939 | Bacteria | 33292 |
| 434 | Ga0207665_10001706 | 3300025939 | Bacteria | 14770 |
| 435 | Ga0207691_10020470 | 3300025940 | Bacteria | 6254 |
| 436 | Ga0207691_10058732 | 3300025940 | Bacteria | 3498 |
| 437 | Ga0207711_10313235 | 3300025941 | Bacteria | 1449 |
| 438 | Ga0207661_10021882 | 3300025944 | Bacteria | 4800 |
| 439 | Ga0207661_10031932 | 3300025944 | Bacteria | 4074 |
| 440 | Ga0207661_10043389 | 3300025944 | Bacteria | 3549 |
| 441 | Ga0207661_10048769 | 3300025944 | Bacteria | 3367 |
| 442 | Ga0207661_10051930 | 3300025944 | Bacteria | 3273 |
| 443 | Ga0207661_10064740 | 3300025944 | Bacteria | 2965 |
| 444 | Ga0207661_10068729 | 3300025944 | Bacteria | 2886 |
| 445 | Ga0207661_10111791 | 3300025944 | Bacteria | 2311 |
| 446 | Ga0207661_10160152 | 3300025944 | Bacteria | 1952 |
| 447 | Ga0207661_10184040 | 3300025944 | Bacteria | 1827 |
| 448 | Ga0207679_10178806 | 3300025945 | Bacteria | 1753 |
| 449 | Ga0207667_10047297 | 3300025949 | Bacteria | 4554 |
| 450 | Ga0207667_10066238 | 3300025949 | Bacteria | 3765 |
| 451 | Ga0207667_10310229 | 3300025949 | Bacteria | 1611 |
| 452 | Ga0207712_10058174 | 3300025961 | Bacteria | 2731 |
| 453 | Ga0207712_10096319 | 3300025961 | Bacteria | 2190 |
| 454 | Ga0207668_10059614 | 3300025972 | Bacteria | 2675 |
| 455 | Ga0207640_10046445 | 3300025981 | Bacteria | 2794 |
| 456 | Ga0207640_10087061 | 3300025981 | Bacteria | 2152 |
| 457 | Ga0207658_10012227 | 3300025986 | Bacteria | 5859 |
| 458 | Ga0207658_10185529 | 3300025986 | Bacteria | 1725 |
| 459 | Ga0207677_10034516 | 3300026023 | Bacteria | 3276 |
| 460 | Ga0207677_10044953 | 3300026023 | Bacteria | 2947 |
| 461 | Ga0207677_10276846 | 3300026023 | Bacteria | 1375 |
| 462 | Ga0207639_10304653 | 3300026041 | Bacteria | 1409 |
| 463 | Ga0207639_10359622 | 3300026041 | Bacteria | 1302 |
| 464 | Ga0207702_10124768 | 3300026078 | Bacteria | 2309 |
| 465 | Ga0207702_10137771 | 3300026078 | Bacteria | 2204 |
| 466 | Ga0207702_10181145 | 3300026078 | Bacteria | 1940 |
| 467 | Ga0207702_10230346 | 3300026078 | Bacteria | 1731 |
| 468 | Ga0207641_10071166 | 3300026088 | Bacteria | 2991 |
| 469 | Ga0207648_10003355 | 3300026089 | Bacteria | 16835 |
| 470 | Ga0207648_10083321 | 3300026089 | Bacteria | 2789 |
| 471 | Ga0207648_10136115 | 3300026089 | Bacteria | 2164 |
| 472 | Ga0207648_10188205 | 3300026089 | Bacteria | 1829 |
| 473 | Ga0207676_10302980 | 3300026095 | Bacteria | 1460 |
| 474 | Ga0207674_10030547 | 3300026116 | Bacteria | 5663 |
| 475 | Ga0207674_10155408 | 3300026116 | Bacteria | 2243 |
| 476 | Ga0207675_100003338 | 3300026118 | Bacteria | 15706 |
| 477 | Ga0207675_100032560 | 3300026118 | Bacteria | 4856 |
| 478 | Ga0207675_100104995 | 3300026118 | Bacteria | 2662 |
| 479 | Ga0207675_100132972 | 3300026118 | Bacteria | 2359 |
| 480 | Ga0207683_10000907 | 3300026121 | Bacteria | 27236 |
| 481 | Ga0207683_10011436 | 3300026121 | Bacteria | 7574 |
| 482 | Ga0207698_10184467 | 3300026142 | Bacteria | 1852 |
| 483 | Ga0209998_10005198 | 3300027717 | Bacteria | 2732 |
| 484 | Ga0207428_10000934 | 3300027907 | Bacteria | 32465 |
| 485 | Ga0207428_10014460 | 3300027907 | Bacteria | 6857 |
| 486 | Ga0207428_10021196 | 3300027907 | Bacteria | 5504 |
| 487 | Ga0207428_10044392 | 3300027907 | Bacteria | 3586 |
| 488 | Ga0207428_10076046 | 3300027907 | Bacteria | 2630 |
| 489 | Ga0207428_10253317 | 3300027907 | Bacteria | 1312 |
| 490 | Ga0268266_10332648 | 3300028379 | Bacteria | 1424 |
| 491 | Ga0268264_10375064 | 3300028381 | Bacteria | 1361 |
| 492 | Ga0265319_1022969 | 3300028563 | Bacteria | 2265 |
| 493 | Ga0265334_10002668 | 3300028573 | Bacteria | 8254 |
| 494 | Ga0265318_10000541 | 3300028577 | Bacteria | 26937 |
| 495 | Ga0265336_10002072 | 3300028666 | Bacteria | 8529 |
| 496 | Ga0265336_10013520 | 3300028666 | Bacteria | 2720 |
| 497 | Ga0265338_10006253 | 3300028800 | Bacteria | 15239 |
| 498 | Ga0265338_10071584 | 3300028800 | Bacteria | 2965 |
| 499 | Ga0265338_10114613 | 3300028800 | Bacteria | 2162 |
| 500 | Ga0265338_10141275 | 3300028800 | Bacteria | 1885 |
| 501 | Ga0265330_10041490 | 3300031235 | Bacteria | 2041 |
| 502 | Ga0265330_10052226 | 3300031235 | Bacteria | 1790 |
| 503 | Ga0265325_10000949 | 3300031241 | Bacteria | 20963 |
| 504 | Ga0265325_10006154 | 3300031241 | Bacteria | 7323 |
| 505 | Ga0265329_10009253 | 3300031242 | Bacteria | 3687 |
| 506 | Ga0265340_10004475 | 3300031247 | Bacteria | 7804 |
| 507 | Ga0265340_10042262 | 3300031247 | Bacteria | 2238 |
| 508 | Ga0265340_10070651 | 3300031247 | Bacteria | 1656 |
| 509 | Ga0265339_10035428 | 3300031249 | Bacteria | 2800 |
| 510 | Ga0265339_10064018 | 3300031249 | Bacteria | 1973 |
| 511 | Ga0265327_10003872 | 3300031251 | Bacteria | 13792 |
| 512 | Ga0265327_10004853 | 3300031251 | Bacteria | 11647 |
| 513 | Ga0265327_10009219 | 3300031251 | Bacteria | 7157 |
| 514 | Ga0265327_10081428 | 3300031251 | Bacteria | 1598 |
| 515 | Ga0265316_10053194 | 3300031344 | Bacteria | 3174 |
| 516 | Ga0265313_10001261 | 3300031595 | Bacteria | 24080 |
| 517 | Ga0265313_10005640 | 3300031595 | Bacteria | 9148 |
| 518 | Ga0265314_10004635 | 3300031711 | Bacteria | 12648 |
| 519 | Ga0265314_10176459 | 3300031711 | Bacteria | 1284 |
| 520 | Ga0316576_10011101 | 3300031727 | Bacteria | 5884 |
| 521 | Ga0316576_10070493 | 3300031727 | Bacteria | 2578 |
| 522 | Ga0316576_10109392 | 3300031727 | Bacteria | 2071 |
| 523 | Ga0316578_10000145 | 3300031728 | Bacteria | 18460 |
| 524 | Ga0307405_10036764 | 3300031731 | Bacteria | 2937 |
| 525 | Ga0307416_100031422 | 3300032002 | Bacteria | 3997 |
| 526 | Ga0307416_100165558 | 3300032002 | Bacteria | 2050 |
| 527 | Ga0307416_100325252 | 3300032002 | Bacteria | 1542 |
| 528 | Ga0307414_10370958 | 3300032004 | Bacteria | 1234 |
| 529 | Ga0307415_100073578 | 3300032126 | Bacteria | 2411 |
| 530 | Ga0316580_10003428 | 3300032139 | Bacteria | 4500 |
| 531 | Ga0373948_0009547 | 3300034817 | Unclassified | 1675 |
| 532 | Ga0373958_0010740 | 3300034819 | Bacteria | 1533 |
| 533 | Ga0373928_0009411 | 3300035084 | Bacteria | 1908 |
| 534 | Ga0373934_0080067 | 3300035086 | Bacteria | 1312 |
| 535 | Ga0373944_0005847 | 3300035089 | Bacteria | 3255 |
| 536 | Ga0373944_0008755 | 3300035089 | Bacteria | 2735 |
| 537 | Ga0373941_0039088 | 3300035115 | Bacteria | 1456 |
| 538 | Ga0373943_0001492 | 3300035170 | Bacteria | 10602 |
| 539 | Ga0373943_0011200 | 3300035170 | Bacteria | 4033 |
| 540 | Ga0373931_0047821 | 3300035691 | Bacteria | 2265 |
| 541 | Ga0373931_0064446 | 3300035691 | Bacteria | 1983 |
| 542 | Ga0373935_0023337 | 3300035692 | Bacteria | 3801 |
| 543 | Ga0373935_0167083 | 3300035692 | Bacteria | 1503 |
| 544 | Ga0373933_0120765 | 3300035724 | Bacteria | 1641 |
| 545 | Ga0373933_0131302 | 3300035724 | Bacteria | 1575 |
| 546 | Ga0373947_0001675 | 3300035725 | Bacteria | 13561 |
| 547 | Ga0373947_0004617 | 3300035725 | Bacteria | 8076 |
| 548 | Ga0373947_0023617 | 3300035725 | Bacteria | 3579 |
| 549 | Ga0373937_0020040 | 3300036401 | Bacteria | 5991 |
| 550 | Ga0316582_0026980 | 3300036647 | Bacteria | 3464 |
| 551 | Ga0316584_0000210 | 3300036712 | Bacteria | 28809 |
| 552 | Ga0373925_0002352 | 3300037068 | Bacteria | 15188 |
| 553 | Ga0395899_0002892 | 3300037312 | Bacteria | 13793 |
| 554 | Ga0395899_0004853 | 3300037312 | Bacteria | 10477 |
| 555 | Ga0395899_0006387 | 3300037312 | Bacteria | 9130 |
| 556 | Ga0395899_0012260 | 3300037312 | Bacteria | 6565 |
| 557 | Ga0395899_0051640 | 3300037312 | Bacteria | 3050 |
| 558 | Ga0395899_0067382 | 3300037312 | Bacteria | 2626 |
| 559 | Ga0395900_0003129 | 3300037418 | Bacteria | 17953 |
| 560 | Ga0395900_0006147 | 3300037418 | Bacteria | 12532 |
| 561 | Ga0395900_0010590 | 3300037418 | Bacteria | 9429 |
| 562 | Ga0395900_0015326 | 3300037418 | Bacteria | 7814 |
| 563 | Ga0395900_0032766 | 3300037418 | Bacteria | 5344 |
| 564 | Ga0395900_0051474 | 3300037418 | Bacteria | 4242 |
| 565 | Ga0395900_0057081 | 3300037418 | Bacteria | 4019 |
| 566 | Ga0395900_0059150 | 3300037418 | Bacteria | 3945 |
| 567 | Ga0395900_0060264 | 3300037418 | Bacteria | 3906 |
| 568 | Ga0395900_0073144 | 3300037418 | Bacteria | 3524 |
| 569 | Ga0395900_0106957 | 3300037418 | Bacteria | 2874 |
| 570 | Ga0395900_0247194 | 3300037418 | Bacteria | 1786 |
| 571 | Ga0395900_0285013 | 3300037418 | Bacteria | 1642 |
| 572 | Ga0395898_0001406 | 3300037466 | Bacteria | 34311 |
| 573 | Ga0395898_0002816 | 3300037466 | Bacteria | 19946 |
| 574 | Ga0395898_0006113 | 3300037466 | Bacteria | 12907 |
| 575 | Ga0395898_0014630 | 3300037466 | Bacteria | 8057 |
| 576 | Ga0395898_0021048 | 3300037466 | Bacteria | 6617 |
| 577 | Ga0395898_0027384 | 3300037466 | Bacteria | 5723 |
| 578 | Ga0395898_0028358 | 3300037466 | Bacteria | 5611 |
| 579 | Ga0395898_0032012 | 3300037466 | Bacteria | 5249 |
| 580 | Ga0395898_0051521 | 3300037466 | Bacteria | 4025 |
| 581 | Ga0395898_0059980 | 3300037466 | Bacteria | 3699 |
| 582 | Ga0395898_0092008 | 3300037466 | Bacteria | 2917 |
| 583 | Ga0395898_0105290 | 3300037466 | Bacteria | 2705 |
| 584 | Ga0395898_0117019 | 3300037466 | Bacteria | 2554 |
| 585 | Ga0395898_0267610 | 3300037466 | Bacteria | 1630 |
| 586 | Ga0395898_0427411 | 3300037466 | Bacteria | 1262 |
| 587 | Ga0395905_0000786 | 3300037471 | Bacteria | 41747 |
| 588 | Ga0395905_0012807 | 3300037471 | Bacteria | 8064 |
| 589 | Ga0395905_0016305 | 3300037471 | Bacteria | 7060 |
| 590 | Ga0395905_0032268 | 3300037471 | Bacteria | 4925 |
| 591 | Ga0395905_0072168 | 3300037471 | Bacteria | 3237 |
| 592 | Ga0395905_0076779 | 3300037471 | Bacteria | 3130 |
| 593 | Ga0395905_0084025 | 3300037471 | Bacteria | 2982 |
| 594 | Ga0395905_0115141 | 3300037471 | Bacteria | 2526 |
| 595 | Ga0395905_0157922 | 3300037471 | Bacteria | 2132 |
| 596 | Ga0395905_0257888 | 3300037471 | Bacteria | 1628 |
| 597 | Ga0395905_0336185 | 3300037471 | Bacteria | 1401 |
| 598 | Ga0395901_0003238 | 3300038443 | Bacteria | 16375 |
| 599 | Ga0395901_0003793 | 3300038443 | Bacteria | 15221 |
| 600 | Ga0395901_0007737 | 3300038443 | Bacteria | 10840 |
| 601 | Ga0395901_0007808 | 3300038443 | Bacteria | 10795 |
| 602 | Ga0395901_0019406 | 3300038443 | Bacteria | 6951 |
| 603 | Ga0395901_0019981 | 3300038443 | Bacteria | 6852 |
| 604 | Ga0395901_0024522 | 3300038443 | Bacteria | 6192 |
| 605 | Ga0395901_0027511 | 3300038443 | Bacteria | 5843 |
| 606 | Ga0395901_0028742 | 3300038443 | Bacteria | 5720 |
| 607 | Ga0395901_0044951 | 3300038443 | Bacteria | 4582 |
| 608 | Ga0395901_0052533 | 3300038443 | Bacteria | 4235 |
| 609 | Ga0395901_0053752 | 3300038443 | Bacteria | 4185 |
| 610 | Ga0395901_0101385 | 3300038443 | Bacteria | 3021 |
| 611 | Ga0395901_0143034 | 3300038443 | Bacteria | 2514 |
| 612 | Ga0395901_0160781 | 3300038443 | Bacteria | 2359 |
| 613 | Ga0395901_0163814 | 3300038443 | Bacteria | 2335 |
| 614 | Ga0395901_0171832 | 3300038443 | Bacteria | 2274 |
| 615 | Ga0395901_0259934 | 3300038443 | Bacteria | 1807 |
| 616 | Ga0395901_0404868 | 3300038443 | Bacteria | 1401 |
| 617 | Ga0395901_0430990 | 3300038443 | Bacteria | 1351 |
| 618 | Ga0395901_0589880 | 3300038443 | Bacteria | 1122 |
| 619 | Ga0436365_1041009 | 3300039437 | Bacteria | 1713 |
| 620 | Ga0436365_1159630 | 3300039437 | Bacteria | 2699 |
| 621 | Ga0436365_1203947 | 3300039437 | Bacteria | 1586 |
| 622 | Ga0436365_1437009 | 3300039437 | Bacteria | 13547 |
| 623 | Ga0436365_1674627 | 3300039437 | Bacteria | 2828 |
| 624 | Ga0436360_0070085 | 3300039438 | Bacteria | 4621 |
| 625 | Ga0436363_1684106 | 3300039450 | Bacteria | 2425 |
| 626 | Ga0439453_0012174 | 3300041408 | Bacteria | 1445 |
| 627 | Ga0439461_0008158 | 3300041410 | Bacteria | 1871 |
| 628 | Ga0451853_1423526 | 3300041512 | Bacteria | 1316 |
| 629 | Ga0439433_0001766 | 3300041999 | Bacteria | 4487 |
| 630 | Ga0439442_018737 | 3300042002 | Bacteria | 1431 |
| 631 | Ga0439448_0044030 | 3300042005 | Bacteria | 1450 |
| 632 | Ga0439462_0017785 | 3300042015 | Bacteria | 1842 |
| 633 | Ga0439446_0004319 | 3300042156 | Bacteria | 3598 |
| 634 | Ga0451577_0037639 | 3300042876 | Bacteria | 4354 |
| 635 | Ga0466969_0002202 | 3300044656 | Bacteria | 10416 |
| 636 | Ga0453683_0011143 | 3300044673 | Bacteria | 5943 |
| 637 | Ga0453683_0012532 | 3300044673 | Bacteria | 5555 |
| 638 | Ga0466965_0015015 | 3300044683 | Bacteria | 3674 |
| 639 | Ga0466966_0018779 | 3300044684 | Bacteria | 4555 |
| 640 | Ga0466961_0007507 | 3300044693 | Bacteria | 6936 |
| 641 | Ga0466961_0028228 | 3300044693 | Bacteria | 3608 |
| 642 | Ga0466961_0029817 | 3300044693 | Bacteria | 3505 |
| 643 | Ga0466961_0042190 | 3300044693 | Bacteria | 2924 |
| 644 | Ga0466961_0052448 | 3300044693 | Bacteria | 2603 |
| 645 | Ga0466961_0183711 | 3300044693 | Bacteria | 1298 |
| 646 | Ga0466963_0000430 | 3300044694 | Bacteria | 19359 |
| 647 | Ga0466963_0001559 | 3300044694 | Bacteria | 12424 |
| 648 | Ga0466963_0003053 | 3300044694 | Bacteria | 9480 |
| 649 | Ga0466963_0006703 | 3300044694 | Bacteria | 6838 |
| 650 | Ga0466963_0007066 | 3300044694 | Bacteria | 6685 |
| 651 | Ga0466963_0008450 | 3300044694 | Bacteria | 6170 |
| 652 | Ga0466963_0008744 | 3300044694 | Bacteria | 6080 |
| 653 | Ga0466963_0010043 | 3300044694 | Bacteria | 5723 |
| 654 | Ga0466963_0010163 | 3300044694 | Bacteria | 5690 |
| 655 | Ga0466963_0011078 | 3300044694 | Bacteria | 5483 |
| 656 | Ga0466963_0016280 | 3300044694 | Bacteria | 4621 |
| 657 | Ga0466963_0017063 | 3300044694 | Bacteria | 4522 |
| 658 | Ga0466963_0017321 | 3300044694 | Bacteria | 4490 |
| 659 | Ga0466963_0018744 | 3300044694 | Bacteria | 4331 |
| 660 | Ga0466963_0037144 | 3300044694 | Bacteria | 3179 |
| 661 | Ga0466963_0039571 | 3300044694 | Bacteria | 3088 |
| 662 | Ga0466963_0052899 | 3300044694 | Bacteria | 2695 |
| 663 | Ga0466963_0078307 | 3300044694 | Bacteria | 2234 |
| 664 | Ga0466963_0083433 | 3300044694 | Bacteria | 2167 |
| 665 | Ga0466963_0140249 | 3300044694 | Bacteria | 1674 |
| 666 | Ga0466964_0001644 | 3300044706 | Bacteria | 7724 |
| 667 | Ga0466964_0004155 | 3300044706 | Bacteria | 5324 |
| 668 | Ga0466964_0004602 | 3300044706 | Bacteria | 5101 |
| 669 | Ga0466964_0013552 | 3300044706 | Bacteria | 3093 |
| 670 | Ga0466964_0020056 | 3300044706 | Bacteria | 2573 |
| 671 | Ga0466964_0027950 | 3300044706 | Bacteria | 2218 |
| 672 | Ga0466964_0097470 | 3300044706 | Bacteria | 1290 |
| 673 | Ga0453684_0128288 | 3300044712 | Bacteria | 3048 |
| 674 | Ga0466971_0000571 | 3300044719 | Bacteria | 14575 |
| 675 | Ga0466971_0003068 | 3300044719 | Bacteria | 7102 |
| 676 | Ga0466968_0001242 | 3300044735 | Bacteria | 9053 |
| 677 | Ga0466968_0001271 | 3300044735 | Bacteria | 8983 |
| 678 | Ga0466968_0005848 | 3300044735 | Bacteria | 4618 |
| 679 | Ga0466968_0014588 | 3300044735 | Bacteria | 3106 |
| 680 | Ga0466968_0016358 | 3300044735 | Bacteria | 2952 |
| 681 | Ga0466970_0005446 | 3300044765 | Bacteria | 6315 |
| 682 | Ga0466970_0056479 | 3300044765 | Bacteria | 2098 |
| 683 | Ga0466957_0005254 | 3300044842 | Bacteria | 7251 |
| 684 | Ga0466957_0008394 | 3300044842 | Bacteria | 5873 |
| 685 | Ga0466957_0010147 | 3300044842 | Bacteria | 5390 |
| 686 | Ga0466957_0010946 | 3300044842 | Bacteria | 5216 |
| 687 | Ga0466957_0015241 | 3300044842 | Bacteria | 4489 |
| 688 | Ga0466957_0020548 | 3300044842 | Bacteria | 3886 |
| 689 | Ga0466957_0024346 | 3300044842 | Bacteria | 3582 |
| 690 | Ga0466957_0027194 | 3300044842 | Bacteria | 3398 |
| 691 | Ga0466957_0050273 | 3300044842 | Bacteria | 2536 |
| 692 | Ga0466957_0142476 | 3300044842 | Bacteria | 1545 |
| 693 | Ga0466960_0007597 | 3300044901 | Bacteria | 4413 |
| 694 | Ga0466960_0009601 | 3300044901 | Bacteria | 3994 |
| 695 | Ga0466959_0000479 | 3300045049 | Bacteria | 23287 |
| 696 | Ga0466959_0034099 | 3300045049 | Bacteria | 3766 |
| 697 | Ga0466959_0044815 | 3300045049 | Bacteria | 3258 |
| 698 | Ga0466959_0056480 | 3300045049 | Bacteria | 2864 |
| 699 | Ga0466959_0065876 | 3300045049 | Bacteria | 2628 |
| 700 | Ga0466959_0148052 | 3300045049 | Bacteria | 1656 |
| 701 | Ga0466959_0153122 | 3300045049 | Bacteria | 1624 |
| 702 | Ga0451576_0252855 | 3300045051 | Bacteria | 1842 |
| 703 | Ga0451576_0266539 | 3300045051 | Bacteria | 1790 |
| 704 | Ga0466958_0001620 | 3300045836 | Bacteria | 10837 |
| 705 | Ga0466958_0002869 | 3300045836 | Bacteria | 8782 |
| 706 | Ga0466958_0008231 | 3300045836 | Bacteria | 5775 |
| 707 | Ga0466958_0008855 | 3300045836 | Bacteria | 5591 |
| 708 | Ga0466958_0012290 | 3300045836 | Bacteria | 4848 |
| 709 | Ga0466958_0020188 | 3300045836 | Bacteria | 3884 |
| 710 | Ga0466958_0025054 | 3300045836 | Bacteria | 3514 |
| 711 | Ga0466958_0038479 | 3300045836 | Bacteria | 2870 |
| 712 | Ga0466958_0048445 | 3300045836 | Bacteria | 2568 |
| 713 | Ga0466958_0060024 | 3300045836 | Bacteria | 2314 |
| 714 | Ga0466958_0114145 | 3300045836 | Bacteria | 1687 |
| 715 | Ga0466958_0116083 | 3300045836 | Bacteria | 1673 |
| 716 | Ga0466958_0251484 | 3300045836 | Bacteria | 1130 |
| 717 | Ga0466967_0002221 | 3300045976 | Bacteria | 11944 |
| 718 | Ga0466967_0002496 | 3300045976 | Bacteria | 11486 |
| 719 | Ga0466967_0006144 | 3300045976 | Bacteria | 8454 |
| 720 | Ga0466967_0006258 | 3300045976 | Bacteria | 8394 |
| 721 | Ga0466967_0008012 | 3300045976 | Bacteria | 7697 |
| 722 | Ga0466967_0010163 | 3300045976 | Bacteria | 7039 |
| 723 | Ga0466967_0013224 | 3300045976 | Bacteria | 6364 |
| 724 | Ga0466967_0015777 | 3300045976 | Bacteria | 5934 |
| 725 | Ga0466967_0025288 | 3300045976 | Bacteria | 4894 |
| 726 | Ga0466967_0028405 | 3300045976 | Bacteria | 4669 |
| 727 | Ga0466967_0030656 | 3300045976 | Bacteria | 4516 |
| 728 | Ga0466967_0036182 | 3300045976 | Bacteria | 4212 |
| 729 | Ga0466967_0041940 | 3300045976 | Bacteria | 3950 |
| 730 | Ga0466967_0043843 | 3300045976 | Bacteria | 3876 |
| 731 | Ga0466967_0045632 | 3300045976 | Bacteria | 3808 |
| 732 | Ga0466967_0049750 | 3300045976 | Bacteria | 3667 |
| 733 | Ga0466967_0049997 | 3300045976 | Bacteria | 3659 |
| 734 | Ga0466967_0053383 | 3300045976 | Bacteria | 3551 |
| 735 | Ga0466967_0057898 | 3300045976 | Bacteria | 3423 |
| 736 | Ga0466967_0058407 | 3300045976 | Bacteria | 3410 |
| 737 | Ga0466967_0073861 | 3300045976 | Bacteria | 3060 |
| 738 | Ga0466967_0085779 | 3300045976 | Bacteria | 2851 |
| 739 | Ga0466967_0105828 | 3300045976 | Bacteria | 2577 |
| 740 | Ga0466967_0116544 | 3300045976 | Bacteria | 2461 |
| 741 | Ga0466967_0122778 | 3300045976 | Bacteria | 2402 |
| 742 | Ga0466967_0146681 | 3300045976 | Bacteria | 2201 |
| 743 | Ga0466967_0150267 | 3300045976 | Bacteria | 2176 |
| 744 | Ga0466967_0170935 | 3300045976 | Bacteria | 2045 |
| 745 | Ga0466967_0173080 | 3300045976 | Bacteria | 2032 |
| 746 | Ga0466967_0183041 | 3300045976 | Bacteria | 1977 |
| 747 | Ga0466967_0184918 | 3300045976 | Bacteria | 1967 |
| 748 | Ga0466967_0199870 | 3300045976 | Bacteria | 1892 |
| 749 | Ga0466967_0201895 | 3300045976 | Bacteria | 1883 |
| 750 | Ga0466967_0261006 | 3300045976 | Bacteria | 1657 |
| 751 | Ga0466967_0379309 | 3300045976 | Bacteria | 1372 |
| 752 | Ga0466967_0596433 | 3300045976 | Bacteria | 1090 |
| 753 | Ga0466967_0789713 | 3300045976 | Bacteria | 942 |
| 754 | Ga0495592_0000125 | 3300046454 | Bacteria | 68045 |
| 755 | Ga0495592_0020342 | 3300046454 | Bacteria | 5048 |
| 756 | Ga0495592_0041170 | 3300046454 | Bacteria | 3462 |
| 757 | Ga0495592_0171125 | 3300046454 | Bacteria | 1487 |
| 758 | Ga0495592_0204192 | 3300046454 | Bacteria | 1332 |
| 759 | Ga0495603_0002588 | 3300046455 | Bacteria | 10676 |
| 760 | Ga0495603_0003187 | 3300046455 | Bacteria | 9759 |
| 761 | Ga0495603_0060076 | 3300046455 | Bacteria | 2246 |
| 762 | Ga0495603_0072196 | 3300046455 | Bacteria | 2028 |
| 763 | Ga0495603_0076174 | 3300046455 | Bacteria | 1969 |
| 764 | Ga0495603_0105830 | 3300046455 | Bacteria | 1642 |
| 765 | Ga0495629_0004786 | 3300046459 | Bacteria | 10148 |
| 766 | Ga0495629_0129220 | 3300046459 | Bacteria | 1760 |
| 767 | Ga0495629_0136817 | 3300046459 | Bacteria | 1705 |
| 768 | Ga0495629_0164767 | 3300046459 | Bacteria | 1539 |
| 769 | Ga0495629_0215737 | 3300046459 | Bacteria | 1324 |
| 770 | Ga0495629_0265684 | 3300046459 | Bacteria | 1179 |
| 771 | Ga0495641_0000455 | 3300046461 | Bacteria | 34086 |
| 772 | Ga0495641_0003498 | 3300046461 | Bacteria | 11713 |
| 773 | Ga0495651_0000104 | 3300046462 | Bacteria | 61716 |
| 774 | Ga0495651_0002454 | 3300046462 | Bacteria | 14323 |
| 775 | Ga0495651_0023417 | 3300046462 | Bacteria | 4801 |
| 776 | Ga0495651_0051543 | 3300046462 | Bacteria | 3172 |
| 777 | Ga0495653_0004604 | 3300046463 | Bacteria | 11155 |
| 778 | Ga0495653_0005005 | 3300046463 | Bacteria | 10755 |
| 779 | Ga0495653_0025029 | 3300046463 | Bacteria | 4802 |
| 780 | Ga0495653_0086897 | 3300046463 | Bacteria | 2297 |
| 781 | Ga0495653_0192707 | 3300046463 | Bacteria | 1389 |
| 782 | Ga0495582_0008896 | 3300046473 | Bacteria | 5540 |
| 783 | Ga0495582_0009208 | 3300046473 | Bacteria | 5446 |
| 784 | Ga0495582_0035419 | 3300046473 | Bacteria | 2745 |
| 785 | Ga0495582_0139131 | 3300046473 | Bacteria | 1375 |
| 786 | Ga0495582_0169684 | 3300046473 | Bacteria | 1242 |
| 787 | Ga0495605_0018697 | 3300046474 | Bacteria | 3709 |
| 788 | Ga0495605_0106923 | 3300046474 | Bacteria | 1280 |
| 789 | Ga0495639_0000871 | 3300046475 | Bacteria | 13644 |
| 790 | Ga0495662_0018674 | 3300046476 | Bacteria | 3356 |
| 791 | Ga0495662_0103207 | 3300046476 | Bacteria | 1395 |
| 792 | Ga0495664_0025767 | 3300046477 | Bacteria | 3424 |
| 793 | Ga0495664_0126694 | 3300046477 | Bacteria | 1545 |
| 794 | Ga0495584_0036926 | 3300046491 | Bacteria | 2468 |
| 795 | Ga0495584_0038990 | 3300046491 | Bacteria | 2401 |
| 796 | Ga0495594_0000352 | 3300046499 | Bacteria | 23103 |
| 797 | Ga0495596_0059302 | 3300046500 | Bacteria | 1492 |
| 798 | Ga0495607_0043294 | 3300046501 | Bacteria | 2663 |
| 799 | Ga0495608_0000595 | 3300046511 | Bacteria | 24865 |
| 800 | Ga0495608_0013071 | 3300046511 | Bacteria | 5760 |
| 801 | Ga0495608_0017819 | 3300046511 | Bacteria | 4909 |
| 802 | Ga0495608_0025993 | 3300046511 | Bacteria | 3995 |
| 803 | Ga0495608_0084370 | 3300046511 | Bacteria | 2060 |
| 804 | Ga0495608_0094446 | 3300046511 | Bacteria | 1932 |
| 805 | Ga0495618_0006629 | 3300046514 | Bacteria | 7016 |
| 806 | Ga0495618_0013492 | 3300046514 | Bacteria | 4970 |
| 807 | Ga0495618_0050218 | 3300046514 | Bacteria | 2635 |
| 808 | Ga0495628_0000040 | 3300046516 | Bacteria | 104506 |
| 809 | Ga0495628_0008773 | 3300046516 | Bacteria | 8653 |
| 810 | Ga0495628_0008875 | 3300046516 | Bacteria | 8601 |
| 811 | Ga0495628_0040955 | 3300046516 | Bacteria | 3698 |
| 812 | Ga0495628_0219966 | 3300046516 | Bacteria | 1426 |
| 813 | Ga0495628_0262752 | 3300046516 | Bacteria | 1286 |
| 814 | Ga0495630_0003720 | 3300046517 | Bacteria | 10634 |
| 815 | Ga0495630_0017698 | 3300046517 | Bacteria | 5225 |
| 816 | Ga0495630_0019912 | 3300046517 | Bacteria | 4939 |
| 817 | Ga0495630_0027300 | 3300046517 | Bacteria | 4233 |
| 818 | Ga0495630_0045027 | 3300046517 | Bacteria | 3297 |
| 819 | Ga0495630_0080951 | 3300046517 | Bacteria | 2451 |
| 820 | Ga0495630_0089104 | 3300046517 | Bacteria | 2330 |
| 821 | Ga0495630_0116135 | 3300046517 | Bacteria | 2028 |
| 822 | Ga0495630_0123402 | 3300046517 | Bacteria | 1965 |
| 823 | Ga0495630_0159142 | 3300046517 | Bacteria | 1719 |
| 824 | Ga0495630_0189550 | 3300046517 | Bacteria | 1569 |
| 825 | Ga0495644_0099866 | 3300046523 | Bacteria | 1098 |
| 826 | Ga0495666_0007047 | 3300046526 | Bacteria | 5648 |
| 827 | Ga0495666_0015658 | 3300046526 | Bacteria | 3776 |
| 828 | Ga0495652_0000298 | 3300046529 | Bacteria | 59074 |
| 829 | Ga0495652_0093106 | 3300046529 | Bacteria | 2461 |
| 830 | Ga0495652_0110145 | 3300046529 | Bacteria | 2215 |
| 831 | Ga0495652_0115375 | 3300046529 | Bacteria | 2152 |
| 832 | Ga0495652_0126607 | 3300046529 | Bacteria | 2028 |
| 833 | Ga0495665_0002244 | 3300046531 | Bacteria | 10458 |
| 834 | Ga0495665_0074768 | 3300046531 | Bacteria | 1784 |
| 835 | Ga0495640_0001758 | 3300046533 | Bacteria | 17170 |
| 836 | Ga0495640_0044379 | 3300046533 | Bacteria | 3091 |
| 837 | Ga0495640_0058395 | 3300046533 | Bacteria | 2631 |
| 838 | Ga0495640_0061616 | 3300046533 | Bacteria | 2547 |
| 839 | Ga0495640_0084847 | 3300046533 | Bacteria | 2099 |
| 840 | Ga0495640_0110951 | 3300046533 | Bacteria | 1793 |
| 841 | Ga0495587_0000212 | 3300046536 | Bacteria | 43340 |
| 842 | Ga0495587_0025540 | 3300046536 | Bacteria | 3610 |
| 843 | Ga0495587_0032844 | 3300046536 | Bacteria | 3135 |
| 844 | Ga0495587_0061580 | 3300046536 | Bacteria | 2199 |
| 845 | Ga0495609_0035401 | 3300046538 | Bacteria | 2260 |
| 846 | Ga0495609_0049744 | 3300046538 | Bacteria | 1870 |
| 847 | Ga0495645_0000035 | 3300046543 | Bacteria | 102305 |
| 848 | Ga0495645_0072687 | 3300046543 | Bacteria | 2478 |
| 849 | Ga0495645_0084403 | 3300046543 | Bacteria | 2274 |
| 850 | Ga0495645_0161612 | 3300046543 | Bacteria | 1548 |
| 851 | Ga0495622_0029075 | 3300046557 | Bacteria | 2582 |
| 852 | Ga0495667_0025972 | 3300046559 | Bacteria | 3945 |
| 853 | Ga0495667_0029233 | 3300046559 | Bacteria | 3709 |
| 854 | Ga0495667_0133415 | 3300046559 | Bacteria | 1601 |
| 855 | Ga0495656_0003461 | 3300046615 | Bacteria | 5338 |
| 856 | Ga0495634_0022140 | 3300046642 | Bacteria | 4480 |
| 857 | Ga0495634_0089748 | 3300046642 | Bacteria | 1997 |
| 858 | Ga0495634_0175114 | 3300046642 | Bacteria | 1346 |
| 859 | Ga0495611_0030048 | 3300046648 | Bacteria | 2387 |
| 860 | Ga0495635_0031027 | 3300046663 | Bacteria | 3713 |
| 861 | Ga0495635_0128027 | 3300046663 | Bacteria | 1731 |
| 862 | Ga0495659_0003008 | 3300046664 | Bacteria | 5407 |
| 863 | Ga0495661_0113819 | 3300046665 | Bacteria | 1504 |
| 864 | Ga0495588_0001261 | 3300046674 | Bacteria | 10856 |
| 865 | Ga0495657_0002891 | 3300046675 | Bacteria | 14255 |
| 866 | Ga0495657_0044094 | 3300046675 | Bacteria | 3037 |
| 867 | Ga0495657_0047828 | 3300046675 | Bacteria | 2889 |
| 868 | Ga0495657_0048638 | 3300046675 | Bacteria | 2859 |
| 869 | Ga0495599_0000009 | 3300046678 | Bacteria | 217299 |
| 870 | Ga0495599_0096758 | 3300046678 | Bacteria | 1840 |
| 871 | Ga0495599_0170355 | 3300046678 | Bacteria | 1344 |
| 872 | Ga0495599_0282386 | 3300046678 | Bacteria | 1005 |
| 873 | Ga0495623_0001465 | 3300046679 | Bacteria | 15981 |
| 874 | Ga0495623_0032031 | 3300046679 | Bacteria | 3380 |
| 875 | Ga0495623_0063824 | 3300046679 | Bacteria | 2305 |
| 876 | Ga0495646_0006560 | 3300046680 | Bacteria | 7385 |
| 877 | Ga0495646_0019252 | 3300046680 | Bacteria | 4324 |
| 878 | Ga0495647_0027036 | 3300046681 | Bacteria | 2106 |
| 879 | Ga0495647_0039174 | 3300046681 | Bacteria | 1795 |
| 880 | Ga0495658_0000943 | 3300046683 | Bacteria | 15496 |
| 881 | Ga0495658_0004844 | 3300046683 | Bacteria | 6603 |
| 882 | Ga0495658_0150261 | 3300046683 | Bacteria | 1430 |
| 883 | Ga0495613_0001715 | 3300046689 | Bacteria | 16689 |
| 884 | Ga0495613_0005719 | 3300046689 | Bacteria | 9321 |
| 885 | Ga0495613_0089060 | 3300046689 | Bacteria | 2236 |
| 886 | Ga0495613_0158948 | 3300046689 | Bacteria | 1608 |
| 887 | Ga0495613_0228359 | 3300046689 | Bacteria | 1305 |
| 888 | Ga0495613_0254173 | 3300046689 | Bacteria | 1226 |
| 889 | Ga0495624_0056006 | 3300046690 | Bacteria | 2482 |
| 890 | Ga0495670_0065612 | 3300046691 | Bacteria | 1830 |
| 891 | Ga0495670_0088604 | 3300046691 | Bacteria | 1582 |
| 892 | Ga0495589_0142309 | 3300046794 | Bacteria | 1148 |
| 893 | Ga0495600_0018215 | 3300046809 | Bacteria | 4471 |
| 894 | Ga0495600_0022173 | 3300046809 | Bacteria | 4075 |
| 895 | Ga0495600_0069166 | 3300046809 | Bacteria | 2307 |
| 896 | Ga0495581_0000618 | 3300047315 | Bacteria | 18638 |
| 897 | Ga0495581_0015527 | 3300047315 | Bacteria | 4421 |
| 898 | Ga0495604_0000120 | 3300047317 | Bacteria | 66462 |
| 899 | Ga0495604_0172875 | 3300047317 | Bacteria | 1517 |
| 900 | Ga0495604_0175538 | 3300047317 | Bacteria | 1503 |
| 901 | Ga0495674_0002761 | 3300047319 | Bacteria | 17035 |
| 902 | Ga0495674_0031685 | 3300047319 | Bacteria | 4800 |
| 903 | Ga0495674_0038281 | 3300047319 | Bacteria | 4306 |
| 904 | Ga0495674_0040406 | 3300047319 | Bacteria | 4172 |
| 905 | Ga0495674_0087891 | 3300047319 | Bacteria | 2659 |
| 906 | Ga0495674_0115831 | 3300047319 | Bacteria | 2268 |
| 907 | Ga0495674_0175200 | 3300047319 | Bacteria | 1788 |
| 908 | Ga0495676_0006670 | 3300047321 | Bacteria | 10638 |
| 909 | Ga0495676_0009347 | 3300047321 | Bacteria | 8934 |
| 910 | Ga0495676_0143535 | 3300047321 | Bacteria | 1708 |
| 911 | Ga0495680_0000280 | 3300047322 | Bacteria | 57136 |
| 912 | Ga0495680_0002774 | 3300047322 | Bacteria | 17672 |
| 913 | Ga0495680_0004409 | 3300047322 | Bacteria | 13460 |
| 914 | Ga0495680_0008617 | 3300047322 | Bacteria | 9258 |
| 915 | Ga0495680_0022786 | 3300047322 | Bacteria | 5215 |
| 916 | Ga0495680_0032999 | 3300047322 | Bacteria | 4196 |
| 917 | Ga0495680_0061497 | 3300047322 | Bacteria | 2889 |
| 918 | Ga0495680_0105614 | 3300047322 | Bacteria | 2094 |
| 919 | Ga0495680_0154818 | 3300047322 | Bacteria | 1668 |
| 920 | Ga0495675_0000137 | 3300047444 | Bacteria | 50947 |
| 921 | Ga0495675_0046463 | 3300047444 | Bacteria | 2764 |
| 922 | Ga0495675_0109399 | 3300047444 | Bacteria | 1726 |
| 923 | Ga0495677_0060035 | 3300047445 | Bacteria | 1409 |
| 924 | Ga0495677_0142568 | 3300047445 | Bacteria | 920 |
| 925 | Ga0495679_021229 | 3300047446 | Bacteria | 2247 |
| 926 | Ga0495684_0003498 | 3300047471 | Bacteria | 12285 |
| 927 | Ga0495684_0003793 | 3300047471 | Bacteria | 11780 |
| 928 | Ga0495684_0013160 | 3300047471 | Bacteria | 6384 |
| 929 | Ga0495684_0028726 | 3300047471 | Bacteria | 4270 |
| 930 | Ga0495684_0043393 | 3300047471 | Bacteria | 3443 |
| 931 | Ga0495684_0096425 | 3300047471 | Bacteria | 2238 |
| 932 | Ga0495684_0142305 | 3300047471 | Bacteria | 1798 |
| 933 | Ga0495593_0003213 | 3300047673 | Bacteria | 9801 |
| 934 | Ga0495602_0001635 | 3300048088 | Bacteria | 22289 |
| 935 | Ga0495602_0025218 | 3300048088 | Bacteria | 5755 |
| 936 | Ga0495602_0038656 | 3300048088 | Bacteria | 4409 |
| 937 | Ga0495602_0099776 | 3300048088 | Bacteria | 2386 |
| 938 | Ga0495602_0118124 | 3300048088 | Bacteria | 2139 |
| 939 | Ga0495602_0126326 | 3300048088 | Bacteria | 2048 |
| 940 | Ga0495614_0015578 | 3300048089 | Bacteria | 3314 |
| 941 | Ga0496100_0009180 | 3300048903 | Bacteria | 5548 |
| 942 | Ga0496100_0024253 | 3300048903 | Bacteria | 3697 |
| 943 | Ga0496100_0050713 | 3300048903 | Bacteria | 2690 |
| 944 | Ga0496100_0087301 | 3300048903 | Bacteria | 2120 |
| 945 | Ga0496100_0087517 | 3300048903 | Bacteria | 2118 |
| 946 | Ga0496100_0143041 | 3300048903 | Bacteria | 1697 |
| 947 | Ga0496100_0143662 | 3300048903 | Bacteria | 1694 |
| 948 | Ga0496101_0020105 | 3300048904 | Bacteria | 4566 |
| 949 | Ga0496101_0042290 | 3300048904 | Bacteria | 3252 |
| 950 | Ga0496101_0047319 | 3300048904 | Bacteria | 3087 |
| 951 | Ga0496101_0057734 | 3300048904 | Bacteria | 2808 |
| 952 | Ga0496101_0059389 | 3300048904 | Bacteria | 2771 |
| 953 | Ga0496101_0065916 | 3300048904 | Bacteria | 2640 |
| 954 | Ga0496101_0075050 | 3300048904 | Bacteria | 2488 |
| 955 | Ga0496101_0081026 | 3300048904 | Bacteria | 2399 |
| 956 | Ga0496101_0082217 | 3300048904 | Bacteria | 2383 |
| 957 | Ga0496102_0013736 | 3300048905 | Bacteria | 7022 |
| 958 | Ga0496102_0015401 | 3300048905 | Bacteria | 6659 |
| 959 | Ga0496102_0050155 | 3300048905 | Bacteria | 3799 |
| 960 | Ga0496102_0056157 | 3300048905 | Bacteria | 3591 |
| 961 | Ga0496102_0060977 | 3300048905 | Bacteria | 3451 |
| 962 | Ga0496102_0128722 | 3300048905 | Bacteria | 2368 |
| 963 | Ga0496102_0144504 | 3300048905 | Bacteria | 2232 |
| 964 | Ga0496102_0278908 | 3300048905 | Bacteria | 1575 |
| 965 | Ga0496102_0441322 | 3300048905 | Bacteria | 1221 |
| 966 | Ga0496103_0015177 | 3300048906 | Bacteria | 4579 |
| 967 | Ga0496103_0018176 | 3300048906 | Bacteria | 4216 |
| 968 | Ga0496103_0041829 | 3300048906 | Bacteria | 2818 |
| 969 | Ga0496103_0042171 | 3300048906 | Bacteria | 2807 |
| 970 | Ga0496103_0156346 | 3300048906 | Bacteria | 1462 |
| 971 | Ga0496104_0000288 | 3300048907 | Bacteria | 44366 |
| 972 | Ga0496104_0002201 | 3300048907 | Bacteria | 16866 |
| 973 | Ga0496104_0003018 | 3300048907 | Bacteria | 14496 |
| 974 | Ga0496104_0008275 | 3300048907 | Bacteria | 9236 |
| 975 | Ga0496104_0012649 | 3300048907 | Bacteria | 7598 |
| 976 | Ga0496104_0012732 | 3300048907 | Bacteria | 7577 |
| 977 | Ga0496104_0014445 | 3300048907 | Bacteria | 7133 |
| 978 | Ga0496104_0098374 | 3300048907 | Bacteria | 2801 |
| 979 | Ga0496104_0249842 | 3300048907 | Bacteria | 1686 |
| 980 | Ga0496104_0495841 | 3300048907 | Bacteria | 1132 |
| 981 | Ga0496104_0562447 | 3300048907 | Bacteria | 1051 |
| 982 | Ga0496105_0001581 | 3300048908 | Bacteria | 16141 |
| 983 | Ga0496105_0002146 | 3300048908 | Bacteria | 14289 |
| 984 | Ga0496105_0002776 | 3300048908 | Bacteria | 12802 |
| 985 | Ga0496105_0004733 | 3300048908 | Bacteria | 10271 |
| 986 | Ga0496105_0004966 | 3300048908 | Bacteria | 10056 |
| 987 | Ga0496105_0006879 | 3300048908 | Bacteria | 8754 |
| 988 | Ga0496105_0007108 | 3300048908 | Bacteria | 8635 |
| 989 | Ga0496105_0046089 | 3300048908 | Bacteria | 3599 |
| 990 | Ga0496105_0047377 | 3300048908 | Bacteria | 3547 |
| 991 | Ga0496105_0069465 | 3300048908 | Bacteria | 2911 |
| 992 | Ga0496105_0073408 | 3300048908 | Bacteria | 2826 |
| 993 | Ga0496105_0134161 | 3300048908 | Bacteria | 2040 |
| 994 | Ga0496105_0317832 | 3300048908 | Bacteria | 1249 |
| 995 | Ga0496106_0020665 | 3300048909 | Bacteria | 4888 |
| 996 | Ga0496106_0046880 | 3300048909 | Bacteria | 3250 |
| 997 | Ga0496106_0083964 | 3300048909 | Bacteria | 2450 |
| 998 | Ga0496106_0116707 | 3300048909 | Bacteria | 2082 |
| 999 | Ga0496106_0150046 | 3300048909 | Bacteria | 1838 |
| 1000 | Ga0496106_0235753 | 3300048909 | Bacteria | 1462 |
| 1001 | Ga0496107_0008952 | 3300048910 | Bacteria | 6937 |
| 1002 | Ga0496107_0012664 | 3300048910 | Bacteria | 5891 |
| 1003 | Ga0496107_0055230 | 3300048910 | Bacteria | 2868 |
| 1004 | Ga0496107_0059556 | 3300048910 | Bacteria | 2763 |
| 1005 | Ga0496107_0101876 | 3300048910 | Bacteria | 2105 |
| 1006 | Ga0496107_0202545 | 3300048910 | Bacteria | 1475 |
| 1007 | Ga0496108_0000488 | 3300048911 | Bacteria | 31704 |
| 1008 | Ga0496108_0005783 | 3300048911 | Bacteria | 10018 |
| 1009 | Ga0496108_0008358 | 3300048911 | Bacteria | 8396 |
| 1010 | Ga0496108_0008784 | 3300048911 | Bacteria | 8191 |
| 1011 | Ga0496108_0013131 | 3300048911 | Bacteria | 6751 |
| 1012 | Ga0496108_0081342 | 3300048911 | Bacteria | 2745 |
| 1013 | Ga0496108_0083028 | 3300048911 | Bacteria | 2717 |
| 1014 | Ga0496109_0003085 | 3300048912 | Bacteria | 13897 |
| 1015 | Ga0496109_0004872 | 3300048912 | Bacteria | 11208 |
| 1016 | Ga0496109_0007811 | 3300048912 | Bacteria | 9061 |
| 1017 | Ga0496109_0014579 | 3300048912 | Bacteria | 6839 |
| 1018 | Ga0496109_0080298 | 3300048912 | Bacteria | 3005 |
| 1019 | Ga0496109_0089324 | 3300048912 | Bacteria | 2848 |
| 1020 | Ga0496109_0095735 | 3300048912 | Bacteria | 2749 |
| 1021 | Ga0496109_0144396 | 3300048912 | Bacteria | 2226 |
| 1022 | Ga0496109_0153872 | 3300048912 | Bacteria | 2154 |
| 1023 | Ga0496109_0176924 | 3300048912 | Bacteria | 2003 |
| 1024 | Ga0496109_0193260 | 3300048912 | Bacteria | 1912 |
| 1025 | Ga0496109_0236387 | 3300048912 | Bacteria | 1719 |
| 1026 | Ga0496109_0294386 | 3300048912 | Bacteria | 1530 |
| 1027 | Ga0496109_0384129 | 3300048912 | Bacteria | 1326 |
| 1028 | Ga0496109_0607902 | 3300048912 | Bacteria | 1030 |
| 1029 | Ga0496110_0016414 | 3300048913 | Bacteria | 6182 |
| 1030 | Ga0496110_0022355 | 3300048913 | Bacteria | 5369 |
| 1031 | Ga0496110_0022538 | 3300048913 | Bacteria | 5348 |
| 1032 | Ga0496110_0033713 | 3300048913 | Bacteria | 4432 |
| 1033 | Ga0496110_0037483 | 3300048913 | Bacteria | 4214 |
| 1034 | Ga0496110_0037654 | 3300048913 | Bacteria | 4204 |
| 1035 | Ga0496110_0051079 | 3300048913 | Bacteria | 3633 |
| 1036 | Ga0496110_0086044 | 3300048913 | Bacteria | 2806 |
| 1037 | Ga0496110_0092493 | 3300048913 | Bacteria | 2706 |
| 1038 | Ga0496110_0106849 | 3300048913 | Bacteria | 2512 |
| 1039 | Ga0496110_0139601 | 3300048913 | Bacteria | 2191 |
| 1040 | Ga0496110_0180958 | 3300048913 | Bacteria | 1914 |
| 1041 | Ga0496111_0000604 | 3300048914 | Bacteria | 18917 |
| 1042 | Ga0496111_0019304 | 3300048914 | Bacteria | 4732 |
| 1043 | Ga0496111_0020875 | 3300048914 | Bacteria | 4566 |
| 1044 | Ga0496111_0050050 | 3300048914 | Bacteria | 3012 |
| 1045 | Ga0496111_0088342 | 3300048914 | Bacteria | 2270 |
| 1046 | Ga0496111_0092557 | 3300048914 | Bacteria | 2216 |
| 1047 | Ga0496111_0200123 | 3300048914 | Bacteria | 1485 |
| 1048 | Ga0496112_0000715 | 3300048915 | Bacteria | 23054 |
| 1049 | Ga0496112_0001042 | 3300048915 | Bacteria | 20421 |
| 1050 | Ga0496112_0002767 | 3300048915 | Bacteria | 14230 |
| 1051 | Ga0496112_0014719 | 3300048915 | Bacteria | 7273 |
| 1052 | Ga0496112_0044861 | 3300048915 | Bacteria | 4332 |
| 1053 | Ga0496112_0146187 | 3300048915 | Bacteria | 2332 |
| 1054 | Ga0496112_0181306 | 3300048915 | Bacteria | 2070 |
| 1055 | Ga0496112_0234523 | 3300048915 | Bacteria | 1789 |
| 1056 | Ga0496112_0235780 | 3300048915 | Bacteria | 1783 |
| 1057 | Ga0496112_0297927 | 3300048915 | Bacteria | 1558 |
| 1058 | Ga0496113_0000904 | 3300048916 | Bacteria | 15662 |
| 1059 | Ga0496113_0089995 | 3300048916 | Bacteria | 2363 |
| 1060 | Ga0496113_0149401 | 3300048916 | Bacteria | 1842 |
| 1061 | Ga0496114_0002005 | 3300048917 | Bacteria | 15475 |
| 1062 | Ga0496114_0002698 | 3300048917 | Bacteria | 13561 |
| 1063 | Ga0496114_0005403 | 3300048917 | Bacteria | 9990 |
| 1064 | Ga0496114_0009509 | 3300048917 | Bacteria | 7714 |
| 1065 | Ga0496114_0014287 | 3300048917 | Bacteria | 6370 |
| 1066 | Ga0496114_0033577 | 3300048917 | Bacteria | 4229 |
| 1067 | Ga0496114_0052280 | 3300048917 | Bacteria | 3403 |
| 1068 | Ga0496114_0086337 | 3300048917 | Bacteria | 2659 |
| 1069 | Ga0496114_0128642 | 3300048917 | Bacteria | 2185 |
| 1070 | Ga0496114_0140860 | 3300048917 | Bacteria | 2088 |
| 1071 | Ga0496114_0141978 | 3300048917 | Bacteria | 2080 |
| 1072 | Ga0496114_0217541 | 3300048917 | Bacteria | 1676 |
| 1073 | Ga0496114_0233486 | 3300048917 | Bacteria | 1616 |
| 1074 | Ga0496114_0249453 | 3300048917 | Bacteria | 1562 |
| 1075 | Ga0496114_0277508 | 3300048917 | Bacteria | 1477 |
| 1076 | Ga0496114_0337051 | 3300048917 | Bacteria | 1333 |
| 1077 | Ga0496115_0000494 | 3300048918 | Bacteria | 31060 |
| 1078 | Ga0496115_0002797 | 3300048918 | Bacteria | 12540 |
| 1079 | Ga0496115_0007279 | 3300048918 | Bacteria | 8137 |
| 1080 | Ga0496115_0019707 | 3300048918 | Bacteria | 5194 |
| 1081 | Ga0496115_0043676 | 3300048918 | Bacteria | 3575 |
| 1082 | Ga0496115_0077080 | 3300048918 | Bacteria | 2710 |
| 1083 | Ga0496115_0091187 | 3300048918 | Bacteria | 2490 |
| 1084 | Ga0496115_0092657 | 3300048918 | Bacteria | 2470 |
| 1085 | Ga0496115_0099542 | 3300048918 | Bacteria | 2382 |
| 1086 | Ga0496115_0112872 | 3300048918 | Bacteria | 2233 |
| 1087 | Ga0496115_0158560 | 3300048918 | Bacteria | 1870 |
| 1088 | Ga0496115_0174156 | 3300048918 | Bacteria | 1779 |
| 1089 | Ga0496115_0208850 | 3300048918 | Bacteria | 1613 |
| 1090 | Ga0496115_0312521 | 3300048918 | Bacteria | 1286 |
| 1091 | Ga0501307_008991 | 3300049162 | Bacteria | 1134 |
| 1092 | Ga0501031_0002608 | 3300049568 | Bacteria | 11480 |
| 1093 | Ga0501031_0006204 | 3300049568 | Bacteria | 7799 |
| 1094 | Ga0501031_0029371 | 3300049568 | Bacteria | 3586 |
| 1095 | Ga0501031_0039144 | 3300049568 | Bacteria | 3093 |
| 1096 | Ga0501031_0166877 | 3300049568 | Bacteria | 1439 |
| 1097 | Ga0501031_0343713 | 3300049568 | Bacteria | 966 |
| 1098 | Ga0501032_0001008 | 3300049569 | Bacteria | 22721 |
| 1099 | Ga0501032_0098395 | 3300049569 | Bacteria | 1938 |
| 1100 | Ga0501033_0002030 | 3300049570 | Bacteria | 17598 |
| 1101 | Ga0501033_0089834 | 3300049570 | Bacteria | 2247 |
| 1102 | Ga0501033_0093848 | 3300049570 | Bacteria | 2194 |
| 1103 | Ga0501033_0131363 | 3300049570 | Bacteria | 1814 |
| 1104 | Ga0501033_0272644 | 3300049570 | Bacteria | 1196 |
| 1105 | Ga0501034_0006109 | 3300049571 | Bacteria | 12994 |
| 1106 | Ga0501034_0010389 | 3300049571 | Bacteria | 9702 |
| 1107 | Ga0501034_0045662 | 3300049571 | Bacteria | 4426 |
| 1108 | Ga0501034_0102207 | 3300049571 | Bacteria | 2859 |
| 1109 | Ga0501034_0138299 | 3300049571 | Bacteria | 2416 |
| 1110 | Ga0501034_0143406 | 3300049571 | Bacteria | 2367 |
| 1111 | Ga0501036_0000259 | 3300049572 | Bacteria | 36044 |
| 1112 | Ga0501036_0005680 | 3300049572 | Bacteria | 10117 |
| 1113 | Ga0501036_0042308 | 3300049572 | Bacteria | 3857 |
| 1114 | Ga0501036_0067581 | 3300049572 | Bacteria | 3024 |
| 1115 | Ga0501036_0118044 | 3300049572 | Bacteria | 2240 |
| 1116 | Ga0501036_0176340 | 3300049572 | Bacteria | 1800 |
| 1117 | Ga0501037_0000205 | 3300049573 | Bacteria | 53176 |
| 1118 | Ga0501037_0030488 | 3300049573 | Bacteria | 3985 |
| 1119 | Ga0501037_0048820 | 3300049573 | Bacteria | 3100 |
| 1120 | Ga0501037_0061840 | 3300049573 | Bacteria | 2731 |
| 1121 | Ga0501037_0327783 | 3300049573 | Bacteria | 1059 |
| 1122 | Ga0501038_0000771 | 3300049574 | Bacteria | 28416 |
| 1123 | Ga0501038_0009846 | 3300049574 | Bacteria | 8750 |
| 1124 | Ga0501038_0057309 | 3300049574 | Bacteria | 3345 |
| 1125 | Ga0501038_0071914 | 3300049574 | Bacteria | 2932 |
| 1126 | Ga0501038_0115083 | 3300049574 | Bacteria | 2223 |
| 1127 | Ga0501038_0310496 | 3300049574 | Bacteria | 1236 |
| 1128 | Ga0501039_0000149 | 3300049575 | Bacteria | 47666 |
| 1129 | Ga0501039_0008886 | 3300049575 | Bacteria | 7655 |
| 1130 | Ga0501039_0010904 | 3300049575 | Bacteria | 6926 |
| 1131 | Ga0501039_0043125 | 3300049575 | Bacteria | 3485 |
| 1132 | Ga0501039_0091230 | 3300049575 | Bacteria | 2374 |
| 1133 | Ga0501039_0138075 | 3300049575 | Bacteria | 1915 |
| 1134 | Ga0501039_0411486 | 3300049575 | Bacteria | 1062 |
| 1135 | Ga0501040_0001153 | 3300049576 | Bacteria | 16813 |
| 1136 | Ga0501040_0003109 | 3300049576 | Bacteria | 10759 |
| 1137 | Ga0501040_0006410 | 3300049576 | Bacteria | 7642 |
| 1138 | Ga0501040_0018389 | 3300049576 | Bacteria | 4640 |
| 1139 | Ga0501040_0021630 | 3300049576 | Bacteria | 4298 |
| 1140 | Ga0501040_0024737 | 3300049576 | Bacteria | 4032 |
| 1141 | Ga0501040_0043845 | 3300049576 | Bacteria | 3049 |
| 1142 | Ga0501040_0064922 | 3300049576 | Bacteria | 2514 |
| 1143 | Ga0501040_0067524 | 3300049576 | Bacteria | 2464 |
| 1144 | Ga0501040_0141097 | 3300049576 | Bacteria | 1697 |
| 1145 | Ga0501040_0316681 | 3300049576 | Bacteria | 1116 |
| 1146 | Ga0501041_0000092 | 3300049577 | Bacteria | 36084 |
| 1147 | Ga0501041_0000426 | 3300049577 | Bacteria | 21371 |
| 1148 | Ga0501041_0003403 | 3300049577 | Bacteria | 9155 |
| 1149 | Ga0501041_0005613 | 3300049577 | Bacteria | 7333 |
| 1150 | Ga0501041_0008904 | 3300049577 | Bacteria | 5906 |
| 1151 | Ga0501041_0047244 | 3300049577 | Bacteria | 2620 |
| 1152 | Ga0501041_0090433 | 3300049577 | Bacteria | 1890 |
| 1153 | Ga0501042_0001259 | 3300049578 | Bacteria | 14757 |
| 1154 | Ga0501042_0001326 | 3300049578 | Bacteria | 14430 |
| 1155 | Ga0501042_0005053 | 3300049578 | Bacteria | 8460 |
| 1156 | Ga0501042_0014163 | 3300049578 | Bacteria | 5438 |
| 1157 | Ga0501042_0016716 | 3300049578 | Bacteria | 5044 |
| 1158 | Ga0501042_0028191 | 3300049578 | Bacteria | 3953 |
| 1159 | Ga0501042_0124002 | 3300049578 | Bacteria | 1860 |
| 1160 | Ga0501042_0132793 | 3300049578 | Bacteria | 1794 |
| 1161 | Ga0501042_0339527 | 3300049578 | Bacteria | 1086 |
| 1162 | Ga0501043_0000217 | 3300049579 | Bacteria | 52111 |
| 1163 | Ga0501043_0020703 | 3300049579 | Bacteria | 5160 |
| 1164 | Ga0501043_0067363 | 3300049579 | Bacteria | 2811 |
| 1165 | Ga0501043_0073810 | 3300049579 | Bacteria | 2679 |
| 1166 | Ga0501046_0001786 | 3300049580 | Bacteria | 20504 |
| 1167 | Ga0501046_0003483 | 3300049580 | Bacteria | 14432 |
| 1168 | Ga0501046_0031351 | 3300049580 | Bacteria | 4310 |
| 1169 | Ga0501046_0051090 | 3300049580 | Bacteria | 3264 |
| 1170 | Ga0501046_0098171 | 3300049580 | Bacteria | 2249 |
| 1171 | Ga0501046_0228896 | 3300049580 | Bacteria | 1374 |
| 1172 | Ga0501047_0001439 | 3300049581 | Bacteria | 23306 |
| 1173 | Ga0501047_0011868 | 3300049581 | Bacteria | 8241 |
| 1174 | Ga0501047_0090343 | 3300049581 | Bacteria | 2939 |
| 1175 | Ga0501047_0109719 | 3300049581 | Bacteria | 2642 |
| 1176 | Ga0501048_0000345 | 3300049582 | Bacteria | 32035 |
| 1177 | Ga0501048_0005592 | 3300049582 | Bacteria | 9558 |
| 1178 | Ga0501048_0014732 | 3300049582 | Bacteria | 5786 |
| 1179 | Ga0501048_0037228 | 3300049582 | Bacteria | 3493 |
| 1180 | Ga0501048_0041067 | 3300049582 | Bacteria | 3314 |
| 1181 | Ga0501048_0042735 | 3300049582 | Bacteria | 3244 |
| 1182 | Ga0501048_0062206 | 3300049582 | Bacteria | 2642 |
| 1183 | Ga0501048_0168068 | 3300049582 | Bacteria | 1553 |
| 1184 | Ga0501048_0321511 | 3300049582 | Bacteria | 1102 |
| 1185 | Ga0501067_0001525 | 3300049583 | Bacteria | 12613 |
| 1186 | Ga0501067_0003105 | 3300049583 | Bacteria | 9168 |
| 1187 | Ga0501067_0035182 | 3300049583 | Bacteria | 2781 |
| 1188 | Ga0501067_0055144 | 3300049583 | Bacteria | 2202 |
| 1189 | Ga0501067_0100244 | 3300049583 | Bacteria | 1609 |
| 1190 | Ga0501067_0103576 | 3300049583 | Bacteria | 1581 |
| 1191 | Ga0501068_0000158 | 3300049584 | Bacteria | 31187 |
| 1192 | Ga0501068_0007257 | 3300049584 | Bacteria | 6138 |
| 1193 | Ga0501068_0010420 | 3300049584 | Bacteria | 5223 |
| 1194 | Ga0501068_0024871 | 3300049584 | Bacteria | 3519 |
| 1195 | Ga0501068_0039784 | 3300049584 | Bacteria | 2820 |
| 1196 | Ga0501068_0122887 | 3300049584 | Bacteria | 1620 |
| 1197 | Ga0501068_0178950 | 3300049584 | Bacteria | 1341 |
| 1198 | Ga0501069_0004840 | 3300049585 | Bacteria | 6972 |
| 1199 | Ga0501069_0005068 | 3300049585 | Bacteria | 6831 |
| 1200 | Ga0501069_0011257 | 3300049585 | Bacteria | 4743 |
| 1201 | Ga0501069_0012646 | 3300049585 | Bacteria | 4490 |
| 1202 | Ga0501069_0016981 | 3300049585 | Bacteria | 3911 |
| 1203 | Ga0501069_0041440 | 3300049585 | Bacteria | 2545 |
| 1204 | Ga0501069_0055477 | 3300049585 | Bacteria | 2208 |
| 1205 | Ga0501069_0146039 | 3300049585 | Bacteria | 1358 |
| 1206 | Ga0501070_0007733 | 3300049586 | Bacteria | 9110 |
| 1207 | Ga0501070_0021479 | 3300049586 | Bacteria | 5415 |
| 1208 | Ga0501070_0058859 | 3300049586 | Bacteria | 3185 |
| 1209 | Ga0501070_0074282 | 3300049586 | Bacteria | 2814 |
| 1210 | Ga0501070_0131558 | 3300049586 | Bacteria | 2066 |
| 1211 | Ga0501070_0139422 | 3300049586 | Bacteria | 2002 |
| 1212 | Ga0501070_0359629 | 3300049586 | Bacteria | 1181 |
| 1213 | Ga0501071_0000097 | 3300049587 | Bacteria | 33417 |
| 1214 | Ga0501071_0008697 | 3300049587 | Bacteria | 6719 |
| 1215 | Ga0501071_0012044 | 3300049587 | Bacteria | 5847 |
| 1216 | Ga0501071_0015914 | 3300049587 | Bacteria | 5166 |
| 1217 | Ga0501071_0020464 | 3300049587 | Bacteria | 4599 |
| 1218 | Ga0501071_0023711 | 3300049587 | Bacteria | 4286 |
| 1219 | Ga0501071_0024819 | 3300049587 | Bacteria | 4194 |
| 1220 | Ga0501071_0033359 | 3300049587 | Bacteria | 3657 |
| 1221 | Ga0501071_0037141 | 3300049587 | Bacteria | 3477 |
| 1222 | Ga0501071_0113756 | 3300049587 | Bacteria | 2001 |
| 1223 | Ga0501071_0134280 | 3300049587 | Bacteria | 1840 |
| 1224 | Ga0501072_0000248 | 3300049588 | Bacteria | 39794 |
| 1225 | Ga0501072_0005632 | 3300049588 | Bacteria | 9533 |
| 1226 | Ga0501072_0007574 | 3300049588 | Bacteria | 8236 |
| 1227 | Ga0501072_0042963 | 3300049588 | Bacteria | 3552 |
| 1228 | Ga0501072_0072520 | 3300049588 | Bacteria | 2721 |
| 1229 | Ga0501072_0078261 | 3300049588 | Bacteria | 2618 |
| 1230 | Ga0501072_0201124 | 3300049588 | Bacteria | 1588 |
| 1231 | Ga0501072_0207790 | 3300049588 | Bacteria | 1560 |
| 1232 | Ga0501072_0351865 | 3300049588 | Bacteria | 1170 |
| 1233 | Ga0501073_0004502 | 3300049589 | Bacteria | 10470 |
| 1234 | Ga0501073_0020584 | 3300049589 | Bacteria | 4757 |
| 1235 | Ga0501073_0075815 | 3300049589 | Bacteria | 2341 |
| 1236 | Ga0501074_0003746 | 3300049590 | Bacteria | 10796 |
| 1237 | Ga0501074_0007316 | 3300049590 | Bacteria | 7982 |
| 1238 | Ga0501074_0007464 | 3300049590 | Bacteria | 7907 |
| 1239 | Ga0501074_0017408 | 3300049590 | Bacteria | 5215 |
| 1240 | Ga0501074_0024653 | 3300049590 | Bacteria | 4369 |
| 1241 | Ga0501074_0036149 | 3300049590 | Bacteria | 3579 |
| 1242 | Ga0501074_0041770 | 3300049590 | Bacteria | 3319 |
| 1243 | Ga0501074_0047886 | 3300049590 | Bacteria | 3089 |
| 1244 | Ga0501074_0207762 | 3300049590 | Bacteria | 1395 |
| 1245 | Ga0501074_0232497 | 3300049590 | Bacteria | 1312 |
| 1246 | Ga0501074_0290395 | 3300049590 | Bacteria | 1162 |
| 1247 | Ga0501075_0000701 | 3300049591 | Bacteria | 20737 |
| 1248 | Ga0501075_0000729 | 3300049591 | Bacteria | 20389 |
| 1249 | Ga0501075_0006520 | 3300049591 | Bacteria | 8036 |
| 1250 | Ga0501075_0017532 | 3300049591 | Bacteria | 5172 |
| 1251 | Ga0501075_0039441 | 3300049591 | Bacteria | 3535 |
| 1252 | Ga0501075_0071433 | 3300049591 | Bacteria | 2624 |
| 1253 | Ga0501076_0000734 | 3300049592 | Bacteria | 21188 |
| 1254 | Ga0501076_0008186 | 3300049592 | Bacteria | 7654 |
| 1255 | Ga0501076_0010550 | 3300049592 | Bacteria | 6858 |
| 1256 | Ga0501076_0015180 | 3300049592 | Bacteria | 5818 |
| 1257 | Ga0501076_0015217 | 3300049592 | Bacteria | 5811 |
| 1258 | Ga0501076_0023789 | 3300049592 | Bacteria | 4727 |
| 1259 | Ga0501076_0042465 | 3300049592 | Bacteria | 3579 |
| 1260 | Ga0501076_0047245 | 3300049592 | Bacteria | 3403 |
| 1261 | Ga0501076_0191736 | 3300049592 | Bacteria | 1668 |
| 1262 | Ga0501076_0202018 | 3300049592 | Bacteria | 1623 |
| 1263 | Ga0501076_0223566 | 3300049592 | Bacteria | 1538 |
| 1264 | Ga0501076_0439230 | 3300049592 | Bacteria | 1074 |
| 1265 | Ga0501077_0000132 | 3300049593 | Bacteria | 40709 |
| 1266 | Ga0501077_0004551 | 3300049593 | Bacteria | 8430 |
| 1267 | Ga0501077_0005321 | 3300049593 | Bacteria | 7820 |
| 1268 | Ga0501077_0010909 | 3300049593 | Bacteria | 5662 |
| 1269 | Ga0501077_0015387 | 3300049593 | Bacteria | 4816 |
| 1270 | Ga0501077_0024165 | 3300049593 | Bacteria | 3857 |
| 1271 | Ga0501079_0002142 | 3300049741 | Bacteria | 14202 |
| 1272 | Ga0501079_0003515 | 3300049741 | Bacteria | 11516 |
| 1273 | Ga0501079_0003795 | 3300049741 | Bacteria | 11159 |
| 1274 | Ga0501079_0008320 | 3300049741 | Bacteria | 7862 |
| 1275 | Ga0501079_0009532 | 3300049741 | Bacteria | 7361 |
| 1276 | Ga0501079_0063627 | 3300049741 | Bacteria | 2846 |
| 1277 | Ga0501079_0065388 | 3300049741 | Bacteria | 2805 |
| 1278 | Ga0501079_0075314 | 3300049741 | Bacteria | 2610 |
| 1279 | Ga0501079_0092625 | 3300049741 | Bacteria | 2341 |
| 1280 | Ga0501079_0114298 | 3300049741 | Bacteria | 2098 |
| 1281 | Ga0501079_0122669 | 3300049741 | Bacteria | 2021 |
| 1282 | Ga0501080_0005018 | 3300049742 | Bacteria | 11789 |
| 1283 | Ga0501080_0013013 | 3300049742 | Bacteria | 7639 |
| 1284 | Ga0501080_0019728 | 3300049742 | Bacteria | 6243 |
| 1285 | Ga0501080_0057179 | 3300049742 | Bacteria | 3632 |
| 1286 | Ga0501080_0067444 | 3300049742 | Bacteria | 3327 |
| 1287 | Ga0501080_0095992 | 3300049742 | Bacteria | 2752 |
| 1288 | Ga0501080_0195209 | 3300049742 | Bacteria | 1859 |
| 1289 | Ga0501080_0203365 | 3300049742 | Bacteria | 1817 |
| 1290 | Ga0501080_0333458 | 3300049742 | Bacteria | 1371 |
| 1291 | Ga0501081_0000692 | 3300049743 | Bacteria | 19453 |
| 1292 | Ga0501081_0000837 | 3300049743 | Bacteria | 18200 |
| 1293 | Ga0501081_0002602 | 3300049743 | Bacteria | 11405 |
| 1294 | Ga0501081_0008632 | 3300049743 | Bacteria | 6621 |
| 1295 | Ga0501081_0018101 | 3300049743 | Bacteria | 4675 |
| 1296 | Ga0501081_0019017 | 3300049743 | Bacteria | 4569 |
| 1297 | Ga0501081_0050380 | 3300049743 | Bacteria | 2869 |
| 1298 | Ga0501081_0172378 | 3300049743 | Bacteria | 1562 |
| 1299 | Ga0501083_0000086 | 3300049744 | Bacteria | 63536 |
| 1300 | Ga0501083_0000751 | 3300049744 | Bacteria | 21158 |
| 1301 | Ga0501083_0022268 | 3300049744 | Bacteria | 4396 |
| 1302 | Ga0501083_0061820 | 3300049744 | Bacteria | 2500 |
| 1303 | Ga0501083_0068964 | 3300049744 | Bacteria | 2353 |
| 1304 | Ga0501083_0154087 | 3300049744 | Bacteria | 1504 |
| 1305 | Ga0501083_0291072 | 3300049744 | Bacteria | 1062 |
| 1306 | Ga0501035_0000437 | 3300049822 | Bacteria | 46759 |
| 1307 | Ga0501035_0190386 | 3300049822 | Bacteria | 1764 |
| 1308 | Ga0501035_0193833 | 3300049822 | Bacteria | 1746 |
| 1309 | Ga0501035_0204989 | 3300049822 | Bacteria | 1689 |
| 1310 | Ga0501035_0245816 | 3300049822 | Bacteria | 1520 |
| 1311 | Ga0501035_0253454 | 3300049822 | Bacteria | 1494 |
| 1312 | Ga0501044_0001726 | 3300049823 | Bacteria | 25582 |
| 1313 | Ga0501044_0085816 | 3300049823 | Bacteria | 3180 |
| 1314 | Ga0501044_0154163 | 3300049823 | Bacteria | 2278 |
| 1315 | Ga0501044_0505617 | 3300049823 | Bacteria | 1109 |
| 1316 | Ga0501045_0005349 | 3300049824 | Bacteria | 8894 |
| 1317 | Ga0501045_0007717 | 3300049824 | Bacteria | 7485 |
| 1318 | Ga0501045_0011122 | 3300049824 | Bacteria | 6306 |
| 1319 | Ga0501045_0015419 | 3300049824 | Bacteria | 5423 |
| 1320 | Ga0501045_0028196 | 3300049824 | Bacteria | 4049 |
| 1321 | Ga0501045_0028262 | 3300049824 | Bacteria | 4045 |
| 1322 | Ga0501045_0047092 | 3300049824 | Bacteria | 3140 |
| 1323 | Ga0501045_0050649 | 3300049824 | Bacteria | 3030 |
| 1324 | Ga0501045_0054535 | 3300049824 | Bacteria | 2922 |
| 1325 | nmdc:mga00v17_20992_c1 | 3300050491 | Bacteria | 3750 |
| 1326 | nmdc:mga00v17_231455_c1 | 3300050491 | Bacteria | 1197 |
| 1327 | nmdc:mga00v17_47034_c1 | 3300050491 | Bacteria | 2612 |
| 1328 | nmdc:mga0yw44_18281_c1 | 3300050492 | Bacteria | 3834 |
| 1329 | nmdc:mga0yw44_65818_c1 | 3300050492 | Bacteria | 2235 |
| 1330 | nmdc:mga06z11_116254_c1 | 3300050494 | Bacteria | 1487 |
| 1331 | nmdc:mga05p37_112741_c1 | 3300050507 | Bacteria | 3344 |
| 1332 | nmdc:mga05p37_227216_c1 | 3300050507 | Bacteria | 2250 |
| 1333 | nmdc:mga05p37_23364_c1 | 3300050507 | Bacteria | 7502 |
| 1334 | nmdc:mga05p37_310914_c1 | 3300050507 | Bacteria | 1868 |
| 1335 | nmdc:mga05p37_51716_c1 | 3300050507 | Bacteria | 5051 |
| 1336 | nmdc:mga05p37_78159_c1 | 3300050507 | Bacteria | 4074 |
| 1337 | nmdc:mga09592_10222_c1 | 3300050508 | Bacteria | 7636 |
| 1338 | nmdc:mga09592_12706_c1 | 3300050508 | Bacteria | 6863 |
| 1339 | nmdc:mga09592_61406_c1 | 3300050508 | Bacteria | 3179 |
| 1340 | nmdc:mga0qj67_15282_c1 | 3300050509 | Bacteria | 5812 |
| 1341 | nmdc:mga0qj67_155880_c1 | 3300050509 | Bacteria | 1853 |
| 1342 | nmdc:mga0qj67_40913_c1 | 3300050509 | Bacteria | 3644 |
| 1343 | nmdc:mga06r32_206997_c1 | 3300050510 | Bacteria | 1950 |
| 1344 | nmdc:mga06r32_43886_c1 | 3300050510 | Bacteria | 4255 |
| 1345 | nmdc:mga06r32_439664_c1 | 3300050510 | Bacteria | 1284 |
| 1346 | nmdc:mga08y16_11874_c1 | 3300050511 | Bacteria | 9149 |
| 1347 | nmdc:mga08y16_14378_c1 | 3300050511 | Bacteria | 8331 |
| 1348 | nmdc:mga08y16_25511_c1 | 3300050511 | Bacteria | 6235 |
| 1349 | nmdc:mga08y16_367559_c1 | 3300050511 | Bacteria | 1476 |
| 1350 | nmdc:mga08y16_63375_c1 | 3300050511 | Bacteria | 3860 |
| 1351 | nmdc:mga08y16_82262_c1 | 3300050511 | Bacteria | 3357 |
| 1352 | nmdc:mga0n895_216489_c1 | 3300050512 | Bacteria | 1945 |
| 1353 | nmdc:mga0n895_21900_c1 | 3300050512 | Bacteria | 5986 |
| 1354 | nmdc:mga0n895_345629_c1 | 3300050512 | Bacteria | 1507 |
| 1355 | nmdc:mga0n895_35200_c1 | 3300050512 | Bacteria | 4826 |
| 1356 | nmdc:mga0rr50_10341_c1 | 3300050513 | Bacteria | 5917 |
| 1357 | nmdc:mga0rr50_42906_c1 | 3300050513 | Bacteria | 3307 |
| 1358 | nmdc:mga08x19_28488_c1 | 3300050514 | Bacteria | 3498 |
| 1359 | nmdc:mga0a205_2180_c1 | 3300050515 | Bacteria | 17232 |
| 1360 | nmdc:mga0a205_23779_c1 | 3300050515 | Bacteria | 5815 |
| 1361 | nmdc:mga0a205_31410_c1 | 3300050515 | Bacteria | 5088 |
| 1362 | nmdc:mga0a205_33265_c2 | 3300050515 | Bacteria | 3603 |
| 1363 | Ga0495601_0000983 | 3300053077 | Bacteria | 15574 |
| 1364 | Ga0495601_0032476 | 3300053077 | Bacteria | 3250 |
| 1365 | Ga0495601_0087100 | 3300053077 | Bacteria | 2007 |
| 1366 | Ga0495601_0113091 | 3300053077 | Bacteria | 1759 |
| 1367 | Ga0495601_0115389 | 3300053077 | Bacteria | 1741 |
| 1368 | Ga0495601_0196673 | 3300053077 | Bacteria | 1318 |
| 1369 | Ga0495612_0009152 | 3300053078 | Bacteria | 4018 |
| 1370 | Ga0495655_0029979 | 3300053083 | Bacteria | 1312 |
| 1371 | Ga0495595_0036286 | 3300053084 | Bacteria | 2236 |
| 1372 | Ga0495595_0047786 | 3300053084 | Bacteria | 1975 |
| 1373 | Ga0495595_0122436 | 3300053084 | Bacteria | 1267 |
| 1374 | Ga0495595_0168621 | 3300053084 | Bacteria | 1083 |
| 1375 | Ga0495619_0004719 | 3300053085 | Bacteria | 8677 |
| 1376 | Ga0495619_0008649 | 3300053085 | Bacteria | 6442 |
| 1377 | Ga0495619_0023175 | 3300053085 | Bacteria | 3978 |
| 1378 | Ga0495619_0025735 | 3300053085 | Bacteria | 3781 |
| 1379 | Ga0495619_0031759 | 3300053085 | Bacteria | 3423 |
| 1380 | Ga0495619_0078590 | 3300053085 | Bacteria | 2218 |
| 1381 | Ga0495619_0122862 | 3300053085 | Bacteria | 1780 |
| 1382 | Ga0500568_0001852 | 3300053139 | Bacteria | 13026 |
| 1383 | Ga0500616_0000215 | 3300053153 | Bacteria | 91354 |
| 1384 | Ga0501084_0000492 | 3300054114 | Bacteria | 30321 |
| 1385 | Ga0501084_0005749 | 3300054114 | Bacteria | 10200 |
| 1386 | Ga0501084_0013559 | 3300054114 | Bacteria | 6743 |
| 1387 | Ga0501084_0015632 | 3300054114 | Bacteria | 6294 |
| 1388 | Ga0501084_0027990 | 3300054114 | Bacteria | 4709 |
| 1389 | Ga0501084_0046847 | 3300054114 | Bacteria | 3621 |
| 1390 | Ga0501084_0168843 | 3300054114 | Bacteria | 1847 |
| 1391 | Ga0501084_0208810 | 3300054114 | Bacteria | 1648 |
| 1392 | Ga0501084_0209001 | 3300054114 | Bacteria | 1647 |
| 1393 | Ga0501084_0363283 | 3300054114 | Bacteria | 1223 |
| 1394 | Ga0590075_008777 | 3300059424 | Bacteria | 2418 |
| 1395 | Ga0501082_0000139 | 3300060353 | Bacteria | 59897 |
| 1396 | Ga0501082_0008363 | 3300060353 | Bacteria | 8925 |
| 1397 | Ga0501082_0010188 | 3300060353 | Bacteria | 8095 |
| 1398 | Ga0501082_0011909 | 3300060353 | Bacteria | 7478 |
| 1399 | Ga0501082_0058794 | 3300060353 | Bacteria | 3312 |
| 1400 | Ga0501082_0065507 | 3300060353 | Bacteria | 3129 |
| 1401 | Ga0501082_0112269 | 3300060353 | Bacteria | 2360 |
| 1402 | Ga0501082_0255885 | 3300060353 | Bacteria | 1523 |
| 1403 | Ga0466962_0002601 | 3300061719 | Bacteria | 8576 |
| 1404 | Ga0466962_0004184 | 3300061719 | Bacteria | 6916 |
| 1405 | Ga0466962_0004907 | 3300061719 | Bacteria | 6434 |
| 1406 | Ga0466962_0017606 | 3300061719 | Bacteria | 3440 |
| 1407 | Ga0466962_0046896 | 3300061719 | Bacteria | 2065 |
| 1408 | Ga0530510_0000086 | 3300061734 | Bacteria | 49340 |
| 1409 | Ga0530510_0001228 | 3300061734 | Bacteria | 17096 |
| 1410 | Ga0530510_0007446 | 3300061734 | Bacteria | 7620 |
| 1411 | Ga0530510_0027645 | 3300061734 | Bacteria | 4065 |
| 1412 | Ga0530510_0029265 | 3300061734 | Bacteria | 3953 |
| 1413 | Ga0530510_0030125 | 3300061734 | Bacteria | 3896 |
| 1414 | Ga0530510_0043266 | 3300061734 | Bacteria | 3253 |
| 1415 | Ga0530510_0184062 | 3300061734 | Bacteria | 1549 |
| 1416 | Ga0105240_10055580 | |||
| 1417 | JGI24738J21930_10004813 | |||
| 1418 | JGI25407J50210_10002464 | |||
| 1419 | Ga0070658_10016045 | |||
| 1420 | Ga0070658_10034579 | |||
| 1421 | Ga0070658_10089110 | |||
| 1422 | Ga0070658_10238552 | |||
| 1423 | Ga0070683_100003672 | |||
| 1424 | Ga0070683_100047809 | |||
| 1425 | Ga0070683_100076195 | |||
| 1426 | Ga0070683_100177274 | |||
| 1427 | Ga0070680_100003014 | |||
| 1428 | Ga0070680_100026345 | |||
| 1429 | Ga0070680_100033482 | |||
| 1430 | Ga0070680_100039991 | |||
| 1431 | Ga0070680_100046229 | |||
| 1432 | Ga0070682_100001154 | |||
| 1433 | Ga0070682_100007677 | |||
| 1434 | Ga0070682_100086954 | |||
| 1435 | Ga0070660_100003891 | |||
| 1436 | Ga0070660_100028566 | |||
| 1437 | Ga0070660_100048434 | |||
| 1438 | Ga0070660_100122221 | |||
| 1439 | Ga0070660_100336603 | |||
| 1440 | Ga0070689_100010453 | |||
| 1441 | Ga0070691_10001490 | |||
| 1442 | Ga0070661_100014347 | |||
| 1443 | Ga0070661_100042605 | |||
| 1444 | Ga0070661_100087400 | |||
| 1445 | Ga0070692_10001185 | |||
| 1446 | Ga0070668_100276978 | |||
| 1447 | Ga0070668_100373723 | |||
| 1448 | Ga0070669_100295841 | |||
| 1449 | Ga0070675_100006250 | |||
| 1450 | Ga0070671_100054537 | |||
| 1451 | Ga0070671_100102254 | |||
| 1452 | Ga0070671_100279533 | |||
| 1453 | Ga0070674_100006216 | |||
| 1454 | Ga0070674_100007050 | |||
| 1455 | Ga0070674_100055396 | |||
| 1456 | Ga0070674_100115142 | |||
| 1457 | Ga0070673_100004299 | |||
| 1458 | Ga0070673_100196375 | |||
| 1459 | Ga0070673_100244424 | |||
| 1460 | Ga0070688_100074382 | |||
| 1461 | Ga0070659_100001847 | |||
| 1462 | Ga0070659_100047410 | |||
| 1463 | Ga0070659_100053595 | |||
| 1464 | Ga0070667_100131229 | |||
| 1465 | Ga0070667_100155197 | |||
| 1466 | Ga0070667_100355532 | |||
| 1467 | Ga0070714_100009702 | |||
| 1468 | Ga0070714_100087305 | |||
| 1469 | Ga0070714_100150039 | |||
| 1470 | Ga0070714_100181520 | |||
| 1471 | Ga0070713_100002387 | |||
| 1472 | Ga0070713_100022139 | |||
| 1473 | Ga0070713_100022174 | |||
| 1474 | Ga0070713_100106551 | |||
| 1475 | Ga0070713_100170654 | |||
| 1476 | Ga0070710_10002369 | |||
| 1477 | Ga0070710_10004604 | |||
| 1478 | Ga0070710_10093515 | |||
| 1479 | Ga0070710_10135845 | |||
| 1480 | Ga0070711_100021791 | |||
| 1481 | Ga0070711_100049950 | |||
| 1482 | Ga0070694_100279111 | |||
| 1483 | Ga0070708_100201715 | |||
| 1484 | Ga0070663_100077065 | |||
| 1485 | Ga0070678_100022013 | |||
| 1486 | Ga0070678_100071075 | |||
| 1487 | Ga0070662_100014193 | |||
| 1488 | Ga0070662_100032861 | |||
| 1489 | Ga0070681_10013997 | |||
| 1490 | Ga0070681_10016356 | |||
| 1491 | Ga0070681_10023730 | |||
| 1492 | Ga0070681_10053838 | |||
| 1493 | Ga0070681_10394122 | |||
| 1494 | Ga0068867_100009456 | |||
| 1495 | Ga0068867_100090407 | |||
| 1496 | Ga0068867_100106689 | |||
| 1497 | Ga0068867_100271941 | |||
| 1498 | Ga0070706_100025393 | |||
| 1499 | Ga0070706_100102851 | |||
| 1500 | Ga0070706_100154233 | |||
| 1501 | Ga0070707_100008855 | |||
| 1502 | Ga0070707_100129005 | |||
| 1503 | Ga0070698_100000472 | |||
| 1504 | Ga0070698_100001742 | |||
| 1505 | Ga0070698_100012860 | |||
| 1506 | Ga0070698_100022411 | |||
| 1507 | Ga0070698_100082519 | |||
| 1508 | Ga0070698_100143501 | |||
| 1509 | Ga0070699_100026853 | |||
| 1510 | Ga0070699_100108344 | |||
| 1511 | Ga0070699_100119828 | |||
| 1512 | Ga0070679_100002682 | |||
| 1513 | Ga0070679_100010105 | |||
| 1514 | Ga0070679_100015262 | |||
| 1515 | Ga0070679_100060606 | |||
| 1516 | Ga0070679_100091769 | |||
| 1517 | Ga0070679_100206925 | |||
| 1518 | Ga0070679_100621161 | |||
| 1519 | Ga0070684_100002494 | |||
| 1520 | Ga0070684_100009589 | |||
| 1521 | Ga0070684_100021102 | |||
| 1522 | Ga0070684_100022528 | |||
| 1523 | Ga0070684_100044309 | |||
| 1524 | Ga0070684_100162758 | |||
| 1525 | Ga0070697_100028193 | |||
| 1526 | Ga0070697_100302970 | |||
| 1527 | Ga0068853_100013517 | |||
| 1528 | Ga0068853_100081711 | |||
| 1529 | Ga0070672_100065196 | |||
| 1530 | Ga0070686_100192428 | |||
| 1531 | Ga0070695_100042730 | |||
| 1532 | Ga0070693_100009457 | |||
| 1533 | Ga0070693_100010362 | |||
| 1534 | Ga0070693_100038476 | |||
| 1535 | Ga0070665_100056061 | |||
| 1536 | Ga0070704_100128218 | |||
| 1537 | Ga0068855_100029321 | |||
| 1538 | Ga0068855_100046564 | |||
| 1539 | Ga0068855_100107411 | |||
| 1540 | Ga0068855_100124516 | |||
| 1541 | Ga0068855_100135714 | |||
| 1542 | Ga0068857_100085160 | |||
| 1543 | Ga0068854_100005175 | |||
| 1544 | Ga0068854_100019060 | |||
| 1545 | Ga0068856_100184171 | |||
| 1546 | Ga0068856_100322675 | |||
| 1547 | Ga0070702_100062138 | |||
| 1548 | Ga0068852_100072149 | |||
| 1549 | Ga0068852_100084248 | |||
| 1550 | Ga0068852_100110738 | |||
| 1551 | Ga0068852_100182380 | |||
| 1552 | Ga0068866_10015588 | |||
| 1553 | Ga0068866_10019659 | |||
| 1554 | Ga0068861_100013608 | |||
| 1555 | Ga0068861_100086224 | |||
| 1556 | Ga0068870_10231683 | |||
| 1557 | Ga0068863_100059691 | |||
| 1558 | Ga0068858_100155850 | |||
| 1559 | Ga0068858_100255878 | |||
| 1560 | Ga0068860_100123490 | |||
| 1561 | Ga0068860_100152182 | |||
| 1562 | Ga0068860_100226779 | |||
| 1563 | Ga0068862_100263267 | |||
| 1564 | Ga0081455_10002893 | |||
| 1565 | Ga0081455_10006617 | |||
| 1566 | Ga0081455_10007185 | |||
| 1567 | Ga0081455_10012039 | |||
| 1568 | Ga0081455_10029777 | |||
| 1569 | Ga0081455_10044856 | |||
| 1570 | Ga0081455_10049104 | |||
| 1571 | Ga0081455_10091421 | |||
| 1572 | Ga0081455_10109191 | |||
| 1573 | Ga0081455_10133880 | |||
| 1574 | Ga0081538_10000012 | |||
| 1575 | Ga0081538_10000205 | |||
| 1576 | Ga0081538_10001091 | |||
| 1577 | Ga0081538_10001170 | |||
| 1578 | Ga0081538_10009350 | |||
| 1579 | Ga0081538_10010785 | |||
| 1580 | Ga0081538_10040029 | |||
| 1581 | Ga0081538_10098834 | |||
| 1582 | Ga0081540_1004192 | |||
| 1583 | Ga0081540_1006685 | |||
| 1584 | Ga0081539_10001511 | |||
| 1585 | Ga0081539_10001867 | |||
| 1586 | Ga0081539_10014792 | |||
| 1587 | Ga0070717_10004071 | |||
| 1588 | Ga0070717_10005336 | |||
| 1589 | Ga0070717_10008478 | |||
| 1590 | Ga0070717_10022452 | |||
| 1591 | Ga0070717_10114763 | |||
| 1592 | Ga0070717_10331987 | |||
| 1593 | Ga0075365_10050801 | |||
| 1594 | Ga0075365_10119624 | |||
| 1595 | Ga0075363_100158018 | |||
| 1596 | Ga0075364_10003473 | |||
| 1597 | Ga0075364_10008474 | |||
| 1598 | Ga0075364_10171756 | |||
| 1599 | Ga0075432_10015158 | |||
| 1600 | Ga0075432_10047605 | |||
| 1601 | Ga0070715_10000223 | |||
| 1602 | Ga0070716_100005561 | |||
| 1603 | Ga0070716_100051755 | |||
| 1604 | Ga0070716_100086655 | |||
| 1605 | Ga0070716_100150625 | |||
| 1606 | Ga0070712_100053783 | |||
| 1607 | Ga0075367_10197620 | |||
| 1608 | Ga0075366_10188846 | |||
| 1609 | Ga0097621_100122420 | |||
| 1610 | Ga0068871_100031259 | |||
| 1611 | Ga0075428_100000881 | |||
| 1612 | Ga0075428_100145687 | |||
| 1613 | Ga0075428_100204957 | |||
| 1614 | Ga0075430_100010050 | |||
| 1615 | Ga0075430_100138194 | |||
| 1616 | Ga0075430_100227031 | |||
| 1617 | Ga0075431_100029898 | |||
| 1618 | Ga0075431_100140313 | |||
| 1619 | Ga0075431_100145995 | |||
| 1620 | Ga0075431_100201835 | |||
| 1621 | Ga0075433_10001982 | |||
| 1622 | Ga0075433_10005692 | |||
| 1623 | Ga0075433_10079051 | |||
| 1624 | Ga0075434_100005232 | |||
| 1625 | Ga0075434_100010926 | |||
| 1626 | Ga0075434_100016151 | |||
| 1627 | Ga0075434_100047760 | |||
| 1628 | Ga0075434_100075796 | |||
| 1629 | Ga0075429_100002453 | |||
| 1630 | Ga0075429_100012763 | |||
| 1631 | Ga0075429_100016341 | |||
| 1632 | Ga0068865_100001102 | |||
| 1633 | Ga0068865_100067166 | |||
| 1634 | Ga0068865_100073362 | |||
| 1635 | Ga0068865_100082917 | |||
| 1636 | Ga0068865_100112570 | |||
| 1637 | Ga0075436_100004569 | |||
| 1638 | Ga0075436_100007624 | |||
| 1639 | Ga0075435_100002576 | |||
| 1640 | Ga0075435_100003349 | |||
| 1641 | Ga0075435_100098257 | |||
| 1642 | Ga0075435_100116723 | |||
| 1643 | Ga0105240_10027857 | |||
| 1644 | Ga0105240_10041896 | |||
| 1645 | Ga0105240_10066726 | |||
| 1646 | Ga0105240_10155567 | |||
| 1647 | Ga0105240_10179582 | |||
| 1648 | Ga0105240_10223643 | |||
| 1649 | Ga0105240_10343080 | |||
| 1650 | Ga0105240_10452039 | |||
| 1651 | Ga0111539_10005140 | |||
| 1652 | Ga0111539_10014417 | |||
| 1653 | Ga0111539_10289463 | |||
| 1654 | Ga0111539_10290287 | |||
| 1655 | Ga0111539_10314413 | |||
| 1656 | Ga0111539_10384773 | |||
| 1657 | Ga0105245_10015258 | |||
| 1658 | Ga0105245_10018003 | |||
| 1659 | Ga0105245_10032641 | |||
| 1660 | Ga0105245_10092679 | |||
| 1661 | Ga0105245_10207348 | |||
| 1662 | Ga0105245_10268117 | |||
| 1663 | Ga0105245_10495005 | |||
| 1664 | Ga0114129_10002158 | |||
| 1665 | Ga0114129_10097354 | |||
| 1666 | Ga0114129_10147476 | |||
| 1667 | Ga0114129_10377196 | |||
| 1668 | Ga0105243_10001674 | |||
| 1669 | Ga0105243_10007507 | |||
| 1670 | Ga0105243_10043286 | |||
| 1671 | Ga0105243_10086132 | |||
| 1672 | Ga0105243_10131094 | |||
| 1673 | Ga0105241_10130208 | |||
| 1674 | Ga0105242_10160950 | |||
| 1675 | Ga0105242_10302628 | |||
| 1676 | Ga0105242_10320360 | |||
| 1677 | Ga0105248_10178837 | |||
| 1678 | Ga0105248_10251936 | |||
| 1679 | Ga0105248_10560927 | |||
| 1680 | Ga0105237_10133570 | |||
| 1681 | Ga0105237_10176025 | |||
| 1682 | Ga0105238_10017502 | |||
| 1683 | Ga0105249_10007414 | |||
| 1684 | Ga0105249_10013589 | |||
| 1685 | Ga0105249_10342739 | |||
| 1686 | Ga0105239_10013948 | |||
| 1687 | Ga0105239_10020380 | |||
| 1688 | Ga0105239_10063871 | |||
| 1689 | Ga0105239_10146444 | |||
| 1690 | Ga0105239_10385004 | |||
| 1691 | Ga0105246_10026923 | |||
| 1692 | Ga0105246_10047578 | |||
| 1693 | Ga0105246_10354495 | |||
| 1694 | Ga0157373_10200948 | |||
| 1695 | Ga0157370_10031456 | |||
| 1696 | Ga0157370_10042692 | |||
| 1697 | Ga0157370_10044790 | |||
| 1698 | Ga0157370_10052706 | |||
| 1699 | Ga0157370_10145851 | |||
| 1700 | Ga0157370_10261974 | |||
| 1701 | Ga0157369_10002166 | |||
| 1702 | Ga0157369_10005648 | |||
| 1703 | Ga0157369_10007096 | |||
| 1704 | Ga0157369_10030268 | |||
| 1705 | Ga0157369_10070311 | |||
| 1706 | Ga0157369_10162046 | |||
| 1707 | Ga0157369_10175111 | |||
| 1708 | Ga0157369_10188014 | |||
| 1709 | Ga0157369_10320631 | |||
| 1710 | Ga0157374_10021783 | |||
| 1711 | Ga0157374_10077349 | |||
| 1712 | Ga0157374_10102677 | |||
| 1713 | Ga0157374_10377676 | |||
| 1714 | Ga0157378_10005680 | |||
| 1715 | Ga0157378_10209805 | |||
| 1716 | Ga0163162_10013965 | |||
| 1717 | Ga0163162_10080684 | |||
| 1718 | Ga0157372_10005776 | |||
| 1719 | Ga0157372_10426644 | |||
| 1720 | Ga0157375_10047986 | |||
| 1721 | Ga0163163_10010439 | |||
| 1722 | Ga0157380_10003284 | |||
| 1723 | Ga0157380_10505591 | |||
| 1724 | Ga0182008_10003056 | |||
| 1725 | Ga0157377_10016525 | |||
| 1726 | Ga0157379_10007742 | |||
| 1727 | Ga0157379_10011001 | |||
| 1728 | Ga0157379_10062950 | |||
| 1729 | Ga0157376_10081159 | |||
| 1730 | Ga0157376_10398389 | |||
| 1731 | Ga0197907_10066705 | |||
| 1732 | Ga0197907_10406384 | |||
| 1733 | Ga0197907_10589986 | |||
| 1734 | Ga0197907_10762704 | |||
| 1735 | Ga0206356_10072031 | |||
| 1736 | Ga0206356_10246559 | |||
| 1737 | Ga0206356_10770587 | |||
| 1738 | Ga0206356_11853397 | |||
| 1739 | Ga0206349_1962268 | |||
| 1740 | Ga0206352_11055655 | |||
| 1741 | Ga0206350_11051890 | |||
| 1742 | Ga0206350_11490151 | |||
| 1743 | Ga0206354_10052620 | |||
| 1744 | Ga0206354_10075868 | |||
| 1745 | Ga0206354_10378407 | |||
| 1746 | Ga0206354_10823254 | |||
| 1747 | Ga0206354_10928650 | |||
| 1748 | Ga0206353_10050633 | |||
| 1749 | Ga0206353_10328476 | |||
| 1750 | Ga0206353_10337916 | |||
| 1751 | Ga0206353_10902253 | |||
| 1752 | Ga0206353_11349432 | |||
| 1753 | Ga0206353_11456732 | |||
| 1754 | Ga0154015_1653186 | |||
| 1755 | Ga0213876_10008372 | |||
| 1756 | Ga0224712_10036199 | |||
| 1757 | Ga0224712_10057349 | |||
| 1758 | Ga0224712_10060366 | |||
| 1759 | Ga0224712_10060459 | |||
| 1760 | Ga0224712_10068235 | |||
| 1761 | Ga0224712_10091385 | |||
| 1762 | Ga0207692_10009309 | |||
| 1763 | Ga0207692_10061903 | |||
| 1764 | Ga0207642_10004636 | |||
| 1765 | Ga0207710_10035176 | |||
| 1766 | Ga0207688_10001633 | |||
| 1767 | Ga0207688_10048617 | |||
| 1768 | Ga0207699_10025004 | |||
| 1769 | Ga0207699_10029643 | |||
| 1770 | Ga0207699_10083633 | |||
| 1771 | Ga0207705_10064990 | |||
| 1772 | Ga0207705_10096065 | |||
| 1773 | Ga0207684_10029946 | |||
| 1774 | Ga0207684_10131952 | |||
| 1775 | Ga0207684_10197302 | |||
| 1776 | Ga0207654_10161075 | |||
| 1777 | Ga0207707_10001918 | |||
| 1778 | Ga0207707_10014107 | |||
| 1779 | Ga0207707_10068293 | |||
| 1780 | Ga0207707_10070389 | |||
| 1781 | Ga0207707_10158121 | |||
| 1782 | Ga0207707_10167554 | |||
| 1783 | Ga0207695_10071373 | |||
| 1784 | Ga0207695_10075586 | |||
| 1785 | Ga0207695_10141155 | |||
| 1786 | Ga0207695_10194970 | |||
| 1787 | Ga0207693_10004473 | |||
| 1788 | Ga0207693_10008397 | |||
| 1789 | Ga0207693_10016529 | |||
| 1790 | Ga0207693_10024908 | |||
| 1791 | Ga0207663_10003098 | |||
| 1792 | Ga0207663_10009226 | |||
| 1793 | Ga0207663_10013008 | |||
| 1794 | Ga0207663_10020518 | |||
| 1795 | Ga0207660_10019997 | |||
| 1796 | Ga0207660_10041731 | |||
| 1797 | Ga0207662_10017739 | |||
| 1798 | Ga0207657_10000500 | |||
| 1799 | Ga0207657_10001046 | |||
| 1800 | Ga0207657_10001931 | |||
| 1801 | Ga0207657_10014505 | |||
| 1802 | Ga0207657_10019153 | |||
| 1803 | Ga0207657_10022973 | |||
| 1804 | Ga0207657_10056995 | |||
| 1805 | Ga0207657_10069854 | |||
| 1806 | Ga0207649_10011519 | |||
| 1807 | Ga0207649_10024948 | |||
| 1808 | Ga0207652_10005399 | |||
| 1809 | Ga0207652_10151714 | |||
| 1810 | Ga0207646_10036601 | |||
| 1811 | Ga0207646_10080638 | |||
| 1812 | Ga0207694_10112758 | |||
| 1813 | Ga0207687_10031842 | |||
| 1814 | Ga0207687_10048253 | |||
| 1815 | Ga0207687_10096767 | |||
| 1816 | Ga0207687_10106529 | |||
| 1817 | Ga0207700_10005417 | |||
| 1818 | Ga0207700_10017243 | |||
| 1819 | Ga0207700_10034302 | |||
| 1820 | Ga0207700_10067327 | |||
| 1821 | Ga0207700_10233285 | |||
| 1822 | Ga0207664_10010163 | |||
| 1823 | Ga0207664_10026028 | |||
| 1824 | Ga0207664_10036943 | |||
| 1825 | Ga0207664_10059801 | |||
| 1826 | Ga0207664_10069742 | |||
| 1827 | Ga0207664_10075061 | |||
| 1828 | Ga0207664_10075416 | |||
| 1829 | Ga0207664_10086846 | |||
| 1830 | Ga0207664_10170476 | |||
| 1831 | Ga0207664_10231227 | |||
| 1832 | Ga0207644_10328402 | |||
| 1833 | Ga0207690_10025161 | |||
| 1834 | Ga0207690_10246022 | |||
| 1835 | Ga0207706_10010685 | |||
| 1836 | Ga0207706_10010784 | |||
| 1837 | Ga0207686_10030588 | |||
| 1838 | Ga0207686_10063426 | |||
| 1839 | Ga0207686_10089203 | |||
| 1840 | Ga0207686_10117078 | |||
| 1841 | Ga0207686_10147019 | |||
| 1842 | Ga0207709_10031676 | |||
| 1843 | Ga0207709_10051738 | |||
| 1844 | Ga0207709_10096258 | |||
| 1845 | Ga0207669_10049721 | |||
| 1846 | Ga0207669_10087587 | |||
| 1847 | Ga0207704_10243875 | |||
| 1848 | Ga0207665_10000322 | |||
| 1849 | Ga0207665_10001706 | |||
| 1850 | Ga0207691_10020470 | |||
| 1851 | Ga0207691_10058732 | |||
| 1852 | Ga0207711_10313235 | |||
| 1853 | Ga0207661_10021882 | |||
| 1854 | Ga0207661_10031932 | |||
| 1855 | Ga0207661_10043389 | |||
| 1856 | Ga0207661_10048769 | |||
| 1857 | Ga0207661_10051930 | |||
| 1858 | Ga0207661_10064740 | |||
| 1859 | Ga0207661_10068729 | |||
| 1860 | Ga0207661_10111791 | |||
| 1861 | Ga0207661_10160152 | |||
| 1862 | Ga0207661_10184040 | |||
| 1863 | Ga0207679_10178806 | |||
| 1864 | Ga0207667_10047297 | |||
| 1865 | Ga0207667_10066238 | |||
| 1866 | Ga0207667_10310229 | |||
| 1867 | Ga0207712_10058174 | |||
| 1868 | Ga0207712_10096319 | |||
| 1869 | Ga0207668_10059614 | |||
| 1870 | Ga0207640_10046445 | |||
| 1871 | Ga0207640_10087061 | |||
| 1872 | Ga0207658_10012227 | |||
| 1873 | Ga0207658_10185529 | |||
| 1874 | Ga0207677_10034516 | |||
| 1875 | Ga0207677_10044953 | |||
| 1876 | Ga0207677_10276846 | |||
| 1877 | Ga0207639_10304653 | |||
| 1878 | Ga0207639_10359622 | |||
| 1879 | Ga0207702_10124768 | |||
| 1880 | Ga0207702_10137771 | |||
| 1881 | Ga0207702_10181145 | |||
| 1882 | Ga0207702_10230346 | |||
| 1883 | Ga0207641_10071166 | |||
| 1884 | Ga0207648_10003355 | |||
| 1885 | Ga0207648_10083321 | |||
| 1886 | Ga0207648_10136115 | |||
| 1887 | Ga0207648_10188205 | |||
| 1888 | Ga0207676_10302980 | |||
| 1889 | Ga0207674_10030547 | |||
| 1890 | Ga0207674_10155408 | |||
| 1891 | Ga0207675_100003338 | |||
| 1892 | Ga0207675_100032560 | |||
| 1893 | Ga0207675_100104995 | |||
| 1894 | Ga0207675_100132972 | |||
| 1895 | Ga0207683_10000907 | |||
| 1896 | Ga0207683_10011436 | |||
| 1897 | Ga0207698_10184467 | |||
| 1898 | Ga0209998_10005198 | |||
| 1899 | Ga0207428_10000934 | |||
| 1900 | Ga0207428_10014460 | |||
| 1901 | Ga0207428_10021196 | |||
| 1902 | Ga0207428_10044392 | |||
| 1903 | Ga0207428_10076046 | |||
| 1904 | Ga0207428_10253317 | |||
| 1905 | Ga0268266_10332648 | |||
| 1906 | Ga0268264_10375064 | |||
| 1907 | Ga0265319_1022969 | |||
| 1908 | Ga0265334_10002668 | |||
| 1909 | Ga0265318_10000541 | |||
| 1910 | Ga0265336_10002072 | |||
| 1911 | Ga0265336_10013520 | |||
| 1912 | Ga0265338_10006253 | |||
| 1913 | Ga0265338_10071584 | |||
| 1914 | Ga0265338_10114613 | |||
| 1915 | Ga0265338_10141275 | |||
| 1916 | Ga0265330_10041490 | |||
| 1917 | Ga0265330_10052226 | |||
| 1918 | Ga0265325_10000949 | |||
| 1919 | Ga0265325_10006154 | |||
| 1920 | Ga0265329_10009253 | |||
| 1921 | Ga0265340_10004475 | |||
| 1922 | Ga0265340_10042262 | |||
| 1923 | Ga0265340_10070651 | |||
| 1924 | Ga0265339_10035428 | |||
| 1925 | Ga0265339_10064018 | |||
| 1926 | Ga0265327_10003872 | |||
| 1927 | Ga0265327_10004853 | |||
| 1928 | Ga0265327_10009219 | |||
| 1929 | Ga0265327_10081428 | |||
| 1930 | Ga0265316_10053194 | |||
| 1931 | Ga0265313_10001261 | |||
| 1932 | Ga0265313_10005640 | |||
| 1933 | Ga0265314_10004635 | |||
| 1934 | Ga0265314_10176459 | |||
| 1935 | Ga0316576_10011101 | |||
| 1936 | Ga0316576_10070493 | |||
| 1937 | Ga0316576_10109392 | |||
| 1938 | Ga0316578_10000145 | |||
| 1939 | Ga0307405_10036764 | |||
| 1940 | Ga0307416_100031422 | |||
| 1941 | Ga0307416_100165558 | |||
| 1942 | Ga0307416_100325252 | |||
| 1943 | Ga0307414_10370958 | |||
| 1944 | Ga0307415_100073578 | |||
| 1945 | Ga0316580_10003428 | |||
| 1946 | Ga0373948_0009547 | |||
| 1947 | Ga0373958_0010740 | |||
| 1948 | Ga0373928_0009411 | |||
| 1949 | Ga0373934_0080067 | |||
| 1950 | Ga0373944_0005847 | |||
| 1951 | Ga0373944_0008755 | |||
| 1952 | Ga0373941_0039088 | |||
| 1953 | Ga0373943_0001492 | |||
| 1954 | Ga0373943_0011200 | |||
| 1955 | Ga0373931_0047821 | |||
| 1956 | Ga0373931_0064446 | |||
| 1957 | Ga0373935_0023337 | |||
| 1958 | Ga0373935_0167083 | |||
| 1959 | Ga0373933_0120765 | |||
| 1960 | Ga0373933_0131302 | |||
| 1961 | Ga0373947_0001675 | |||
| 1962 | Ga0373947_0004617 | |||
| 1963 | Ga0373947_0023617 | |||
| 1964 | Ga0373937_0020040 | |||
| 1965 | Ga0316582_0026980 | |||
| 1966 | Ga0316584_0000210 | |||
| 1967 | Ga0373925_0002352 | |||
| 1968 | Ga0395899_0002892 | |||
| 1969 | Ga0395899_0004853 | |||
| 1970 | Ga0395899_0006387 | |||
| 1971 | Ga0395899_0012260 | |||
| 1972 | Ga0395899_0051640 | |||
| 1973 | Ga0395899_0067382 | |||
| 1974 | Ga0395900_0003129 | |||
| 1975 | Ga0395900_0006147 | |||
| 1976 | Ga0395900_0010590 | |||
| 1977 | Ga0395900_0015326 | |||
| 1978 | Ga0395900_0032766 | |||
| 1979 | Ga0395900_0051474 | |||
| 1980 | Ga0395900_0057081 | |||
| 1981 | Ga0395900_0059150 | |||
| 1982 | Ga0395900_0060264 | |||
| 1983 | Ga0395900_0073144 | |||
| 1984 | Ga0395900_0106957 | |||
| 1985 | Ga0395900_0247194 | |||
| 1986 | Ga0395900_0285013 | |||
| 1987 | Ga0395898_0001406 | |||
| 1988 | Ga0395898_0002816 | |||
| 1989 | Ga0395898_0006113 | |||
| 1990 | Ga0395898_0014630 | |||
| 1991 | Ga0395898_0021048 | |||
| 1992 | Ga0395898_0027384 | |||
| 1993 | Ga0395898_0028358 | |||
| 1994 | Ga0395898_0032012 | |||
| 1995 | Ga0395898_0051521 | |||
| 1996 | Ga0395898_0059980 | |||
| 1997 | Ga0395898_0092008 | |||
| 1998 | Ga0395898_0105290 | |||
| 1999 | Ga0395898_0117019 | |||
| 2000 | Ga0395898_0267610 | |||
| 2001 | Ga0395898_0427411 | |||
| 2002 | Ga0395905_0000786 | |||
| 2003 | Ga0395905_0012807 | |||
| 2004 | Ga0395905_0016305 | |||
| 2005 | Ga0395905_0032268 | |||
| 2006 | Ga0395905_0072168 | |||
| 2007 | Ga0395905_0076779 | |||
| 2008 | Ga0395905_0084025 | |||
| 2009 | Ga0395905_0115141 | |||
| 2010 | Ga0395905_0157922 | |||
| 2011 | Ga0395905_0257888 | |||
| 2012 | Ga0395905_0336185 | |||
| 2013 | Ga0395901_0003238 | |||
| 2014 | Ga0395901_0003793 | |||
| 2015 | Ga0395901_0007737 | |||
| 2016 | Ga0395901_0007808 | |||
| 2017 | Ga0395901_0019406 | |||
| 2018 | Ga0395901_0019981 | |||
| 2019 | Ga0395901_0024522 | |||
| 2020 | Ga0395901_0027511 | |||
| 2021 | Ga0395901_0028742 | |||
| 2022 | Ga0395901_0044951 | |||
| 2023 | Ga0395901_0052533 | |||
| 2024 | Ga0395901_0053752 | |||
| 2025 | Ga0395901_0101385 | |||
| 2026 | Ga0395901_0143034 | |||
| 2027 | Ga0395901_0160781 | |||
| 2028 | Ga0395901_0163814 | |||
| 2029 | Ga0395901_0171832 | |||
| 2030 | Ga0395901_0259934 | |||
| 2031 | Ga0395901_0404868 | |||
| 2032 | Ga0395901_0430990 | |||
| 2033 | Ga0395901_0589880 | |||
| 2034 | Ga0436365_1041009 | |||
| 2035 | Ga0436365_1159630 | |||
| 2036 | Ga0436365_1203947 | |||
| 2037 | Ga0436365_1437009 | |||
| 2038 | Ga0436365_1674627 | |||
| 2039 | Ga0436360_0070085 | |||
| 2040 | Ga0436363_1684106 | |||
| 2041 | Ga0439453_0012174 | |||
| 2042 | Ga0439461_0008158 | |||
| 2043 | Ga0451853_1423526 | |||
| 2044 | Ga0439433_0001766 | |||
| 2045 | Ga0439442_018737 | |||
| 2046 | Ga0439448_0044030 | |||
| 2047 | Ga0439462_0017785 | |||
| 2048 | Ga0439446_0004319 | |||
| 2049 | Ga0451577_0037639 | |||
| 2050 | Ga0466969_0002202 | |||
| 2051 | Ga0453683_0011143 | |||
| 2052 | Ga0453683_0012532 | |||
| 2053 | Ga0466965_0015015 | |||
| 2054 | Ga0466966_0018779 | |||
| 2055 | Ga0466961_0007507 | |||
| 2056 | Ga0466961_0028228 | |||
| 2057 | Ga0466961_0029817 | |||
| 2058 | Ga0466961_0042190 | |||
| 2059 | Ga0466961_0052448 | |||
| 2060 | Ga0466961_0183711 | |||
| 2061 | Ga0466963_0000430 | |||
| 2062 | Ga0466963_0001559 | |||
| 2063 | Ga0466963_0003053 | |||
| 2064 | Ga0466963_0006703 | |||
| 2065 | Ga0466963_0007066 | |||
| 2066 | Ga0466963_0008450 | |||
| 2067 | Ga0466963_0008744 | |||
| 2068 | Ga0466963_0010043 | |||
| 2069 | Ga0466963_0010163 | |||
| 2070 | Ga0466963_0011078 | |||
| 2071 | Ga0466963_0016280 | |||
| 2072 | Ga0466963_0017063 | |||
| 2073 | Ga0466963_0017321 | |||
| 2074 | Ga0466963_0018744 | |||
| 2075 | Ga0466963_0037144 | |||
| 2076 | Ga0466963_0039571 | |||
| 2077 | Ga0466963_0052899 | |||
| 2078 | Ga0466963_0078307 | |||
| 2079 | Ga0466963_0083433 | |||
| 2080 | Ga0466963_0140249 | |||
| 2081 | Ga0466964_0001644 | |||
| 2082 | Ga0466964_0004155 | |||
| 2083 | Ga0466964_0004602 | |||
| 2084 | Ga0466964_0013552 | |||
| 2085 | Ga0466964_0020056 | |||
| 2086 | Ga0466964_0027950 | |||
| 2087 | Ga0466964_0097470 | |||
| 2088 | Ga0453684_0128288 | |||
| 2089 | Ga0466971_0000571 | |||
| 2090 | Ga0466971_0003068 | |||
| 2091 | Ga0466968_0001242 | |||
| 2092 | Ga0466968_0001271 | |||
| 2093 | Ga0466968_0005848 | |||
| 2094 | Ga0466968_0014588 | |||
| 2095 | Ga0466968_0016358 | |||
| 2096 | Ga0466970_0005446 | |||
| 2097 | Ga0466970_0056479 | |||
| 2098 | Ga0466957_0005254 | |||
| 2099 | Ga0466957_0008394 | |||
| 2100 | Ga0466957_0010147 | |||
| 2101 | Ga0466957_0010946 | |||
| 2102 | Ga0466957_0015241 | |||
| 2103 | Ga0466957_0020548 | |||
| 2104 | Ga0466957_0024346 | |||
| 2105 | Ga0466957_0027194 | |||
| 2106 | Ga0466957_0050273 | |||
| 2107 | Ga0466957_0142476 | |||
| 2108 | Ga0466960_0007597 | |||
| 2109 | Ga0466960_0009601 | |||
| 2110 | Ga0466959_0000479 | |||
| 2111 | Ga0466959_0034099 | |||
| 2112 | Ga0466959_0044815 | |||
| 2113 | Ga0466959_0056480 | |||
| 2114 | Ga0466959_0065876 | |||
| 2115 | Ga0466959_0148052 | |||
| 2116 | Ga0466959_0153122 | |||
| 2117 | Ga0451576_0252855 | |||
| 2118 | Ga0451576_0266539 | |||
| 2119 | Ga0466958_0001620 | |||
| 2120 | Ga0466958_0002869 | |||
| 2121 | Ga0466958_0008231 | |||
| 2122 | Ga0466958_0008855 | |||
| 2123 | Ga0466958_0012290 | |||
| 2124 | Ga0466958_0020188 | |||
| 2125 | Ga0466958_0025054 | |||
| 2126 | Ga0466958_0038479 | |||
| 2127 | Ga0466958_0048445 | |||
| 2128 | Ga0466958_0060024 | |||
| 2129 | Ga0466958_0114145 | |||
| 2130 | Ga0466958_0116083 | |||
| 2131 | Ga0466958_0251484 | |||
| 2132 | Ga0466967_0002221 | |||
| 2133 | Ga0466967_0002496 | |||
| 2134 | Ga0466967_0006144 | |||
| 2135 | Ga0466967_0006258 | |||
| 2136 | Ga0466967_0008012 | |||
| 2137 | Ga0466967_0010163 | |||
| 2138 | Ga0466967_0013224 | |||
| 2139 | Ga0466967_0015777 | |||
| 2140 | Ga0466967_0025288 | |||
| 2141 | Ga0466967_0028405 | |||
| 2142 | Ga0466967_0030656 | |||
| 2143 | Ga0466967_0036182 | |||
| 2144 | Ga0466967_0041940 | |||
| 2145 | Ga0466967_0043843 | |||
| 2146 | Ga0466967_0045632 | |||
| 2147 | Ga0466967_0049750 | |||
| 2148 | Ga0466967_0049997 | |||
| 2149 | Ga0466967_0053383 | |||
| 2150 | Ga0466967_0057898 | |||
| 2151 | Ga0466967_0058407 | |||
| 2152 | Ga0466967_0073861 | |||
| 2153 | Ga0466967_0085779 | |||
| 2154 | Ga0466967_0105828 | |||
| 2155 | Ga0466967_0116544 | |||
| 2156 | Ga0466967_0122778 | |||
| 2157 | Ga0466967_0146681 | |||
| 2158 | Ga0466967_0150267 | |||
| 2159 | Ga0466967_0170935 | |||
| 2160 | Ga0466967_0173080 | |||
| 2161 | Ga0466967_0183041 | |||
| 2162 | Ga0466967_0184918 | |||
| 2163 | Ga0466967_0199870 | |||
| 2164 | Ga0466967_0201895 | |||
| 2165 | Ga0466967_0261006 | |||
| 2166 | Ga0466967_0379309 | |||
| 2167 | Ga0466967_0596433 | |||
| 2168 | Ga0466967_0789713 | |||
| 2169 | Ga0495592_0000125 | |||
| 2170 | Ga0495592_0020342 | |||
| 2171 | Ga0495592_0041170 | |||
| 2172 | Ga0495592_0171125 | |||
| 2173 | Ga0495592_0204192 | |||
| 2174 | Ga0495603_0002588 | |||
| 2175 | Ga0495603_0003187 | |||
| 2176 | Ga0495603_0060076 | |||
| 2177 | Ga0495603_0072196 | |||
| 2178 | Ga0495603_0076174 | |||
| 2179 | Ga0495603_0105830 | |||
| 2180 | Ga0495629_0004786 | |||
| 2181 | Ga0495629_0129220 | |||
| 2182 | Ga0495629_0136817 | |||
| 2183 | Ga0495629_0164767 | |||
| 2184 | Ga0495629_0215737 | |||
| 2185 | Ga0495629_0265684 | |||
| 2186 | Ga0495641_0000455 | |||
| 2187 | Ga0495641_0003498 | |||
| 2188 | Ga0495651_0000104 | |||
| 2189 | Ga0495651_0002454 | |||
| 2190 | Ga0495651_0023417 | |||
| 2191 | Ga0495651_0051543 | |||
| 2192 | Ga0495653_0004604 | |||
| 2193 | Ga0495653_0005005 | |||
| 2194 | Ga0495653_0025029 | |||
| 2195 | Ga0495653_0086897 | |||
| 2196 | Ga0495653_0192707 | |||
| 2197 | Ga0495582_0008896 | |||
| 2198 | Ga0495582_0009208 | |||
| 2199 | Ga0495582_0035419 | |||
| 2200 | Ga0495582_0139131 | |||
| 2201 | Ga0495582_0169684 | |||
| 2202 | Ga0495605_0018697 | |||
| 2203 | Ga0495605_0106923 | |||
| 2204 | Ga0495639_0000871 | |||
| 2205 | Ga0495662_0018674 | |||
| 2206 | Ga0495662_0103207 | |||
| 2207 | Ga0495664_0025767 | |||
| 2208 | Ga0495664_0126694 | |||
| 2209 | Ga0495584_0036926 | |||
| 2210 | Ga0495584_0038990 | |||
| 2211 | Ga0495594_0000352 | |||
| 2212 | Ga0495596_0059302 | |||
| 2213 | Ga0495607_0043294 | |||
| 2214 | Ga0495608_0000595 | |||
| 2215 | Ga0495608_0013071 | |||
| 2216 | Ga0495608_0017819 | |||
| 2217 | Ga0495608_0025993 | |||
| 2218 | Ga0495608_0084370 | |||
| 2219 | Ga0495608_0094446 | |||
| 2220 | Ga0495618_0006629 | |||
| 2221 | Ga0495618_0013492 | |||
| 2222 | Ga0495618_0050218 | |||
| 2223 | Ga0495628_0000040 | |||
| 2224 | Ga0495628_0008773 | |||
| 2225 | Ga0495628_0008875 | |||
| 2226 | Ga0495628_0040955 | |||
| 2227 | Ga0495628_0219966 | |||
| 2228 | Ga0495628_0262752 | |||
| 2229 | Ga0495630_0003720 | |||
| 2230 | Ga0495630_0017698 | |||
| 2231 | Ga0495630_0019912 | |||
| 2232 | Ga0495630_0027300 | |||
| 2233 | Ga0495630_0045027 | |||
| 2234 | Ga0495630_0080951 | |||
| 2235 | Ga0495630_0089104 | |||
| 2236 | Ga0495630_0116135 | |||
| 2237 | Ga0495630_0123402 | |||
| 2238 | Ga0495630_0159142 | |||
| 2239 | Ga0495630_0189550 | |||
| 2240 | Ga0495644_0099866 | |||
| 2241 | Ga0495666_0007047 | |||
| 2242 | Ga0495666_0015658 | |||
| 2243 | Ga0495652_0000298 | |||
| 2244 | Ga0495652_0093106 | |||
| 2245 | Ga0495652_0110145 | |||
| 2246 | Ga0495652_0115375 | |||
| 2247 | Ga0495652_0126607 | |||
| 2248 | Ga0495665_0002244 | |||
| 2249 | Ga0495665_0074768 | |||
| 2250 | Ga0495640_0001758 | |||
| 2251 | Ga0495640_0044379 | |||
| 2252 | Ga0495640_0058395 | |||
| 2253 | Ga0495640_0061616 | |||
| 2254 | Ga0495640_0084847 | |||
| 2255 | Ga0495640_0110951 | |||
| 2256 | Ga0495587_0000212 | |||
| 2257 | Ga0495587_0025540 | |||
| 2258 | Ga0495587_0032844 | |||
| 2259 | Ga0495587_0061580 | |||
| 2260 | Ga0495609_0035401 | |||
| 2261 | Ga0495609_0049744 | |||
| 2262 | Ga0495645_0000035 | |||
| 2263 | Ga0495645_0072687 | |||
| 2264 | Ga0495645_0084403 | |||
| 2265 | Ga0495645_0161612 | |||
| 2266 | Ga0495622_0029075 | |||
| 2267 | Ga0495667_0025972 | |||
| 2268 | Ga0495667_0029233 | |||
| 2269 | Ga0495667_0133415 | |||
| 2270 | Ga0495656_0003461 | |||
| 2271 | Ga0495634_0022140 | |||
| 2272 | Ga0495634_0089748 | |||
| 2273 | Ga0495634_0175114 | |||
| 2274 | Ga0495611_0030048 | |||
| 2275 | Ga0495635_0031027 | |||
| 2276 | Ga0495635_0128027 | |||
| 2277 | Ga0495659_0003008 | |||
| 2278 | Ga0495661_0113819 | |||
| 2279 | Ga0495588_0001261 | |||
| 2280 | Ga0495657_0002891 | |||
| 2281 | Ga0495657_0044094 | |||
| 2282 | Ga0495657_0047828 | |||
| 2283 | Ga0495657_0048638 | |||
| 2284 | Ga0495599_0000009 | |||
| 2285 | Ga0495599_0096758 | |||
| 2286 | Ga0495599_0170355 | |||
| 2287 | Ga0495599_0282386 | |||
| 2288 | Ga0495623_0001465 | |||
| 2289 | Ga0495623_0032031 | |||
| 2290 | Ga0495623_0063824 | |||
| 2291 | Ga0495646_0006560 | |||
| 2292 | Ga0495646_0019252 | |||
| 2293 | Ga0495647_0027036 | |||
| 2294 | Ga0495647_0039174 | |||
| 2295 | Ga0495658_0000943 | |||
| 2296 | Ga0495658_0004844 | |||
| 2297 | Ga0495658_0150261 | |||
| 2298 | Ga0495613_0001715 | |||
| 2299 | Ga0495613_0005719 | |||
| 2300 | Ga0495613_0089060 | |||
| 2301 | Ga0495613_0158948 | |||
| 2302 | Ga0495613_0228359 | |||
| 2303 | Ga0495613_0254173 | |||
| 2304 | Ga0495624_0056006 | |||
| 2305 | Ga0495670_0065612 | |||
| 2306 | Ga0495670_0088604 | |||
| 2307 | Ga0495589_0142309 | |||
| 2308 | Ga0495600_0018215 | |||
| 2309 | Ga0495600_0022173 | |||
| 2310 | Ga0495600_0069166 | |||
| 2311 | Ga0495581_0000618 | |||
| 2312 | Ga0495581_0015527 | |||
| 2313 | Ga0495604_0000120 | |||
| 2314 | Ga0495604_0172875 | |||
| 2315 | Ga0495604_0175538 | |||
| 2316 | Ga0495674_0002761 | |||
| 2317 | Ga0495674_0031685 | |||
| 2318 | Ga0495674_0038281 | |||
| 2319 | Ga0495674_0040406 | |||
| 2320 | Ga0495674_0087891 | |||
| 2321 | Ga0495674_0115831 | |||
| 2322 | Ga0495674_0175200 | |||
| 2323 | Ga0495676_0006670 | |||
| 2324 | Ga0495676_0009347 | |||
| 2325 | Ga0495676_0143535 | |||
| 2326 | Ga0495680_0000280 | |||
| 2327 | Ga0495680_0002774 | |||
| 2328 | Ga0495680_0004409 | |||
| 2329 | Ga0495680_0008617 | |||
| 2330 | Ga0495680_0022786 | |||
| 2331 | Ga0495680_0032999 | |||
| 2332 | Ga0495680_0061497 | |||
| 2333 | Ga0495680_0105614 | |||
| 2334 | Ga0495680_0154818 | |||
| 2335 | Ga0495675_0000137 | |||
| 2336 | Ga0495675_0046463 | |||
| 2337 | Ga0495675_0109399 | |||
| 2338 | Ga0495677_0060035 | |||
| 2339 | Ga0495677_0142568 | |||
| 2340 | Ga0495679_021229 | |||
| 2341 | Ga0495684_0003498 | |||
| 2342 | Ga0495684_0003793 | |||
| 2343 | Ga0495684_0013160 | |||
| 2344 | Ga0495684_0028726 | |||
| 2345 | Ga0495684_0043393 | |||
| 2346 | Ga0495684_0096425 | |||
| 2347 | Ga0495684_0142305 | |||
| 2348 | Ga0495593_0003213 | |||
| 2349 | Ga0495602_0001635 | |||
| 2350 | Ga0495602_0025218 | |||
| 2351 | Ga0495602_0038656 | |||
| 2352 | Ga0495602_0099776 | |||
| 2353 | Ga0495602_0118124 | |||
| 2354 | Ga0495602_0126326 | |||
| 2355 | Ga0495614_0015578 | |||
| 2356 | Ga0496100_0009180 | |||
| 2357 | Ga0496100_0024253 | |||
| 2358 | Ga0496100_0050713 | |||
| 2359 | Ga0496100_0087301 | |||
| 2360 | Ga0496100_0087517 | |||
| 2361 | Ga0496100_0143041 | |||
| 2362 | Ga0496100_0143662 | |||
| 2363 | Ga0496101_0020105 | |||
| 2364 | Ga0496101_0042290 | |||
| 2365 | Ga0496101_0047319 | |||
| 2366 | Ga0496101_0057734 | |||
| 2367 | Ga0496101_0059389 | |||
| 2368 | Ga0496101_0065916 | |||
| 2369 | Ga0496101_0075050 | |||
| 2370 | Ga0496101_0081026 | |||
| 2371 | Ga0496101_0082217 | |||
| 2372 | Ga0496102_0013736 | |||
| 2373 | Ga0496102_0015401 | |||
| 2374 | Ga0496102_0050155 | |||
| 2375 | Ga0496102_0056157 | |||
| 2376 | Ga0496102_0060977 | |||
| 2377 | Ga0496102_0128722 | |||
| 2378 | Ga0496102_0144504 | |||
| 2379 | Ga0496102_0278908 | |||
| 2380 | Ga0496102_0441322 | |||
| 2381 | Ga0496103_0015177 | |||
| 2382 | Ga0496103_0018176 | |||
| 2383 | Ga0496103_0041829 | |||
| 2384 | Ga0496103_0042171 | |||
| 2385 | Ga0496103_0156346 | |||
| 2386 | Ga0496104_0000288 | |||
| 2387 | Ga0496104_0002201 | |||
| 2388 | Ga0496104_0003018 | |||
| 2389 | Ga0496104_0008275 | |||
| 2390 | Ga0496104_0012649 | |||
| 2391 | Ga0496104_0012732 | |||
| 2392 | Ga0496104_0014445 | |||
| 2393 | Ga0496104_0098374 | |||
| 2394 | Ga0496104_0249842 | |||
| 2395 | Ga0496104_0495841 | |||
| 2396 | Ga0496104_0562447 | |||
| 2397 | Ga0496105_0001581 | |||
| 2398 | Ga0496105_0002146 | |||
| 2399 | Ga0496105_0002776 | |||
| 2400 | Ga0496105_0004733 | |||
| 2401 | Ga0496105_0004966 | |||
| 2402 | Ga0496105_0006879 | |||
| 2403 | Ga0496105_0007108 | |||
| 2404 | Ga0496105_0046089 | |||
| 2405 | Ga0496105_0047377 | |||
| 2406 | Ga0496105_0069465 | |||
| 2407 | Ga0496105_0073408 | |||
| 2408 | Ga0496105_0134161 | |||
| 2409 | Ga0496105_0317832 | |||
| 2410 | Ga0496106_0020665 | |||
| 2411 | Ga0496106_0046880 | |||
| 2412 | Ga0496106_0083964 | |||
| 2413 | Ga0496106_0116707 | |||
| 2414 | Ga0496106_0150046 | |||
| 2415 | Ga0496106_0235753 | |||
| 2416 | Ga0496107_0008952 | |||
| 2417 | Ga0496107_0012664 | |||
| 2418 | Ga0496107_0055230 | |||
| 2419 | Ga0496107_0059556 | |||
| 2420 | Ga0496107_0101876 | |||
| 2421 | Ga0496107_0202545 | |||
| 2422 | Ga0496108_0000488 | |||
| 2423 | Ga0496108_0005783 | |||
| 2424 | Ga0496108_0008358 | |||
| 2425 | Ga0496108_0008784 | |||
| 2426 | Ga0496108_0013131 | |||
| 2427 | Ga0496108_0081342 | |||
| 2428 | Ga0496108_0083028 | |||
| 2429 | Ga0496109_0003085 | |||
| 2430 | Ga0496109_0004872 | |||
| 2431 | Ga0496109_0007811 | |||
| 2432 | Ga0496109_0014579 | |||
| 2433 | Ga0496109_0080298 | |||
| 2434 | Ga0496109_0089324 | |||
| 2435 | Ga0496109_0095735 | |||
| 2436 | Ga0496109_0144396 | |||
| 2437 | Ga0496109_0153872 | |||
| 2438 | Ga0496109_0176924 | |||
| 2439 | Ga0496109_0193260 | |||
| 2440 | Ga0496109_0236387 | |||
| 2441 | Ga0496109_0294386 | |||
| 2442 | Ga0496109_0384129 | |||
| 2443 | Ga0496109_0607902 | |||
| 2444 | Ga0496110_0016414 | |||
| 2445 | Ga0496110_0022355 | |||
| 2446 | Ga0496110_0022538 | |||
| 2447 | Ga0496110_0033713 | |||
| 2448 | Ga0496110_0037483 | |||
| 2449 | Ga0496110_0037654 | |||
| 2450 | Ga0496110_0051079 | |||
| 2451 | Ga0496110_0086044 | |||
| 2452 | Ga0496110_0092493 | |||
| 2453 | Ga0496110_0106849 | |||
| 2454 | Ga0496110_0139601 | |||
| 2455 | Ga0496110_0180958 | |||
| 2456 | Ga0496111_0000604 | |||
| 2457 | Ga0496111_0019304 | |||
| 2458 | Ga0496111_0020875 | |||
| 2459 | Ga0496111_0050050 | |||
| 2460 | Ga0496111_0088342 | |||
| 2461 | Ga0496111_0092557 | |||
| 2462 | Ga0496111_0200123 | |||
| 2463 | Ga0496112_0000715 | |||
| 2464 | Ga0496112_0001042 | |||
| 2465 | Ga0496112_0002767 | |||
| 2466 | Ga0496112_0014719 | |||
| 2467 | Ga0496112_0044861 | |||
| 2468 | Ga0496112_0146187 | |||
| 2469 | Ga0496112_0181306 | |||
| 2470 | Ga0496112_0234523 | |||
| 2471 | Ga0496112_0235780 | |||
| 2472 | Ga0496112_0297927 | |||
| 2473 | Ga0496113_0000904 | |||
| 2474 | Ga0496113_0089995 | |||
| 2475 | Ga0496113_0149401 | |||
| 2476 | Ga0496114_0002005 | |||
| 2477 | Ga0496114_0002698 | |||
| 2478 | Ga0496114_0005403 | |||
| 2479 | Ga0496114_0009509 | |||
| 2480 | Ga0496114_0014287 | |||
| 2481 | Ga0496114_0033577 | |||
| 2482 | Ga0496114_0052280 | |||
| 2483 | Ga0496114_0086337 | |||
| 2484 | Ga0496114_0128642 | |||
| 2485 | Ga0496114_0140860 | |||
| 2486 | Ga0496114_0141978 | |||
| 2487 | Ga0496114_0217541 | |||
| 2488 | Ga0496114_0233486 | |||
| 2489 | Ga0496114_0249453 | |||
| 2490 | Ga0496114_0277508 | |||
| 2491 | Ga0496114_0337051 | |||
| 2492 | Ga0496115_0000494 | |||
| 2493 | Ga0496115_0002797 | |||
| 2494 | Ga0496115_0007279 | |||
| 2495 | Ga0496115_0019707 | |||
| 2496 | Ga0496115_0043676 | |||
| 2497 | Ga0496115_0077080 | |||
| 2498 | Ga0496115_0091187 | |||
| 2499 | Ga0496115_0092657 | |||
| 2500 | Ga0496115_0099542 | |||
| 2501 | Ga0496115_0112872 | |||
| 2502 | Ga0496115_0158560 | |||
| 2503 | Ga0496115_0174156 | |||
| 2504 | Ga0496115_0208850 | |||
| 2505 | Ga0496115_0312521 | |||
| 2506 | Ga0501307_008991 | |||
| 2507 | Ga0501031_0002608 | |||
| 2508 | Ga0501031_0006204 | |||
| 2509 | Ga0501031_0029371 | |||
| 2510 | Ga0501031_0039144 | |||
| 2511 | Ga0501031_0166877 | |||
| 2512 | Ga0501031_0343713 | |||
| 2513 | Ga0501032_0001008 | |||
| 2514 | Ga0501032_0098395 | |||
| 2515 | Ga0501033_0002030 | |||
| 2516 | Ga0501033_0089834 | |||
| 2517 | Ga0501033_0093848 | |||
| 2518 | Ga0501033_0131363 | |||
| 2519 | Ga0501033_0272644 | |||
| 2520 | Ga0501034_0006109 | |||
| 2521 | Ga0501034_0010389 | |||
| 2522 | Ga0501034_0045662 | |||
| 2523 | Ga0501034_0102207 | |||
| 2524 | Ga0501034_0138299 | |||
| 2525 | Ga0501034_0143406 | |||
| 2526 | Ga0501036_0000259 | |||
| 2527 | Ga0501036_0005680 | |||
| 2528 | Ga0501036_0042308 | |||
| 2529 | Ga0501036_0067581 | |||
| 2530 | Ga0501036_0118044 | |||
| 2531 | Ga0501036_0176340 | |||
| 2532 | Ga0501037_0000205 | |||
| 2533 | Ga0501037_0030488 | |||
| 2534 | Ga0501037_0048820 | |||
| 2535 | Ga0501037_0061840 | |||
| 2536 | Ga0501037_0327783 | |||
| 2537 | Ga0501038_0000771 | |||
| 2538 | Ga0501038_0009846 | |||
| 2539 | Ga0501038_0057309 | |||
| 2540 | Ga0501038_0071914 | |||
| 2541 | Ga0501038_0115083 | |||
| 2542 | Ga0501038_0310496 | |||
| 2543 | Ga0501039_0000149 | |||
| 2544 | Ga0501039_0008886 | |||
| 2545 | Ga0501039_0010904 | |||
| 2546 | Ga0501039_0043125 | |||
| 2547 | Ga0501039_0091230 | |||
| 2548 | Ga0501039_0138075 | |||
| 2549 | Ga0501039_0411486 | |||
| 2550 | Ga0501040_0001153 | |||
| 2551 | Ga0501040_0003109 | |||
| 2552 | Ga0501040_0006410 | |||
| 2553 | Ga0501040_0018389 | |||
| 2554 | Ga0501040_0021630 | |||
| 2555 | Ga0501040_0024737 | |||
| 2556 | Ga0501040_0043845 | |||
| 2557 | Ga0501040_0064922 | |||
| 2558 | Ga0501040_0067524 | |||
| 2559 | Ga0501040_0141097 | |||
| 2560 | Ga0501040_0316681 | |||
| 2561 | Ga0501041_0000092 | |||
| 2562 | Ga0501041_0000426 | |||
| 2563 | Ga0501041_0003403 | |||
| 2564 | Ga0501041_0005613 | |||
| 2565 | Ga0501041_0008904 | |||
| 2566 | Ga0501041_0047244 | |||
| 2567 | Ga0501041_0090433 | |||
| 2568 | Ga0501042_0001259 | |||
| 2569 | Ga0501042_0001326 | |||
| 2570 | Ga0501042_0005053 | |||
| 2571 | Ga0501042_0014163 | |||
| 2572 | Ga0501042_0016716 | |||
| 2573 | Ga0501042_0028191 | |||
| 2574 | Ga0501042_0124002 | |||
| 2575 | Ga0501042_0132793 | |||
| 2576 | Ga0501042_0339527 | |||
| 2577 | Ga0501043_0000217 | |||
| 2578 | Ga0501043_0020703 | |||
| 2579 | Ga0501043_0067363 | |||
| 2580 | Ga0501043_0073810 | |||
| 2581 | Ga0501046_0001786 | |||
| 2582 | Ga0501046_0003483 | |||
| 2583 | Ga0501046_0031351 | |||
| 2584 | Ga0501046_0051090 | |||
| 2585 | Ga0501046_0098171 | |||
| 2586 | Ga0501046_0228896 | |||
| 2587 | Ga0501047_0001439 | |||
| 2588 | Ga0501047_0011868 | |||
| 2589 | Ga0501047_0090343 | |||
| 2590 | Ga0501047_0109719 | |||
| 2591 | Ga0501048_0000345 | |||
| 2592 | Ga0501048_0005592 | |||
| 2593 | Ga0501048_0014732 | |||
| 2594 | Ga0501048_0037228 | |||
| 2595 | Ga0501048_0041067 | |||
| 2596 | Ga0501048_0042735 | |||
| 2597 | Ga0501048_0062206 | |||
| 2598 | Ga0501048_0168068 | |||
| 2599 | Ga0501048_0321511 | |||
| 2600 | Ga0501067_0001525 | |||
| 2601 | Ga0501067_0003105 | |||
| 2602 | Ga0501067_0035182 | |||
| 2603 | Ga0501067_0055144 | |||
| 2604 | Ga0501067_0100244 | |||
| 2605 | Ga0501067_0103576 | |||
| 2606 | Ga0501068_0000158 | |||
| 2607 | Ga0501068_0007257 | |||
| 2608 | Ga0501068_0010420 | |||
| 2609 | Ga0501068_0024871 | |||
| 2610 | Ga0501068_0039784 | |||
| 2611 | Ga0501068_0122887 | |||
| 2612 | Ga0501068_0178950 | |||
| 2613 | Ga0501069_0004840 | |||
| 2614 | Ga0501069_0005068 | |||
| 2615 | Ga0501069_0011257 | |||
| 2616 | Ga0501069_0012646 | |||
| 2617 | Ga0501069_0016981 | |||
| 2618 | Ga0501069_0041440 | |||
| 2619 | Ga0501069_0055477 | |||
| 2620 | Ga0501069_0146039 | |||
| 2621 | Ga0501070_0007733 | |||
| 2622 | Ga0501070_0021479 | |||
| 2623 | Ga0501070_0058859 | |||
| 2624 | Ga0501070_0074282 | |||
| 2625 | Ga0501070_0131558 | |||
| 2626 | Ga0501070_0139422 | |||
| 2627 | Ga0501070_0359629 | |||
| 2628 | Ga0501071_0000097 | |||
| 2629 | Ga0501071_0008697 | |||
| 2630 | Ga0501071_0012044 | |||
| 2631 | Ga0501071_0015914 | |||
| 2632 | Ga0501071_0020464 | |||
| 2633 | Ga0501071_0023711 | |||
| 2634 | Ga0501071_0024819 | |||
| 2635 | Ga0501071_0033359 | |||
| 2636 | Ga0501071_0037141 | |||
| 2637 | Ga0501071_0113756 | |||
| 2638 | Ga0501071_0134280 | |||
| 2639 | Ga0501072_0000248 | |||
| 2640 | Ga0501072_0005632 | |||
| 2641 | Ga0501072_0007574 | |||
| 2642 | Ga0501072_0042963 | |||
| 2643 | Ga0501072_0072520 | |||
| 2644 | Ga0501072_0078261 | |||
| 2645 | Ga0501072_0201124 | |||
| 2646 | Ga0501072_0207790 | |||
| 2647 | Ga0501072_0351865 | |||
| 2648 | Ga0501073_0004502 | |||
| 2649 | Ga0501073_0020584 | |||
| 2650 | Ga0501073_0075815 | |||
| 2651 | Ga0501074_0003746 | |||
| 2652 | Ga0501074_0007316 | |||
| 2653 | Ga0501074_0007464 | |||
| 2654 | Ga0501074_0017408 | |||
| 2655 | Ga0501074_0024653 | |||
| 2656 | Ga0501074_0036149 | |||
| 2657 | Ga0501074_0041770 | |||
| 2658 | Ga0501074_0047886 | |||
| 2659 | Ga0501074_0207762 | |||
| 2660 | Ga0501074_0232497 | |||
| 2661 | Ga0501074_0290395 | |||
| 2662 | Ga0501075_0000701 | |||
| 2663 | Ga0501075_0000729 | |||
| 2664 | Ga0501075_0006520 | |||
| 2665 | Ga0501075_0017532 | |||
| 2666 | Ga0501075_0039441 | |||
| 2667 | Ga0501075_0071433 | |||
| 2668 | Ga0501076_0000734 | |||
| 2669 | Ga0501076_0008186 | |||
| 2670 | Ga0501076_0010550 | |||
| 2671 | Ga0501076_0015180 | |||
| 2672 | Ga0501076_0015217 | |||
| 2673 | Ga0501076_0023789 | |||
| 2674 | Ga0501076_0042465 | |||
| 2675 | Ga0501076_0047245 | |||
| 2676 | Ga0501076_0191736 | |||
| 2677 | Ga0501076_0202018 | |||
| 2678 | Ga0501076_0223566 | |||
| 2679 | Ga0501076_0439230 | |||
| 2680 | Ga0501077_0000132 | |||
| 2681 | Ga0501077_0004551 | |||
| 2682 | Ga0501077_0005321 | |||
| 2683 | Ga0501077_0010909 | |||
| 2684 | Ga0501077_0015387 | |||
| 2685 | Ga0501077_0024165 | |||
| 2686 | Ga0501079_0002142 | |||
| 2687 | Ga0501079_0003515 | |||
| 2688 | Ga0501079_0003795 | |||
| 2689 | Ga0501079_0008320 | |||
| 2690 | Ga0501079_0009532 | |||
| 2691 | Ga0501079_0063627 | |||
| 2692 | Ga0501079_0065388 | |||
| 2693 | Ga0501079_0075314 | |||
| 2694 | Ga0501079_0092625 | |||
| 2695 | Ga0501079_0114298 | |||
| 2696 | Ga0501079_0122669 | |||
| 2697 | Ga0501080_0005018 | |||
| 2698 | Ga0501080_0013013 | |||
| 2699 | Ga0501080_0019728 | |||
| 2700 | Ga0501080_0057179 | |||
| 2701 | Ga0501080_0067444 | |||
| 2702 | Ga0501080_0095992 | |||
| 2703 | Ga0501080_0195209 | |||
| 2704 | Ga0501080_0203365 | |||
| 2705 | Ga0501080_0333458 | |||
| 2706 | Ga0501081_0000692 | |||
| 2707 | Ga0501081_0000837 | |||
| 2708 | Ga0501081_0002602 | |||
| 2709 | Ga0501081_0008632 | |||
| 2710 | Ga0501081_0018101 | |||
| 2711 | Ga0501081_0019017 | |||
| 2712 | Ga0501081_0050380 | |||
| 2713 | Ga0501081_0172378 | |||
| 2714 | Ga0501083_0000086 | |||
| 2715 | Ga0501083_0000751 | |||
| 2716 | Ga0501083_0022268 | |||
| 2717 | Ga0501083_0061820 | |||
| 2718 | Ga0501083_0068964 | |||
| 2719 | Ga0501083_0154087 | |||
| 2720 | Ga0501083_0291072 | |||
| 2721 | Ga0501035_0000437 | |||
| 2722 | Ga0501035_0190386 | |||
| 2723 | Ga0501035_0193833 | |||
| 2724 | Ga0501035_0204989 | |||
| 2725 | Ga0501035_0245816 | |||
| 2726 | Ga0501035_0253454 | |||
| 2727 | Ga0501044_0001726 | |||
| 2728 | Ga0501044_0085816 | |||
| 2729 | Ga0501044_0154163 | |||
| 2730 | Ga0501044_0505617 | |||
| 2731 | Ga0501045_0005349 | |||
| 2732 | Ga0501045_0007717 | |||
| 2733 | Ga0501045_0011122 | |||
| 2734 | Ga0501045_0015419 | |||
| 2735 | Ga0501045_0028196 | |||
| 2736 | Ga0501045_0028262 | |||
| 2737 | Ga0501045_0047092 | |||
| 2738 | Ga0501045_0050649 | |||
| 2739 | Ga0501045_0054535 | |||
| 2740 | nmdc:mga00v17_20992_c1 | |||
| 2741 | nmdc:mga00v17_231455_c1 | |||
| 2742 | nmdc:mga00v17_47034_c1 | |||
| 2743 | nmdc:mga0yw44_18281_c1 | |||
| 2744 | nmdc:mga0yw44_65818_c1 | |||
| 2745 | nmdc:mga06z11_116254_c1 | |||
| 2746 | nmdc:mga05p37_112741_c1 | |||
| 2747 | nmdc:mga05p37_227216_c1 | |||
| 2748 | nmdc:mga05p37_23364_c1 | |||
| 2749 | nmdc:mga05p37_310914_c1 | |||
| 2750 | nmdc:mga05p37_51716_c1 | |||
| 2751 | nmdc:mga05p37_78159_c1 | |||
| 2752 | nmdc:mga09592_10222_c1 | |||
| 2753 | nmdc:mga09592_12706_c1 | |||
| 2754 | nmdc:mga09592_61406_c1 | |||
| 2755 | nmdc:mga0qj67_15282_c1 | |||
| 2756 | nmdc:mga0qj67_155880_c1 | |||
| 2757 | nmdc:mga0qj67_40913_c1 | |||
| 2758 | nmdc:mga06r32_206997_c1 | |||
| 2759 | nmdc:mga06r32_43886_c1 | |||
| 2760 | nmdc:mga06r32_439664_c1 | |||
| 2761 | nmdc:mga08y16_11874_c1 | |||
| 2762 | nmdc:mga08y16_14378_c1 | |||
| 2763 | nmdc:mga08y16_25511_c1 | |||
| 2764 | nmdc:mga08y16_367559_c1 | |||
| 2765 | nmdc:mga08y16_63375_c1 | |||
| 2766 | nmdc:mga08y16_82262_c1 | |||
| 2767 | nmdc:mga0n895_216489_c1 | |||
| 2768 | nmdc:mga0n895_21900_c1 | |||
| 2769 | nmdc:mga0n895_345629_c1 | |||
| 2770 | nmdc:mga0n895_35200_c1 | |||
| 2771 | nmdc:mga0rr50_10341_c1 | |||
| 2772 | nmdc:mga0rr50_42906_c1 | |||
| 2773 | nmdc:mga08x19_28488_c1 | |||
| 2774 | nmdc:mga0a205_2180_c1 | |||
| 2775 | nmdc:mga0a205_23779_c1 | |||
| 2776 | nmdc:mga0a205_31410_c1 | |||
| 2777 | nmdc:mga0a205_33265_c2 | |||
| 2778 | Ga0495601_0000983 | |||
| 2779 | Ga0495601_0032476 | |||
| 2780 | Ga0495601_0087100 | |||
| 2781 | Ga0495601_0113091 | |||
| 2782 | Ga0495601_0115389 | |||
| 2783 | Ga0495601_0196673 | |||
| 2784 | Ga0495612_0009152 | |||
| 2785 | Ga0495655_0029979 | |||
| 2786 | Ga0495595_0036286 | |||
| 2787 | Ga0495595_0047786 | |||
| 2788 | Ga0495595_0122436 | |||
| 2789 | Ga0495595_0168621 | |||
| 2790 | Ga0495619_0004719 | |||
| 2791 | Ga0495619_0008649 | |||
| 2792 | Ga0495619_0023175 | |||
| 2793 | Ga0495619_0025735 | |||
| 2794 | Ga0495619_0031759 | |||
| 2795 | Ga0495619_0078590 | |||
| 2796 | Ga0495619_0122862 | |||
| 2797 | Ga0500568_0001852 | |||
| 2798 | Ga0500616_0000215 | |||
| 2799 | Ga0501084_0000492 | |||
| 2800 | Ga0501084_0005749 | |||
| 2801 | Ga0501084_0013559 | |||
| 2802 | Ga0501084_0015632 | |||
| 2803 | Ga0501084_0027990 | |||
| 2804 | Ga0501084_0046847 | |||
| 2805 | Ga0501084_0168843 | |||
| 2806 | Ga0501084_0208810 | |||
| 2807 | Ga0501084_0209001 | |||
| 2808 | Ga0501084_0363283 | |||
| 2809 | Ga0590075_008777 | |||
| 2810 | Ga0501082_0000139 | |||
| 2811 | Ga0501082_0008363 | |||
| 2812 | Ga0501082_0010188 | |||
| 2813 | Ga0501082_0011909 | |||
| 2814 | Ga0501082_0058794 | |||
| 2815 | Ga0501082_0065507 | |||
| 2816 | Ga0501082_0112269 | |||
| 2817 | Ga0501082_0255885 | |||
| 2818 | Ga0466962_0002601 | |||
| 2819 | Ga0466962_0004184 | |||
| 2820 | Ga0466962_0004907 | |||
| 2821 | Ga0466962_0017606 | |||
| 2822 | Ga0466962_0046896 | |||
| 2823 | Ga0530510_0000086 | |||
| 2824 | Ga0530510_0001228 | |||
| 2825 | Ga0530510_0007446 | |||
| 2826 | Ga0530510_0027645 | |||
| 2827 | Ga0530510_0029265 | |||
| 2828 | Ga0530510_0030125 | |||
| 2829 | Ga0530510_0043266 | |||
| 2830 | Ga0530510_0184062 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5mh4-assembly1.cif.gz_A | crystal structure of lactococcus lactis thioredoxin reductase (fr conformation) | 0.9537 | 8 | 309 |
| 5mh4-assembly1.cif.gz_A | crystal structure of lactococcus lactis thioredoxin reductase (fr conformation) | 0.9445 | 8 | 309 |
| 1f6m-assembly1.cif.gz_A | crystal structure of a complex between thioredoxin reductase, thioredoxin, and the nadp+ analog, aadp+ | 0.9346 | 4 | 313 |
| 5u63-assembly1.cif.gz_A | crystal structure of putative thioredoxin reductase from haemophilus influenzae | 0.9288 | 6 | 310 |
| 4mif-assembly1.cif.gz_D | pyranose 2-oxidase from phanerochaete chrysosporium, wild type from natural source | 0.9266 | 8 | 36 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5uthA02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9879 | 118 | 240 | 3.50.50.60 |
| 5uthA02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9801 | 118 | 240 | 3.50.50.60 |
| 4zn0C02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9729 | 118 | 240 | 3.50.50.60 |
| 3f8rD02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9664 | 118 | 240 | 3.50.50.60 |
| 4ykgA03 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9626 | 118 | 240 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0YJU2-F1-model_v4 | deleted | 0.9921 | 136 | 202 |
|
| AF-K1UEN0-F1-model_v4 | Protein containing Pyridine nucleotide-disulfide oxidoreductase, NAD-binding region domain protein (EC 1.-.-.-) | 0.9853 | 141 | 207 |
GO:0016491
|
| AF-A0A3D5UWY6-F1-model_v4 | Thioredoxin-disulfide reductase | 0.9847 | 143 | 231 |
GO:0016491
|
| AF-A0A6B3EPH4-F1-model_v4 | FAD-dependent oxidoreductase | 0.9789 | 113 | 226 |
GO:0016668
|
| AF-A0A7H4N4U0-F1-model_v4 | Alkyl hydroperoxide reductase protein F (EC 1.8.1.-) | 0.9745 | 120 | 202 |
GO:0016668
|