F493694
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1403 | 394 | 2807 | 125 |
Family's Representative Sequence
| Representative Sequence | 3300042007|Ga0439449_0126358|Ga0439449_0126358_363_806 |
| Length | 147 |
| Sequence | MARGSAAAHNLQYLCSEKEQIMSIHLTPDNKLKKLIVVGDRVLIKPTQPNERTDSGLYLPPGVQEREKVQQGYVIKTGPGYAIPVPAEETESWKPEEEKVKYIPLQAKEGDLAIFLISGSTEVLYQGEKYFIVPQGAILMLEREEEL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 2 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 16 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 17 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 86 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 212 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 213 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 214 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 215 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 216 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 217 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 219 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 220 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 221 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 222 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 223 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 224 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 225 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 226 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 227 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 229 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 234 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 237 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 238 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 241 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 242 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 243 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 244 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 245 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 246 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 247 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 248 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 251 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 252 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 253 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 254 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 255 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 256 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 257 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 258 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 259 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 260 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 261 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 262 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 263 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 264 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 265 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 266 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 267 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 268 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 269 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 270 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 271 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 272 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 273 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 274 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 275 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 276 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 277 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 311 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 313 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 314 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 315 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 316 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 336 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 337 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 338 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 339 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 340 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 341 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 342 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 343 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 344 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 345 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 346 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 347 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 348 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 349 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 353 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 354 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 355 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 356 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 357 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 358 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 361 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 362 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 363 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 370 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 371 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 372 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 373 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 374 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 375 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 376 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 377 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 378 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 379 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 380 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 381 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 382 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 383 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 384 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 385 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 386 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 387 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 388 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 390 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 392 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 393 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 394 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.71 |
| Metatranscriptomes | 0 |
| Isolates | 0.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.56 |
| Nodule | 0 |
| Rhizoplane | 0.64 |
| Rhizosphere | 92.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0439449_0126358 | 3300042007 | Unclassified | 949 |
| 2 | SwRhRL3b_contig_139884 | 2162886006 | Bacteria | 835 |
| 3 | SwRhRL2b_contig_1042660 | 2162886007 | Bacteria | 836 |
| 4 | JGI24740J21852_10002875 | 3300001979 | Bacteria | 7694 |
| 5 | JGI24740J21852_10033689 | 3300001979 | Bacteria | 1622 |
| 6 | JGI24739J22299_10000573 | 3300001989 | Bacteria | 13281 |
| 7 | JGI24739J22299_10009027 | 3300001989 | Bacteria | 3720 |
| 8 | JGI24744J21845_10010154 | 3300002077 | Bacteria | 1930 |
| 9 | JGI24033J26618_1016177 | 3300002155 | Bacteria | 925 |
| 10 | JGI25154J39366_1000021 | 3300002738 | Bacteria | 221559 |
| 11 | JGI25154J39366_1006212 | 3300002738 | Bacteria | 1782 |
| 12 | JGI25157J39369_1002591 | 3300002741 | Bacteria | 4308 |
| 13 | JGI25406J46586_10122729 | 3300003203 | Unclassified | 764 |
| 14 | JGI25153J46596_10000222 | 3300003215 | Bacteria | 49028 |
| 15 | rootH1_10012114 | 3300003316 | Bacteria | 1966 |
| 16 | rootH1_10112267 | 3300003316 | Bacteria | 5379 |
| 17 | rootH1_10189234 | 3300003316 | Bacteria | 1113 |
| 18 | rootH2_10001833 | 3300003320 | Bacteria | 2205 |
| 19 | rootH2_10033753 | 3300003320 | Bacteria | 1473 |
| 20 | rootH2_10191781 | 3300003320 | Bacteria | 2718 |
| 21 | rootH2_10249049 | 3300003320 | Bacteria | 1308 |
| 22 | rootL2_10012010 | 3300003322 | Bacteria | 12776 |
| 23 | rootL2_10025600 | 3300003322 | Bacteria | 3038 |
| 24 | rootL2_10073523 | 3300003322 | Bacteria | 3772 |
| 25 | rootL2_10073524 | 3300003322 | Bacteria | 1498 |
| 26 | rootL2_10219317 | 3300003322 | Unclassified | 3006 |
| 27 | rootL2_10314317 | 3300003322 | Bacteria | 1747 |
| 28 | rootL2_10317203 | 3300003322 | Unclassified | 2512 |
| 29 | rootH1_10051194 | 3300003323 | Bacteria | 12062 |
| 30 | rootH1_10094721 | 3300003316 | Bacteria | 7097 |
| 31 | rootH1_10094721 | 3300003323 | Bacteria | 3188 |
| 32 | rootH1_10129380 | 3300003323 | Bacteria | 1753 |
| 33 | rootH1_10274667 | 3300003323 | Bacteria | 1109 |
| 34 | JGI25160J50197_1006628 | 3300003354 | Bacteria | 4662 |
| 35 | JGI25160J50197_1008451 | 3300003354 | Bacteria | 3921 |
| 36 | JGI25160J50197_1008565 | 3300003354 | Bacteria | 3886 |
| 37 | JGI25160J50197_1020538 | 3300003354 | Bacteria | 1990 |
| 38 | Ga0055535_1003814 | 3300003761 | Bacteria | 3999 |
| 39 | Ga0055526_1024154 | 3300003771 | Bacteria | 2000 |
| 40 | Ga0055528_1002059 | 3300003790 | Bacteria | 11231 |
| 41 | Ga0055530_10001651 | 3300003791 | Bacteria | 15904 |
| 42 | Ga0055543_1009549 | 3300004625 | Bacteria | 2079 |
| 43 | Ga0065165_1000579 | 3300005262 | Bacteria | 54043 |
| 44 | Ga0065714_10129073 | 3300005288 | Unclassified | 1267 |
| 45 | Ga0065704_10141375 | 3300005289 | Bacteria | 1514 |
| 46 | Ga0065704_10185428 | 3300005289 | Bacteria | 1215 |
| 47 | Ga0065712_10001362 | 3300005290 | Bacteria | 6394 |
| 48 | Ga0065712_10008351 | 3300005290 | Bacteria | 2953 |
| 49 | Ga0065712_10160108 | 3300005290 | Bacteria | 1308 |
| 50 | Ga0065712_10228679 | 3300005290 | Bacteria | 1018 |
| 51 | Ga0065715_10013855 | 3300005293 | Bacteria | 2103 |
| 52 | Ga0065707_10004405 | 3300005295 | Bacteria | 3902 |
| 53 | Ga0065707_10105293 | 3300005295 | Bacteria | 2651 |
| 54 | Ga0065707_10131851 | 3300005295 | Bacteria | 1906 |
| 55 | Ga0070658_10029219 | 3300005327 | Bacteria | 4428 |
| 56 | Ga0070658_10092767 | 3300005327 | Bacteria | 2490 |
| 57 | Ga0070658_10425663 | 3300005327 | Bacteria | 1142 |
| 58 | Ga0070676_10005217 | 3300005328 | Bacteria | 6907 |
| 59 | Ga0070676_10045937 | 3300005328 | Bacteria | 2545 |
| 60 | Ga0070676_10145306 | 3300005328 | Unclassified | 1513 |
| 61 | Ga0070676_10360534 | 3300005328 | Bacteria | 1002 |
| 62 | Ga0070676_11038170 | 3300005328 | Bacteria | 617 |
| 63 | Ga0070683_100002359 | 3300005329 | Bacteria | 14997 |
| 64 | Ga0070683_100005979 | 3300005329 | Bacteria | 10189 |
| 65 | Ga0070683_100007262 | 3300005329 | Bacteria | 9346 |
| 66 | Ga0070683_100026768 | 3300005329 | Bacteria | 5196 |
| 67 | Ga0070683_100193767 | 3300005329 | Bacteria | 1930 |
| 68 | Ga0070683_100210525 | 3300005329 | Bacteria | 1847 |
| 69 | Ga0070683_100337058 | 3300005329 | Bacteria | 1436 |
| 70 | Ga0070683_100765835 | 3300005329 | Bacteria | 925 |
| 71 | Ga0070683_101433181 | 3300005329 | Bacteria | 664 |
| 72 | Ga0070683_101774651 | 3300005329 | Bacteria | 593 |
| 73 | Ga0070690_100016204 | 3300005330 | Bacteria | 4460 |
| 74 | Ga0070690_100259426 | 3300005330 | Bacteria | 1232 |
| 75 | Ga0070690_100280524 | 3300005330 | Bacteria | 1188 |
| 76 | Ga0070690_100296129 | 3300005330 | Bacteria | 1159 |
| 77 | Ga0070690_100593920 | 3300005330 | Bacteria | 840 |
| 78 | Ga0070690_100598769 | 3300005330 | Bacteria | 836 |
| 79 | Ga0070690_101019879 | 3300005330 | Bacteria | 653 |
| 80 | Ga0070670_100015785 | 3300005331 | Bacteria | 6483 |
| 81 | Ga0070670_100032493 | 3300005331 | Bacteria | 4494 |
| 82 | Ga0070670_100045331 | 3300005331 | Bacteria | 3779 |
| 83 | Ga0070670_100090508 | 3300005331 | Bacteria | 2629 |
| 84 | Ga0070670_100109318 | 3300005331 | Bacteria | 2382 |
| 85 | Ga0070670_100176567 | 3300005331 | Bacteria | 1854 |
| 86 | Ga0070670_100197725 | 3300005331 | Bacteria | 1746 |
| 87 | Ga0070670_100287355 | 3300005331 | Bacteria | 1436 |
| 88 | Ga0070670_100318516 | 3300005331 | Bacteria | 1362 |
| 89 | Ga0070670_100650309 | 3300005331 | Bacteria | 946 |
| 90 | Ga0070670_100660965 | 3300005331 | Bacteria | 938 |
| 91 | Ga0070670_100775135 | 3300005331 | Bacteria | 865 |
| 92 | Ga0070670_100885825 | 3300005331 | Bacteria | 809 |
| 93 | Ga0070677_10007969 | 3300005333 | Bacteria | 3547 |
| 94 | Ga0070677_10132731 | 3300005333 | Bacteria | 1139 |
| 95 | Ga0070677_10173723 | 3300005333 | Bacteria | 1021 |
| 96 | Ga0070677_10499685 | 3300005333 | Bacteria | 659 |
| 97 | Ga0068869_100008418 | 3300005334 | Bacteria | 6650 |
| 98 | Ga0068869_100014754 | 3300005334 | Bacteria | 5225 |
| 99 | Ga0068869_100037107 | 3300005334 | Bacteria | 3464 |
| 100 | Ga0068869_100047138 | 3300005334 | Bacteria | 3111 |
| 101 | Ga0068869_100070957 | 3300005334 | Unclassified | 2578 |
| 102 | Ga0068869_100134454 | 3300005334 | Unclassified | 1904 |
| 103 | Ga0068869_100163058 | 3300005334 | Bacteria | 1736 |
| 104 | Ga0068869_100171602 | 3300005334 | Unclassified | 1695 |
| 105 | Ga0068869_100295430 | 3300005334 | Bacteria | 1307 |
| 106 | Ga0068869_100549808 | 3300005334 | Bacteria | 970 |
| 107 | Ga0068869_100624182 | 3300005334 | Bacteria | 912 |
| 108 | Ga0068869_100710832 | 3300005334 | Bacteria | 858 |
| 109 | Ga0068869_100773993 | 3300005334 | Bacteria | 823 |
| 110 | Ga0068869_100798371 | 3300005334 | Bacteria | 811 |
| 111 | Ga0068869_101172520 | 3300005334 | Bacteria | 674 |
| 112 | Ga0070666_10000019 | 3300005335 | Bacteria | 185877 |
| 113 | Ga0070666_10002676 | 3300005335 | Bacteria | 10745 |
| 114 | Ga0070666_10017990 | 3300005335 | Bacteria | 4536 |
| 115 | Ga0070666_10264070 | 3300005335 | Bacteria | 1221 |
| 116 | Ga0070666_10313812 | 3300005335 | Bacteria | 1118 |
| 117 | Ga0070666_10637358 | 3300005335 | Bacteria | 779 |
| 118 | Ga0070680_100001352 | 3300005336 | Bacteria | 17745 |
| 119 | Ga0070680_100217894 | 3300005336 | Unclassified | 1611 |
| 120 | Ga0070680_100238448 | 3300005336 | Bacteria | 1537 |
| 121 | Ga0070682_100000934 | 3300005337 | Bacteria | 17036 |
| 122 | Ga0070682_100179206 | 3300005337 | Bacteria | 1478 |
| 123 | Ga0070682_100259229 | 3300005337 | Bacteria | 1257 |
| 124 | Ga0070682_100366595 | 3300005337 | Bacteria | 1079 |
| 125 | Ga0068868_100005373 | 3300005338 | Bacteria | 9000 |
| 126 | Ga0068868_100011564 | 3300005338 | Bacteria | 6428 |
| 127 | Ga0068868_100016289 | 3300005338 | Bacteria | 5516 |
| 128 | Ga0068868_100109067 | 3300005338 | Bacteria | 2248 |
| 129 | Ga0068868_100454250 | 3300005338 | Bacteria | 1115 |
| 130 | Ga0068868_100503970 | 3300005338 | Bacteria | 1061 |
| 131 | Ga0068868_100524087 | 3300005338 | Bacteria | 1041 |
| 132 | Ga0068868_100801433 | 3300005338 | Bacteria | 850 |
| 133 | Ga0070660_100175208 | 3300005339 | Bacteria | 1734 |
| 134 | Ga0070660_100267402 | 3300005339 | Unclassified | 1397 |
| 135 | Ga0070660_100902364 | 3300005339 | Bacteria | 745 |
| 136 | Ga0070660_100913152 | 3300005339 | Bacteria | 741 |
| 137 | Ga0070660_101002380 | 3300005339 | Bacteria | 706 |
| 138 | Ga0070660_101191157 | 3300005339 | Bacteria | 646 |
| 139 | Ga0070689_100021838 | 3300005340 | Bacteria | 4771 |
| 140 | Ga0070689_100024989 | 3300005340 | Bacteria | 4484 |
| 141 | Ga0070689_100086957 | 3300005340 | Bacteria | 2459 |
| 142 | Ga0070689_100107571 | 3300005340 | Bacteria | 2214 |
| 143 | Ga0070689_100187848 | 3300005340 | Bacteria | 1681 |
| 144 | Ga0070689_100360884 | 3300005340 | Bacteria | 1221 |
| 145 | Ga0070689_100404445 | 3300005340 | Bacteria | 1154 |
| 146 | Ga0070689_100746492 | 3300005340 | Unclassified | 857 |
| 147 | Ga0070689_100845023 | 3300005340 | Unclassified | 807 |
| 148 | Ga0070689_101330076 | 3300005340 | Bacteria | 648 |
| 149 | Ga0070691_10000160 | 3300005341 | Bacteria | 21713 |
| 150 | Ga0070687_100041534 | 3300005343 | Bacteria | 2325 |
| 151 | Ga0070687_100453255 | 3300005343 | Unclassified | 854 |
| 152 | Ga0070687_100553019 | 3300005343 | Bacteria | 783 |
| 153 | Ga0070687_100581185 | 3300005343 | Bacteria | 767 |
| 154 | Ga0070661_100002162 | 3300005344 | Bacteria | 13543 |
| 155 | Ga0070661_100004509 | 3300005344 | Bacteria | 9592 |
| 156 | Ga0070661_100220538 | 3300005344 | Bacteria | 1454 |
| 157 | Ga0070661_100225332 | 3300005344 | Bacteria | 1439 |
| 158 | Ga0070661_100641735 | 3300005344 | Unclassified | 861 |
| 159 | Ga0070661_100682279 | 3300005344 | Bacteria | 836 |
| 160 | Ga0070661_100811809 | 3300005344 | Bacteria | 768 |
| 161 | Ga0070668_100005318 | 3300005347 | Bacteria | 9557 |
| 162 | Ga0070668_100008164 | 3300005347 | Bacteria | 7775 |
| 163 | Ga0070668_100056832 | 3300005347 | Bacteria | 3023 |
| 164 | Ga0070668_100421066 | 3300005347 | Bacteria | 1143 |
| 165 | Ga0070669_100015572 | 3300005353 | Bacteria | 5423 |
| 166 | Ga0070669_100051623 | 3300005353 | Bacteria | 3007 |
| 167 | Ga0070669_100071414 | 3300005353 | Bacteria | 2568 |
| 168 | Ga0070669_100097908 | 3300005353 | Bacteria | 2209 |
| 169 | Ga0070669_100136893 | 3300005353 | Bacteria | 1884 |
| 170 | Ga0070669_100153192 | 3300005353 | Bacteria | 1786 |
| 171 | Ga0070669_100208420 | 3300005353 | Bacteria | 1541 |
| 172 | Ga0070669_100387929 | 3300005353 | Unclassified | 1140 |
| 173 | Ga0070669_100411834 | 3300005353 | Bacteria | 1108 |
| 174 | Ga0070669_100422220 | 3300005353 | Bacteria | 1095 |
| 175 | Ga0070669_100439709 | 3300005353 | Bacteria | 1073 |
| 176 | Ga0070675_100009953 | 3300005354 | Bacteria | 7415 |
| 177 | Ga0070675_100018596 | 3300005354 | Bacteria | 5532 |
| 178 | Ga0070675_100030391 | 3300005354 | Unclassified | 4362 |
| 179 | Ga0070675_100132999 | 3300005354 | Bacteria | 2121 |
| 180 | Ga0070675_100192221 | 3300005354 | Bacteria | 1769 |
| 181 | Ga0070675_100218099 | 3300005354 | Bacteria | 1660 |
| 182 | Ga0070675_100243153 | 3300005354 | Bacteria | 1573 |
| 183 | Ga0070675_100604987 | 3300005354 | Bacteria | 994 |
| 184 | Ga0070675_101028937 | 3300005354 | Bacteria | 756 |
| 185 | Ga0070675_101043029 | 3300005354 | Bacteria | 751 |
| 186 | Ga0070675_101137723 | 3300005354 | Unclassified | 718 |
| 187 | Ga0070671_100040747 | 3300005355 | Bacteria | 3859 |
| 188 | Ga0070671_100069414 | 3300005355 | Bacteria | 2939 |
| 189 | Ga0070671_100133278 | 3300005355 | Bacteria | 2093 |
| 190 | Ga0070671_100285295 | 3300005355 | Bacteria | 1405 |
| 191 | Ga0070671_100443364 | 3300005355 | Bacteria | 1113 |
| 192 | Ga0070671_100912242 | 3300005355 | Bacteria | 768 |
| 193 | Ga0070671_101110595 | 3300005355 | Bacteria | 695 |
| 194 | Ga0070671_101566408 | 3300005355 | Bacteria | 584 |
| 195 | Ga0070671_101576720 | 3300005355 | Bacteria | 582 |
| 196 | Ga0070674_100020556 | 3300005356 | Bacteria | 4221 |
| 197 | Ga0070674_100470652 | 3300005356 | Unclassified | 1041 |
| 198 | Ga0070673_100004592 | 3300005364 | Bacteria | 8753 |
| 199 | Ga0070673_100007862 | 3300005364 | Bacteria | 7064 |
| 200 | Ga0070673_100042190 | 3300005364 | Bacteria | 3515 |
| 201 | Ga0070673_100042736 | 3300005364 | Bacteria | 3496 |
| 202 | Ga0070673_100044249 | 3300005364 | Bacteria | 3446 |
| 203 | Ga0070673_100046399 | 3300005364 | Bacteria | 3375 |
| 204 | Ga0070673_100207789 | 3300005364 | Bacteria | 1689 |
| 205 | Ga0070673_100235135 | 3300005364 | Bacteria | 1591 |
| 206 | Ga0070673_101215611 | 3300005364 | Bacteria | 706 |
| 207 | Ga0070673_101462557 | 3300005364 | Unclassified | 644 |
| 208 | Ga0070673_102239188 | 3300005364 | Bacteria | 519 |
| 209 | Ga0070688_100022281 | 3300005365 | Bacteria | 3709 |
| 210 | Ga0070688_100075143 | 3300005365 | Bacteria | 2171 |
| 211 | Ga0070688_100179297 | 3300005365 | Bacteria | 1468 |
| 212 | Ga0070688_100506415 | 3300005365 | Bacteria | 911 |
| 213 | Ga0070688_100947223 | 3300005365 | Unclassified | 681 |
| 214 | Ga0070659_100008080 | 3300005366 | Bacteria | 7672 |
| 215 | Ga0070659_100026990 | 3300005366 | Bacteria | 4422 |
| 216 | Ga0070659_100140711 | 3300005366 | Bacteria | 1965 |
| 217 | Ga0070659_100377949 | 3300005366 | Bacteria | 1193 |
| 218 | Ga0070659_101506732 | 3300005366 | Unclassified | 599 |
| 219 | Ga0070659_101926145 | 3300005366 | Bacteria | 530 |
| 220 | Ga0070667_100010175 | 3300005367 | Bacteria | 7774 |
| 221 | Ga0070667_100012137 | 3300005367 | Bacteria | 7131 |
| 222 | Ga0070667_100042945 | 3300005367 | Bacteria | 3793 |
| 223 | Ga0070667_100161448 | 3300005367 | Bacteria | 1974 |
| 224 | Ga0070667_100431772 | 3300005367 | Unclassified | 1202 |
| 225 | Ga0070667_100503754 | 3300005367 | Bacteria | 1110 |
| 226 | Ga0070667_100652968 | 3300005367 | Bacteria | 971 |
| 227 | Ga0070667_100753343 | 3300005367 | Bacteria | 903 |
| 228 | Ga0070667_100929864 | 3300005367 | Bacteria | 810 |
| 229 | Ga0070667_100985772 | 3300005367 | Bacteria | 786 |
| 230 | Ga0070701_10085487 | 3300005438 | Bacteria | 1717 |
| 231 | Ga0070711_100865591 | 3300005439 | Bacteria | 770 |
| 232 | Ga0070700_100052053 | 3300005441 | Bacteria | 2552 |
| 233 | Ga0070700_100180068 | 3300005441 | Bacteria | 1470 |
| 234 | Ga0070700_100257657 | 3300005441 | Bacteria | 1255 |
| 235 | Ga0070708_101116930 | 3300005445 | Unclassified | 738 |
| 236 | Ga0070663_100396287 | 3300005455 | Bacteria | 1127 |
| 237 | Ga0070663_100528834 | 3300005455 | Bacteria | 983 |
| 238 | Ga0070678_100020735 | 3300005456 | Bacteria | 4318 |
| 239 | Ga0070678_100163084 | 3300005456 | Bacteria | 1808 |
| 240 | Ga0070678_100363368 | 3300005456 | Bacteria | 1248 |
| 241 | Ga0070678_100667507 | 3300005456 | Bacteria | 934 |
| 242 | Ga0070678_100779674 | 3300005456 | Unclassified | 867 |
| 243 | Ga0070678_100806103 | 3300005456 | Bacteria | 853 |
| 244 | Ga0070678_101372825 | 3300005456 | Bacteria | 659 |
| 245 | Ga0070678_101677587 | 3300005456 | Bacteria | 598 |
| 246 | Ga0070678_101720517 | 3300005456 | Bacteria | 590 |
| 247 | Ga0070662_100006375 | 3300005457 | Bacteria | 7600 |
| 248 | Ga0070662_100020905 | 3300005457 | Bacteria | 4464 |
| 249 | Ga0070662_100156874 | 3300005457 | Bacteria | 1777 |
| 250 | Ga0070662_100518771 | 3300005457 | Bacteria | 995 |
| 251 | Ga0070681_10087439 | 3300005458 | Bacteria | 3069 |
| 252 | Ga0070681_10539602 | 3300005458 | Bacteria | 1080 |
| 253 | Ga0070681_10853129 | 3300005458 | Bacteria | 828 |
| 254 | Ga0068867_100026488 | 3300005459 | Bacteria | 4164 |
| 255 | Ga0068867_100058811 | 3300005459 | Bacteria | 2848 |
| 256 | Ga0068867_100074210 | 3300005459 | Bacteria | 2549 |
| 257 | Ga0068867_100078793 | 3300005459 | Bacteria | 2479 |
| 258 | Ga0068867_100088793 | 3300005459 | Bacteria | 2343 |
| 259 | Ga0068867_100182308 | 3300005459 | Bacteria | 1670 |
| 260 | Ga0068867_100202053 | 3300005459 | Bacteria | 1591 |
| 261 | Ga0068867_100860576 | 3300005459 | Bacteria | 813 |
| 262 | Ga0068867_100873588 | 3300005459 | Bacteria | 807 |
| 263 | Ga0068867_100941715 | 3300005459 | Unclassified | 780 |
| 264 | Ga0068867_101114020 | 3300005459 | Unclassified | 721 |
| 265 | Ga0068867_102224129 | 3300005459 | Bacteria | 521 |
| 266 | Ga0070685_10010718 | 3300005466 | Unclassified | 4772 |
| 267 | Ga0070685_10048572 | 3300005466 | Bacteria | 2444 |
| 268 | Ga0070685_10065169 | 3300005466 | Bacteria | 2144 |
| 269 | Ga0070685_10144908 | 3300005466 | Bacteria | 1499 |
| 270 | Ga0070685_10349408 | 3300005466 | Bacteria | 1010 |
| 271 | Ga0070685_10882106 | 3300005466 | Bacteria | 665 |
| 272 | Ga0070707_100075842 | 3300005468 | Unclassified | 3244 |
| 273 | Ga0070707_100535603 | 3300005468 | Bacteria | 1133 |
| 274 | Ga0070698_100006956 | 3300005471 | Bacteria | 12250 |
| 275 | Ga0070698_100898800 | 3300005471 | Bacteria | 831 |
| 276 | Ga0070699_100241967 | 3300005518 | Unclassified | 1611 |
| 277 | Ga0070699_101171228 | 3300005518 | Bacteria | 705 |
| 278 | Ga0070679_100009634 | 3300005530 | Bacteria | 9137 |
| 279 | Ga0070679_100173836 | 3300005530 | Bacteria | 2126 |
| 280 | Ga0070679_100225680 | 3300005530 | Bacteria | 1833 |
| 281 | Ga0070679_100777218 | 3300005530 | Bacteria | 901 |
| 282 | Ga0070679_100785224 | 3300005530 | Bacteria | 895 |
| 283 | Ga0070679_101515727 | 3300005530 | Bacteria | 617 |
| 284 | Ga0070684_100026097 | 3300005535 | Bacteria | 4918 |
| 285 | Ga0070684_100063337 | 3300005535 | Bacteria | 3241 |
| 286 | Ga0070684_100084135 | 3300005535 | Bacteria | 2819 |
| 287 | Ga0070684_100172922 | 3300005535 | Bacteria | 1962 |
| 288 | Ga0070684_100285191 | 3300005535 | Bacteria | 1513 |
| 289 | Ga0070684_100358565 | 3300005535 | Bacteria | 1342 |
| 290 | Ga0070684_100614193 | 3300005535 | Bacteria | 1011 |
| 291 | Ga0070684_100873833 | 3300005535 | Bacteria | 842 |
| 292 | Ga0068853_100041942 | 3300005539 | Bacteria | 3910 |
| 293 | Ga0068853_100058156 | 3300005539 | Bacteria | 3337 |
| 294 | Ga0068853_100118870 | 3300005539 | Bacteria | 2355 |
| 295 | Ga0068853_100167512 | 3300005539 | Bacteria | 1986 |
| 296 | Ga0068853_100181658 | 3300005539 | Bacteria | 1908 |
| 297 | Ga0068853_100289574 | 3300005539 | Bacteria | 1512 |
| 298 | Ga0068853_100755091 | 3300005539 | Unclassified | 930 |
| 299 | Ga0068853_101222534 | 3300005539 | Bacteria | 726 |
| 300 | Ga0068853_101556740 | 3300005539 | Bacteria | 640 |
| 301 | Ga0068853_102016465 | 3300005539 | Bacteria | 560 |
| 302 | Ga0070672_100045424 | 3300005543 | Bacteria | 3397 |
| 303 | Ga0070672_100049195 | 3300005543 | Unclassified | 3278 |
| 304 | Ga0070672_100204888 | 3300005543 | Unclassified | 1650 |
| 305 | Ga0070672_100294496 | 3300005543 | Bacteria | 1374 |
| 306 | Ga0070672_100369043 | 3300005543 | Unclassified | 1226 |
| 307 | Ga0070672_100446829 | 3300005543 | Bacteria | 1113 |
| 308 | Ga0070672_100513370 | 3300005543 | Bacteria | 1038 |
| 309 | Ga0070672_100606064 | 3300005543 | Bacteria | 954 |
| 310 | Ga0070672_100774942 | 3300005543 | Bacteria | 843 |
| 311 | Ga0070686_100060375 | 3300005544 | Bacteria | 2446 |
| 312 | Ga0070686_100082764 | 3300005544 | Bacteria | 2129 |
| 313 | Ga0070686_100221273 | 3300005544 | Bacteria | 1368 |
| 314 | Ga0070686_100232825 | 3300005544 | Bacteria | 1337 |
| 315 | Ga0070686_101554685 | 3300005544 | Bacteria | 559 |
| 316 | Ga0070693_100013640 | 3300005547 | Bacteria | 4144 |
| 317 | Ga0070693_100557487 | 3300005547 | Unclassified | 821 |
| 318 | Ga0070693_101162752 | 3300005547 | Bacteria | 591 |
| 319 | Ga0070665_100009994 | 3300005548 | Bacteria | 9599 |
| 320 | Ga0070665_100329485 | 3300005548 | Bacteria | 1531 |
| 321 | Ga0070665_101371568 | 3300005548 | Bacteria | 716 |
| 322 | Ga0070665_102248713 | 3300005548 | Bacteria | 549 |
| 323 | Ga0070704_100503663 | 3300005549 | Bacteria | 1051 |
| 324 | Ga0070704_100573948 | 3300005549 | Bacteria | 988 |
| 325 | Ga0070704_100972542 | 3300005549 | Bacteria | 767 |
| 326 | Ga0068855_100003963 | 3300005563 | Bacteria | 18072 |
| 327 | Ga0068855_100017499 | 3300005563 | Bacteria | 8619 |
| 328 | Ga0068855_100019154 | 3300005563 | Bacteria | 8225 |
| 329 | Ga0068855_100041940 | 3300005563 | Bacteria | 5423 |
| 330 | Ga0068855_100193800 | 3300005563 | Bacteria | 2290 |
| 331 | Ga0068855_100292651 | 3300005563 | Bacteria | 1805 |
| 332 | Ga0068855_100701628 | 3300005563 | Bacteria | 1083 |
| 333 | Ga0068855_100791892 | 3300005563 | Bacteria | 1008 |
| 334 | Ga0070664_100013799 | 3300005564 | Bacteria | 6587 |
| 335 | Ga0070664_100015152 | 3300005564 | Bacteria | 6297 |
| 336 | Ga0070664_100033788 | 3300005564 | Bacteria | 4287 |
| 337 | Ga0070664_100124560 | 3300005564 | Bacteria | 2259 |
| 338 | Ga0070664_100126729 | 3300005564 | Bacteria | 2240 |
| 339 | Ga0070664_100353355 | 3300005564 | Bacteria | 1337 |
| 340 | Ga0070664_100377346 | 3300005564 | Bacteria | 1294 |
| 341 | Ga0070664_100654244 | 3300005564 | Bacteria | 977 |
| 342 | Ga0070664_101264124 | 3300005564 | Bacteria | 697 |
| 343 | Ga0070664_101288177 | 3300005564 | Bacteria | 690 |
| 344 | Ga0070664_101499985 | 3300005564 | Bacteria | 638 |
| 345 | Ga0070664_101522935 | 3300005564 | Bacteria | 633 |
| 346 | Ga0068857_100004299 | 3300005577 | Bacteria | 12016 |
| 347 | Ga0068857_100025400 | 3300005577 | Bacteria | 5216 |
| 348 | Ga0068857_100031073 | 3300005577 | Bacteria | 4719 |
| 349 | Ga0068857_100166907 | 3300005577 | Bacteria | 2000 |
| 350 | Ga0068857_100291360 | 3300005577 | Bacteria | 1503 |
| 351 | Ga0068857_100675898 | 3300005577 | Bacteria | 980 |
| 352 | Ga0068857_100790722 | 3300005577 | Bacteria | 906 |
| 353 | Ga0068857_100849247 | 3300005577 | Bacteria | 874 |
| 354 | Ga0068857_101525160 | 3300005577 | Unclassified | 651 |
| 355 | Ga0068854_100043187 | 3300005578 | Unclassified | 3194 |
| 356 | Ga0068854_100053069 | 3300005578 | Bacteria | 2909 |
| 357 | Ga0068854_100063939 | 3300005578 | Unclassified | 2672 |
| 358 | Ga0068854_100086163 | 3300005578 | Bacteria | 2328 |
| 359 | Ga0068854_100232725 | 3300005578 | Bacteria | 1463 |
| 360 | Ga0068854_100498467 | 3300005578 | Bacteria | 1025 |
| 361 | Ga0068854_100672854 | 3300005578 | Unclassified | 891 |
| 362 | Ga0068856_100024151 | 3300005614 | Bacteria | 5914 |
| 363 | Ga0068856_100372503 | 3300005614 | Bacteria | 1447 |
| 364 | Ga0068856_100494438 | 3300005614 | Bacteria | 1244 |
| 365 | Ga0068856_101142107 | 3300005614 | Bacteria | 796 |
| 366 | Ga0068856_101314682 | 3300005614 | Bacteria | 738 |
| 367 | Ga0070702_100025541 | 3300005615 | Bacteria | 3167 |
| 368 | Ga0070702_100650045 | 3300005615 | Bacteria | 797 |
| 369 | Ga0068852_100059907 | 3300005616 | Bacteria | 3303 |
| 370 | Ga0068852_100088967 | 3300005616 | Bacteria | 2759 |
| 371 | Ga0068852_100094839 | 3300005616 | Bacteria | 2678 |
| 372 | Ga0068852_100099119 | 3300005616 | Bacteria | 2626 |
| 373 | Ga0068852_100167408 | 3300005616 | Bacteria | 2057 |
| 374 | Ga0068852_100557525 | 3300005616 | Unclassified | 1147 |
| 375 | Ga0068852_100563656 | 3300005616 | Bacteria | 1140 |
| 376 | Ga0068852_100660036 | 3300005616 | Bacteria | 1054 |
| 377 | Ga0068852_100695370 | 3300005616 | Unclassified | 1027 |
| 378 | Ga0068852_100895584 | 3300005616 | Bacteria | 904 |
| 379 | Ga0068852_101356885 | 3300005616 | Bacteria | 733 |
| 380 | Ga0068852_101528089 | 3300005616 | Bacteria | 690 |
| 381 | Ga0068852_101567735 | 3300005616 | Bacteria | 681 |
| 382 | Ga0068852_102034474 | 3300005616 | Unclassified | 596 |
| 383 | Ga0068859_100000013 | 3300005617 | Bacteria | 291126 |
| 384 | Ga0068859_100010105 | 3300005617 | Bacteria | 9512 |
| 385 | Ga0068859_100062252 | 3300005617 | Bacteria | 3761 |
| 386 | Ga0068859_100069743 | 3300005617 | Bacteria | 3550 |
| 387 | Ga0068859_100078718 | 3300005617 | Bacteria | 3337 |
| 388 | Ga0068859_100086803 | 3300005617 | Bacteria | 3176 |
| 389 | Ga0068859_100088052 | 3300005617 | Bacteria | 3154 |
| 390 | Ga0068859_100270926 | 3300005617 | Bacteria | 1790 |
| 391 | Ga0068859_100283340 | 3300005617 | Bacteria | 1750 |
| 392 | Ga0068859_100325223 | 3300005617 | Bacteria | 1632 |
| 393 | Ga0068859_100899595 | 3300005617 | Bacteria | 970 |
| 394 | Ga0068859_101414457 | 3300005617 | Bacteria | 767 |
| 395 | Ga0068859_101686273 | 3300005617 | Bacteria | 700 |
| 396 | Ga0068859_102259506 | 3300005617 | Bacteria | 600 |
| 397 | Ga0068859_102327114 | 3300005617 | Bacteria | 591 |
| 398 | Ga0068859_102870796 | 3300005617 | Unclassified | 528 |
| 399 | Ga0068864_100002531 | 3300005618 | Bacteria | 15099 |
| 400 | Ga0068864_100013970 | 3300005618 | Bacteria | 6657 |
| 401 | Ga0068864_100287296 | 3300005618 | Unclassified | 1537 |
| 402 | Ga0068864_100465577 | 3300005618 | Unclassified | 1211 |
| 403 | Ga0068864_100543744 | 3300005618 | Bacteria | 1122 |
| 404 | Ga0068864_100564470 | 3300005618 | Bacteria | 1101 |
| 405 | Ga0068864_100606492 | 3300005618 | Bacteria | 1063 |
| 406 | Ga0068864_100698741 | 3300005618 | Unclassified | 991 |
| 407 | Ga0068864_100805098 | 3300005618 | Bacteria | 924 |
| 408 | Ga0068864_101022781 | 3300005618 | Bacteria | 820 |
| 409 | Ga0068864_101405234 | 3300005618 | Bacteria | 700 |
| 410 | Ga0068866_10157062 | 3300005718 | Bacteria | 1323 |
| 411 | Ga0068866_10176469 | 3300005718 | Bacteria | 1258 |
| 412 | Ga0068866_10180903 | 3300005718 | Bacteria | 1245 |
| 413 | Ga0068866_10377838 | 3300005718 | Bacteria | 908 |
| 414 | Ga0068861_100015324 | 3300005719 | Bacteria | 5399 |
| 415 | Ga0068861_100160774 | 3300005719 | Unclassified | 1852 |
| 416 | Ga0068861_100248230 | 3300005719 | Bacteria | 1517 |
| 417 | Ga0068861_100280117 | 3300005719 | Bacteria | 1435 |
| 418 | Ga0068861_100374226 | 3300005719 | Bacteria | 1256 |
| 419 | Ga0068861_100402138 | 3300005719 | Bacteria | 1215 |
| 420 | Ga0068861_100535381 | 3300005719 | Bacteria | 1065 |
| 421 | Ga0068861_100623591 | 3300005719 | Bacteria | 993 |
| 422 | Ga0068861_100780097 | 3300005719 | Bacteria | 895 |
| 423 | Ga0068861_100790175 | 3300005719 | Bacteria | 890 |
| 424 | Ga0068861_101185912 | 3300005719 | Bacteria | 738 |
| 425 | Ga0068861_101380584 | 3300005719 | Bacteria | 687 |
| 426 | Ga0068851_10008282 | 3300005834 | Bacteria | 4802 |
| 427 | Ga0068851_10196750 | 3300005834 | Bacteria | 1123 |
| 428 | Ga0068851_10205639 | 3300005834 | Bacteria | 1101 |
| 429 | Ga0068851_10650934 | 3300005834 | Unclassified | 645 |
| 430 | Ga0068851_10653719 | 3300005834 | Bacteria | 644 |
| 431 | Ga0068851_10718384 | 3300005834 | Unclassified | 616 |
| 432 | Ga0068851_10775410 | 3300005834 | Unclassified | 594 |
| 433 | Ga0068851_10923005 | 3300005834 | Bacteria | 548 |
| 434 | Ga0068870_10015883 | 3300005840 | Plasmid | 3584 |
| 435 | Ga0068870_10073950 | 3300005840 | Bacteria | 1865 |
| 436 | Ga0068870_10247517 | 3300005840 | Bacteria | 1103 |
| 437 | Ga0068870_10333595 | 3300005840 | Bacteria | 968 |
| 438 | Ga0068870_10392520 | 3300005840 | Unclassified | 901 |
| 439 | Ga0068870_10724423 | 3300005840 | Bacteria | 688 |
| 440 | Ga0068870_10847201 | 3300005840 | Bacteria | 642 |
| 441 | Ga0068870_11106325 | 3300005840 | Unclassified | 570 |
| 442 | Ga0068863_100001058 | 3300005841 | Bacteria | 27510 |
| 443 | Ga0068863_100016960 | 3300005841 | Bacteria | 6985 |
| 444 | Ga0068863_100031954 | 3300005841 | Bacteria | 5020 |
| 445 | Ga0068863_100032772 | 3300005841 | Bacteria | 4950 |
| 446 | Ga0068863_100179888 | 3300005841 | Bacteria | 2030 |
| 447 | Ga0068863_100374779 | 3300005841 | Bacteria | 1389 |
| 448 | Ga0068858_100008721 | 3300005842 | Bacteria | 9735 |
| 449 | Ga0068858_100173445 | 3300005842 | Bacteria | 2034 |
| 450 | Ga0068858_100323671 | 3300005842 | Bacteria | 1474 |
| 451 | Ga0068858_100770485 | 3300005842 | Unclassified | 938 |
| 452 | Ga0068858_101040636 | 3300005842 | Bacteria | 803 |
| 453 | Ga0068858_102281426 | 3300005842 | Bacteria | 535 |
| 454 | Ga0068860_100007046 | 3300005843 | Bacteria | 11253 |
| 455 | Ga0068860_100010577 | 3300005843 | Bacteria | 9113 |
| 456 | Ga0068860_100010672 | 3300005843 | Bacteria | 9072 |
| 457 | Ga0068860_100244255 | 3300005843 | Bacteria | 1746 |
| 458 | Ga0068860_100257354 | 3300005843 | Bacteria | 1701 |
| 459 | Ga0068860_100507055 | 3300005843 | Bacteria | 1205 |
| 460 | Ga0068860_100525491 | 3300005843 | Bacteria | 1183 |
| 461 | Ga0068860_100569259 | 3300005843 | Bacteria | 1136 |
| 462 | Ga0068860_101437052 | 3300005843 | Unclassified | 711 |
| 463 | Ga0068860_101471452 | 3300005843 | Bacteria | 703 |
| 464 | Ga0068862_100001187 | 3300005844 | Bacteria | 24555 |
| 465 | Ga0068862_100081363 | 3300005844 | Unclassified | 2810 |
| 466 | Ga0068862_100133333 | 3300005844 | Bacteria | 2199 |
| 467 | Ga0068862_101008145 | 3300005844 | Unclassified | 824 |
| 468 | Ga0068862_101321141 | 3300005844 | Bacteria | 723 |
| 469 | Ga0068862_101477169 | 3300005844 | Bacteria | 685 |
| 470 | Ga0068862_102286085 | 3300005844 | Bacteria | 552 |
| 471 | Ga0081539_10031023 | 3300005985 | Bacteria | 3302 |
| 472 | Ga0081539_10255293 | 3300005985 | Bacteria | 776 |
| 473 | Ga0070715_10163182 | 3300006163 | Unclassified | 1103 |
| 474 | Ga0070715_10171973 | 3300006163 | Bacteria | 1080 |
| 475 | Ga0070716_100740546 | 3300006173 | Bacteria | 755 |
| 476 | Ga0075366_10019812 | 3300006195 | Bacteria | 3899 |
| 477 | Ga0075366_10067705 | 3300006195 | Bacteria | 2125 |
| 478 | Ga0075366_10354904 | 3300006195 | Unclassified | 900 |
| 479 | Ga0075366_10376516 | 3300006195 | Bacteria | 873 |
| 480 | Ga0075366_10526986 | 3300006195 | Unclassified | 731 |
| 481 | Ga0075366_10715853 | 3300006195 | Bacteria | 622 |
| 482 | Ga0097621_100001972 | 3300006237 | Bacteria | 13991 |
| 483 | Ga0097621_100027113 | 3300006237 | Bacteria | 4502 |
| 484 | Ga0097621_100041789 | 3300006237 | Bacteria | 3692 |
| 485 | Ga0097621_100063981 | 3300006237 | Bacteria | 3024 |
| 486 | Ga0097621_100273291 | 3300006237 | Bacteria | 1485 |
| 487 | Ga0097621_100286377 | 3300006237 | Bacteria | 1451 |
| 488 | Ga0097621_100540733 | 3300006237 | Bacteria | 1059 |
| 489 | Ga0097621_100602203 | 3300006237 | Bacteria | 1004 |
| 490 | Ga0097621_100698998 | 3300006237 | Bacteria | 933 |
| 491 | Ga0097621_100710364 | 3300006237 | Unclassified | 926 |
| 492 | Ga0097621_101245509 | 3300006237 | Bacteria | 702 |
| 493 | Ga0097621_101509884 | 3300006237 | Bacteria | 638 |
| 494 | Ga0075370_10212574 | 3300006353 | Bacteria | 1142 |
| 495 | Ga0075370_10490689 | 3300006353 | Bacteria | 741 |
| 496 | Ga0068871_100003860 | 3300006358 | Bacteria | 10333 |
| 497 | Ga0068871_100015010 | 3300006358 | Bacteria | 5792 |
| 498 | Ga0068871_100017231 | 3300006358 | Bacteria | 5462 |
| 499 | Ga0068871_100234064 | 3300006358 | Bacteria | 1595 |
| 500 | Ga0068871_100305471 | 3300006358 | Bacteria | 1397 |
| 501 | Ga0068871_100315066 | 3300006358 | Unclassified | 1376 |
| 502 | Ga0068871_100666139 | 3300006358 | Bacteria | 951 |
| 503 | Ga0068871_100879666 | 3300006358 | Bacteria | 829 |
| 504 | Ga0068871_100921890 | 3300006358 | Unclassified | 810 |
| 505 | Ga0068871_101035164 | 3300006358 | Bacteria | 766 |
| 506 | Ga0068871_101132280 | 3300006358 | Bacteria | 732 |
| 507 | Ga0068871_101855873 | 3300006358 | Bacteria | 573 |
| 508 | Ga0068871_101881755 | 3300006358 | Bacteria | 569 |
| 509 | Ga0068871_102063601 | 3300006358 | Unclassified | 543 |
| 510 | Ga0068871_102302527 | 3300006358 | Unclassified | 514 |
| 511 | Ga0075428_100010497 | 3300006844 | Bacteria | 10291 |
| 512 | Ga0075428_100043546 | 3300006844 | Bacteria | 4935 |
| 513 | Ga0075428_100108035 | 3300006844 | Unclassified | 3032 |
| 514 | Ga0075428_100477959 | 3300006844 | Unclassified | 1334 |
| 515 | Ga0075428_102279292 | 3300006844 | Bacteria | 558 |
| 516 | Ga0075430_100026460 | 3300006846 | Bacteria | 4935 |
| 517 | Ga0075430_100084952 | 3300006846 | Bacteria | 2650 |
| 518 | Ga0075431_100195236 | 3300006847 | Bacteria | 2072 |
| 519 | Ga0075431_100563260 | 3300006847 | Bacteria | 1126 |
| 520 | Ga0075434_100602397 | 3300006871 | Bacteria | 1118 |
| 521 | Ga0075429_100016535 | 3300006880 | Bacteria | 6391 |
| 522 | Ga0075429_100039595 | 3300006880 | Bacteria | 4102 |
| 523 | Ga0075429_100311291 | 3300006880 | Bacteria | 1378 |
| 524 | Ga0068865_100014264 | 3300006881 | Bacteria | 5046 |
| 525 | Ga0068865_100115404 | 3300006881 | Bacteria | 1987 |
| 526 | Ga0068865_100170998 | 3300006881 | Bacteria | 1666 |
| 527 | Ga0068865_100221094 | 3300006881 | Bacteria | 1481 |
| 528 | Ga0068865_100286972 | 3300006881 | Unclassified | 1312 |
| 529 | Ga0068865_100357065 | 3300006881 | Bacteria | 1185 |
| 530 | Ga0068865_100454330 | 3300006881 | Bacteria | 1060 |
| 531 | Ga0068865_100482239 | 3300006881 | Bacteria | 1031 |
| 532 | Ga0068865_100926891 | 3300006881 | Bacteria | 759 |
| 533 | Ga0068865_101708111 | 3300006881 | Unclassified | 567 |
| 534 | Ga0097620_100000013 | 3300006931 | Bacteria | 291126 |
| 535 | Ga0097620_100010105 | 3300006931 | Bacteria | 9512 |
| 536 | Ga0097620_100062249 | 3300006931 | Bacteria | 3761 |
| 537 | Ga0097620_100069741 | 3300006931 | Bacteria | 3550 |
| 538 | Ga0097620_100078715 | 3300006931 | Bacteria | 3337 |
| 539 | Ga0097620_100086798 | 3300006931 | Bacteria | 3176 |
| 540 | Ga0097620_100088052 | 3300006931 | Bacteria | 3154 |
| 541 | Ga0097620_100270951 | 3300006931 | Bacteria | 1790 |
| 542 | Ga0097620_100283331 | 3300006931 | Bacteria | 1750 |
| 543 | Ga0097620_100325229 | 3300006931 | Bacteria | 1632 |
| 544 | Ga0097620_100824180 | 3300006931 | Bacteria | 1015 |
| 545 | Ga0097620_100899455 | 3300006931 | Bacteria | 970 |
| 546 | Ga0097620_101414266 | 3300006931 | Bacteria | 767 |
| 547 | Ga0097620_101686187 | 3300006931 | Bacteria | 700 |
| 548 | Ga0097620_102260709 | 3300006931 | Bacteria | 600 |
| 549 | Ga0097620_102326905 | 3300006931 | Bacteria | 591 |
| 550 | Ga0097620_102869928 | 3300006931 | Unclassified | 528 |
| 551 | Ga0105251_10117551 | 3300009011 | Bacteria | 1208 |
| 552 | Ga0105251_10628716 | 3300009011 | Bacteria | 512 |
| 553 | Ga0105240_10073897 | 3300009093 | Bacteria | 4209 |
| 554 | Ga0105240_10330089 | 3300009093 | Bacteria | 1736 |
| 555 | Ga0105240_10542894 | 3300009093 | Bacteria | 1287 |
| 556 | Ga0105240_11380112 | 3300009093 | Unclassified | 741 |
| 557 | Ga0105240_11550884 | 3300009093 | Bacteria | 694 |
| 558 | Ga0111539_10021933 | 3300009094 | Bacteria | 7849 |
| 559 | Ga0111539_10319434 | 3300009094 | Unclassified | 1807 |
| 560 | Ga0111539_10929534 | 3300009094 | Bacteria | 1011 |
| 561 | Ga0111539_10933982 | 3300009094 | Bacteria | 1009 |
| 562 | Ga0111539_11718783 | 3300009094 | Bacteria | 728 |
| 563 | Ga0111539_11830652 | 3300009094 | Bacteria | 704 |
| 564 | Ga0111539_12544072 | 3300009094 | Bacteria | 594 |
| 565 | Ga0111539_13226945 | 3300009094 | Unclassified | 526 |
| 566 | Ga0105245_10204984 | 3300009098 | Bacteria | 1895 |
| 567 | Ga0105247_10003653 | 3300009101 | Bacteria | 9994 |
| 568 | Ga0105247_10006290 | 3300009101 | Bacteria | 7361 |
| 569 | Ga0105247_10285655 | 3300009101 | Bacteria | 1140 |
| 570 | Ga0105247_11555552 | 3300009101 | Bacteria | 541 |
| 571 | Ga0105247_11705607 | 3300009101 | Unclassified | 521 |
| 572 | Ga0114129_10006355 | 3300009147 | Bacteria | 16753 |
| 573 | Ga0114129_10021381 | 3300009147 | Bacteria | 9184 |
| 574 | Ga0114129_10048278 | 3300009147 | Bacteria | 5981 |
| 575 | Ga0114129_10118770 | 3300009147 | Bacteria | 3642 |
| 576 | Ga0114129_10612993 | 3300009147 | Bacteria | 1409 |
| 577 | Ga0105243_10221980 | 3300009148 | Bacteria | 1671 |
| 578 | Ga0105243_10622689 | 3300009148 | Bacteria | 1042 |
| 579 | Ga0105243_10639247 | 3300009148 | Bacteria | 1030 |
| 580 | Ga0105241_10000607 | 3300009174 | Bacteria | 27006 |
| 581 | Ga0105241_10001739 | 3300009174 | Bacteria | 16527 |
| 582 | Ga0105241_10026762 | 3300009174 | Bacteria | 4293 |
| 583 | Ga0105241_10275544 | 3300009174 | Bacteria | 1435 |
| 584 | Ga0105241_10405623 | 3300009174 | Bacteria | 1196 |
| 585 | Ga0105241_10569829 | 3300009174 | Bacteria | 1019 |
| 586 | Ga0105241_10762013 | 3300009174 | Bacteria | 888 |
| 587 | Ga0105241_11505287 | 3300009174 | Bacteria | 648 |
| 588 | Ga0105241_11538202 | 3300009174 | Bacteria | 641 |
| 589 | Ga0105241_11538794 | 3300009174 | Bacteria | 641 |
| 590 | Ga0105241_11834085 | 3300009174 | Unclassified | 593 |
| 591 | Ga0105242_10007154 | 3300009176 | Bacteria | 8615 |
| 592 | Ga0105242_10030421 | 3300009176 | Bacteria | 4311 |
| 593 | Ga0105242_10147457 | 3300009176 | Bacteria | 2048 |
| 594 | Ga0105242_10597639 | 3300009176 | Unclassified | 1065 |
| 595 | Ga0105242_10844510 | 3300009176 | Bacteria | 911 |
| 596 | Ga0105242_11358156 | 3300009176 | Bacteria | 736 |
| 597 | Ga0105242_11713805 | 3300009176 | Unclassified | 665 |
| 598 | Ga0105248_10261967 | 3300009177 | Bacteria | 1946 |
| 599 | Ga0105237_10005546 | 3300009545 | Bacteria | 14228 |
| 600 | Ga0105237_10011762 | 3300009545 | Bacteria | 9258 |
| 601 | Ga0105237_10081869 | 3300009545 | Bacteria | 3219 |
| 602 | Ga0105237_10358878 | 3300009545 | Bacteria | 1462 |
| 603 | Ga0105237_11174810 | 3300009545 | Unclassified | 774 |
| 604 | Ga0105249_10001440 | 3300009553 | Bacteria | 20815 |
| 605 | Ga0105249_10001920 | 3300009553 | Bacteria | 18039 |
| 606 | Ga0105249_10002116 | 3300009553 | Bacteria | 17248 |
| 607 | Ga0105249_10006146 | 3300009553 | Bacteria | 10415 |
| 608 | Ga0105249_10059447 | 3300009553 | Bacteria | 3505 |
| 609 | Ga0105249_10115848 | 3300009553 | Bacteria | 2540 |
| 610 | Ga0105249_10299911 | 3300009553 | Bacteria | 1611 |
| 611 | Ga0105249_10718590 | 3300009553 | Bacteria | 1060 |
| 612 | Ga0105249_10842509 | 3300009553 | Bacteria | 982 |
| 613 | Ga0105249_12737691 | 3300009553 | Bacteria | 565 |
| 614 | Ga0099796_10548998 | 3300010159 | Bacteria | 519 |
| 615 | Ga0105239_10001030 | 3300010375 | Bacteria | 38874 |
| 616 | Ga0105239_10121875 | 3300010375 | Bacteria | 2897 |
| 617 | Ga0105239_10130222 | 3300010375 | Bacteria | 2798 |
| 618 | Ga0105239_10188446 | 3300010375 | Bacteria | 2309 |
| 619 | Ga0105239_10315190 | 3300010375 | Bacteria | 1763 |
| 620 | Ga0105239_10328002 | 3300010375 | Bacteria | 1726 |
| 621 | Ga0105239_11091723 | 3300010375 | Bacteria | 918 |
| 622 | Ga0105239_12167462 | 3300010375 | Bacteria | 646 |
| 623 | Ga0105239_12742352 | 3300010375 | Bacteria | 575 |
| 624 | Ga0105246_10202600 | 3300011119 | Unclassified | 1544 |
| 625 | Ga0105246_10225083 | 3300011119 | Bacteria | 1473 |
| 626 | Ga0105246_10227029 | 3300011119 | Bacteria | 1468 |
| 627 | Ga0105246_10262137 | 3300011119 | Unclassified | 1377 |
| 628 | Ga0105246_10290881 | 3300011119 | Unclassified | 1314 |
| 629 | Ga0105246_10439468 | 3300011119 | Bacteria | 1094 |
| 630 | Ga0105246_11094778 | 3300011119 | Bacteria | 727 |
| 631 | Ga0105246_11133743 | 3300011119 | Bacteria | 716 |
| 632 | Ga0105246_11743308 | 3300011119 | Bacteria | 593 |
| 633 | Ga0105246_11801505 | 3300011119 | Bacteria | 585 |
| 634 | Ga0157373_10010111 | 3300013100 | Bacteria | 6950 |
| 635 | Ga0157373_10010949 | 3300013100 | Bacteria | 6677 |
| 636 | Ga0157373_10048518 | 3300013100 | Bacteria | 3027 |
| 637 | Ga0157373_10054494 | 3300013100 | Bacteria | 2841 |
| 638 | Ga0157373_10146381 | 3300013100 | Bacteria | 1662 |
| 639 | Ga0157373_10166453 | 3300013100 | Bacteria | 1551 |
| 640 | Ga0157373_10193034 | 3300013100 | Bacteria | 1435 |
| 641 | Ga0157373_10341457 | 3300013100 | Unclassified | 1067 |
| 642 | Ga0157373_10423336 | 3300013100 | Bacteria | 956 |
| 643 | Ga0157373_10429817 | 3300013100 | Unclassified | 949 |
| 644 | Ga0157373_11365537 | 3300013100 | Bacteria | 538 |
| 645 | Ga0157371_10002605 | 3300013102 | Bacteria | 17116 |
| 646 | Ga0157371_10006357 | 3300013102 | Bacteria | 9770 |
| 647 | Ga0157371_10017441 | 3300013102 | Bacteria | 5332 |
| 648 | Ga0157371_10039615 | 3300013102 | Bacteria | 3369 |
| 649 | Ga0157371_10056378 | 3300013102 | Bacteria | 2787 |
| 650 | Ga0157371_10087373 | 3300013102 | Bacteria | 2208 |
| 651 | Ga0157371_10094817 | 3300013102 | Bacteria | 2115 |
| 652 | Ga0157371_10168529 | 3300013102 | Bacteria | 1564 |
| 653 | Ga0157371_10172783 | 3300013102 | Bacteria | 1544 |
| 654 | Ga0157371_10183731 | 3300013102 | Bacteria | 1496 |
| 655 | Ga0157371_10209688 | 3300013102 | Bacteria | 1398 |
| 656 | Ga0157371_10272766 | 3300013102 | Bacteria | 1221 |
| 657 | Ga0157371_10300057 | 3300013102 | Bacteria | 1163 |
| 658 | Ga0157371_10748900 | 3300013102 | Bacteria | 734 |
| 659 | Ga0157371_10893120 | 3300013102 | Bacteria | 673 |
| 660 | Ga0157371_11323232 | 3300013102 | Bacteria | 558 |
| 661 | Ga0157371_11366592 | 3300013102 | Unclassified | 549 |
| 662 | Ga0157371_11615693 | 3300013102 | Bacteria | 508 |
| 663 | Ga0157370_10001361 | 3300013104 | Bacteria | 30267 |
| 664 | Ga0157370_10013762 | 3300013104 | Bacteria | 8313 |
| 665 | Ga0157370_10100782 | 3300013104 | Bacteria | 2706 |
| 666 | Ga0157370_10247715 | 3300013104 | Unclassified | 1648 |
| 667 | Ga0157370_10251876 | 3300013104 | Bacteria | 1633 |
| 668 | Ga0157370_10304121 | 3300013104 | Unclassified | 1472 |
| 669 | Ga0157370_10352286 | 3300013104 | Bacteria | 1357 |
| 670 | Ga0157370_10384508 | 3300013104 | Bacteria | 1293 |
| 671 | Ga0157370_10425762 | 3300013104 | Bacteria | 1221 |
| 672 | Ga0157370_10586891 | 3300013104 | Bacteria | 1021 |
| 673 | Ga0157370_10769651 | 3300013104 | Bacteria | 877 |
| 674 | Ga0157370_11320897 | 3300013104 | Bacteria | 650 |
| 675 | Ga0157370_11390421 | 3300013104 | Bacteria | 632 |
| 676 | Ga0157370_11704708 | 3300013104 | Unclassified | 566 |
| 677 | Ga0157369_10019844 | 3300013105 | Bacteria | 7521 |
| 678 | Ga0157369_10035272 | 3300013105 | Bacteria | 5486 |
| 679 | Ga0157369_10069114 | 3300013105 | Bacteria | 3795 |
| 680 | Ga0157369_10093086 | 3300013105 | Bacteria | 3217 |
| 681 | Ga0157369_10133167 | 3300013105 | Bacteria | 2633 |
| 682 | Ga0157369_10453116 | 3300013105 | Bacteria | 1329 |
| 683 | Ga0157369_12259826 | 3300013105 | Unclassified | 551 |
| 684 | Ga0157374_10006069 | 3300013296 | Bacteria | 10225 |
| 685 | Ga0157374_10010105 | 3300013296 | Bacteria | 8104 |
| 686 | Ga0157374_10035407 | 3300013296 | Bacteria | 4567 |
| 687 | Ga0157374_10071484 | 3300013296 | Bacteria | 3271 |
| 688 | Ga0157374_10089454 | 3300013296 | Bacteria | 2934 |
| 689 | Ga0157374_10114491 | 3300013296 | Bacteria | 2597 |
| 690 | Ga0157374_10159147 | 3300013296 | Unclassified | 2199 |
| 691 | Ga0157374_10176423 | 3300013296 | Bacteria | 2086 |
| 692 | Ga0157374_10798738 | 3300013296 | Bacteria | 959 |
| 693 | Ga0157374_10815803 | 3300013296 | Bacteria | 949 |
| 694 | Ga0157374_11004597 | 3300013296 | Unclassified | 853 |
| 695 | Ga0157374_12180581 | 3300013296 | Unclassified | 581 |
| 696 | Ga0157378_10003215 | 3300013297 | Bacteria | 14526 |
| 697 | Ga0157378_10003796 | 3300013297 | Bacteria | 13379 |
| 698 | Ga0157378_10026251 | 3300013297 | Bacteria | 5135 |
| 699 | Ga0157378_10033953 | 3300013297 | Bacteria | 4512 |
| 700 | Ga0157378_10067026 | 3300013297 | Bacteria | 3216 |
| 701 | Ga0157378_10264251 | 3300013297 | Bacteria | 1652 |
| 702 | Ga0157378_10377791 | 3300013297 | Bacteria | 1391 |
| 703 | Ga0157378_10689944 | 3300013297 | Bacteria | 1040 |
| 704 | Ga0157378_10720578 | 3300013297 | Bacteria | 1018 |
| 705 | Ga0157378_10749144 | 3300013297 | Unclassified | 999 |
| 706 | Ga0157378_10971219 | 3300013297 | Bacteria | 883 |
| 707 | Ga0163162_10000722 | 3300013306 | Bacteria | 30672 |
| 708 | Ga0163162_10011275 | 3300013306 | Bacteria | 8716 |
| 709 | Ga0163162_10030877 | 3300013306 | Bacteria | 5311 |
| 710 | Ga0163162_10053922 | 3300013306 | Bacteria | 4042 |
| 711 | Ga0163162_10081748 | 3300013306 | Bacteria | 3302 |
| 712 | Ga0163162_10117430 | 3300013306 | Bacteria | 2762 |
| 713 | Ga0163162_10153728 | 3300013306 | Bacteria | 2419 |
| 714 | Ga0163162_10233605 | 3300013306 | Bacteria | 1970 |
| 715 | Ga0163162_10234643 | 3300013306 | Bacteria | 1965 |
| 716 | Ga0163162_10353911 | 3300013306 | Bacteria | 1601 |
| 717 | Ga0163162_10461057 | 3300013306 | Bacteria | 1402 |
| 718 | Ga0163162_10773215 | 3300013306 | Bacteria | 1079 |
| 719 | Ga0163162_11371591 | 3300013306 | Unclassified | 804 |
| 720 | Ga0163162_11763586 | 3300013306 | Unclassified | 707 |
| 721 | Ga0163162_12648402 | 3300013306 | Bacteria | 577 |
| 722 | Ga0157372_10028035 | 3300013307 | Bacteria | 6142 |
| 723 | Ga0157372_10068152 | 3300013307 | Bacteria | 4000 |
| 724 | Ga0157372_10071721 | 3300013307 | Bacteria | 3902 |
| 725 | Ga0157372_10080065 | 3300013307 | Bacteria | 3695 |
| 726 | Ga0157372_10080397 | 3300013307 | Bacteria | 3687 |
| 727 | Ga0157372_10112925 | 3300013307 | Unclassified | 3113 |
| 728 | Ga0157372_10134535 | 3300013307 | Bacteria | 2846 |
| 729 | Ga0157372_10265508 | 3300013307 | Bacteria | 1993 |
| 730 | Ga0157372_10335751 | 3300013307 | Bacteria | 1760 |
| 731 | Ga0157372_10449967 | 3300013307 | Bacteria | 1501 |
| 732 | Ga0157372_10536633 | 3300013307 | Bacteria | 1364 |
| 733 | Ga0157372_10549572 | 3300013307 | Bacteria | 1346 |
| 734 | Ga0157372_10562714 | 3300013307 | Bacteria | 1329 |
| 735 | Ga0157372_10697083 | 3300013307 | Bacteria | 1182 |
| 736 | Ga0157372_10727683 | 3300013307 | Unclassified | 1154 |
| 737 | Ga0157372_11114217 | 3300013307 | Bacteria | 913 |
| 738 | Ga0157372_11246437 | 3300013307 | Bacteria | 859 |
| 739 | Ga0157372_11279727 | 3300013307 | Bacteria | 846 |
| 740 | Ga0157372_11356810 | 3300013307 | Unclassified | 820 |
| 741 | Ga0157372_11578875 | 3300013307 | Bacteria | 755 |
| 742 | Ga0157372_11780485 | 3300013307 | Unclassified | 708 |
| 743 | Ga0157372_12493642 | 3300013307 | Unclassified | 594 |
| 744 | Ga0157372_12705790 | 3300013307 | Bacteria | 569 |
| 745 | Ga0157375_10002648 | 3300013308 | Bacteria | 15501 |
| 746 | Ga0157375_10015089 | 3300013308 | Bacteria | 6911 |
| 747 | Ga0157375_10031395 | 3300013308 | Bacteria | 5022 |
| 748 | Ga0157375_10097407 | 3300013308 | Bacteria | 3016 |
| 749 | Ga0157375_10127621 | 3300013308 | Bacteria | 2660 |
| 750 | Ga0157375_10243083 | 3300013308 | Bacteria | 1960 |
| 751 | Ga0157375_10255264 | 3300013308 | Bacteria | 1915 |
| 752 | Ga0157375_10260512 | 3300013308 | Bacteria | 1896 |
| 753 | Ga0157375_10395124 | 3300013308 | Bacteria | 1549 |
| 754 | Ga0157375_10406190 | 3300013308 | Unclassified | 1528 |
| 755 | Ga0157375_10510722 | 3300013308 | Bacteria | 1366 |
| 756 | Ga0157375_10542186 | 3300013308 | Bacteria | 1325 |
| 757 | Ga0157375_11273800 | 3300013308 | Unclassified | 864 |
| 758 | Ga0157375_13053795 | 3300013308 | Bacteria | 559 |
| 759 | Ga0163163_10001099 | 3300014325 | Bacteria | 22954 |
| 760 | Ga0163163_10006617 | 3300014325 | Bacteria | 10148 |
| 761 | Ga0163163_10103685 | 3300014325 | Unclassified | 2869 |
| 762 | Ga0163163_10233436 | 3300014325 | Bacteria | 1889 |
| 763 | Ga0163163_10235285 | 3300014325 | Bacteria | 1881 |
| 764 | Ga0163163_10290652 | 3300014325 | Bacteria | 1686 |
| 765 | Ga0163163_10303128 | 3300014325 | Bacteria | 1650 |
| 766 | Ga0163163_10390588 | 3300014325 | Bacteria | 1449 |
| 767 | Ga0163163_10669732 | 3300014325 | Bacteria | 1101 |
| 768 | Ga0163163_10803951 | 3300014325 | Bacteria | 1004 |
| 769 | Ga0163163_11920271 | 3300014325 | Bacteria | 652 |
| 770 | Ga0163163_12168570 | 3300014325 | Bacteria | 615 |
| 771 | Ga0157380_10063737 | 3300014326 | Bacteria | 2956 |
| 772 | Ga0157380_10100646 | 3300014326 | Bacteria | 2407 |
| 773 | Ga0157380_10105756 | 3300014326 | Bacteria | 2353 |
| 774 | Ga0157380_10198436 | 3300014326 | Bacteria | 1778 |
| 775 | Ga0157380_10211529 | 3300014326 | Bacteria | 1728 |
| 776 | Ga0157380_10436095 | 3300014326 | Bacteria | 1254 |
| 777 | Ga0157380_10507468 | 3300014326 | Unclassified | 1173 |
| 778 | Ga0157380_10599292 | 3300014326 | Bacteria | 1090 |
| 779 | Ga0157380_10692607 | 3300014326 | Bacteria | 1023 |
| 780 | Ga0157380_10806587 | 3300014326 | Bacteria | 956 |
| 781 | Ga0157380_10850544 | 3300014326 | Bacteria | 934 |
| 782 | Ga0157380_10899160 | 3300014326 | Unclassified | 911 |
| 783 | Ga0157380_10947884 | 3300014326 | Bacteria | 890 |
| 784 | Ga0157380_11402009 | 3300014326 | Unclassified | 749 |
| 785 | Ga0157380_11417247 | 3300014326 | Bacteria | 746 |
| 786 | Ga0157380_11604824 | 3300014326 | Bacteria | 706 |
| 787 | Ga0157377_10000916 | 3300014745 | Bacteria | 12300 |
| 788 | Ga0157377_10015970 | 3300014745 | Bacteria | 3852 |
| 789 | Ga0157377_10059777 | 3300014745 | Bacteria | 2174 |
| 790 | Ga0157377_10136866 | 3300014745 | Bacteria | 1502 |
| 791 | Ga0157377_10169948 | 3300014745 | Bacteria | 1363 |
| 792 | Ga0157377_10209117 | 3300014745 | Bacteria | 1243 |
| 793 | Ga0157377_10244516 | 3300014745 | Bacteria | 1160 |
| 794 | Ga0157377_10598561 | 3300014745 | Bacteria | 786 |
| 795 | Ga0157377_10698905 | 3300014745 | Unclassified | 736 |
| 796 | Ga0157379_10065826 | 3300014968 | Bacteria | 3240 |
| 797 | Ga0157379_10123465 | 3300014968 | Bacteria | 2330 |
| 798 | Ga0157379_10216724 | 3300014968 | Bacteria | 1734 |
| 799 | Ga0157379_10247188 | 3300014968 | Bacteria | 1619 |
| 800 | Ga0157379_10705112 | 3300014968 | Bacteria | 947 |
| 801 | Ga0157379_10822047 | 3300014968 | Bacteria | 878 |
| 802 | Ga0157379_11046349 | 3300014968 | Bacteria | 780 |
| 803 | Ga0157379_11256426 | 3300014968 | Bacteria | 714 |
| 804 | Ga0157376_10030234 | 3300014969 | Bacteria | 4323 |
| 805 | Ga0157376_10138281 | 3300014969 | Bacteria | 2182 |
| 806 | Ga0157376_10243683 | 3300014969 | Bacteria | 1676 |
| 807 | Ga0157376_10286984 | 3300014969 | Bacteria | 1552 |
| 808 | Ga0157376_10397069 | 3300014969 | Bacteria | 1332 |
| 809 | Ga0157376_10452433 | 3300014969 | Bacteria | 1253 |
| 810 | Ga0157376_10806850 | 3300014969 | Bacteria | 951 |
| 811 | Ga0157376_10858890 | 3300014969 | Bacteria | 923 |
| 812 | Ga0157376_11042656 | 3300014969 | Bacteria | 842 |
| 813 | Ga0163161_10138583 | 3300017792 | Bacteria | 1841 |
| 814 | Ga0163161_10388731 | 3300017792 | Bacteria | 1116 |
| 815 | Ga0163161_10579301 | 3300017792 | Bacteria | 923 |
| 816 | Ga0163161_11126393 | 3300017792 | Bacteria | 676 |
| 817 | Ga0163161_11268531 | 3300017792 | Unclassified | 639 |
| 818 | Ga0163161_11316854 | 3300017792 | Bacteria | 628 |
| 819 | Ga0163161_11855944 | 3300017792 | Unclassified | 536 |
| 820 | Ga0209258_100032 | 3300025242 | Bacteria | 452764 |
| 821 | Ga0207425_1006123 | 3300025245 | Bacteria | 3329 |
| 822 | Ga0209646_1000050 | 3300025246 | Bacteria | 296599 |
| 823 | Ga0209646_1026798 | 3300025246 | Bacteria | 797 |
| 824 | Ga0209026_1000195 | 3300025250 | Bacteria | 84589 |
| 825 | Ga0209148_1000525 | 3300025254 | Bacteria | 37785 |
| 826 | Ga0209129_1013708 | 3300025258 | Bacteria | 1769 |
| 827 | Ga0209673_1000339 | 3300025273 | Bacteria | 85906 |
| 828 | Ga0209673_1047261 | 3300025273 | Bacteria | 1168 |
| 829 | Ga0209564_1003365 | 3300025295 | Bacteria | 11060 |
| 830 | Ga0209564_1011893 | 3300025295 | Bacteria | 3852 |
| 831 | Ga0209758_1000653 | 3300025297 | Bacteria | 52393 |
| 832 | Ga0209758_1005705 | 3300025297 | Bacteria | 9393 |
| 833 | Ga0209050_1000256 | 3300025298 | Bacteria | 114192 |
| 834 | Ga0207426_1001367 | 3300025302 | Bacteria | 20677 |
| 835 | Ga0207426_1002135 | 3300025302 | Bacteria | 13503 |
| 836 | Ga0207426_1010849 | 3300025302 | Bacteria | 3510 |
| 837 | Ga0207426_1077809 | 3300025302 | Bacteria | 907 |
| 838 | Ga0209051_1017223 | 3300025303 | Bacteria | 3235 |
| 839 | Ga0209257_1000659 | 3300025304 | Bacteria | 54234 |
| 840 | Ga0207697_10051134 | 3300025315 | Bacteria | 1707 |
| 841 | Ga0207697_10188867 | 3300025315 | Bacteria | 904 |
| 842 | Ga0207656_10004462 | 3300025321 | Bacteria | 4890 |
| 843 | Ga0207656_10065766 | 3300025321 | Bacteria | 1601 |
| 844 | Ga0207656_10429256 | 3300025321 | Bacteria | 666 |
| 845 | Ga0207656_10432301 | 3300025321 | Bacteria | 664 |
| 846 | Ga0207682_10038461 | 3300025893 | Bacteria | 1941 |
| 847 | Ga0207682_10068997 | 3300025893 | Bacteria | 1494 |
| 848 | Ga0207682_10203036 | 3300025893 | Bacteria | 912 |
| 849 | Ga0207682_10243979 | 3300025893 | Unclassified | 835 |
| 850 | Ga0207642_10043852 | 3300025899 | Bacteria | 1976 |
| 851 | Ga0207642_10129380 | 3300025899 | Bacteria | 1315 |
| 852 | Ga0207642_10365143 | 3300025899 | Unclassified | 855 |
| 853 | Ga0207710_10000509 | 3300025900 | Bacteria | 24244 |
| 854 | Ga0207688_10034747 | 3300025901 | Bacteria | 2791 |
| 855 | Ga0207688_10228410 | 3300025901 | Bacteria | 1123 |
| 856 | Ga0207688_10259500 | 3300025901 | Bacteria | 1054 |
| 857 | Ga0207688_10302439 | 3300025901 | Bacteria | 978 |
| 858 | Ga0207680_10000113 | 3300025903 | Bacteria | 37153 |
| 859 | Ga0207680_10012344 | 3300025903 | Bacteria | 4348 |
| 860 | Ga0207680_10050510 | 3300025903 | Bacteria | 2482 |
| 861 | Ga0207680_10051558 | 3300025903 | Bacteria | 2461 |
| 862 | Ga0207680_10385937 | 3300025903 | Bacteria | 988 |
| 863 | Ga0207680_11130535 | 3300025903 | Bacteria | 559 |
| 864 | Ga0207647_10005536 | 3300025904 | Bacteria | 9246 |
| 865 | Ga0207685_10125551 | 3300025905 | Unclassified | 1132 |
| 866 | Ga0207645_10000920 | 3300025907 | Bacteria | 24452 |
| 867 | Ga0207645_10046411 | 3300025907 | Bacteria | 2775 |
| 868 | Ga0207645_10320703 | 3300025907 | Bacteria | 1033 |
| 869 | Ga0207643_10036267 | 3300025908 | Bacteria | 2765 |
| 870 | Ga0207705_10069787 | 3300025909 | Bacteria | 2545 |
| 871 | Ga0207705_10109588 | 3300025909 | Bacteria | 2039 |
| 872 | Ga0207705_10232984 | 3300025909 | Bacteria | 1401 |
| 873 | Ga0207705_10350379 | 3300025909 | Bacteria | 1137 |
| 874 | Ga0207684_11145948 | 3300025910 | Bacteria | 646 |
| 875 | Ga0207654_10007676 | 3300025911 | Bacteria | 5442 |
| 876 | Ga0207654_10018791 | 3300025911 | Bacteria | 3633 |
| 877 | Ga0207654_10722096 | 3300025911 | Bacteria | 717 |
| 878 | Ga0207707_10046933 | 3300025912 | Bacteria | 3762 |
| 879 | Ga0207707_10078348 | 3300025912 | Bacteria | 2886 |
| 880 | Ga0207707_10420269 | 3300025912 | Bacteria | 1146 |
| 881 | Ga0207695_10071320 | 3300025913 | Bacteria | 3548 |
| 882 | Ga0207695_10440951 | 3300025913 | Bacteria | 1186 |
| 883 | Ga0207695_10838035 | 3300025913 | Bacteria | 799 |
| 884 | Ga0207671_10000965 | 3300025914 | Bacteria | 35673 |
| 885 | Ga0207671_10330504 | 3300025914 | Bacteria | 1207 |
| 886 | Ga0207660_10064310 | 3300025917 | Bacteria | 2648 |
| 887 | Ga0207660_10069191 | 3300025917 | Bacteria | 2562 |
| 888 | Ga0207662_10111795 | 3300025918 | Bacteria | 1704 |
| 889 | Ga0207662_10501719 | 3300025918 | Bacteria | 836 |
| 890 | Ga0207662_10652659 | 3300025918 | Bacteria | 735 |
| 891 | Ga0207657_10030117 | 3300025919 | Bacteria | 4931 |
| 892 | Ga0207657_10124366 | 3300025919 | Bacteria | 2119 |
| 893 | Ga0207657_10124836 | 3300025919 | Bacteria | 2115 |
| 894 | Ga0207649_10001633 | 3300025920 | Bacteria | 13025 |
| 895 | Ga0207649_10001967 | 3300025920 | Bacteria | 11709 |
| 896 | Ga0207649_10196919 | 3300025920 | Bacteria | 1420 |
| 897 | Ga0207649_10623630 | 3300025920 | Bacteria | 831 |
| 898 | Ga0207649_10746658 | 3300025920 | Bacteria | 761 |
| 899 | Ga0207649_10872416 | 3300025920 | Bacteria | 705 |
| 900 | Ga0207649_11149431 | 3300025920 | Bacteria | 613 |
| 901 | Ga0207652_10010146 | 3300025921 | Bacteria | 7587 |
| 902 | Ga0207652_10304548 | 3300025921 | Bacteria | 1438 |
| 903 | Ga0207681_10050405 | 3300025923 | Bacteria | 2817 |
| 904 | Ga0207681_10097741 | 3300025923 | Bacteria | 2111 |
| 905 | Ga0207681_10158627 | 3300025923 | Bacteria | 1703 |
| 906 | Ga0207681_10169106 | 3300025923 | Bacteria | 1656 |
| 907 | Ga0207681_10407281 | 3300025923 | Bacteria | 1099 |
| 908 | Ga0207650_10125219 | 3300025925 | Bacteria | 2005 |
| 909 | Ga0207650_10289002 | 3300025925 | Bacteria | 1336 |
| 910 | Ga0207650_10290916 | 3300025925 | Bacteria | 1332 |
| 911 | Ga0207650_10296689 | 3300025925 | Bacteria | 1319 |
| 912 | Ga0207650_10308011 | 3300025925 | Bacteria | 1295 |
| 913 | Ga0207650_11774036 | 3300025925 | Unclassified | 522 |
| 914 | Ga0207659_10013948 | 3300025926 | Bacteria | 5169 |
| 915 | Ga0207659_10033422 | 3300025926 | Bacteria | 3540 |
| 916 | Ga0207659_10081595 | 3300025926 | Bacteria | 2392 |
| 917 | Ga0207659_10142609 | 3300025926 | Bacteria | 1861 |
| 918 | Ga0207659_10157302 | 3300025926 | Bacteria | 1781 |
| 919 | Ga0207659_10266662 | 3300025926 | Bacteria | 1395 |
| 920 | Ga0207659_11221243 | 3300025926 | Bacteria | 646 |
| 921 | Ga0207687_10186070 | 3300025927 | Bacteria | 1612 |
| 922 | Ga0207644_10132991 | 3300025931 | Bacteria | 1907 |
| 923 | Ga0207644_10200414 | 3300025931 | Bacteria | 1574 |
| 924 | Ga0207644_10476686 | 3300025931 | Bacteria | 1027 |
| 925 | Ga0207644_10575175 | 3300025931 | Bacteria | 934 |
| 926 | Ga0207644_10649308 | 3300025931 | Bacteria | 878 |
| 927 | Ga0207644_11809436 | 3300025931 | Bacteria | 511 |
| 928 | Ga0207690_10077899 | 3300025932 | Bacteria | 2305 |
| 929 | Ga0207690_10336867 | 3300025932 | Bacteria | 1189 |
| 930 | Ga0207690_11431134 | 3300025932 | Bacteria | 578 |
| 931 | Ga0207706_10002817 | 3300025933 | Bacteria | 16877 |
| 932 | Ga0207706_10032029 | 3300025933 | Bacteria | 4683 |
| 933 | Ga0207706_10301950 | 3300025933 | Bacteria | 1395 |
| 934 | Ga0207706_10350292 | 3300025933 | Bacteria | 1284 |
| 935 | Ga0207686_10000668 | 3300025934 | Bacteria | 21199 |
| 936 | Ga0207686_10013149 | 3300025934 | Bacteria | 4572 |
| 937 | Ga0207686_10039781 | 3300025934 | Bacteria | 2854 |
| 938 | Ga0207686_10396132 | 3300025934 | Bacteria | 1050 |
| 939 | Ga0207686_10549188 | 3300025934 | Bacteria | 903 |
| 940 | Ga0207686_11200474 | 3300025934 | Bacteria | 621 |
| 941 | Ga0207709_11004077 | 3300025935 | Unclassified | 682 |
| 942 | Ga0207670_10003085 | 3300025936 | Bacteria | 8803 |
| 943 | Ga0207670_10019316 | 3300025936 | Bacteria | 4161 |
| 944 | Ga0207670_10023002 | 3300025936 | Bacteria | 3872 |
| 945 | Ga0207670_10298847 | 3300025936 | Bacteria | 1260 |
| 946 | Ga0207669_10226556 | 3300025937 | Bacteria | 1376 |
| 947 | Ga0207669_10455882 | 3300025937 | Bacteria | 1014 |
| 948 | Ga0207669_11018441 | 3300025937 | Bacteria | 696 |
| 949 | Ga0207704_10057834 | 3300025938 | Bacteria | 2384 |
| 950 | Ga0207704_10119076 | 3300025938 | Bacteria | 1802 |
| 951 | Ga0207704_10311952 | 3300025938 | Bacteria | 1210 |
| 952 | Ga0207704_10361327 | 3300025938 | Bacteria | 1134 |
| 953 | Ga0207704_10479088 | 3300025938 | Bacteria | 999 |
| 954 | Ga0207704_10702655 | 3300025938 | Bacteria | 837 |
| 955 | Ga0207704_10803854 | 3300025938 | Bacteria | 785 |
| 956 | Ga0207691_10011397 | 3300025940 | Bacteria | 8533 |
| 957 | Ga0207691_10051341 | 3300025940 | Bacteria | 3771 |
| 958 | Ga0207691_10072810 | 3300025940 | Bacteria | 3099 |
| 959 | Ga0207691_10181325 | 3300025940 | Bacteria | 1840 |
| 960 | Ga0207691_10443603 | 3300025940 | Bacteria | 1105 |
| 961 | Ga0207691_10606945 | 3300025940 | Bacteria | 926 |
| 962 | Ga0207689_10000380 | 3300025942 | Bacteria | 41875 |
| 963 | Ga0207689_10001907 | 3300025942 | Bacteria | 19712 |
| 964 | Ga0207689_10006453 | 3300025942 | Bacteria | 10370 |
| 965 | Ga0207689_10016965 | 3300025942 | Bacteria | 6161 |
| 966 | Ga0207689_10024943 | 3300025942 | Bacteria | 5012 |
| 967 | Ga0207689_10035716 | 3300025942 | Bacteria | 4127 |
| 968 | Ga0207689_10144686 | 3300025942 | Bacteria | 1958 |
| 969 | Ga0207689_10149971 | 3300025942 | Bacteria | 1922 |
| 970 | Ga0207689_10198149 | 3300025942 | Bacteria | 1657 |
| 971 | Ga0207689_10599711 | 3300025942 | Bacteria | 926 |
| 972 | Ga0207689_11222915 | 3300025942 | Bacteria | 632 |
| 973 | Ga0207689_11710260 | 3300025942 | Bacteria | 521 |
| 974 | Ga0207661_10000183 | 3300025944 | Bacteria | 40561 |
| 975 | Ga0207661_10014178 | 3300025944 | Bacteria | 5834 |
| 976 | Ga0207661_10034081 | 3300025944 | Bacteria | 3957 |
| 977 | Ga0207661_10485509 | 3300025944 | Bacteria | 1128 |
| 978 | Ga0207661_10762815 | 3300025944 | Bacteria | 890 |
| 979 | Ga0207679_10000308 | 3300025945 | Bacteria | 36802 |
| 980 | Ga0207679_10002211 | 3300025945 | Bacteria | 12015 |
| 981 | Ga0207679_10071588 | 3300025945 | Bacteria | 2616 |
| 982 | Ga0207679_10075877 | 3300025945 | Bacteria | 2552 |
| 983 | Ga0207679_10667486 | 3300025945 | Bacteria | 941 |
| 984 | Ga0207679_11119982 | 3300025945 | Bacteria | 722 |
| 985 | Ga0207667_10032226 | 3300025949 | Bacteria | 5649 |
| 986 | Ga0207667_10626676 | 3300025949 | Bacteria | 1083 |
| 987 | Ga0207667_10670734 | 3300025949 | Bacteria | 1041 |
| 988 | Ga0207667_10746546 | 3300025949 | Bacteria | 978 |
| 989 | Ga0207667_10949716 | 3300025949 | Bacteria | 849 |
| 990 | Ga0207667_11241413 | 3300025949 | Bacteria | 723 |
| 991 | Ga0207651_10042406 | 3300025960 | Bacteria | 3028 |
| 992 | Ga0207651_10077065 | 3300025960 | Bacteria | 2385 |
| 993 | Ga0207651_10088586 | 3300025960 | Bacteria | 2257 |
| 994 | Ga0207651_10092389 | 3300025960 | Bacteria | 2219 |
| 995 | Ga0207651_10132861 | 3300025960 | Unclassified | 1908 |
| 996 | Ga0207651_10436500 | 3300025960 | Bacteria | 1121 |
| 997 | Ga0207651_10592206 | 3300025960 | Bacteria | 968 |
| 998 | Ga0207651_10633236 | 3300025960 | Bacteria | 938 |
| 999 | Ga0207712_10005082 | 3300025961 | Bacteria | 8319 |
| 1000 | Ga0207712_10011763 | 3300025961 | Bacteria | 5578 |
| 1001 | Ga0207712_10023854 | 3300025961 | Bacteria | 4043 |
| 1002 | Ga0207712_10037862 | 3300025961 | Bacteria | 3294 |
| 1003 | Ga0207712_10041820 | 3300025961 | Bacteria | 3152 |
| 1004 | Ga0207712_10195793 | 3300025961 | Bacteria | 1598 |
| 1005 | Ga0207668_10011523 | 3300025972 | Bacteria | 5376 |
| 1006 | Ga0207640_10041907 | 3300025981 | Bacteria | 2915 |
| 1007 | Ga0207640_10072082 | 3300025981 | Bacteria | 2329 |
| 1008 | Ga0207640_10134118 | 3300025981 | Unclassified | 1794 |
| 1009 | Ga0207640_10277372 | 3300025981 | Bacteria | 1315 |
| 1010 | Ga0207640_10455830 | 3300025981 | Bacteria | 1055 |
| 1011 | Ga0207640_11667235 | 3300025981 | Bacteria | 575 |
| 1012 | Ga0207658_10003708 | 3300025986 | Bacteria | 10759 |
| 1013 | Ga0207658_10020081 | 3300025986 | Bacteria | 4625 |
| 1014 | Ga0207658_10024233 | 3300025986 | Bacteria | 4244 |
| 1015 | Ga0207658_10253953 | 3300025986 | Bacteria | 1495 |
| 1016 | Ga0207658_10826341 | 3300025986 | Bacteria | 842 |
| 1017 | Ga0207658_10909420 | 3300025986 | Bacteria | 801 |
| 1018 | Ga0207658_11253087 | 3300025986 | Bacteria | 678 |
| 1019 | Ga0207677_10031330 | 3300026023 | Bacteria | 3405 |
| 1020 | Ga0207677_10149174 | 3300026023 | Bacteria | 1801 |
| 1021 | Ga0207677_10172688 | 3300026023 | Bacteria | 1692 |
| 1022 | Ga0207677_10175441 | 3300026023 | Bacteria | 1680 |
| 1023 | Ga0207677_10197959 | 3300026023 | Bacteria | 1595 |
| 1024 | Ga0207677_10980906 | 3300026023 | Bacteria | 765 |
| 1025 | Ga0207703_10036407 | 3300026035 | Bacteria | 3917 |
| 1026 | Ga0207703_10081972 | 3300026035 | Bacteria | 2691 |
| 1027 | Ga0207703_10620295 | 3300026035 | Bacteria | 1024 |
| 1028 | Ga0207639_10014657 | 3300026041 | Bacteria | 5521 |
| 1029 | Ga0207639_10044603 | 3300026041 | Bacteria | 3335 |
| 1030 | Ga0207639_10165750 | 3300026041 | Bacteria | 1866 |
| 1031 | Ga0207639_10193084 | 3300026041 | Bacteria | 1740 |
| 1032 | Ga0207639_10558305 | 3300026041 | Bacteria | 1052 |
| 1033 | Ga0207639_10767550 | 3300026041 | Unclassified | 897 |
| 1034 | Ga0207639_11483709 | 3300026041 | Bacteria | 636 |
| 1035 | Ga0207678_10065717 | 3300026067 | Bacteria | 3114 |
| 1036 | Ga0207678_10677955 | 3300026067 | Unclassified | 906 |
| 1037 | Ga0207708_10064969 | 3300026075 | Bacteria | 2789 |
| 1038 | Ga0207708_10368180 | 3300026075 | Bacteria | 1182 |
| 1039 | Ga0207708_10998639 | 3300026075 | Bacteria | 727 |
| 1040 | Ga0207702_10562196 | 3300026078 | Bacteria | 1116 |
| 1041 | Ga0207702_10789513 | 3300026078 | Bacteria | 938 |
| 1042 | Ga0207702_11131392 | 3300026078 | Bacteria | 777 |
| 1043 | Ga0207641_10000184 | 3300026088 | Bacteria | 86994 |
| 1044 | Ga0207641_10001379 | 3300026088 | Bacteria | 23962 |
| 1045 | Ga0207641_10011200 | 3300026088 | Bacteria | 7357 |
| 1046 | Ga0207641_10024994 | 3300026088 | Bacteria | 4926 |
| 1047 | Ga0207641_10249866 | 3300026088 | Bacteria | 1656 |
| 1048 | Ga0207641_10339822 | 3300026088 | Bacteria | 1428 |
| 1049 | Ga0207641_10573489 | 3300026088 | Bacteria | 1102 |
| 1050 | Ga0207641_11311963 | 3300026088 | Bacteria | 724 |
| 1051 | Ga0207641_11537856 | 3300026088 | Bacteria | 667 |
| 1052 | Ga0207648_10000860 | 3300026089 | Bacteria | 34249 |
| 1053 | Ga0207648_10017610 | 3300026089 | Bacteria | 6490 |
| 1054 | Ga0207648_10037487 | 3300026089 | Bacteria | 4270 |
| 1055 | Ga0207648_10045474 | 3300026089 | Bacteria | 3850 |
| 1056 | Ga0207648_10096147 | 3300026089 | Bacteria | 2592 |
| 1057 | Ga0207648_10110047 | 3300026089 | Bacteria | 2418 |
| 1058 | Ga0207648_10245323 | 3300026089 | Bacteria | 1596 |
| 1059 | Ga0207648_10255402 | 3300026089 | Bacteria | 1563 |
| 1060 | Ga0207648_10842831 | 3300026089 | Bacteria | 855 |
| 1061 | Ga0207648_11095681 | 3300026089 | Bacteria | 747 |
| 1062 | Ga0207676_10001951 | 3300026095 | Bacteria | 15035 |
| 1063 | Ga0207676_10015458 | 3300026095 | Bacteria | 5506 |
| 1064 | Ga0207676_10022928 | 3300026095 | Bacteria | 4597 |
| 1065 | Ga0207676_10080505 | 3300026095 | Bacteria | 2644 |
| 1066 | Ga0207676_10115148 | 3300026095 | Bacteria | 2257 |
| 1067 | Ga0207676_10124811 | 3300026095 | Bacteria | 2178 |
| 1068 | Ga0207676_10138994 | 3300026095 | Bacteria | 2077 |
| 1069 | Ga0207676_10240499 | 3300026095 | Bacteria | 1624 |
| 1070 | Ga0207676_10498046 | 3300026095 | Bacteria | 1156 |
| 1071 | Ga0207676_12008519 | 3300026095 | Unclassified | 577 |
| 1072 | Ga0207674_10040364 | 3300026116 | Bacteria | 4834 |
| 1073 | Ga0207674_10438952 | 3300026116 | Bacteria | 1262 |
| 1074 | Ga0207674_10461806 | 3300026116 | Bacteria | 1227 |
| 1075 | Ga0207674_10677807 | 3300026116 | Bacteria | 995 |
| 1076 | Ga0207674_10826144 | 3300026116 | Bacteria | 894 |
| 1077 | Ga0207674_10837534 | 3300026116 | Unclassified | 887 |
| 1078 | Ga0207674_11900206 | 3300026116 | Bacteria | 561 |
| 1079 | Ga0207675_100008623 | 3300026118 | Bacteria | 9586 |
| 1080 | Ga0207675_100046352 | 3300026118 | Bacteria | 4061 |
| 1081 | Ga0207675_100165080 | 3300026118 | Bacteria | 2114 |
| 1082 | Ga0207675_100192685 | 3300026118 | Bacteria | 1955 |
| 1083 | Ga0207675_100198755 | 3300026118 | Bacteria | 1925 |
| 1084 | Ga0207675_100234637 | 3300026118 | Bacteria | 1771 |
| 1085 | Ga0207675_100358061 | 3300026118 | Bacteria | 1431 |
| 1086 | Ga0207675_100380016 | 3300026118 | Bacteria | 1389 |
| 1087 | Ga0207675_100450760 | 3300026118 | Bacteria | 1275 |
| 1088 | Ga0207675_100540226 | 3300026118 | Bacteria | 1164 |
| 1089 | Ga0207683_10002839 | 3300026121 | Bacteria | 15129 |
| 1090 | Ga0207683_10119924 | 3300026121 | Bacteria | 2360 |
| 1091 | Ga0207683_10303018 | 3300026121 | Bacteria | 1462 |
| 1092 | Ga0207683_10434463 | 3300026121 | Bacteria | 1210 |
| 1093 | Ga0207683_10461829 | 3300026121 | Bacteria | 1171 |
| 1094 | Ga0207683_10685936 | 3300026121 | Bacteria | 949 |
| 1095 | Ga0207683_11488896 | 3300026121 | Bacteria | 625 |
| 1096 | Ga0207683_11507889 | 3300026121 | Bacteria | 621 |
| 1097 | Ga0207698_10058187 | 3300026142 | Bacteria | 2994 |
| 1098 | Ga0207698_10069458 | 3300026142 | Bacteria | 2786 |
| 1099 | Ga0207698_10285070 | 3300026142 | Bacteria | 1530 |
| 1100 | Ga0207698_10645038 | 3300026142 | Bacteria | 1048 |
| 1101 | Ga0207698_10775104 | 3300026142 | Unclassified | 959 |
| 1102 | Ga0207698_11916651 | 3300026142 | Bacteria | 607 |
| 1103 | Ga0209981_1066372 | 3300027378 | Bacteria | 555 |
| 1104 | Ga0209968_1055835 | 3300027526 | Bacteria | 691 |
| 1105 | Ga0209971_1100774 | 3300027682 | Bacteria | 707 |
| 1106 | Ga0268266_10029288 | 3300028379 | Bacteria | 4681 |
| 1107 | Ga0268266_10240746 | 3300028379 | Bacteria | 1670 |
| 1108 | Ga0268266_10269250 | 3300028379 | Bacteria | 1581 |
| 1109 | Ga0268266_10990619 | 3300028379 | Bacteria | 813 |
| 1110 | Ga0268266_11490070 | 3300028379 | Bacteria | 652 |
| 1111 | Ga0268266_11811590 | 3300028379 | Bacteria | 585 |
| 1112 | Ga0268265_10218713 | 3300028380 | Bacteria | 1665 |
| 1113 | Ga0268265_10258091 | 3300028380 | Bacteria | 1548 |
| 1114 | Ga0268265_10947400 | 3300028380 | Bacteria | 848 |
| 1115 | Ga0268265_10986228 | 3300028380 | Bacteria | 832 |
| 1116 | Ga0268265_12149664 | 3300028380 | Bacteria | 565 |
| 1117 | Ga0268264_10012233 | 3300028381 | Bacteria | 7060 |
| 1118 | Ga0268264_10017697 | 3300028381 | Bacteria | 5834 |
| 1119 | Ga0268264_10186287 | 3300028381 | Bacteria | 1889 |
| 1120 | Ga0268264_10547591 | 3300028381 | Bacteria | 1134 |
| 1121 | Ga0268264_10884539 | 3300028381 | Bacteria | 896 |
| 1122 | Ga0268264_10930117 | 3300028381 | Bacteria | 874 |
| 1123 | Ga0268264_10965040 | 3300028381 | Bacteria | 858 |
| 1124 | Ga0307515_10000455 | 3300028794 | Bacteria | 97670 |
| 1125 | Ga0307511_10328808 | 3300030521 | Bacteria | 671 |
| 1126 | Ga0307509_10098473 | 3300031507 | Bacteria | 2969 |
| 1127 | Ga0307509_10162480 | 3300031507 | Bacteria | 2128 |
| 1128 | Ga0307408_100278443 | 3300031548 | Bacteria | 1392 |
| 1129 | Ga0307508_10227058 | 3300031616 | Unclassified | 1466 |
| 1130 | Ga0307516_10694501 | 3300031730 | Unclassified | 674 |
| 1131 | Ga0307405_11177813 | 3300031731 | Bacteria | 662 |
| 1132 | Ga0307413_10034923 | 3300031824 | Bacteria | 2879 |
| 1133 | Ga0307413_10579210 | 3300031824 | Unclassified | 915 |
| 1134 | Ga0307410_12026717 | 3300031852 | Bacteria | 514 |
| 1135 | Ga0307407_10039492 | 3300031903 | Bacteria | 2625 |
| 1136 | Ga0307412_11172441 | 3300031911 | Bacteria | 687 |
| 1137 | Ga0307412_11510993 | 3300031911 | Bacteria | 611 |
| 1138 | Ga0307409_102610784 | 3300031995 | Bacteria | 534 |
| 1139 | Ga0307416_100330608 | 3300032002 | Bacteria | 1531 |
| 1140 | Ga0307416_100902127 | 3300032002 | Bacteria | 984 |
| 1141 | Ga0307416_102345531 | 3300032002 | Bacteria | 634 |
| 1142 | Ga0307414_10317882 | 3300032004 | Bacteria | 1324 |
| 1143 | Ga0307414_11342735 | 3300032004 | Unclassified | 664 |
| 1144 | Ga0307414_11959103 | 3300032004 | Bacteria | 547 |
| 1145 | Ga0307411_10261087 | 3300032005 | Bacteria | 1368 |
| 1146 | Ga0307411_10316235 | 3300032005 | Bacteria | 1259 |
| 1147 | Ga0307415_100142800 | 3300032126 | Bacteria | 1831 |
| 1148 | Ga0307415_100538822 | 3300032126 | Unclassified | 1028 |
| 1149 | Ga0373934_0104556 | 3300035086 | Bacteria | 1146 |
| 1150 | Ga0373944_0066866 | 3300035089 | Bacteria | 1163 |
| 1151 | Ga0373944_0445613 | 3300035089 | Unclassified | 504 |
| 1152 | Ga0373953_0114597 | 3300035117 | Bacteria | 1142 |
| 1153 | Ga0373943_0076049 | 3300035170 | Bacteria | 1712 |
| 1154 | Ga0373943_0305686 | 3300035170 | Bacteria | 904 |
| 1155 | Ga0373943_0651243 | 3300035170 | Bacteria | 622 |
| 1156 | Ga0373946_0219715 | 3300035171 | Bacteria | 917 |
| 1157 | Ga0373955_0071227 | 3300035172 | Bacteria | 1944 |
| 1158 | Ga0373924_0162034 | 3300035410 | Bacteria | 981 |
| 1159 | Ga0373931_0498748 | 3300035691 | Bacteria | 785 |
| 1160 | Ga0373931_1140980 | 3300035691 | Bacteria | 532 |
| 1161 | Ga0373935_0322514 | 3300035692 | Bacteria | 1096 |
| 1162 | Ga0373933_0015285 | 3300035724 | Bacteria | 4279 |
| 1163 | Ga0373947_0036116 | 3300035725 | Bacteria | 2929 |
| 1164 | Ga0373947_0156700 | 3300035725 | Bacteria | 1470 |
| 1165 | Ga0373937_0002667 | 3300036401 | Bacteria | 14878 |
| 1166 | Ga0373937_0377229 | 3300036401 | Bacteria | 1345 |
| 1167 | Ga0373925_0685544 | 3300037068 | Bacteria | 845 |
| 1168 | Ga0395899_0184714 | 3300037312 | Bacteria | 1462 |
| 1169 | Ga0395900_0470851 | 3300037418 | Bacteria | 1210 |
| 1170 | Ga0395900_0747476 | 3300037418 | Bacteria | 908 |
| 1171 | Ga0395900_1488485 | 3300037418 | Unclassified | 589 |
| 1172 | Ga0395898_0285479 | 3300037466 | Bacteria | 1574 |
| 1173 | Ga0395898_0344623 | 3300037466 | Bacteria | 1421 |
| 1174 | Ga0395905_0034017 | 3300037471 | Bacteria | 4786 |
| 1175 | Ga0436365_0149163 | 3300039437 | Bacteria | 3634 |
| 1176 | Ga0436365_0613268 | 3300039437 | Bacteria | 2185 |
| 1177 | Ga0439436_0020593 | 3300041404 | Bacteria | 1964 |
| 1178 | Ga0439439_0003200 | 3300041406 | Bacteria | 3588 |
| 1179 | Ga0439466_0051681 | 3300041411 | Bacteria | 1345 |
| 1180 | Ga0451798_0524149 | 3300041458 | Bacteria | 663 |
| 1181 | Ga0451807_1862478 | 3300041486 | Bacteria | 1383 |
| 1182 | Ga0451807_2252505 | 3300041486 | Bacteria | 904 |
| 1183 | Ga0451839_0915601 | 3300041496 | Bacteria | 1259 |
| 1184 | Ga0451851_0544741 | 3300041507 | Bacteria | 1210 |
| 1185 | Ga0451853_3011882 | 3300041512 | Bacteria | 609 |
| 1186 | Ga0439431_0005153 | 3300041997 | Bacteria | 2882 |
| 1187 | Ga0439431_0044376 | 3300041997 | Bacteria | 1139 |
| 1188 | Ga0439433_0034434 | 3300041999 | Bacteria | 1166 |
| 1189 | Ga0439433_0069896 | 3300041999 | Bacteria | 845 |
| 1190 | Ga0439441_040452 | 3300042001 | Unclassified | 933 |
| 1191 | Ga0439442_003302 | 3300042002 | Bacteria | 3188 |
| 1192 | Ga0439454_056956 | 3300042011 | Bacteria | 671 |
| 1193 | Ga0439457_057968 | 3300042014 | Bacteria | 875 |
| 1194 | Ga0439457_161289 | 3300042014 | Bacteria | 542 |
| 1195 | Ga0450890_057777 | 3300042127 | Bacteria | 603 |
| 1196 | Ga0450894_065197 | 3300042131 | Unclassified | 552 |
| 1197 | Ga0450898_002496 | 3300042134 | Bacteria | 2568 |
| 1198 | Ga0450899_001155 | 3300042135 | Bacteria | 2998 |
| 1199 | Ga0439434_0174820 | 3300042435 | Unclassified | 718 |
| 1200 | Ga0450893_0020902 | 3300042532 | Bacteria | 1128 |
| 1201 | Ga0466969_0002175 | 3300044656 | Bacteria | 10472 |
| 1202 | Ga0466972_0172860 | 3300044658 | Bacteria | 1014 |
| 1203 | Ga0466972_0311439 | 3300044658 | Unclassified | 735 |
| 1204 | Ga0466965_0465645 | 3300044683 | Bacteria | 705 |
| 1205 | Ga0466966_0000372 | 3300044684 | Bacteria | 29210 |
| 1206 | Ga0466961_0619196 | 3300044693 | Unclassified | 650 |
| 1207 | Ga0453684_1359317 | 3300044712 | Bacteria | 738 |
| 1208 | Ga0466968_0175887 | 3300044735 | Bacteria | 993 |
| 1209 | Ga0466968_0293421 | 3300044735 | Bacteria | 781 |
| 1210 | Ga0466970_0573469 | 3300044765 | Bacteria | 653 |
| 1211 | Ga0466960_0332200 | 3300044901 | Bacteria | 863 |
| 1212 | Ga0466959_0000076 | 3300045049 | Bacteria | 62314 |
| 1213 | Ga0466959_0030670 | 3300045049 | Bacteria | 3981 |
| 1214 | Ga0451576_0317661 | 3300045051 | Bacteria | 1630 |
| 1215 | Ga0466967_0069119 | 3300045976 | Bacteria | 3156 |
| 1216 | Ga0495627_011163 | 3300046453 | Bacteria | 3233 |
| 1217 | Ga0495592_0241459 | 3300046454 | Bacteria | 1198 |
| 1218 | Ga0495638_0157372 | 3300046460 | Bacteria | 1313 |
| 1219 | Ga0495651_0344036 | 3300046462 | Bacteria | 987 |
| 1220 | Ga0495650_0284301 | 3300046471 | Bacteria | 556 |
| 1221 | Ga0495664_0693636 | 3300046477 | Bacteria | 602 |
| 1222 | Ga0495594_0416782 | 3300046499 | Bacteria | 764 |
| 1223 | Ga0495608_0029638 | 3300046511 | Bacteria | 3710 |
| 1224 | Ga0495618_0160524 | 3300046514 | Bacteria | 1433 |
| 1225 | Ga0495628_0019670 | 3300046516 | Bacteria | 5578 |
| 1226 | Ga0495630_0008167 | 3300046517 | Bacteria | 7518 |
| 1227 | Ga0495652_0706674 | 3300046529 | Unclassified | 678 |
| 1228 | Ga0495640_0105481 | 3300046533 | Bacteria | 1846 |
| 1229 | Ga0495586_0011108 | 3300046535 | Bacteria | 4786 |
| 1230 | Ga0495598_0229815 | 3300046537 | Unclassified | 680 |
| 1231 | Ga0495598_0342498 | 3300046537 | Bacteria | 574 |
| 1232 | Ga0495621_0031236 | 3300046539 | Bacteria | 1826 |
| 1233 | Ga0495645_0128336 | 3300046543 | Bacteria | 1780 |
| 1234 | Ga0495633_0000153 | 3300046558 | Bacteria | 90972 |
| 1235 | Ga0495634_0016445 | 3300046642 | Bacteria | 5292 |
| 1236 | Ga0495625_0394614 | 3300046660 | Bacteria | 866 |
| 1237 | Ga0495635_0114621 | 3300046663 | Bacteria | 1840 |
| 1238 | Ga0495635_0388559 | 3300046663 | Bacteria | 928 |
| 1239 | Ga0495657_0072803 | 3300046675 | Bacteria | 2240 |
| 1240 | Ga0495599_0071095 | 3300046678 | Bacteria | 2172 |
| 1241 | Ga0495669_0636243 | 3300046684 | Bacteria | 519 |
| 1242 | Ga0495649_0297039 | 3300046694 | Bacteria | 823 |
| 1243 | Ga0495604_0340073 | 3300047317 | Bacteria | 999 |
| 1244 | Ga0495604_0552022 | 3300047317 | Bacteria | 743 |
| 1245 | Ga0495674_0333335 | 3300047319 | Bacteria | 1234 |
| 1246 | Ga0495674_0814247 | 3300047319 | Unclassified | 726 |
| 1247 | Ga0495672_0033415 | 3300047320 | Bacteria | 3187 |
| 1248 | Ga0495676_0111372 | 3300047321 | Bacteria | 2008 |
| 1249 | Ga0495676_0615514 | 3300047321 | Bacteria | 706 |
| 1250 | Ga0495680_0250799 | 3300047322 | Bacteria | 1254 |
| 1251 | Ga0495684_0467500 | 3300047471 | Bacteria | 873 |
| 1252 | Ga0495686_0007526 | 3300047472 | Bacteria | 8155 |
| 1253 | Ga0495686_0243458 | 3300047472 | Bacteria | 1013 |
| 1254 | Ga0496100_0514053 | 3300048903 | Bacteria | 924 |
| 1255 | Ga0496105_0564132 | 3300048908 | Bacteria | 887 |
| 1256 | Ga0496108_0687936 | 3300048911 | Bacteria | 887 |
| 1257 | Ga0496110_0030109 | 3300048913 | Bacteria | 4677 |
| 1258 | Ga0496110_0336023 | 3300048913 | Bacteria | 1376 |
| 1259 | Ga0496113_0663356 | 3300048916 | Bacteria | 834 |
| 1260 | Ga0501292_041869 | 3300049515 | Bacteria | 793 |
| 1261 | Ga0501298_015416 | 3300049521 | Bacteria | 1376 |
| 1262 | Ga0501031_0024317 | 3300049568 | Bacteria | 3948 |
| 1263 | Ga0501032_0003013 | 3300049569 | Bacteria | 13068 |
| 1264 | Ga0501032_0149135 | 3300049569 | Bacteria | 1538 |
| 1265 | Ga0501032_0160366 | 3300049569 | Bacteria | 1477 |
| 1266 | Ga0501032_0235536 | 3300049569 | Bacteria | 1190 |
| 1267 | Ga0501032_0307288 | 3300049569 | Bacteria | 1025 |
| 1268 | Ga0501033_0168839 | 3300049570 | Bacteria | 1572 |
| 1269 | Ga0501033_0171491 | 3300049570 | Bacteria | 1558 |
| 1270 | Ga0501033_0622476 | 3300049570 | Bacteria | 739 |
| 1271 | Ga0501034_0004054 | 3300049571 | Bacteria | 16437 |
| 1272 | Ga0501034_0055740 | 3300049571 | Bacteria | 3977 |
| 1273 | Ga0501034_0186464 | 3300049571 | Bacteria | 2038 |
| 1274 | Ga0501034_0259589 | 3300049571 | Bacteria | 1680 |
| 1275 | Ga0501034_0314242 | 3300049571 | Bacteria | 1500 |
| 1276 | Ga0501036_0005975 | 3300049572 | Bacteria | 9870 |
| 1277 | Ga0501036_0023640 | 3300049572 | Bacteria | 5178 |
| 1278 | Ga0501036_0483018 | 3300049572 | Bacteria | 1031 |
| 1279 | Ga0501036_1458061 | 3300049572 | Bacteria | 554 |
| 1280 | Ga0501037_0008358 | 3300049573 | Bacteria | 7587 |
| 1281 | Ga0501037_0019627 | 3300049573 | Bacteria | 4988 |
| 1282 | Ga0501037_0129634 | 3300049573 | Bacteria | 1809 |
| 1283 | Ga0501037_0247461 | 3300049573 | Bacteria | 1248 |
| 1284 | Ga0501037_0705897 | 3300049573 | Unclassified | 671 |
| 1285 | Ga0501038_0008230 | 3300049574 | Bacteria | 9598 |
| 1286 | Ga0501038_0012975 | 3300049574 | Bacteria | 7602 |
| 1287 | Ga0501038_0015492 | 3300049574 | Bacteria | 6930 |
| 1288 | Ga0501038_0767055 | 3300049574 | Bacteria | 719 |
| 1289 | Ga0501039_0004070 | 3300049575 | Bacteria | 10995 |
| 1290 | Ga0501039_0110954 | 3300049575 | Bacteria | 2144 |
| 1291 | Ga0501040_0377297 | 3300049576 | Bacteria | 1017 |
| 1292 | Ga0501043_0010180 | 3300049579 | Bacteria | 7370 |
| 1293 | Ga0501043_0042578 | 3300049579 | Bacteria | 3568 |
| 1294 | Ga0501043_0078691 | 3300049579 | Bacteria | 2591 |
| 1295 | Ga0501043_0374849 | 3300049579 | Bacteria | 1078 |
| 1296 | Ga0501043_0465266 | 3300049579 | Bacteria | 948 |
| 1297 | Ga0501043_0569927 | 3300049579 | Unclassified | 839 |
| 1298 | Ga0501046_0021865 | 3300049580 | Bacteria | 5273 |
| 1299 | Ga0501046_0041982 | 3300049580 | Bacteria | 3647 |
| 1300 | Ga0501047_0002595 | 3300049581 | Bacteria | 17203 |
| 1301 | Ga0501047_0071282 | 3300049581 | Bacteria | 3345 |
| 1302 | Ga0501048_0060298 | 3300049582 | Bacteria | 2689 |
| 1303 | Ga0501067_0019924 | 3300049583 | Bacteria | 3711 |
| 1304 | Ga0501068_0101820 | 3300049584 | Bacteria | 1781 |
| 1305 | Ga0501069_0701545 | 3300049585 | Bacteria | 610 |
| 1306 | Ga0501070_0018561 | 3300049586 | Bacteria | 5834 |
| 1307 | Ga0501070_0029610 | 3300049586 | Bacteria | 4588 |
| 1308 | Ga0501073_0001021 | 3300049589 | Bacteria | 20249 |
| 1309 | Ga0501073_0005193 | 3300049589 | Bacteria | 9762 |
| 1310 | Ga0501074_0000870 | 3300049590 | Bacteria | 19252 |
| 1311 | Ga0501074_0413113 | 3300049590 | Bacteria | 957 |
| 1312 | Ga0501202_005335 | 3300049652 | Bacteria | 2276 |
| 1313 | Ga0501207_007692 | 3300049654 | Bacteria | 1541 |
| 1314 | Ga0501207_011460 | 3300049654 | Bacteria | 1321 |
| 1315 | Ga0501207_037991 | 3300049654 | Bacteria | 829 |
| 1316 | Ga0501214_089510 | 3300049659 | Unclassified | 529 |
| 1317 | Ga0501223_106046 | 3300049663 | Bacteria | 583 |
| 1318 | Ga0501227_023200 | 3300049665 | Unclassified | 1441 |
| 1319 | Ga0501230_040675 | 3300049667 | Bacteria | 900 |
| 1320 | Ga0501235_126253 | 3300049669 | Bacteria | 644 |
| 1321 | Ga0501243_007566 | 3300049675 | Bacteria | 1662 |
| 1322 | Ga0501250_000832 | 3300049680 | Bacteria | 2297 |
| 1323 | Ga0501257_005190 | 3300049686 | Bacteria | 2865 |
| 1324 | Ga0501257_011337 | 3300049686 | Bacteria | 2034 |
| 1325 | Ga0501259_000638 | 3300049688 | Bacteria | 5621 |
| 1326 | Ga0501221_048979 | 3300049704 | Bacteria | 947 |
| 1327 | Ga0501225_0066659 | 3300049705 | Bacteria | 1018 |
| 1328 | Ga0501234_008433 | 3300049707 | Bacteria | 1606 |
| 1329 | Ga0501079_0038835 | 3300049741 | Bacteria | 3672 |
| 1330 | Ga0501079_0999593 | 3300049741 | Bacteria | 659 |
| 1331 | Ga0501080_0036451 | 3300049742 | Bacteria | 4590 |
| 1332 | Ga0501080_0043692 | 3300049742 | Bacteria | 4172 |
| 1333 | Ga0501080_0240935 | 3300049742 | Bacteria | 1651 |
| 1334 | Ga0501080_0561930 | 3300049742 | Bacteria | 1015 |
| 1335 | Ga0501080_0811575 | 3300049742 | Bacteria | 820 |
| 1336 | Ga0501080_0999646 | 3300049742 | Bacteria | 725 |
| 1337 | Ga0501083_0007806 | 3300049744 | Bacteria | 7580 |
| 1338 | Ga0501083_0008173 | 3300049744 | Bacteria | 7401 |
| 1339 | Ga0501083_0095690 | 3300049744 | Bacteria | 1959 |
| 1340 | Ga0501083_0617478 | 3300049744 | Unclassified | 705 |
| 1341 | Ga0501263_031172 | 3300049760 | Bacteria | 754 |
| 1342 | Ga0501266_001664 | 3300049763 | Bacteria | 2830 |
| 1343 | Ga0501268_098666 | 3300049765 | Unclassified | 624 |
| 1344 | Ga0501274_015326 | 3300049771 | Bacteria | 751 |
| 1345 | Ga0501275_028240 | 3300049772 | Bacteria | 729 |
| 1346 | Ga0501280_053627 | 3300049776 | Bacteria | 684 |
| 1347 | Ga0501035_0005968 | 3300049822 | Bacteria | 11465 |
| 1348 | Ga0501035_0094735 | 3300049822 | Bacteria | 2625 |
| 1349 | Ga0501035_0224160 | 3300049822 | Bacteria | 1604 |
| 1350 | Ga0501035_0227358 | 3300049822 | Bacteria | 1591 |
| 1351 | Ga0501044_0146125 | 3300049823 | Bacteria | 2350 |
| 1352 | Ga0501044_0157297 | 3300049823 | Bacteria | 2251 |
| 1353 | Ga0501044_0177558 | 3300049823 | Unclassified | 2098 |
| 1354 | Ga0501044_0227564 | 3300049823 | Bacteria | 1814 |
| 1355 | Ga0501044_0423672 | 3300049823 | Bacteria | 1241 |
| 1356 | Ga0501044_0684884 | 3300049823 | Bacteria | 912 |
| 1357 | Ga0501044_1107486 | 3300049823 | Unclassified | 661 |
| 1358 | nmdc:mga0k408_22327_c1 | 3300050493 | Bacteria | 3563 |
| 1359 | nmdc:mga0k408_236753_c1 | 3300050493 | Bacteria | 1090 |
| 1360 | nmdc:mga06z11_485122_c1 | 3300050494 | Bacteria | 748 |
| 1361 | nmdc:mga07m45_234658_c1 | 3300050496 | Bacteria | 1067 |
| 1362 | nmdc:mga07m45_336562_c1 | 3300050496 | Bacteria | 877 |
| 1363 | nmdc:mga05p37_217712_c1 | 3300050507 | Bacteria | 2306 |
| 1364 | nmdc:mga05p37_313746_c1 | 3300050507 | Bacteria | 1858 |
| 1365 | nmdc:mga05p37_7918_c1 | 3300050507 | Bacteria | 12540 |
| 1366 | nmdc:mga09592_20923_c1 | 3300050508 | Bacteria | 5388 |
| 1367 | nmdc:mga0qj67_17746_c1 | 3300050509 | Bacteria | 5413 |
| 1368 | nmdc:mga0qj67_35454_c1 | 3300050509 | Bacteria | 3901 |
| 1369 | nmdc:mga06r32_157804_c1 | 3300050510 | Bacteria | 2251 |
| 1370 | nmdc:mga06r32_519977_c1 | 3300050510 | Bacteria | 1166 |
| 1371 | nmdc:mga08y16_257358_c1 | 3300050511 | Bacteria | 1803 |
| 1372 | nmdc:mga08y16_833950_c1 | 3300050511 | Bacteria | 912 |
| 1373 | nmdc:mga08y16_872131_c1 | 3300050511 | Bacteria | 888 |
| 1374 | nmdc:mga0n895_553712_c1 | 3300050512 | Bacteria | 1156 |
| 1375 | Ga0500644_0002231 | 3300053088 | Bacteria | 4887 |
| 1376 | Ga0500646_0022071 | 3300053090 | Bacteria | 1700 |
| 1377 | Ga0500583_0055335 | 3300053092 | Bacteria | 1855 |
| 1378 | Ga0500651_0173882 | 3300053093 | Bacteria | 1282 |
| 1379 | Ga0500650_0430547 | 3300053098 | Unclassified | 568 |
| 1380 | Ga0500660_151764 | 3300053100 | Bacteria | 897 |
| 1381 | Ga0500569_000051 | 3300053109 | Bacteria | 21519 |
| 1382 | Ga0500607_014523 | 3300053121 | Bacteria | 4561 |
| 1383 | Ga0500652_002100 | 3300053131 | Bacteria | 5989 |
| 1384 | Ga0500658_0006891 | 3300053134 | Bacteria | 4206 |
| 1385 | Ga0500559_0020442 | 3300053136 | Bacteria | 2800 |
| 1386 | Ga0500577_0006371 | 3300053142 | Bacteria | 3251 |
| 1387 | Ga0500590_047126 | 3300053148 | Bacteria | 2201 |
| 1388 | Ga0500604_0008066 | 3300053151 | Bacteria | 2794 |
| 1389 | Ga0500616_0022833 | 3300053153 | Bacteria | 3492 |
| 1390 | Ga0500622_0000673 | 3300053156 | Bacteria | 30220 |
| 1391 | Ga0500622_0106563 | 3300053156 | Bacteria | 1374 |
| 1392 | Ga0500633_0013450 | 3300053160 | Bacteria | 2294 |
| 1393 | Ga0500633_0385861 | 3300053160 | Bacteria | 507 |
| 1394 | Ga0500636_0011566 | 3300053177 | Bacteria | 5167 |
| 1395 | Ga0500645_065201 | 3300053730 | Bacteria | 1049 |
| 1396 | Ga0500645_076482 | 3300053730 | Bacteria | 957 |
| 1397 | Ga0501084_0480161 | 3300054114 | Bacteria | 1050 |
| 1398 | Ga0501084_0602857 | 3300054114 | Bacteria | 928 |
| 1399 | Ga0500661_029755 | 3300055283 | Unclassified | 963 |
| 1400 | Ga0501082_0015583 | 3300060353 | Bacteria | 6543 |
| 1401 | 2884796196 | 2884791551 | Bacteria | 8511252 |
| 1402 | 2929240596 | 2929239360 | Bacteria | 7745570 |
| 1403 | 2929922444 | 2929921140 | Bacteria | 8649150 |
| 1404 | 8003153868 | 8003151029 | Bacteria | 8187759 |
| 1405 | Ga0439449_0126358 | |||
| 1406 | SwRhRL3b_contig_139884 | |||
| 1407 | SwRhRL2b_contig_1042660 | |||
| 1408 | JGI24740J21852_10002875 | |||
| 1409 | JGI24740J21852_10033689 | |||
| 1410 | JGI24739J22299_10000573 | |||
| 1411 | JGI24739J22299_10009027 | |||
| 1412 | JGI24744J21845_10010154 | |||
| 1413 | JGI24033J26618_1016177 | |||
| 1414 | JGI25154J39366_1000021 | |||
| 1415 | JGI25154J39366_1006212 | |||
| 1416 | JGI25157J39369_1002591 | |||
| 1417 | JGI25406J46586_10122729 | |||
| 1418 | JGI25153J46596_10000222 | |||
| 1419 | rootH1_10012114 | |||
| 1420 | rootH1_10112267 | |||
| 1421 | rootH1_10189234 | |||
| 1422 | rootH2_10001833 | |||
| 1423 | rootH2_10033753 | |||
| 1424 | rootH2_10191781 | |||
| 1425 | rootH2_10249049 | |||
| 1426 | rootL2_10012010 | |||
| 1427 | rootL2_10025600 | |||
| 1428 | rootL2_10073523 | |||
| 1429 | rootL2_10073524 | |||
| 1430 | rootL2_10219317 | |||
| 1431 | rootL2_10314317 | |||
| 1432 | rootL2_10317203 | |||
| 1433 | rootH1_10051194 | |||
| 1434 | rootH1_10094721 | |||
| 1435 | rootH1_10129380 | |||
| 1436 | rootH1_10274667 | |||
| 1437 | JGI25160J50197_1006628 | |||
| 1438 | JGI25160J50197_1008451 | |||
| 1439 | JGI25160J50197_1008565 | |||
| 1440 | JGI25160J50197_1020538 | |||
| 1441 | Ga0055535_1003814 | |||
| 1442 | Ga0055526_1024154 | |||
| 1443 | Ga0055528_1002059 | |||
| 1444 | Ga0055530_10001651 | |||
| 1445 | Ga0055543_1009549 | |||
| 1446 | Ga0065165_1000579 | |||
| 1447 | Ga0065714_10129073 | |||
| 1448 | Ga0065704_10141375 | |||
| 1449 | Ga0065704_10185428 | |||
| 1450 | Ga0065712_10001362 | |||
| 1451 | Ga0065712_10008351 | |||
| 1452 | Ga0065712_10160108 | |||
| 1453 | Ga0065712_10228679 | |||
| 1454 | Ga0065715_10013855 | |||
| 1455 | Ga0065707_10004405 | |||
| 1456 | Ga0065707_10105293 | |||
| 1457 | Ga0065707_10131851 | |||
| 1458 | Ga0070658_10029219 | |||
| 1459 | Ga0070658_10092767 | |||
| 1460 | Ga0070658_10425663 | |||
| 1461 | Ga0070676_10005217 | |||
| 1462 | Ga0070676_10045937 | |||
| 1463 | Ga0070676_10145306 | |||
| 1464 | Ga0070676_10360534 | |||
| 1465 | Ga0070676_11038170 | |||
| 1466 | Ga0070683_100002359 | |||
| 1467 | Ga0070683_100005979 | |||
| 1468 | Ga0070683_100007262 | |||
| 1469 | Ga0070683_100026768 | |||
| 1470 | Ga0070683_100193767 | |||
| 1471 | Ga0070683_100210525 | |||
| 1472 | Ga0070683_100337058 | |||
| 1473 | Ga0070683_100765835 | |||
| 1474 | Ga0070683_101433181 | |||
| 1475 | Ga0070683_101774651 | |||
| 1476 | Ga0070690_100016204 | |||
| 1477 | Ga0070690_100259426 | |||
| 1478 | Ga0070690_100280524 | |||
| 1479 | Ga0070690_100296129 | |||
| 1480 | Ga0070690_100593920 | |||
| 1481 | Ga0070690_100598769 | |||
| 1482 | Ga0070690_101019879 | |||
| 1483 | Ga0070670_100015785 | |||
| 1484 | Ga0070670_100032493 | |||
| 1485 | Ga0070670_100045331 | |||
| 1486 | Ga0070670_100090508 | |||
| 1487 | Ga0070670_100109318 | |||
| 1488 | Ga0070670_100176567 | |||
| 1489 | Ga0070670_100197725 | |||
| 1490 | Ga0070670_100287355 | |||
| 1491 | Ga0070670_100318516 | |||
| 1492 | Ga0070670_100650309 | |||
| 1493 | Ga0070670_100660965 | |||
| 1494 | Ga0070670_100775135 | |||
| 1495 | Ga0070670_100885825 | |||
| 1496 | Ga0070677_10007969 | |||
| 1497 | Ga0070677_10132731 | |||
| 1498 | Ga0070677_10173723 | |||
| 1499 | Ga0070677_10499685 | |||
| 1500 | Ga0068869_100008418 | |||
| 1501 | Ga0068869_100014754 | |||
| 1502 | Ga0068869_100037107 | |||
| 1503 | Ga0068869_100047138 | |||
| 1504 | Ga0068869_100070957 | |||
| 1505 | Ga0068869_100134454 | |||
| 1506 | Ga0068869_100163058 | |||
| 1507 | Ga0068869_100171602 | |||
| 1508 | Ga0068869_100295430 | |||
| 1509 | Ga0068869_100549808 | |||
| 1510 | Ga0068869_100624182 | |||
| 1511 | Ga0068869_100710832 | |||
| 1512 | Ga0068869_100773993 | |||
| 1513 | Ga0068869_100798371 | |||
| 1514 | Ga0068869_101172520 | |||
| 1515 | Ga0070666_10000019 | |||
| 1516 | Ga0070666_10002676 | |||
| 1517 | Ga0070666_10017990 | |||
| 1518 | Ga0070666_10264070 | |||
| 1519 | Ga0070666_10313812 | |||
| 1520 | Ga0070666_10637358 | |||
| 1521 | Ga0070680_100001352 | |||
| 1522 | Ga0070680_100217894 | |||
| 1523 | Ga0070680_100238448 | |||
| 1524 | Ga0070682_100000934 | |||
| 1525 | Ga0070682_100179206 | |||
| 1526 | Ga0070682_100259229 | |||
| 1527 | Ga0070682_100366595 | |||
| 1528 | Ga0068868_100005373 | |||
| 1529 | Ga0068868_100011564 | |||
| 1530 | Ga0068868_100016289 | |||
| 1531 | Ga0068868_100109067 | |||
| 1532 | Ga0068868_100454250 | |||
| 1533 | Ga0068868_100503970 | |||
| 1534 | Ga0068868_100524087 | |||
| 1535 | Ga0068868_100801433 | |||
| 1536 | Ga0070660_100175208 | |||
| 1537 | Ga0070660_100267402 | |||
| 1538 | Ga0070660_100902364 | |||
| 1539 | Ga0070660_100913152 | |||
| 1540 | Ga0070660_101002380 | |||
| 1541 | Ga0070660_101191157 | |||
| 1542 | Ga0070689_100021838 | |||
| 1543 | Ga0070689_100024989 | |||
| 1544 | Ga0070689_100086957 | |||
| 1545 | Ga0070689_100107571 | |||
| 1546 | Ga0070689_100187848 | |||
| 1547 | Ga0070689_100360884 | |||
| 1548 | Ga0070689_100404445 | |||
| 1549 | Ga0070689_100746492 | |||
| 1550 | Ga0070689_100845023 | |||
| 1551 | Ga0070689_101330076 | |||
| 1552 | Ga0070691_10000160 | |||
| 1553 | Ga0070687_100041534 | |||
| 1554 | Ga0070687_100453255 | |||
| 1555 | Ga0070687_100553019 | |||
| 1556 | Ga0070687_100581185 | |||
| 1557 | Ga0070661_100002162 | |||
| 1558 | Ga0070661_100004509 | |||
| 1559 | Ga0070661_100220538 | |||
| 1560 | Ga0070661_100225332 | |||
| 1561 | Ga0070661_100641735 | |||
| 1562 | Ga0070661_100682279 | |||
| 1563 | Ga0070661_100811809 | |||
| 1564 | Ga0070668_100005318 | |||
| 1565 | Ga0070668_100008164 | |||
| 1566 | Ga0070668_100056832 | |||
| 1567 | Ga0070668_100421066 | |||
| 1568 | Ga0070669_100015572 | |||
| 1569 | Ga0070669_100051623 | |||
| 1570 | Ga0070669_100071414 | |||
| 1571 | Ga0070669_100097908 | |||
| 1572 | Ga0070669_100136893 | |||
| 1573 | Ga0070669_100153192 | |||
| 1574 | Ga0070669_100208420 | |||
| 1575 | Ga0070669_100387929 | |||
| 1576 | Ga0070669_100411834 | |||
| 1577 | Ga0070669_100422220 | |||
| 1578 | Ga0070669_100439709 | |||
| 1579 | Ga0070675_100009953 | |||
| 1580 | Ga0070675_100018596 | |||
| 1581 | Ga0070675_100030391 | |||
| 1582 | Ga0070675_100132999 | |||
| 1583 | Ga0070675_100192221 | |||
| 1584 | Ga0070675_100218099 | |||
| 1585 | Ga0070675_100243153 | |||
| 1586 | Ga0070675_100604987 | |||
| 1587 | Ga0070675_101028937 | |||
| 1588 | Ga0070675_101043029 | |||
| 1589 | Ga0070675_101137723 | |||
| 1590 | Ga0070671_100040747 | |||
| 1591 | Ga0070671_100069414 | |||
| 1592 | Ga0070671_100133278 | |||
| 1593 | Ga0070671_100285295 | |||
| 1594 | Ga0070671_100443364 | |||
| 1595 | Ga0070671_100912242 | |||
| 1596 | Ga0070671_101110595 | |||
| 1597 | Ga0070671_101566408 | |||
| 1598 | Ga0070671_101576720 | |||
| 1599 | Ga0070674_100020556 | |||
| 1600 | Ga0070674_100470652 | |||
| 1601 | Ga0070673_100004592 | |||
| 1602 | Ga0070673_100007862 | |||
| 1603 | Ga0070673_100042190 | |||
| 1604 | Ga0070673_100042736 | |||
| 1605 | Ga0070673_100044249 | |||
| 1606 | Ga0070673_100046399 | |||
| 1607 | Ga0070673_100207789 | |||
| 1608 | Ga0070673_100235135 | |||
| 1609 | Ga0070673_101215611 | |||
| 1610 | Ga0070673_101462557 | |||
| 1611 | Ga0070673_102239188 | |||
| 1612 | Ga0070688_100022281 | |||
| 1613 | Ga0070688_100075143 | |||
| 1614 | Ga0070688_100179297 | |||
| 1615 | Ga0070688_100506415 | |||
| 1616 | Ga0070688_100947223 | |||
| 1617 | Ga0070659_100008080 | |||
| 1618 | Ga0070659_100026990 | |||
| 1619 | Ga0070659_100140711 | |||
| 1620 | Ga0070659_100377949 | |||
| 1621 | Ga0070659_101506732 | |||
| 1622 | Ga0070659_101926145 | |||
| 1623 | Ga0070667_100010175 | |||
| 1624 | Ga0070667_100012137 | |||
| 1625 | Ga0070667_100042945 | |||
| 1626 | Ga0070667_100161448 | |||
| 1627 | Ga0070667_100431772 | |||
| 1628 | Ga0070667_100503754 | |||
| 1629 | Ga0070667_100652968 | |||
| 1630 | Ga0070667_100753343 | |||
| 1631 | Ga0070667_100929864 | |||
| 1632 | Ga0070667_100985772 | |||
| 1633 | Ga0070701_10085487 | |||
| 1634 | Ga0070711_100865591 | |||
| 1635 | Ga0070700_100052053 | |||
| 1636 | Ga0070700_100180068 | |||
| 1637 | Ga0070700_100257657 | |||
| 1638 | Ga0070708_101116930 | |||
| 1639 | Ga0070663_100396287 | |||
| 1640 | Ga0070663_100528834 | |||
| 1641 | Ga0070678_100020735 | |||
| 1642 | Ga0070678_100163084 | |||
| 1643 | Ga0070678_100363368 | |||
| 1644 | Ga0070678_100667507 | |||
| 1645 | Ga0070678_100779674 | |||
| 1646 | Ga0070678_100806103 | |||
| 1647 | Ga0070678_101372825 | |||
| 1648 | Ga0070678_101677587 | |||
| 1649 | Ga0070678_101720517 | |||
| 1650 | Ga0070662_100006375 | |||
| 1651 | Ga0070662_100020905 | |||
| 1652 | Ga0070662_100156874 | |||
| 1653 | Ga0070662_100518771 | |||
| 1654 | Ga0070681_10087439 | |||
| 1655 | Ga0070681_10539602 | |||
| 1656 | Ga0070681_10853129 | |||
| 1657 | Ga0068867_100026488 | |||
| 1658 | Ga0068867_100058811 | |||
| 1659 | Ga0068867_100074210 | |||
| 1660 | Ga0068867_100078793 | |||
| 1661 | Ga0068867_100088793 | |||
| 1662 | Ga0068867_100182308 | |||
| 1663 | Ga0068867_100202053 | |||
| 1664 | Ga0068867_100860576 | |||
| 1665 | Ga0068867_100873588 | |||
| 1666 | Ga0068867_100941715 | |||
| 1667 | Ga0068867_101114020 | |||
| 1668 | Ga0068867_102224129 | |||
| 1669 | Ga0070685_10010718 | |||
| 1670 | Ga0070685_10048572 | |||
| 1671 | Ga0070685_10065169 | |||
| 1672 | Ga0070685_10144908 | |||
| 1673 | Ga0070685_10349408 | |||
| 1674 | Ga0070685_10882106 | |||
| 1675 | Ga0070707_100075842 | |||
| 1676 | Ga0070707_100535603 | |||
| 1677 | Ga0070698_100006956 | |||
| 1678 | Ga0070698_100898800 | |||
| 1679 | Ga0070699_100241967 | |||
| 1680 | Ga0070699_101171228 | |||
| 1681 | Ga0070679_100009634 | |||
| 1682 | Ga0070679_100173836 | |||
| 1683 | Ga0070679_100225680 | |||
| 1684 | Ga0070679_100777218 | |||
| 1685 | Ga0070679_100785224 | |||
| 1686 | Ga0070679_101515727 | |||
| 1687 | Ga0070684_100026097 | |||
| 1688 | Ga0070684_100063337 | |||
| 1689 | Ga0070684_100084135 | |||
| 1690 | Ga0070684_100172922 | |||
| 1691 | Ga0070684_100285191 | |||
| 1692 | Ga0070684_100358565 | |||
| 1693 | Ga0070684_100614193 | |||
| 1694 | Ga0070684_100873833 | |||
| 1695 | Ga0068853_100041942 | |||
| 1696 | Ga0068853_100058156 | |||
| 1697 | Ga0068853_100118870 | |||
| 1698 | Ga0068853_100167512 | |||
| 1699 | Ga0068853_100181658 | |||
| 1700 | Ga0068853_100289574 | |||
| 1701 | Ga0068853_100755091 | |||
| 1702 | Ga0068853_101222534 | |||
| 1703 | Ga0068853_101556740 | |||
| 1704 | Ga0068853_102016465 | |||
| 1705 | Ga0070672_100045424 | |||
| 1706 | Ga0070672_100049195 | |||
| 1707 | Ga0070672_100204888 | |||
| 1708 | Ga0070672_100294496 | |||
| 1709 | Ga0070672_100369043 | |||
| 1710 | Ga0070672_100446829 | |||
| 1711 | Ga0070672_100513370 | |||
| 1712 | Ga0070672_100606064 | |||
| 1713 | Ga0070672_100774942 | |||
| 1714 | Ga0070686_100060375 | |||
| 1715 | Ga0070686_100082764 | |||
| 1716 | Ga0070686_100221273 | |||
| 1717 | Ga0070686_100232825 | |||
| 1718 | Ga0070686_101554685 | |||
| 1719 | Ga0070693_100013640 | |||
| 1720 | Ga0070693_100557487 | |||
| 1721 | Ga0070693_101162752 | |||
| 1722 | Ga0070665_100009994 | |||
| 1723 | Ga0070665_100329485 | |||
| 1724 | Ga0070665_101371568 | |||
| 1725 | Ga0070665_102248713 | |||
| 1726 | Ga0070704_100503663 | |||
| 1727 | Ga0070704_100573948 | |||
| 1728 | Ga0070704_100972542 | |||
| 1729 | Ga0068855_100003963 | |||
| 1730 | Ga0068855_100017499 | |||
| 1731 | Ga0068855_100019154 | |||
| 1732 | Ga0068855_100041940 | |||
| 1733 | Ga0068855_100193800 | |||
| 1734 | Ga0068855_100292651 | |||
| 1735 | Ga0068855_100701628 | |||
| 1736 | Ga0068855_100791892 | |||
| 1737 | Ga0070664_100013799 | |||
| 1738 | Ga0070664_100015152 | |||
| 1739 | Ga0070664_100033788 | |||
| 1740 | Ga0070664_100124560 | |||
| 1741 | Ga0070664_100126729 | |||
| 1742 | Ga0070664_100353355 | |||
| 1743 | Ga0070664_100377346 | |||
| 1744 | Ga0070664_100654244 | |||
| 1745 | Ga0070664_101264124 | |||
| 1746 | Ga0070664_101288177 | |||
| 1747 | Ga0070664_101499985 | |||
| 1748 | Ga0070664_101522935 | |||
| 1749 | Ga0068857_100004299 | |||
| 1750 | Ga0068857_100025400 | |||
| 1751 | Ga0068857_100031073 | |||
| 1752 | Ga0068857_100166907 | |||
| 1753 | Ga0068857_100291360 | |||
| 1754 | Ga0068857_100675898 | |||
| 1755 | Ga0068857_100790722 | |||
| 1756 | Ga0068857_100849247 | |||
| 1757 | Ga0068857_101525160 | |||
| 1758 | Ga0068854_100043187 | |||
| 1759 | Ga0068854_100053069 | |||
| 1760 | Ga0068854_100063939 | |||
| 1761 | Ga0068854_100086163 | |||
| 1762 | Ga0068854_100232725 | |||
| 1763 | Ga0068854_100498467 | |||
| 1764 | Ga0068854_100672854 | |||
| 1765 | Ga0068856_100024151 | |||
| 1766 | Ga0068856_100372503 | |||
| 1767 | Ga0068856_100494438 | |||
| 1768 | Ga0068856_101142107 | |||
| 1769 | Ga0068856_101314682 | |||
| 1770 | Ga0070702_100025541 | |||
| 1771 | Ga0070702_100650045 | |||
| 1772 | Ga0068852_100059907 | |||
| 1773 | Ga0068852_100088967 | |||
| 1774 | Ga0068852_100094839 | |||
| 1775 | Ga0068852_100099119 | |||
| 1776 | Ga0068852_100167408 | |||
| 1777 | Ga0068852_100557525 | |||
| 1778 | Ga0068852_100563656 | |||
| 1779 | Ga0068852_100660036 | |||
| 1780 | Ga0068852_100695370 | |||
| 1781 | Ga0068852_100895584 | |||
| 1782 | Ga0068852_101356885 | |||
| 1783 | Ga0068852_101528089 | |||
| 1784 | Ga0068852_101567735 | |||
| 1785 | Ga0068852_102034474 | |||
| 1786 | Ga0068859_100000013 | |||
| 1787 | Ga0068859_100010105 | |||
| 1788 | Ga0068859_100062252 | |||
| 1789 | Ga0068859_100069743 | |||
| 1790 | Ga0068859_100078718 | |||
| 1791 | Ga0068859_100086803 | |||
| 1792 | Ga0068859_100088052 | |||
| 1793 | Ga0068859_100270926 | |||
| 1794 | Ga0068859_100283340 | |||
| 1795 | Ga0068859_100325223 | |||
| 1796 | Ga0068859_100899595 | |||
| 1797 | Ga0068859_101414457 | |||
| 1798 | Ga0068859_101686273 | |||
| 1799 | Ga0068859_102259506 | |||
| 1800 | Ga0068859_102327114 | |||
| 1801 | Ga0068859_102870796 | |||
| 1802 | Ga0068864_100002531 | |||
| 1803 | Ga0068864_100013970 | |||
| 1804 | Ga0068864_100287296 | |||
| 1805 | Ga0068864_100465577 | |||
| 1806 | Ga0068864_100543744 | |||
| 1807 | Ga0068864_100564470 | |||
| 1808 | Ga0068864_100606492 | |||
| 1809 | Ga0068864_100698741 | |||
| 1810 | Ga0068864_100805098 | |||
| 1811 | Ga0068864_101022781 | |||
| 1812 | Ga0068864_101405234 | |||
| 1813 | Ga0068866_10157062 | |||
| 1814 | Ga0068866_10176469 | |||
| 1815 | Ga0068866_10180903 | |||
| 1816 | Ga0068866_10377838 | |||
| 1817 | Ga0068861_100015324 | |||
| 1818 | Ga0068861_100160774 | |||
| 1819 | Ga0068861_100248230 | |||
| 1820 | Ga0068861_100280117 | |||
| 1821 | Ga0068861_100374226 | |||
| 1822 | Ga0068861_100402138 | |||
| 1823 | Ga0068861_100535381 | |||
| 1824 | Ga0068861_100623591 | |||
| 1825 | Ga0068861_100780097 | |||
| 1826 | Ga0068861_100790175 | |||
| 1827 | Ga0068861_101185912 | |||
| 1828 | Ga0068861_101380584 | |||
| 1829 | Ga0068851_10008282 | |||
| 1830 | Ga0068851_10196750 | |||
| 1831 | Ga0068851_10205639 | |||
| 1832 | Ga0068851_10650934 | |||
| 1833 | Ga0068851_10653719 | |||
| 1834 | Ga0068851_10718384 | |||
| 1835 | Ga0068851_10775410 | |||
| 1836 | Ga0068851_10923005 | |||
| 1837 | Ga0068870_10015883 | |||
| 1838 | Ga0068870_10073950 | |||
| 1839 | Ga0068870_10247517 | |||
| 1840 | Ga0068870_10333595 | |||
| 1841 | Ga0068870_10392520 | |||
| 1842 | Ga0068870_10724423 | |||
| 1843 | Ga0068870_10847201 | |||
| 1844 | Ga0068870_11106325 | |||
| 1845 | Ga0068863_100001058 | |||
| 1846 | Ga0068863_100016960 | |||
| 1847 | Ga0068863_100031954 | |||
| 1848 | Ga0068863_100032772 | |||
| 1849 | Ga0068863_100179888 | |||
| 1850 | Ga0068863_100374779 | |||
| 1851 | Ga0068858_100008721 | |||
| 1852 | Ga0068858_100173445 | |||
| 1853 | Ga0068858_100323671 | |||
| 1854 | Ga0068858_100770485 | |||
| 1855 | Ga0068858_101040636 | |||
| 1856 | Ga0068858_102281426 | |||
| 1857 | Ga0068860_100007046 | |||
| 1858 | Ga0068860_100010577 | |||
| 1859 | Ga0068860_100010672 | |||
| 1860 | Ga0068860_100244255 | |||
| 1861 | Ga0068860_100257354 | |||
| 1862 | Ga0068860_100507055 | |||
| 1863 | Ga0068860_100525491 | |||
| 1864 | Ga0068860_100569259 | |||
| 1865 | Ga0068860_101437052 | |||
| 1866 | Ga0068860_101471452 | |||
| 1867 | Ga0068862_100001187 | |||
| 1868 | Ga0068862_100081363 | |||
| 1869 | Ga0068862_100133333 | |||
| 1870 | Ga0068862_101008145 | |||
| 1871 | Ga0068862_101321141 | |||
| 1872 | Ga0068862_101477169 | |||
| 1873 | Ga0068862_102286085 | |||
| 1874 | Ga0081539_10031023 | |||
| 1875 | Ga0081539_10255293 | |||
| 1876 | Ga0070715_10163182 | |||
| 1877 | Ga0070715_10171973 | |||
| 1878 | Ga0070716_100740546 | |||
| 1879 | Ga0075366_10019812 | |||
| 1880 | Ga0075366_10067705 | |||
| 1881 | Ga0075366_10354904 | |||
| 1882 | Ga0075366_10376516 | |||
| 1883 | Ga0075366_10526986 | |||
| 1884 | Ga0075366_10715853 | |||
| 1885 | Ga0097621_100001972 | |||
| 1886 | Ga0097621_100027113 | |||
| 1887 | Ga0097621_100041789 | |||
| 1888 | Ga0097621_100063981 | |||
| 1889 | Ga0097621_100273291 | |||
| 1890 | Ga0097621_100286377 | |||
| 1891 | Ga0097621_100540733 | |||
| 1892 | Ga0097621_100602203 | |||
| 1893 | Ga0097621_100698998 | |||
| 1894 | Ga0097621_100710364 | |||
| 1895 | Ga0097621_101245509 | |||
| 1896 | Ga0097621_101509884 | |||
| 1897 | Ga0075370_10212574 | |||
| 1898 | Ga0075370_10490689 | |||
| 1899 | Ga0068871_100003860 | |||
| 1900 | Ga0068871_100015010 | |||
| 1901 | Ga0068871_100017231 | |||
| 1902 | Ga0068871_100234064 | |||
| 1903 | Ga0068871_100305471 | |||
| 1904 | Ga0068871_100315066 | |||
| 1905 | Ga0068871_100666139 | |||
| 1906 | Ga0068871_100879666 | |||
| 1907 | Ga0068871_100921890 | |||
| 1908 | Ga0068871_101035164 | |||
| 1909 | Ga0068871_101132280 | |||
| 1910 | Ga0068871_101855873 | |||
| 1911 | Ga0068871_101881755 | |||
| 1912 | Ga0068871_102063601 | |||
| 1913 | Ga0068871_102302527 | |||
| 1914 | Ga0075428_100010497 | |||
| 1915 | Ga0075428_100043546 | |||
| 1916 | Ga0075428_100108035 | |||
| 1917 | Ga0075428_100477959 | |||
| 1918 | Ga0075428_102279292 | |||
| 1919 | Ga0075430_100026460 | |||
| 1920 | Ga0075430_100084952 | |||
| 1921 | Ga0075431_100195236 | |||
| 1922 | Ga0075431_100563260 | |||
| 1923 | Ga0075434_100602397 | |||
| 1924 | Ga0075429_100016535 | |||
| 1925 | Ga0075429_100039595 | |||
| 1926 | Ga0075429_100311291 | |||
| 1927 | Ga0068865_100014264 | |||
| 1928 | Ga0068865_100115404 | |||
| 1929 | Ga0068865_100170998 | |||
| 1930 | Ga0068865_100221094 | |||
| 1931 | Ga0068865_100286972 | |||
| 1932 | Ga0068865_100357065 | |||
| 1933 | Ga0068865_100454330 | |||
| 1934 | Ga0068865_100482239 | |||
| 1935 | Ga0068865_100926891 | |||
| 1936 | Ga0068865_101708111 | |||
| 1937 | Ga0097620_100000013 | |||
| 1938 | Ga0097620_100010105 | |||
| 1939 | Ga0097620_100062249 | |||
| 1940 | Ga0097620_100069741 | |||
| 1941 | Ga0097620_100078715 | |||
| 1942 | Ga0097620_100086798 | |||
| 1943 | Ga0097620_100088052 | |||
| 1944 | Ga0097620_100270951 | |||
| 1945 | Ga0097620_100283331 | |||
| 1946 | Ga0097620_100325229 | |||
| 1947 | Ga0097620_100824180 | |||
| 1948 | Ga0097620_100899455 | |||
| 1949 | Ga0097620_101414266 | |||
| 1950 | Ga0097620_101686187 | |||
| 1951 | Ga0097620_102260709 | |||
| 1952 | Ga0097620_102326905 | |||
| 1953 | Ga0097620_102869928 | |||
| 1954 | Ga0105251_10117551 | |||
| 1955 | Ga0105251_10628716 | |||
| 1956 | Ga0105240_10073897 | |||
| 1957 | Ga0105240_10330089 | |||
| 1958 | Ga0105240_10542894 | |||
| 1959 | Ga0105240_11380112 | |||
| 1960 | Ga0105240_11550884 | |||
| 1961 | Ga0111539_10021933 | |||
| 1962 | Ga0111539_10319434 | |||
| 1963 | Ga0111539_10929534 | |||
| 1964 | Ga0111539_10933982 | |||
| 1965 | Ga0111539_11718783 | |||
| 1966 | Ga0111539_11830652 | |||
| 1967 | Ga0111539_12544072 | |||
| 1968 | Ga0111539_13226945 | |||
| 1969 | Ga0105245_10204984 | |||
| 1970 | Ga0105247_10003653 | |||
| 1971 | Ga0105247_10006290 | |||
| 1972 | Ga0105247_10285655 | |||
| 1973 | Ga0105247_11555552 | |||
| 1974 | Ga0105247_11705607 | |||
| 1975 | Ga0114129_10006355 | |||
| 1976 | Ga0114129_10021381 | |||
| 1977 | Ga0114129_10048278 | |||
| 1978 | Ga0114129_10118770 | |||
| 1979 | Ga0114129_10612993 | |||
| 1980 | Ga0105243_10221980 | |||
| 1981 | Ga0105243_10622689 | |||
| 1982 | Ga0105243_10639247 | |||
| 1983 | Ga0105241_10000607 | |||
| 1984 | Ga0105241_10001739 | |||
| 1985 | Ga0105241_10026762 | |||
| 1986 | Ga0105241_10275544 | |||
| 1987 | Ga0105241_10405623 | |||
| 1988 | Ga0105241_10569829 | |||
| 1989 | Ga0105241_10762013 | |||
| 1990 | Ga0105241_11505287 | |||
| 1991 | Ga0105241_11538202 | |||
| 1992 | Ga0105241_11538794 | |||
| 1993 | Ga0105241_11834085 | |||
| 1994 | Ga0105242_10007154 | |||
| 1995 | Ga0105242_10030421 | |||
| 1996 | Ga0105242_10147457 | |||
| 1997 | Ga0105242_10597639 | |||
| 1998 | Ga0105242_10844510 | |||
| 1999 | Ga0105242_11358156 | |||
| 2000 | Ga0105242_11713805 | |||
| 2001 | Ga0105248_10261967 | |||
| 2002 | Ga0105237_10005546 | |||
| 2003 | Ga0105237_10011762 | |||
| 2004 | Ga0105237_10081869 | |||
| 2005 | Ga0105237_10358878 | |||
| 2006 | Ga0105237_11174810 | |||
| 2007 | Ga0105249_10001440 | |||
| 2008 | Ga0105249_10001920 | |||
| 2009 | Ga0105249_10002116 | |||
| 2010 | Ga0105249_10006146 | |||
| 2011 | Ga0105249_10059447 | |||
| 2012 | Ga0105249_10115848 | |||
| 2013 | Ga0105249_10299911 | |||
| 2014 | Ga0105249_10718590 | |||
| 2015 | Ga0105249_10842509 | |||
| 2016 | Ga0105249_12737691 | |||
| 2017 | Ga0099796_10548998 | |||
| 2018 | Ga0105239_10001030 | |||
| 2019 | Ga0105239_10121875 | |||
| 2020 | Ga0105239_10130222 | |||
| 2021 | Ga0105239_10188446 | |||
| 2022 | Ga0105239_10315190 | |||
| 2023 | Ga0105239_10328002 | |||
| 2024 | Ga0105239_11091723 | |||
| 2025 | Ga0105239_12167462 | |||
| 2026 | Ga0105239_12742352 | |||
| 2027 | Ga0105246_10202600 | |||
| 2028 | Ga0105246_10225083 | |||
| 2029 | Ga0105246_10227029 | |||
| 2030 | Ga0105246_10262137 | |||
| 2031 | Ga0105246_10290881 | |||
| 2032 | Ga0105246_10439468 | |||
| 2033 | Ga0105246_11094778 | |||
| 2034 | Ga0105246_11133743 | |||
| 2035 | Ga0105246_11743308 | |||
| 2036 | Ga0105246_11801505 | |||
| 2037 | Ga0157373_10010111 | |||
| 2038 | Ga0157373_10010949 | |||
| 2039 | Ga0157373_10048518 | |||
| 2040 | Ga0157373_10054494 | |||
| 2041 | Ga0157373_10146381 | |||
| 2042 | Ga0157373_10166453 | |||
| 2043 | Ga0157373_10193034 | |||
| 2044 | Ga0157373_10341457 | |||
| 2045 | Ga0157373_10423336 | |||
| 2046 | Ga0157373_10429817 | |||
| 2047 | Ga0157373_11365537 | |||
| 2048 | Ga0157371_10002605 | |||
| 2049 | Ga0157371_10006357 | |||
| 2050 | Ga0157371_10017441 | |||
| 2051 | Ga0157371_10039615 | |||
| 2052 | Ga0157371_10056378 | |||
| 2053 | Ga0157371_10087373 | |||
| 2054 | Ga0157371_10094817 | |||
| 2055 | Ga0157371_10168529 | |||
| 2056 | Ga0157371_10172783 | |||
| 2057 | Ga0157371_10183731 | |||
| 2058 | Ga0157371_10209688 | |||
| 2059 | Ga0157371_10272766 | |||
| 2060 | Ga0157371_10300057 | |||
| 2061 | Ga0157371_10748900 | |||
| 2062 | Ga0157371_10893120 | |||
| 2063 | Ga0157371_11323232 | |||
| 2064 | Ga0157371_11366592 | |||
| 2065 | Ga0157371_11615693 | |||
| 2066 | Ga0157370_10001361 | |||
| 2067 | Ga0157370_10013762 | |||
| 2068 | Ga0157370_10100782 | |||
| 2069 | Ga0157370_10247715 | |||
| 2070 | Ga0157370_10251876 | |||
| 2071 | Ga0157370_10304121 | |||
| 2072 | Ga0157370_10352286 | |||
| 2073 | Ga0157370_10384508 | |||
| 2074 | Ga0157370_10425762 | |||
| 2075 | Ga0157370_10586891 | |||
| 2076 | Ga0157370_10769651 | |||
| 2077 | Ga0157370_11320897 | |||
| 2078 | Ga0157370_11390421 | |||
| 2079 | Ga0157370_11704708 | |||
| 2080 | Ga0157369_10019844 | |||
| 2081 | Ga0157369_10035272 | |||
| 2082 | Ga0157369_10069114 | |||
| 2083 | Ga0157369_10093086 | |||
| 2084 | Ga0157369_10133167 | |||
| 2085 | Ga0157369_10453116 | |||
| 2086 | Ga0157369_12259826 | |||
| 2087 | Ga0157374_10006069 | |||
| 2088 | Ga0157374_10010105 | |||
| 2089 | Ga0157374_10035407 | |||
| 2090 | Ga0157374_10071484 | |||
| 2091 | Ga0157374_10089454 | |||
| 2092 | Ga0157374_10114491 | |||
| 2093 | Ga0157374_10159147 | |||
| 2094 | Ga0157374_10176423 | |||
| 2095 | Ga0157374_10798738 | |||
| 2096 | Ga0157374_10815803 | |||
| 2097 | Ga0157374_11004597 | |||
| 2098 | Ga0157374_12180581 | |||
| 2099 | Ga0157378_10003215 | |||
| 2100 | Ga0157378_10003796 | |||
| 2101 | Ga0157378_10026251 | |||
| 2102 | Ga0157378_10033953 | |||
| 2103 | Ga0157378_10067026 | |||
| 2104 | Ga0157378_10264251 | |||
| 2105 | Ga0157378_10377791 | |||
| 2106 | Ga0157378_10689944 | |||
| 2107 | Ga0157378_10720578 | |||
| 2108 | Ga0157378_10749144 | |||
| 2109 | Ga0157378_10971219 | |||
| 2110 | Ga0163162_10000722 | |||
| 2111 | Ga0163162_10011275 | |||
| 2112 | Ga0163162_10030877 | |||
| 2113 | Ga0163162_10053922 | |||
| 2114 | Ga0163162_10081748 | |||
| 2115 | Ga0163162_10117430 | |||
| 2116 | Ga0163162_10153728 | |||
| 2117 | Ga0163162_10233605 | |||
| 2118 | Ga0163162_10234643 | |||
| 2119 | Ga0163162_10353911 | |||
| 2120 | Ga0163162_10461057 | |||
| 2121 | Ga0163162_10773215 | |||
| 2122 | Ga0163162_11371591 | |||
| 2123 | Ga0163162_11763586 | |||
| 2124 | Ga0163162_12648402 | |||
| 2125 | Ga0157372_10028035 | |||
| 2126 | Ga0157372_10068152 | |||
| 2127 | Ga0157372_10071721 | |||
| 2128 | Ga0157372_10080065 | |||
| 2129 | Ga0157372_10080397 | |||
| 2130 | Ga0157372_10112925 | |||
| 2131 | Ga0157372_10134535 | |||
| 2132 | Ga0157372_10265508 | |||
| 2133 | Ga0157372_10335751 | |||
| 2134 | Ga0157372_10449967 | |||
| 2135 | Ga0157372_10536633 | |||
| 2136 | Ga0157372_10549572 | |||
| 2137 | Ga0157372_10562714 | |||
| 2138 | Ga0157372_10697083 | |||
| 2139 | Ga0157372_10727683 | |||
| 2140 | Ga0157372_11114217 | |||
| 2141 | Ga0157372_11246437 | |||
| 2142 | Ga0157372_11279727 | |||
| 2143 | Ga0157372_11356810 | |||
| 2144 | Ga0157372_11578875 | |||
| 2145 | Ga0157372_11780485 | |||
| 2146 | Ga0157372_12493642 | |||
| 2147 | Ga0157372_12705790 | |||
| 2148 | Ga0157375_10002648 | |||
| 2149 | Ga0157375_10015089 | |||
| 2150 | Ga0157375_10031395 | |||
| 2151 | Ga0157375_10097407 | |||
| 2152 | Ga0157375_10127621 | |||
| 2153 | Ga0157375_10243083 | |||
| 2154 | Ga0157375_10255264 | |||
| 2155 | Ga0157375_10260512 | |||
| 2156 | Ga0157375_10395124 | |||
| 2157 | Ga0157375_10406190 | |||
| 2158 | Ga0157375_10510722 | |||
| 2159 | Ga0157375_10542186 | |||
| 2160 | Ga0157375_11273800 | |||
| 2161 | Ga0157375_13053795 | |||
| 2162 | Ga0163163_10001099 | |||
| 2163 | Ga0163163_10006617 | |||
| 2164 | Ga0163163_10103685 | |||
| 2165 | Ga0163163_10233436 | |||
| 2166 | Ga0163163_10235285 | |||
| 2167 | Ga0163163_10290652 | |||
| 2168 | Ga0163163_10303128 | |||
| 2169 | Ga0163163_10390588 | |||
| 2170 | Ga0163163_10669732 | |||
| 2171 | Ga0163163_10803951 | |||
| 2172 | Ga0163163_11920271 | |||
| 2173 | Ga0163163_12168570 | |||
| 2174 | Ga0157380_10063737 | |||
| 2175 | Ga0157380_10100646 | |||
| 2176 | Ga0157380_10105756 | |||
| 2177 | Ga0157380_10198436 | |||
| 2178 | Ga0157380_10211529 | |||
| 2179 | Ga0157380_10436095 | |||
| 2180 | Ga0157380_10507468 | |||
| 2181 | Ga0157380_10599292 | |||
| 2182 | Ga0157380_10692607 | |||
| 2183 | Ga0157380_10806587 | |||
| 2184 | Ga0157380_10850544 | |||
| 2185 | Ga0157380_10899160 | |||
| 2186 | Ga0157380_10947884 | |||
| 2187 | Ga0157380_11402009 | |||
| 2188 | Ga0157380_11417247 | |||
| 2189 | Ga0157380_11604824 | |||
| 2190 | Ga0157377_10000916 | |||
| 2191 | Ga0157377_10015970 | |||
| 2192 | Ga0157377_10059777 | |||
| 2193 | Ga0157377_10136866 | |||
| 2194 | Ga0157377_10169948 | |||
| 2195 | Ga0157377_10209117 | |||
| 2196 | Ga0157377_10244516 | |||
| 2197 | Ga0157377_10598561 | |||
| 2198 | Ga0157377_10698905 | |||
| 2199 | Ga0157379_10065826 | |||
| 2200 | Ga0157379_10123465 | |||
| 2201 | Ga0157379_10216724 | |||
| 2202 | Ga0157379_10247188 | |||
| 2203 | Ga0157379_10705112 | |||
| 2204 | Ga0157379_10822047 | |||
| 2205 | Ga0157379_11046349 | |||
| 2206 | Ga0157379_11256426 | |||
| 2207 | Ga0157376_10030234 | |||
| 2208 | Ga0157376_10138281 | |||
| 2209 | Ga0157376_10243683 | |||
| 2210 | Ga0157376_10286984 | |||
| 2211 | Ga0157376_10397069 | |||
| 2212 | Ga0157376_10452433 | |||
| 2213 | Ga0157376_10806850 | |||
| 2214 | Ga0157376_10858890 | |||
| 2215 | Ga0157376_11042656 | |||
| 2216 | Ga0163161_10138583 | |||
| 2217 | Ga0163161_10388731 | |||
| 2218 | Ga0163161_10579301 | |||
| 2219 | Ga0163161_11126393 | |||
| 2220 | Ga0163161_11268531 | |||
| 2221 | Ga0163161_11316854 | |||
| 2222 | Ga0163161_11855944 | |||
| 2223 | Ga0209258_100032 | |||
| 2224 | Ga0207425_1006123 | |||
| 2225 | Ga0209646_1000050 | |||
| 2226 | Ga0209646_1026798 | |||
| 2227 | Ga0209026_1000195 | |||
| 2228 | Ga0209148_1000525 | |||
| 2229 | Ga0209129_1013708 | |||
| 2230 | Ga0209673_1000339 | |||
| 2231 | Ga0209673_1047261 | |||
| 2232 | Ga0209564_1003365 | |||
| 2233 | Ga0209564_1011893 | |||
| 2234 | Ga0209758_1000653 | |||
| 2235 | Ga0209758_1005705 | |||
| 2236 | Ga0209050_1000256 | |||
| 2237 | Ga0207426_1001367 | |||
| 2238 | Ga0207426_1002135 | |||
| 2239 | Ga0207426_1010849 | |||
| 2240 | Ga0207426_1077809 | |||
| 2241 | Ga0209051_1017223 | |||
| 2242 | Ga0209257_1000659 | |||
| 2243 | Ga0207697_10051134 | |||
| 2244 | Ga0207697_10188867 | |||
| 2245 | Ga0207656_10004462 | |||
| 2246 | Ga0207656_10065766 | |||
| 2247 | Ga0207656_10429256 | |||
| 2248 | Ga0207656_10432301 | |||
| 2249 | Ga0207682_10038461 | |||
| 2250 | Ga0207682_10068997 | |||
| 2251 | Ga0207682_10203036 | |||
| 2252 | Ga0207682_10243979 | |||
| 2253 | Ga0207642_10043852 | |||
| 2254 | Ga0207642_10129380 | |||
| 2255 | Ga0207642_10365143 | |||
| 2256 | Ga0207710_10000509 | |||
| 2257 | Ga0207688_10034747 | |||
| 2258 | Ga0207688_10228410 | |||
| 2259 | Ga0207688_10259500 | |||
| 2260 | Ga0207688_10302439 | |||
| 2261 | Ga0207680_10000113 | |||
| 2262 | Ga0207680_10012344 | |||
| 2263 | Ga0207680_10050510 | |||
| 2264 | Ga0207680_10051558 | |||
| 2265 | Ga0207680_10385937 | |||
| 2266 | Ga0207680_11130535 | |||
| 2267 | Ga0207647_10005536 | |||
| 2268 | Ga0207685_10125551 | |||
| 2269 | Ga0207645_10000920 | |||
| 2270 | Ga0207645_10046411 | |||
| 2271 | Ga0207645_10320703 | |||
| 2272 | Ga0207643_10036267 | |||
| 2273 | Ga0207705_10069787 | |||
| 2274 | Ga0207705_10109588 | |||
| 2275 | Ga0207705_10232984 | |||
| 2276 | Ga0207705_10350379 | |||
| 2277 | Ga0207684_11145948 | |||
| 2278 | Ga0207654_10007676 | |||
| 2279 | Ga0207654_10018791 | |||
| 2280 | Ga0207654_10722096 | |||
| 2281 | Ga0207707_10046933 | |||
| 2282 | Ga0207707_10078348 | |||
| 2283 | Ga0207707_10420269 | |||
| 2284 | Ga0207695_10071320 | |||
| 2285 | Ga0207695_10440951 | |||
| 2286 | Ga0207695_10838035 | |||
| 2287 | Ga0207671_10000965 | |||
| 2288 | Ga0207671_10330504 | |||
| 2289 | Ga0207660_10064310 | |||
| 2290 | Ga0207660_10069191 | |||
| 2291 | Ga0207662_10111795 | |||
| 2292 | Ga0207662_10501719 | |||
| 2293 | Ga0207662_10652659 | |||
| 2294 | Ga0207657_10030117 | |||
| 2295 | Ga0207657_10124366 | |||
| 2296 | Ga0207657_10124836 | |||
| 2297 | Ga0207649_10001633 | |||
| 2298 | Ga0207649_10001967 | |||
| 2299 | Ga0207649_10196919 | |||
| 2300 | Ga0207649_10623630 | |||
| 2301 | Ga0207649_10746658 | |||
| 2302 | Ga0207649_10872416 | |||
| 2303 | Ga0207649_11149431 | |||
| 2304 | Ga0207652_10010146 | |||
| 2305 | Ga0207652_10304548 | |||
| 2306 | Ga0207681_10050405 | |||
| 2307 | Ga0207681_10097741 | |||
| 2308 | Ga0207681_10158627 | |||
| 2309 | Ga0207681_10169106 | |||
| 2310 | Ga0207681_10407281 | |||
| 2311 | Ga0207650_10125219 | |||
| 2312 | Ga0207650_10289002 | |||
| 2313 | Ga0207650_10290916 | |||
| 2314 | Ga0207650_10296689 | |||
| 2315 | Ga0207650_10308011 | |||
| 2316 | Ga0207650_11774036 | |||
| 2317 | Ga0207659_10013948 | |||
| 2318 | Ga0207659_10033422 | |||
| 2319 | Ga0207659_10081595 | |||
| 2320 | Ga0207659_10142609 | |||
| 2321 | Ga0207659_10157302 | |||
| 2322 | Ga0207659_10266662 | |||
| 2323 | Ga0207659_11221243 | |||
| 2324 | Ga0207687_10186070 | |||
| 2325 | Ga0207644_10132991 | |||
| 2326 | Ga0207644_10200414 | |||
| 2327 | Ga0207644_10476686 | |||
| 2328 | Ga0207644_10575175 | |||
| 2329 | Ga0207644_10649308 | |||
| 2330 | Ga0207644_11809436 | |||
| 2331 | Ga0207690_10077899 | |||
| 2332 | Ga0207690_10336867 | |||
| 2333 | Ga0207690_11431134 | |||
| 2334 | Ga0207706_10002817 | |||
| 2335 | Ga0207706_10032029 | |||
| 2336 | Ga0207706_10301950 | |||
| 2337 | Ga0207706_10350292 | |||
| 2338 | Ga0207686_10000668 | |||
| 2339 | Ga0207686_10013149 | |||
| 2340 | Ga0207686_10039781 | |||
| 2341 | Ga0207686_10396132 | |||
| 2342 | Ga0207686_10549188 | |||
| 2343 | Ga0207686_11200474 | |||
| 2344 | Ga0207709_11004077 | |||
| 2345 | Ga0207670_10003085 | |||
| 2346 | Ga0207670_10019316 | |||
| 2347 | Ga0207670_10023002 | |||
| 2348 | Ga0207670_10298847 | |||
| 2349 | Ga0207669_10226556 | |||
| 2350 | Ga0207669_10455882 | |||
| 2351 | Ga0207669_11018441 | |||
| 2352 | Ga0207704_10057834 | |||
| 2353 | Ga0207704_10119076 | |||
| 2354 | Ga0207704_10311952 | |||
| 2355 | Ga0207704_10361327 | |||
| 2356 | Ga0207704_10479088 | |||
| 2357 | Ga0207704_10702655 | |||
| 2358 | Ga0207704_10803854 | |||
| 2359 | Ga0207691_10011397 | |||
| 2360 | Ga0207691_10051341 | |||
| 2361 | Ga0207691_10072810 | |||
| 2362 | Ga0207691_10181325 | |||
| 2363 | Ga0207691_10443603 | |||
| 2364 | Ga0207691_10606945 | |||
| 2365 | Ga0207689_10000380 | |||
| 2366 | Ga0207689_10001907 | |||
| 2367 | Ga0207689_10006453 | |||
| 2368 | Ga0207689_10016965 | |||
| 2369 | Ga0207689_10024943 | |||
| 2370 | Ga0207689_10035716 | |||
| 2371 | Ga0207689_10144686 | |||
| 2372 | Ga0207689_10149971 | |||
| 2373 | Ga0207689_10198149 | |||
| 2374 | Ga0207689_10599711 | |||
| 2375 | Ga0207689_11222915 | |||
| 2376 | Ga0207689_11710260 | |||
| 2377 | Ga0207661_10000183 | |||
| 2378 | Ga0207661_10014178 | |||
| 2379 | Ga0207661_10034081 | |||
| 2380 | Ga0207661_10485509 | |||
| 2381 | Ga0207661_10762815 | |||
| 2382 | Ga0207679_10000308 | |||
| 2383 | Ga0207679_10002211 | |||
| 2384 | Ga0207679_10071588 | |||
| 2385 | Ga0207679_10075877 | |||
| 2386 | Ga0207679_10667486 | |||
| 2387 | Ga0207679_11119982 | |||
| 2388 | Ga0207667_10032226 | |||
| 2389 | Ga0207667_10626676 | |||
| 2390 | Ga0207667_10670734 | |||
| 2391 | Ga0207667_10746546 | |||
| 2392 | Ga0207667_10949716 | |||
| 2393 | Ga0207667_11241413 | |||
| 2394 | Ga0207651_10042406 | |||
| 2395 | Ga0207651_10077065 | |||
| 2396 | Ga0207651_10088586 | |||
| 2397 | Ga0207651_10092389 | |||
| 2398 | Ga0207651_10132861 | |||
| 2399 | Ga0207651_10436500 | |||
| 2400 | Ga0207651_10592206 | |||
| 2401 | Ga0207651_10633236 | |||
| 2402 | Ga0207712_10005082 | |||
| 2403 | Ga0207712_10011763 | |||
| 2404 | Ga0207712_10023854 | |||
| 2405 | Ga0207712_10037862 | |||
| 2406 | Ga0207712_10041820 | |||
| 2407 | Ga0207712_10195793 | |||
| 2408 | Ga0207668_10011523 | |||
| 2409 | Ga0207640_10041907 | |||
| 2410 | Ga0207640_10072082 | |||
| 2411 | Ga0207640_10134118 | |||
| 2412 | Ga0207640_10277372 | |||
| 2413 | Ga0207640_10455830 | |||
| 2414 | Ga0207640_11667235 | |||
| 2415 | Ga0207658_10003708 | |||
| 2416 | Ga0207658_10020081 | |||
| 2417 | Ga0207658_10024233 | |||
| 2418 | Ga0207658_10253953 | |||
| 2419 | Ga0207658_10826341 | |||
| 2420 | Ga0207658_10909420 | |||
| 2421 | Ga0207658_11253087 | |||
| 2422 | Ga0207677_10031330 | |||
| 2423 | Ga0207677_10149174 | |||
| 2424 | Ga0207677_10172688 | |||
| 2425 | Ga0207677_10175441 | |||
| 2426 | Ga0207677_10197959 | |||
| 2427 | Ga0207677_10980906 | |||
| 2428 | Ga0207703_10036407 | |||
| 2429 | Ga0207703_10081972 | |||
| 2430 | Ga0207703_10620295 | |||
| 2431 | Ga0207639_10014657 | |||
| 2432 | Ga0207639_10044603 | |||
| 2433 | Ga0207639_10165750 | |||
| 2434 | Ga0207639_10193084 | |||
| 2435 | Ga0207639_10558305 | |||
| 2436 | Ga0207639_10767550 | |||
| 2437 | Ga0207639_11483709 | |||
| 2438 | Ga0207678_10065717 | |||
| 2439 | Ga0207678_10677955 | |||
| 2440 | Ga0207708_10064969 | |||
| 2441 | Ga0207708_10368180 | |||
| 2442 | Ga0207708_10998639 | |||
| 2443 | Ga0207702_10562196 | |||
| 2444 | Ga0207702_10789513 | |||
| 2445 | Ga0207702_11131392 | |||
| 2446 | Ga0207641_10000184 | |||
| 2447 | Ga0207641_10001379 | |||
| 2448 | Ga0207641_10011200 | |||
| 2449 | Ga0207641_10024994 | |||
| 2450 | Ga0207641_10249866 | |||
| 2451 | Ga0207641_10339822 | |||
| 2452 | Ga0207641_10573489 | |||
| 2453 | Ga0207641_11311963 | |||
| 2454 | Ga0207641_11537856 | |||
| 2455 | Ga0207648_10000860 | |||
| 2456 | Ga0207648_10017610 | |||
| 2457 | Ga0207648_10037487 | |||
| 2458 | Ga0207648_10045474 | |||
| 2459 | Ga0207648_10096147 | |||
| 2460 | Ga0207648_10110047 | |||
| 2461 | Ga0207648_10245323 | |||
| 2462 | Ga0207648_10255402 | |||
| 2463 | Ga0207648_10842831 | |||
| 2464 | Ga0207648_11095681 | |||
| 2465 | Ga0207676_10001951 | |||
| 2466 | Ga0207676_10015458 | |||
| 2467 | Ga0207676_10022928 | |||
| 2468 | Ga0207676_10080505 | |||
| 2469 | Ga0207676_10115148 | |||
| 2470 | Ga0207676_10124811 | |||
| 2471 | Ga0207676_10138994 | |||
| 2472 | Ga0207676_10240499 | |||
| 2473 | Ga0207676_10498046 | |||
| 2474 | Ga0207676_12008519 | |||
| 2475 | Ga0207674_10040364 | |||
| 2476 | Ga0207674_10438952 | |||
| 2477 | Ga0207674_10461806 | |||
| 2478 | Ga0207674_10677807 | |||
| 2479 | Ga0207674_10826144 | |||
| 2480 | Ga0207674_10837534 | |||
| 2481 | Ga0207674_11900206 | |||
| 2482 | Ga0207675_100008623 | |||
| 2483 | Ga0207675_100046352 | |||
| 2484 | Ga0207675_100165080 | |||
| 2485 | Ga0207675_100192685 | |||
| 2486 | Ga0207675_100198755 | |||
| 2487 | Ga0207675_100234637 | |||
| 2488 | Ga0207675_100358061 | |||
| 2489 | Ga0207675_100380016 | |||
| 2490 | Ga0207675_100450760 | |||
| 2491 | Ga0207675_100540226 | |||
| 2492 | Ga0207683_10002839 | |||
| 2493 | Ga0207683_10119924 | |||
| 2494 | Ga0207683_10303018 | |||
| 2495 | Ga0207683_10434463 | |||
| 2496 | Ga0207683_10461829 | |||
| 2497 | Ga0207683_10685936 | |||
| 2498 | Ga0207683_11488896 | |||
| 2499 | Ga0207683_11507889 | |||
| 2500 | Ga0207698_10058187 | |||
| 2501 | Ga0207698_10069458 | |||
| 2502 | Ga0207698_10285070 | |||
| 2503 | Ga0207698_10645038 | |||
| 2504 | Ga0207698_10775104 | |||
| 2505 | Ga0207698_11916651 | |||
| 2506 | Ga0209981_1066372 | |||
| 2507 | Ga0209968_1055835 | |||
| 2508 | Ga0209971_1100774 | |||
| 2509 | Ga0268266_10029288 | |||
| 2510 | Ga0268266_10240746 | |||
| 2511 | Ga0268266_10269250 | |||
| 2512 | Ga0268266_10990619 | |||
| 2513 | Ga0268266_11490070 | |||
| 2514 | Ga0268266_11811590 | |||
| 2515 | Ga0268265_10218713 | |||
| 2516 | Ga0268265_10258091 | |||
| 2517 | Ga0268265_10947400 | |||
| 2518 | Ga0268265_10986228 | |||
| 2519 | Ga0268265_12149664 | |||
| 2520 | Ga0268264_10012233 | |||
| 2521 | Ga0268264_10017697 | |||
| 2522 | Ga0268264_10186287 | |||
| 2523 | Ga0268264_10547591 | |||
| 2524 | Ga0268264_10884539 | |||
| 2525 | Ga0268264_10930117 | |||
| 2526 | Ga0268264_10965040 | |||
| 2527 | Ga0307515_10000455 | |||
| 2528 | Ga0307511_10328808 | |||
| 2529 | Ga0307509_10098473 | |||
| 2530 | Ga0307509_10162480 | |||
| 2531 | Ga0307408_100278443 | |||
| 2532 | Ga0307508_10227058 | |||
| 2533 | Ga0307516_10694501 | |||
| 2534 | Ga0307405_11177813 | |||
| 2535 | Ga0307413_10034923 | |||
| 2536 | Ga0307413_10579210 | |||
| 2537 | Ga0307410_12026717 | |||
| 2538 | Ga0307407_10039492 | |||
| 2539 | Ga0307412_11172441 | |||
| 2540 | Ga0307412_11510993 | |||
| 2541 | Ga0307409_102610784 | |||
| 2542 | Ga0307416_100330608 | |||
| 2543 | Ga0307416_100902127 | |||
| 2544 | Ga0307416_102345531 | |||
| 2545 | Ga0307414_10317882 | |||
| 2546 | Ga0307414_11342735 | |||
| 2547 | Ga0307414_11959103 | |||
| 2548 | Ga0307411_10261087 | |||
| 2549 | Ga0307411_10316235 | |||
| 2550 | Ga0307415_100142800 | |||
| 2551 | Ga0307415_100538822 | |||
| 2552 | Ga0373934_0104556 | |||
| 2553 | Ga0373944_0066866 | |||
| 2554 | Ga0373944_0445613 | |||
| 2555 | Ga0373953_0114597 | |||
| 2556 | Ga0373943_0076049 | |||
| 2557 | Ga0373943_0305686 | |||
| 2558 | Ga0373943_0651243 | |||
| 2559 | Ga0373946_0219715 | |||
| 2560 | Ga0373955_0071227 | |||
| 2561 | Ga0373924_0162034 | |||
| 2562 | Ga0373931_0498748 | |||
| 2563 | Ga0373931_1140980 | |||
| 2564 | Ga0373935_0322514 | |||
| 2565 | Ga0373933_0015285 | |||
| 2566 | Ga0373947_0036116 | |||
| 2567 | Ga0373947_0156700 | |||
| 2568 | Ga0373937_0002667 | |||
| 2569 | Ga0373937_0377229 | |||
| 2570 | Ga0373925_0685544 | |||
| 2571 | Ga0395899_0184714 | |||
| 2572 | Ga0395900_0470851 | |||
| 2573 | Ga0395900_0747476 | |||
| 2574 | Ga0395900_1488485 | |||
| 2575 | Ga0395898_0285479 | |||
| 2576 | Ga0395898_0344623 | |||
| 2577 | Ga0395905_0034017 | |||
| 2578 | Ga0436365_0149163 | |||
| 2579 | Ga0436365_0613268 | |||
| 2580 | Ga0439436_0020593 | |||
| 2581 | Ga0439439_0003200 | |||
| 2582 | Ga0439466_0051681 | |||
| 2583 | Ga0451798_0524149 | |||
| 2584 | Ga0451807_1862478 | |||
| 2585 | Ga0451807_2252505 | |||
| 2586 | Ga0451839_0915601 | |||
| 2587 | Ga0451851_0544741 | |||
| 2588 | Ga0451853_3011882 | |||
| 2589 | Ga0439431_0005153 | |||
| 2590 | Ga0439431_0044376 | |||
| 2591 | Ga0439433_0034434 | |||
| 2592 | Ga0439433_0069896 | |||
| 2593 | Ga0439441_040452 | |||
| 2594 | Ga0439442_003302 | |||
| 2595 | Ga0439454_056956 | |||
| 2596 | Ga0439457_057968 | |||
| 2597 | Ga0439457_161289 | |||
| 2598 | Ga0450890_057777 | |||
| 2599 | Ga0450894_065197 | |||
| 2600 | Ga0450898_002496 | |||
| 2601 | Ga0450899_001155 | |||
| 2602 | Ga0439434_0174820 | |||
| 2603 | Ga0450893_0020902 | |||
| 2604 | Ga0466969_0002175 | |||
| 2605 | Ga0466972_0172860 | |||
| 2606 | Ga0466972_0311439 | |||
| 2607 | Ga0466965_0465645 | |||
| 2608 | Ga0466966_0000372 | |||
| 2609 | Ga0466961_0619196 | |||
| 2610 | Ga0453684_1359317 | |||
| 2611 | Ga0466968_0175887 | |||
| 2612 | Ga0466968_0293421 | |||
| 2613 | Ga0466970_0573469 | |||
| 2614 | Ga0466960_0332200 | |||
| 2615 | Ga0466959_0000076 | |||
| 2616 | Ga0466959_0030670 | |||
| 2617 | Ga0451576_0317661 | |||
| 2618 | Ga0466967_0069119 | |||
| 2619 | Ga0495627_011163 | |||
| 2620 | Ga0495592_0241459 | |||
| 2621 | Ga0495638_0157372 | |||
| 2622 | Ga0495651_0344036 | |||
| 2623 | Ga0495650_0284301 | |||
| 2624 | Ga0495664_0693636 | |||
| 2625 | Ga0495594_0416782 | |||
| 2626 | Ga0495608_0029638 | |||
| 2627 | Ga0495618_0160524 | |||
| 2628 | Ga0495628_0019670 | |||
| 2629 | Ga0495630_0008167 | |||
| 2630 | Ga0495652_0706674 | |||
| 2631 | Ga0495640_0105481 | |||
| 2632 | Ga0495586_0011108 | |||
| 2633 | Ga0495598_0229815 | |||
| 2634 | Ga0495598_0342498 | |||
| 2635 | Ga0495621_0031236 | |||
| 2636 | Ga0495645_0128336 | |||
| 2637 | Ga0495633_0000153 | |||
| 2638 | Ga0495634_0016445 | |||
| 2639 | Ga0495625_0394614 | |||
| 2640 | Ga0495635_0114621 | |||
| 2641 | Ga0495635_0388559 | |||
| 2642 | Ga0495657_0072803 | |||
| 2643 | Ga0495599_0071095 | |||
| 2644 | Ga0495669_0636243 | |||
| 2645 | Ga0495649_0297039 | |||
| 2646 | Ga0495604_0340073 | |||
| 2647 | Ga0495604_0552022 | |||
| 2648 | Ga0495674_0333335 | |||
| 2649 | Ga0495674_0814247 | |||
| 2650 | Ga0495672_0033415 | |||
| 2651 | Ga0495676_0111372 | |||
| 2652 | Ga0495676_0615514 | |||
| 2653 | Ga0495680_0250799 | |||
| 2654 | Ga0495684_0467500 | |||
| 2655 | Ga0495686_0007526 | |||
| 2656 | Ga0495686_0243458 | |||
| 2657 | Ga0496100_0514053 | |||
| 2658 | Ga0496105_0564132 | |||
| 2659 | Ga0496108_0687936 | |||
| 2660 | Ga0496110_0030109 | |||
| 2661 | Ga0496110_0336023 | |||
| 2662 | Ga0496113_0663356 | |||
| 2663 | Ga0501292_041869 | |||
| 2664 | Ga0501298_015416 | |||
| 2665 | Ga0501031_0024317 | |||
| 2666 | Ga0501032_0003013 | |||
| 2667 | Ga0501032_0149135 | |||
| 2668 | Ga0501032_0160366 | |||
| 2669 | Ga0501032_0235536 | |||
| 2670 | Ga0501032_0307288 | |||
| 2671 | Ga0501033_0168839 | |||
| 2672 | Ga0501033_0171491 | |||
| 2673 | Ga0501033_0622476 | |||
| 2674 | Ga0501034_0004054 | |||
| 2675 | Ga0501034_0055740 | |||
| 2676 | Ga0501034_0186464 | |||
| 2677 | Ga0501034_0259589 | |||
| 2678 | Ga0501034_0314242 | |||
| 2679 | Ga0501036_0005975 | |||
| 2680 | Ga0501036_0023640 | |||
| 2681 | Ga0501036_0483018 | |||
| 2682 | Ga0501036_1458061 | |||
| 2683 | Ga0501037_0008358 | |||
| 2684 | Ga0501037_0019627 | |||
| 2685 | Ga0501037_0129634 | |||
| 2686 | Ga0501037_0247461 | |||
| 2687 | Ga0501037_0705897 | |||
| 2688 | Ga0501038_0008230 | |||
| 2689 | Ga0501038_0012975 | |||
| 2690 | Ga0501038_0015492 | |||
| 2691 | Ga0501038_0767055 | |||
| 2692 | Ga0501039_0004070 | |||
| 2693 | Ga0501039_0110954 | |||
| 2694 | Ga0501040_0377297 | |||
| 2695 | Ga0501043_0010180 | |||
| 2696 | Ga0501043_0042578 | |||
| 2697 | Ga0501043_0078691 | |||
| 2698 | Ga0501043_0374849 | |||
| 2699 | Ga0501043_0465266 | |||
| 2700 | Ga0501043_0569927 | |||
| 2701 | Ga0501046_0021865 | |||
| 2702 | Ga0501046_0041982 | |||
| 2703 | Ga0501047_0002595 | |||
| 2704 | Ga0501047_0071282 | |||
| 2705 | Ga0501048_0060298 | |||
| 2706 | Ga0501067_0019924 | |||
| 2707 | Ga0501068_0101820 | |||
| 2708 | Ga0501069_0701545 | |||
| 2709 | Ga0501070_0018561 | |||
| 2710 | Ga0501070_0029610 | |||
| 2711 | Ga0501073_0001021 | |||
| 2712 | Ga0501073_0005193 | |||
| 2713 | Ga0501074_0000870 | |||
| 2714 | Ga0501074_0413113 | |||
| 2715 | Ga0501202_005335 | |||
| 2716 | Ga0501207_007692 | |||
| 2717 | Ga0501207_011460 | |||
| 2718 | Ga0501207_037991 | |||
| 2719 | Ga0501214_089510 | |||
| 2720 | Ga0501223_106046 | |||
| 2721 | Ga0501227_023200 | |||
| 2722 | Ga0501230_040675 | |||
| 2723 | Ga0501235_126253 | |||
| 2724 | Ga0501243_007566 | |||
| 2725 | Ga0501250_000832 | |||
| 2726 | Ga0501257_005190 | |||
| 2727 | Ga0501257_011337 | |||
| 2728 | Ga0501259_000638 | |||
| 2729 | Ga0501221_048979 | |||
| 2730 | Ga0501225_0066659 | |||
| 2731 | Ga0501234_008433 | |||
| 2732 | Ga0501079_0038835 | |||
| 2733 | Ga0501079_0999593 | |||
| 2734 | Ga0501080_0036451 | |||
| 2735 | Ga0501080_0043692 | |||
| 2736 | Ga0501080_0240935 | |||
| 2737 | Ga0501080_0561930 | |||
| 2738 | Ga0501080_0811575 | |||
| 2739 | Ga0501080_0999646 | |||
| 2740 | Ga0501083_0007806 | |||
| 2741 | Ga0501083_0008173 | |||
| 2742 | Ga0501083_0095690 | |||
| 2743 | Ga0501083_0617478 | |||
| 2744 | Ga0501263_031172 | |||
| 2745 | Ga0501266_001664 | |||
| 2746 | Ga0501268_098666 | |||
| 2747 | Ga0501274_015326 | |||
| 2748 | Ga0501275_028240 | |||
| 2749 | Ga0501280_053627 | |||
| 2750 | Ga0501035_0005968 | |||
| 2751 | Ga0501035_0094735 | |||
| 2752 | Ga0501035_0224160 | |||
| 2753 | Ga0501035_0227358 | |||
| 2754 | Ga0501044_0146125 | |||
| 2755 | Ga0501044_0157297 | |||
| 2756 | Ga0501044_0177558 | |||
| 2757 | Ga0501044_0227564 | |||
| 2758 | Ga0501044_0423672 | |||
| 2759 | Ga0501044_0684884 | |||
| 2760 | Ga0501044_1107486 | |||
| 2761 | nmdc:mga0k408_22327_c1 | |||
| 2762 | nmdc:mga0k408_236753_c1 | |||
| 2763 | nmdc:mga06z11_485122_c1 | |||
| 2764 | nmdc:mga07m45_234658_c1 | |||
| 2765 | nmdc:mga07m45_336562_c1 | |||
| 2766 | nmdc:mga05p37_217712_c1 | |||
| 2767 | nmdc:mga05p37_313746_c1 | |||
| 2768 | nmdc:mga05p37_7918_c1 | |||
| 2769 | nmdc:mga09592_20923_c1 | |||
| 2770 | nmdc:mga0qj67_17746_c1 | |||
| 2771 | nmdc:mga0qj67_35454_c1 | |||
| 2772 | nmdc:mga06r32_157804_c1 | |||
| 2773 | nmdc:mga06r32_519977_c1 | |||
| 2774 | nmdc:mga08y16_257358_c1 | |||
| 2775 | nmdc:mga08y16_833950_c1 | |||
| 2776 | nmdc:mga08y16_872131_c1 | |||
| 2777 | nmdc:mga0n895_553712_c1 | |||
| 2778 | Ga0500644_0002231 | |||
| 2779 | Ga0500646_0022071 | |||
| 2780 | Ga0500583_0055335 | |||
| 2781 | Ga0500651_0173882 | |||
| 2782 | Ga0500650_0430547 | |||
| 2783 | Ga0500660_151764 | |||
| 2784 | Ga0500569_000051 | |||
| 2785 | Ga0500607_014523 | |||
| 2786 | Ga0500652_002100 | |||
| 2787 | Ga0500658_0006891 | |||
| 2788 | Ga0500559_0020442 | |||
| 2789 | Ga0500577_0006371 | |||
| 2790 | Ga0500590_047126 | |||
| 2791 | Ga0500604_0008066 | |||
| 2792 | Ga0500616_0022833 | |||
| 2793 | Ga0500622_0000673 | |||
| 2794 | Ga0500622_0106563 | |||
| 2795 | Ga0500633_0013450 | |||
| 2796 | Ga0500633_0385861 | |||
| 2797 | Ga0500636_0011566 | |||
| 2798 | Ga0500645_065201 | |||
| 2799 | Ga0500645_076482 | |||
| 2800 | Ga0501084_0480161 | |||
| 2801 | Ga0501084_0602857 | |||
| 2802 | Ga0500661_029755 | |||
| 2803 | Ga0501082_0015583 | |||
| 2804 | 2884796196 | |||
| 2805 | 2929240596 | |||
| 2806 | 2929922444 | |||
| 2807 | 8003153868 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3nx6-assembly1.cif.gz_A | crystal structure of co-chaperonin, groes (xoo4289) from xanthomonas oryzae pv. oryzae kacc10331 | 0.9277 | 12 | 117 |
| 1wnr-assembly1.cif.gz_E | crystal structure of the cpn10 from thermus thermophilus hb8 | 0.9151 | 12 | 119 |
| 1wnr-assembly1.cif.gz_E | crystal structure of the cpn10 from thermus thermophilus hb8 | 0.8922 | 12 | 119 |
| 3nx6-assembly1.cif.gz_A | crystal structure of co-chaperonin, groes (xoo4289) from xanthomonas oryzae pv. oryzae kacc10331 | 0.8807 | 12 | 117 |
| 1lep-assembly1.cif.gz_G | three-dimensional structure of the immunodominant heat-shock protein chaperonin-10 of mycobacterium leprae | 0.8368 | 11 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3nx6A00 | Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin | 0.9277 | 12 | 117 | 2.30.33.40 |
| 1wnrD00 | Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin | 0.9152 | 12 | 119 | 2.30.33.40 |
| 1wnrD00 | Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin | 0.8922 | 12 | 119 | 2.30.33.40 |
| 3nx6A00 | Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin | 0.8807 | 12 | 117 | 2.30.33.40 |
| 1hx5A00 | Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin | 0.7689 | 12 | 118 | 2.30.33.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A285QKV6-F1-model_v4 | 10 kDa chaperonin | 0.8588 | 11 | 120 |
GO:0005524
GO:0044183 |
| AF-X6K773-F1-model_v4 | 10 kDa chaperonin | 0.8419 | 43 | 119 |
GO:0005524
GO:0044183 GO:0046872 GO:0051082 GO:0051085 GO:0051087 |
| AF-A0A4Q3SIF6-F1-model_v4 | Co-chaperone GroES | 0.8389 | 50 | 123 |
GO:0006457
|
| AF-A0A285QKV6-F1-model_v4 | 10 kDa chaperonin | 0.8306 | 11 | 120 |
GO:0005524
GO:0044183 |
| AF-X6K773-F1-model_v4 | 10 kDa chaperonin | 0.8306 | 43 | 119 |
GO:0005524
GO:0044183 GO:0046872 GO:0051082 GO:0051085 GO:0051087 |