F493694

General Info

Members Datasets Scaffolds Average Seq Length
1403 394 2807 125

Family's Representative Sequence

Representative Sequence 3300042007|Ga0439449_0126358|Ga0439449_0126358_363_806
Length 147
Sequence MARGSAAAHNLQYLCSEKEQIMSIHLTPDNKLKKLIVVGDRVLIKPTQPNERTDSGLYLPPGVQEREKVQQGYVIKTGPGYAIPVPAEETESWKPEEEKVKYIPLQAKEGDLAIFLISGSTEVLYQGEKYFIVPQGAILMLEREEEL

Samples

Sample ID Description Type Environment
1 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
64 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
137 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
138 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
139 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
141 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
212 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
213 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
216 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
217 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
218 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
219 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
220 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
221 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
222 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
223 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
224 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
225 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
226 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
227 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
228 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
229 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
230 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
231 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
232 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
233 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
237 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
241 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
242 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
243 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
244 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
245 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
246 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
247 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
248 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
249 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
250 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
251 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
252 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
253 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
254 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
255 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
256 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
257 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
258 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
259 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
260 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
261 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
262 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
263 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
264 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
265 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
266 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
267 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
268 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
269 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
270 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
271 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
272 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
273 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
274 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
275 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
276 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
277 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
278 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
279 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
280 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
281 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
282 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
283 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
284 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
285 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
286 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
287 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
288 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
289 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
290 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
291 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
292 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
293 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
294 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
295 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
296 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
297 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
298 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
299 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
300 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
301 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
302 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
303 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
304 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
305 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
306 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
307 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
308 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
309 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
314 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
315 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
316 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
330 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
331 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
332 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
333 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
334 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
335 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
336 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
337 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
338 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
339 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
340 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
341 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
342 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
343 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
344 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
345 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
346 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
347 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
348 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
349 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
350 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
351 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
352 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
353 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
354 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
355 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
356 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
357 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
358 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
360 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
361 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
362 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
363 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
364 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
365 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
366 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
367 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
368 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
369 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
370 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
371 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
372 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
373 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
374 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
375 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
376 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
377 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
378 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
379 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
380 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
381 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
382 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
383 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
384 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
385 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
386 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
387 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
388 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
389 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
390 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
391 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
392 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
393 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
394 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.56
Nodule 0
Rhizoplane 0.64
Rhizosphere 92.02
Stem 0
Stem Tuber 0
Unclassified 10.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439449_0126358 3300042007 Unclassified 949
2 SwRhRL3b_contig_139884 2162886006 Bacteria 835
3 SwRhRL2b_contig_1042660 2162886007 Bacteria 836
4 JGI24740J21852_10002875 3300001979 Bacteria 7694
5 JGI24740J21852_10033689 3300001979 Bacteria 1622
6 JGI24739J22299_10000573 3300001989 Bacteria 13281
7 JGI24739J22299_10009027 3300001989 Bacteria 3720
8 JGI24744J21845_10010154 3300002077 Bacteria 1930
9 JGI24033J26618_1016177 3300002155 Bacteria 925
10 JGI25154J39366_1000021 3300002738 Bacteria 221559
11 JGI25154J39366_1006212 3300002738 Bacteria 1782
12 JGI25157J39369_1002591 3300002741 Bacteria 4308
13 JGI25406J46586_10122729 3300003203 Unclassified 764
14 JGI25153J46596_10000222 3300003215 Bacteria 49028
15 rootH1_10012114 3300003316 Bacteria 1966
16 rootH1_10112267 3300003316 Bacteria 5379
17 rootH1_10189234 3300003316 Bacteria 1113
18 rootH2_10001833 3300003320 Bacteria 2205
19 rootH2_10033753 3300003320 Bacteria 1473
20 rootH2_10191781 3300003320 Bacteria 2718
21 rootH2_10249049 3300003320 Bacteria 1308
22 rootL2_10012010 3300003322 Bacteria 12776
23 rootL2_10025600 3300003322 Bacteria 3038
24 rootL2_10073523 3300003322 Bacteria 3772
25 rootL2_10073524 3300003322 Bacteria 1498
26 rootL2_10219317 3300003322 Unclassified 3006
27 rootL2_10314317 3300003322 Bacteria 1747
28 rootL2_10317203 3300003322 Unclassified 2512
29 rootH1_10051194 3300003323 Bacteria 12062
30 rootH1_10094721 3300003316 Bacteria 7097
31 rootH1_10094721 3300003323 Bacteria 3188
32 rootH1_10129380 3300003323 Bacteria 1753
33 rootH1_10274667 3300003323 Bacteria 1109
34 JGI25160J50197_1006628 3300003354 Bacteria 4662
35 JGI25160J50197_1008451 3300003354 Bacteria 3921
36 JGI25160J50197_1008565 3300003354 Bacteria 3886
37 JGI25160J50197_1020538 3300003354 Bacteria 1990
38 Ga0055535_1003814 3300003761 Bacteria 3999
39 Ga0055526_1024154 3300003771 Bacteria 2000
40 Ga0055528_1002059 3300003790 Bacteria 11231
41 Ga0055530_10001651 3300003791 Bacteria 15904
42 Ga0055543_1009549 3300004625 Bacteria 2079
43 Ga0065165_1000579 3300005262 Bacteria 54043
44 Ga0065714_10129073 3300005288 Unclassified 1267
45 Ga0065704_10141375 3300005289 Bacteria 1514
46 Ga0065704_10185428 3300005289 Bacteria 1215
47 Ga0065712_10001362 3300005290 Bacteria 6394
48 Ga0065712_10008351 3300005290 Bacteria 2953
49 Ga0065712_10160108 3300005290 Bacteria 1308
50 Ga0065712_10228679 3300005290 Bacteria 1018
51 Ga0065715_10013855 3300005293 Bacteria 2103
52 Ga0065707_10004405 3300005295 Bacteria 3902
53 Ga0065707_10105293 3300005295 Bacteria 2651
54 Ga0065707_10131851 3300005295 Bacteria 1906
55 Ga0070658_10029219 3300005327 Bacteria 4428
56 Ga0070658_10092767 3300005327 Bacteria 2490
57 Ga0070658_10425663 3300005327 Bacteria 1142
58 Ga0070676_10005217 3300005328 Bacteria 6907
59 Ga0070676_10045937 3300005328 Bacteria 2545
60 Ga0070676_10145306 3300005328 Unclassified 1513
61 Ga0070676_10360534 3300005328 Bacteria 1002
62 Ga0070676_11038170 3300005328 Bacteria 617
63 Ga0070683_100002359 3300005329 Bacteria 14997
64 Ga0070683_100005979 3300005329 Bacteria 10189
65 Ga0070683_100007262 3300005329 Bacteria 9346
66 Ga0070683_100026768 3300005329 Bacteria 5196
67 Ga0070683_100193767 3300005329 Bacteria 1930
68 Ga0070683_100210525 3300005329 Bacteria 1847
69 Ga0070683_100337058 3300005329 Bacteria 1436
70 Ga0070683_100765835 3300005329 Bacteria 925
71 Ga0070683_101433181 3300005329 Bacteria 664
72 Ga0070683_101774651 3300005329 Bacteria 593
73 Ga0070690_100016204 3300005330 Bacteria 4460
74 Ga0070690_100259426 3300005330 Bacteria 1232
75 Ga0070690_100280524 3300005330 Bacteria 1188
76 Ga0070690_100296129 3300005330 Bacteria 1159
77 Ga0070690_100593920 3300005330 Bacteria 840
78 Ga0070690_100598769 3300005330 Bacteria 836
79 Ga0070690_101019879 3300005330 Bacteria 653
80 Ga0070670_100015785 3300005331 Bacteria 6483
81 Ga0070670_100032493 3300005331 Bacteria 4494
82 Ga0070670_100045331 3300005331 Bacteria 3779
83 Ga0070670_100090508 3300005331 Bacteria 2629
84 Ga0070670_100109318 3300005331 Bacteria 2382
85 Ga0070670_100176567 3300005331 Bacteria 1854
86 Ga0070670_100197725 3300005331 Bacteria 1746
87 Ga0070670_100287355 3300005331 Bacteria 1436
88 Ga0070670_100318516 3300005331 Bacteria 1362
89 Ga0070670_100650309 3300005331 Bacteria 946
90 Ga0070670_100660965 3300005331 Bacteria 938
91 Ga0070670_100775135 3300005331 Bacteria 865
92 Ga0070670_100885825 3300005331 Bacteria 809
93 Ga0070677_10007969 3300005333 Bacteria 3547
94 Ga0070677_10132731 3300005333 Bacteria 1139
95 Ga0070677_10173723 3300005333 Bacteria 1021
96 Ga0070677_10499685 3300005333 Bacteria 659
97 Ga0068869_100008418 3300005334 Bacteria 6650
98 Ga0068869_100014754 3300005334 Bacteria 5225
99 Ga0068869_100037107 3300005334 Bacteria 3464
100 Ga0068869_100047138 3300005334 Bacteria 3111
101 Ga0068869_100070957 3300005334 Unclassified 2578
102 Ga0068869_100134454 3300005334 Unclassified 1904
103 Ga0068869_100163058 3300005334 Bacteria 1736
104 Ga0068869_100171602 3300005334 Unclassified 1695
105 Ga0068869_100295430 3300005334 Bacteria 1307
106 Ga0068869_100549808 3300005334 Bacteria 970
107 Ga0068869_100624182 3300005334 Bacteria 912
108 Ga0068869_100710832 3300005334 Bacteria 858
109 Ga0068869_100773993 3300005334 Bacteria 823
110 Ga0068869_100798371 3300005334 Bacteria 811
111 Ga0068869_101172520 3300005334 Bacteria 674
112 Ga0070666_10000019 3300005335 Bacteria 185877
113 Ga0070666_10002676 3300005335 Bacteria 10745
114 Ga0070666_10017990 3300005335 Bacteria 4536
115 Ga0070666_10264070 3300005335 Bacteria 1221
116 Ga0070666_10313812 3300005335 Bacteria 1118
117 Ga0070666_10637358 3300005335 Bacteria 779
118 Ga0070680_100001352 3300005336 Bacteria 17745
119 Ga0070680_100217894 3300005336 Unclassified 1611
120 Ga0070680_100238448 3300005336 Bacteria 1537
121 Ga0070682_100000934 3300005337 Bacteria 17036
122 Ga0070682_100179206 3300005337 Bacteria 1478
123 Ga0070682_100259229 3300005337 Bacteria 1257
124 Ga0070682_100366595 3300005337 Bacteria 1079
125 Ga0068868_100005373 3300005338 Bacteria 9000
126 Ga0068868_100011564 3300005338 Bacteria 6428
127 Ga0068868_100016289 3300005338 Bacteria 5516
128 Ga0068868_100109067 3300005338 Bacteria 2248
129 Ga0068868_100454250 3300005338 Bacteria 1115
130 Ga0068868_100503970 3300005338 Bacteria 1061
131 Ga0068868_100524087 3300005338 Bacteria 1041
132 Ga0068868_100801433 3300005338 Bacteria 850
133 Ga0070660_100175208 3300005339 Bacteria 1734
134 Ga0070660_100267402 3300005339 Unclassified 1397
135 Ga0070660_100902364 3300005339 Bacteria 745
136 Ga0070660_100913152 3300005339 Bacteria 741
137 Ga0070660_101002380 3300005339 Bacteria 706
138 Ga0070660_101191157 3300005339 Bacteria 646
139 Ga0070689_100021838 3300005340 Bacteria 4771
140 Ga0070689_100024989 3300005340 Bacteria 4484
141 Ga0070689_100086957 3300005340 Bacteria 2459
142 Ga0070689_100107571 3300005340 Bacteria 2214
143 Ga0070689_100187848 3300005340 Bacteria 1681
144 Ga0070689_100360884 3300005340 Bacteria 1221
145 Ga0070689_100404445 3300005340 Bacteria 1154
146 Ga0070689_100746492 3300005340 Unclassified 857
147 Ga0070689_100845023 3300005340 Unclassified 807
148 Ga0070689_101330076 3300005340 Bacteria 648
149 Ga0070691_10000160 3300005341 Bacteria 21713
150 Ga0070687_100041534 3300005343 Bacteria 2325
151 Ga0070687_100453255 3300005343 Unclassified 854
152 Ga0070687_100553019 3300005343 Bacteria 783
153 Ga0070687_100581185 3300005343 Bacteria 767
154 Ga0070661_100002162 3300005344 Bacteria 13543
155 Ga0070661_100004509 3300005344 Bacteria 9592
156 Ga0070661_100220538 3300005344 Bacteria 1454
157 Ga0070661_100225332 3300005344 Bacteria 1439
158 Ga0070661_100641735 3300005344 Unclassified 861
159 Ga0070661_100682279 3300005344 Bacteria 836
160 Ga0070661_100811809 3300005344 Bacteria 768
161 Ga0070668_100005318 3300005347 Bacteria 9557
162 Ga0070668_100008164 3300005347 Bacteria 7775
163 Ga0070668_100056832 3300005347 Bacteria 3023
164 Ga0070668_100421066 3300005347 Bacteria 1143
165 Ga0070669_100015572 3300005353 Bacteria 5423
166 Ga0070669_100051623 3300005353 Bacteria 3007
167 Ga0070669_100071414 3300005353 Bacteria 2568
168 Ga0070669_100097908 3300005353 Bacteria 2209
169 Ga0070669_100136893 3300005353 Bacteria 1884
170 Ga0070669_100153192 3300005353 Bacteria 1786
171 Ga0070669_100208420 3300005353 Bacteria 1541
172 Ga0070669_100387929 3300005353 Unclassified 1140
173 Ga0070669_100411834 3300005353 Bacteria 1108
174 Ga0070669_100422220 3300005353 Bacteria 1095
175 Ga0070669_100439709 3300005353 Bacteria 1073
176 Ga0070675_100009953 3300005354 Bacteria 7415
177 Ga0070675_100018596 3300005354 Bacteria 5532
178 Ga0070675_100030391 3300005354 Unclassified 4362
179 Ga0070675_100132999 3300005354 Bacteria 2121
180 Ga0070675_100192221 3300005354 Bacteria 1769
181 Ga0070675_100218099 3300005354 Bacteria 1660
182 Ga0070675_100243153 3300005354 Bacteria 1573
183 Ga0070675_100604987 3300005354 Bacteria 994
184 Ga0070675_101028937 3300005354 Bacteria 756
185 Ga0070675_101043029 3300005354 Bacteria 751
186 Ga0070675_101137723 3300005354 Unclassified 718
187 Ga0070671_100040747 3300005355 Bacteria 3859
188 Ga0070671_100069414 3300005355 Bacteria 2939
189 Ga0070671_100133278 3300005355 Bacteria 2093
190 Ga0070671_100285295 3300005355 Bacteria 1405
191 Ga0070671_100443364 3300005355 Bacteria 1113
192 Ga0070671_100912242 3300005355 Bacteria 768
193 Ga0070671_101110595 3300005355 Bacteria 695
194 Ga0070671_101566408 3300005355 Bacteria 584
195 Ga0070671_101576720 3300005355 Bacteria 582
196 Ga0070674_100020556 3300005356 Bacteria 4221
197 Ga0070674_100470652 3300005356 Unclassified 1041
198 Ga0070673_100004592 3300005364 Bacteria 8753
199 Ga0070673_100007862 3300005364 Bacteria 7064
200 Ga0070673_100042190 3300005364 Bacteria 3515
201 Ga0070673_100042736 3300005364 Bacteria 3496
202 Ga0070673_100044249 3300005364 Bacteria 3446
203 Ga0070673_100046399 3300005364 Bacteria 3375
204 Ga0070673_100207789 3300005364 Bacteria 1689
205 Ga0070673_100235135 3300005364 Bacteria 1591
206 Ga0070673_101215611 3300005364 Bacteria 706
207 Ga0070673_101462557 3300005364 Unclassified 644
208 Ga0070673_102239188 3300005364 Bacteria 519
209 Ga0070688_100022281 3300005365 Bacteria 3709
210 Ga0070688_100075143 3300005365 Bacteria 2171
211 Ga0070688_100179297 3300005365 Bacteria 1468
212 Ga0070688_100506415 3300005365 Bacteria 911
213 Ga0070688_100947223 3300005365 Unclassified 681
214 Ga0070659_100008080 3300005366 Bacteria 7672
215 Ga0070659_100026990 3300005366 Bacteria 4422
216 Ga0070659_100140711 3300005366 Bacteria 1965
217 Ga0070659_100377949 3300005366 Bacteria 1193
218 Ga0070659_101506732 3300005366 Unclassified 599
219 Ga0070659_101926145 3300005366 Bacteria 530
220 Ga0070667_100010175 3300005367 Bacteria 7774
221 Ga0070667_100012137 3300005367 Bacteria 7131
222 Ga0070667_100042945 3300005367 Bacteria 3793
223 Ga0070667_100161448 3300005367 Bacteria 1974
224 Ga0070667_100431772 3300005367 Unclassified 1202
225 Ga0070667_100503754 3300005367 Bacteria 1110
226 Ga0070667_100652968 3300005367 Bacteria 971
227 Ga0070667_100753343 3300005367 Bacteria 903
228 Ga0070667_100929864 3300005367 Bacteria 810
229 Ga0070667_100985772 3300005367 Bacteria 786
230 Ga0070701_10085487 3300005438 Bacteria 1717
231 Ga0070711_100865591 3300005439 Bacteria 770
232 Ga0070700_100052053 3300005441 Bacteria 2552
233 Ga0070700_100180068 3300005441 Bacteria 1470
234 Ga0070700_100257657 3300005441 Bacteria 1255
235 Ga0070708_101116930 3300005445 Unclassified 738
236 Ga0070663_100396287 3300005455 Bacteria 1127
237 Ga0070663_100528834 3300005455 Bacteria 983
238 Ga0070678_100020735 3300005456 Bacteria 4318
239 Ga0070678_100163084 3300005456 Bacteria 1808
240 Ga0070678_100363368 3300005456 Bacteria 1248
241 Ga0070678_100667507 3300005456 Bacteria 934
242 Ga0070678_100779674 3300005456 Unclassified 867
243 Ga0070678_100806103 3300005456 Bacteria 853
244 Ga0070678_101372825 3300005456 Bacteria 659
245 Ga0070678_101677587 3300005456 Bacteria 598
246 Ga0070678_101720517 3300005456 Bacteria 590
247 Ga0070662_100006375 3300005457 Bacteria 7600
248 Ga0070662_100020905 3300005457 Bacteria 4464
249 Ga0070662_100156874 3300005457 Bacteria 1777
250 Ga0070662_100518771 3300005457 Bacteria 995
251 Ga0070681_10087439 3300005458 Bacteria 3069
252 Ga0070681_10539602 3300005458 Bacteria 1080
253 Ga0070681_10853129 3300005458 Bacteria 828
254 Ga0068867_100026488 3300005459 Bacteria 4164
255 Ga0068867_100058811 3300005459 Bacteria 2848
256 Ga0068867_100074210 3300005459 Bacteria 2549
257 Ga0068867_100078793 3300005459 Bacteria 2479
258 Ga0068867_100088793 3300005459 Bacteria 2343
259 Ga0068867_100182308 3300005459 Bacteria 1670
260 Ga0068867_100202053 3300005459 Bacteria 1591
261 Ga0068867_100860576 3300005459 Bacteria 813
262 Ga0068867_100873588 3300005459 Bacteria 807
263 Ga0068867_100941715 3300005459 Unclassified 780
264 Ga0068867_101114020 3300005459 Unclassified 721
265 Ga0068867_102224129 3300005459 Bacteria 521
266 Ga0070685_10010718 3300005466 Unclassified 4772
267 Ga0070685_10048572 3300005466 Bacteria 2444
268 Ga0070685_10065169 3300005466 Bacteria 2144
269 Ga0070685_10144908 3300005466 Bacteria 1499
270 Ga0070685_10349408 3300005466 Bacteria 1010
271 Ga0070685_10882106 3300005466 Bacteria 665
272 Ga0070707_100075842 3300005468 Unclassified 3244
273 Ga0070707_100535603 3300005468 Bacteria 1133
274 Ga0070698_100006956 3300005471 Bacteria 12250
275 Ga0070698_100898800 3300005471 Bacteria 831
276 Ga0070699_100241967 3300005518 Unclassified 1611
277 Ga0070699_101171228 3300005518 Bacteria 705
278 Ga0070679_100009634 3300005530 Bacteria 9137
279 Ga0070679_100173836 3300005530 Bacteria 2126
280 Ga0070679_100225680 3300005530 Bacteria 1833
281 Ga0070679_100777218 3300005530 Bacteria 901
282 Ga0070679_100785224 3300005530 Bacteria 895
283 Ga0070679_101515727 3300005530 Bacteria 617
284 Ga0070684_100026097 3300005535 Bacteria 4918
285 Ga0070684_100063337 3300005535 Bacteria 3241
286 Ga0070684_100084135 3300005535 Bacteria 2819
287 Ga0070684_100172922 3300005535 Bacteria 1962
288 Ga0070684_100285191 3300005535 Bacteria 1513
289 Ga0070684_100358565 3300005535 Bacteria 1342
290 Ga0070684_100614193 3300005535 Bacteria 1011
291 Ga0070684_100873833 3300005535 Bacteria 842
292 Ga0068853_100041942 3300005539 Bacteria 3910
293 Ga0068853_100058156 3300005539 Bacteria 3337
294 Ga0068853_100118870 3300005539 Bacteria 2355
295 Ga0068853_100167512 3300005539 Bacteria 1986
296 Ga0068853_100181658 3300005539 Bacteria 1908
297 Ga0068853_100289574 3300005539 Bacteria 1512
298 Ga0068853_100755091 3300005539 Unclassified 930
299 Ga0068853_101222534 3300005539 Bacteria 726
300 Ga0068853_101556740 3300005539 Bacteria 640
301 Ga0068853_102016465 3300005539 Bacteria 560
302 Ga0070672_100045424 3300005543 Bacteria 3397
303 Ga0070672_100049195 3300005543 Unclassified 3278
304 Ga0070672_100204888 3300005543 Unclassified 1650
305 Ga0070672_100294496 3300005543 Bacteria 1374
306 Ga0070672_100369043 3300005543 Unclassified 1226
307 Ga0070672_100446829 3300005543 Bacteria 1113
308 Ga0070672_100513370 3300005543 Bacteria 1038
309 Ga0070672_100606064 3300005543 Bacteria 954
310 Ga0070672_100774942 3300005543 Bacteria 843
311 Ga0070686_100060375 3300005544 Bacteria 2446
312 Ga0070686_100082764 3300005544 Bacteria 2129
313 Ga0070686_100221273 3300005544 Bacteria 1368
314 Ga0070686_100232825 3300005544 Bacteria 1337
315 Ga0070686_101554685 3300005544 Bacteria 559
316 Ga0070693_100013640 3300005547 Bacteria 4144
317 Ga0070693_100557487 3300005547 Unclassified 821
318 Ga0070693_101162752 3300005547 Bacteria 591
319 Ga0070665_100009994 3300005548 Bacteria 9599
320 Ga0070665_100329485 3300005548 Bacteria 1531
321 Ga0070665_101371568 3300005548 Bacteria 716
322 Ga0070665_102248713 3300005548 Bacteria 549
323 Ga0070704_100503663 3300005549 Bacteria 1051
324 Ga0070704_100573948 3300005549 Bacteria 988
325 Ga0070704_100972542 3300005549 Bacteria 767
326 Ga0068855_100003963 3300005563 Bacteria 18072
327 Ga0068855_100017499 3300005563 Bacteria 8619
328 Ga0068855_100019154 3300005563 Bacteria 8225
329 Ga0068855_100041940 3300005563 Bacteria 5423
330 Ga0068855_100193800 3300005563 Bacteria 2290
331 Ga0068855_100292651 3300005563 Bacteria 1805
332 Ga0068855_100701628 3300005563 Bacteria 1083
333 Ga0068855_100791892 3300005563 Bacteria 1008
334 Ga0070664_100013799 3300005564 Bacteria 6587
335 Ga0070664_100015152 3300005564 Bacteria 6297
336 Ga0070664_100033788 3300005564 Bacteria 4287
337 Ga0070664_100124560 3300005564 Bacteria 2259
338 Ga0070664_100126729 3300005564 Bacteria 2240
339 Ga0070664_100353355 3300005564 Bacteria 1337
340 Ga0070664_100377346 3300005564 Bacteria 1294
341 Ga0070664_100654244 3300005564 Bacteria 977
342 Ga0070664_101264124 3300005564 Bacteria 697
343 Ga0070664_101288177 3300005564 Bacteria 690
344 Ga0070664_101499985 3300005564 Bacteria 638
345 Ga0070664_101522935 3300005564 Bacteria 633
346 Ga0068857_100004299 3300005577 Bacteria 12016
347 Ga0068857_100025400 3300005577 Bacteria 5216
348 Ga0068857_100031073 3300005577 Bacteria 4719
349 Ga0068857_100166907 3300005577 Bacteria 2000
350 Ga0068857_100291360 3300005577 Bacteria 1503
351 Ga0068857_100675898 3300005577 Bacteria 980
352 Ga0068857_100790722 3300005577 Bacteria 906
353 Ga0068857_100849247 3300005577 Bacteria 874
354 Ga0068857_101525160 3300005577 Unclassified 651
355 Ga0068854_100043187 3300005578 Unclassified 3194
356 Ga0068854_100053069 3300005578 Bacteria 2909
357 Ga0068854_100063939 3300005578 Unclassified 2672
358 Ga0068854_100086163 3300005578 Bacteria 2328
359 Ga0068854_100232725 3300005578 Bacteria 1463
360 Ga0068854_100498467 3300005578 Bacteria 1025
361 Ga0068854_100672854 3300005578 Unclassified 891
362 Ga0068856_100024151 3300005614 Bacteria 5914
363 Ga0068856_100372503 3300005614 Bacteria 1447
364 Ga0068856_100494438 3300005614 Bacteria 1244
365 Ga0068856_101142107 3300005614 Bacteria 796
366 Ga0068856_101314682 3300005614 Bacteria 738
367 Ga0070702_100025541 3300005615 Bacteria 3167
368 Ga0070702_100650045 3300005615 Bacteria 797
369 Ga0068852_100059907 3300005616 Bacteria 3303
370 Ga0068852_100088967 3300005616 Bacteria 2759
371 Ga0068852_100094839 3300005616 Bacteria 2678
372 Ga0068852_100099119 3300005616 Bacteria 2626
373 Ga0068852_100167408 3300005616 Bacteria 2057
374 Ga0068852_100557525 3300005616 Unclassified 1147
375 Ga0068852_100563656 3300005616 Bacteria 1140
376 Ga0068852_100660036 3300005616 Bacteria 1054
377 Ga0068852_100695370 3300005616 Unclassified 1027
378 Ga0068852_100895584 3300005616 Bacteria 904
379 Ga0068852_101356885 3300005616 Bacteria 733
380 Ga0068852_101528089 3300005616 Bacteria 690
381 Ga0068852_101567735 3300005616 Bacteria 681
382 Ga0068852_102034474 3300005616 Unclassified 596
383 Ga0068859_100000013 3300005617 Bacteria 291126
384 Ga0068859_100010105 3300005617 Bacteria 9512
385 Ga0068859_100062252 3300005617 Bacteria 3761
386 Ga0068859_100069743 3300005617 Bacteria 3550
387 Ga0068859_100078718 3300005617 Bacteria 3337
388 Ga0068859_100086803 3300005617 Bacteria 3176
389 Ga0068859_100088052 3300005617 Bacteria 3154
390 Ga0068859_100270926 3300005617 Bacteria 1790
391 Ga0068859_100283340 3300005617 Bacteria 1750
392 Ga0068859_100325223 3300005617 Bacteria 1632
393 Ga0068859_100899595 3300005617 Bacteria 970
394 Ga0068859_101414457 3300005617 Bacteria 767
395 Ga0068859_101686273 3300005617 Bacteria 700
396 Ga0068859_102259506 3300005617 Bacteria 600
397 Ga0068859_102327114 3300005617 Bacteria 591
398 Ga0068859_102870796 3300005617 Unclassified 528
399 Ga0068864_100002531 3300005618 Bacteria 15099
400 Ga0068864_100013970 3300005618 Bacteria 6657
401 Ga0068864_100287296 3300005618 Unclassified 1537
402 Ga0068864_100465577 3300005618 Unclassified 1211
403 Ga0068864_100543744 3300005618 Bacteria 1122
404 Ga0068864_100564470 3300005618 Bacteria 1101
405 Ga0068864_100606492 3300005618 Bacteria 1063
406 Ga0068864_100698741 3300005618 Unclassified 991
407 Ga0068864_100805098 3300005618 Bacteria 924
408 Ga0068864_101022781 3300005618 Bacteria 820
409 Ga0068864_101405234 3300005618 Bacteria 700
410 Ga0068866_10157062 3300005718 Bacteria 1323
411 Ga0068866_10176469 3300005718 Bacteria 1258
412 Ga0068866_10180903 3300005718 Bacteria 1245
413 Ga0068866_10377838 3300005718 Bacteria 908
414 Ga0068861_100015324 3300005719 Bacteria 5399
415 Ga0068861_100160774 3300005719 Unclassified 1852
416 Ga0068861_100248230 3300005719 Bacteria 1517
417 Ga0068861_100280117 3300005719 Bacteria 1435
418 Ga0068861_100374226 3300005719 Bacteria 1256
419 Ga0068861_100402138 3300005719 Bacteria 1215
420 Ga0068861_100535381 3300005719 Bacteria 1065
421 Ga0068861_100623591 3300005719 Bacteria 993
422 Ga0068861_100780097 3300005719 Bacteria 895
423 Ga0068861_100790175 3300005719 Bacteria 890
424 Ga0068861_101185912 3300005719 Bacteria 738
425 Ga0068861_101380584 3300005719 Bacteria 687
426 Ga0068851_10008282 3300005834 Bacteria 4802
427 Ga0068851_10196750 3300005834 Bacteria 1123
428 Ga0068851_10205639 3300005834 Bacteria 1101
429 Ga0068851_10650934 3300005834 Unclassified 645
430 Ga0068851_10653719 3300005834 Bacteria 644
431 Ga0068851_10718384 3300005834 Unclassified 616
432 Ga0068851_10775410 3300005834 Unclassified 594
433 Ga0068851_10923005 3300005834 Bacteria 548
434 Ga0068870_10015883 3300005840 Plasmid 3584
435 Ga0068870_10073950 3300005840 Bacteria 1865
436 Ga0068870_10247517 3300005840 Bacteria 1103
437 Ga0068870_10333595 3300005840 Bacteria 968
438 Ga0068870_10392520 3300005840 Unclassified 901
439 Ga0068870_10724423 3300005840 Bacteria 688
440 Ga0068870_10847201 3300005840 Bacteria 642
441 Ga0068870_11106325 3300005840 Unclassified 570
442 Ga0068863_100001058 3300005841 Bacteria 27510
443 Ga0068863_100016960 3300005841 Bacteria 6985
444 Ga0068863_100031954 3300005841 Bacteria 5020
445 Ga0068863_100032772 3300005841 Bacteria 4950
446 Ga0068863_100179888 3300005841 Bacteria 2030
447 Ga0068863_100374779 3300005841 Bacteria 1389
448 Ga0068858_100008721 3300005842 Bacteria 9735
449 Ga0068858_100173445 3300005842 Bacteria 2034
450 Ga0068858_100323671 3300005842 Bacteria 1474
451 Ga0068858_100770485 3300005842 Unclassified 938
452 Ga0068858_101040636 3300005842 Bacteria 803
453 Ga0068858_102281426 3300005842 Bacteria 535
454 Ga0068860_100007046 3300005843 Bacteria 11253
455 Ga0068860_100010577 3300005843 Bacteria 9113
456 Ga0068860_100010672 3300005843 Bacteria 9072
457 Ga0068860_100244255 3300005843 Bacteria 1746
458 Ga0068860_100257354 3300005843 Bacteria 1701
459 Ga0068860_100507055 3300005843 Bacteria 1205
460 Ga0068860_100525491 3300005843 Bacteria 1183
461 Ga0068860_100569259 3300005843 Bacteria 1136
462 Ga0068860_101437052 3300005843 Unclassified 711
463 Ga0068860_101471452 3300005843 Bacteria 703
464 Ga0068862_100001187 3300005844 Bacteria 24555
465 Ga0068862_100081363 3300005844 Unclassified 2810
466 Ga0068862_100133333 3300005844 Bacteria 2199
467 Ga0068862_101008145 3300005844 Unclassified 824
468 Ga0068862_101321141 3300005844 Bacteria 723
469 Ga0068862_101477169 3300005844 Bacteria 685
470 Ga0068862_102286085 3300005844 Bacteria 552
471 Ga0081539_10031023 3300005985 Bacteria 3302
472 Ga0081539_10255293 3300005985 Bacteria 776
473 Ga0070715_10163182 3300006163 Unclassified 1103
474 Ga0070715_10171973 3300006163 Bacteria 1080
475 Ga0070716_100740546 3300006173 Bacteria 755
476 Ga0075366_10019812 3300006195 Bacteria 3899
477 Ga0075366_10067705 3300006195 Bacteria 2125
478 Ga0075366_10354904 3300006195 Unclassified 900
479 Ga0075366_10376516 3300006195 Bacteria 873
480 Ga0075366_10526986 3300006195 Unclassified 731
481 Ga0075366_10715853 3300006195 Bacteria 622
482 Ga0097621_100001972 3300006237 Bacteria 13991
483 Ga0097621_100027113 3300006237 Bacteria 4502
484 Ga0097621_100041789 3300006237 Bacteria 3692
485 Ga0097621_100063981 3300006237 Bacteria 3024
486 Ga0097621_100273291 3300006237 Bacteria 1485
487 Ga0097621_100286377 3300006237 Bacteria 1451
488 Ga0097621_100540733 3300006237 Bacteria 1059
489 Ga0097621_100602203 3300006237 Bacteria 1004
490 Ga0097621_100698998 3300006237 Bacteria 933
491 Ga0097621_100710364 3300006237 Unclassified 926
492 Ga0097621_101245509 3300006237 Bacteria 702
493 Ga0097621_101509884 3300006237 Bacteria 638
494 Ga0075370_10212574 3300006353 Bacteria 1142
495 Ga0075370_10490689 3300006353 Bacteria 741
496 Ga0068871_100003860 3300006358 Bacteria 10333
497 Ga0068871_100015010 3300006358 Bacteria 5792
498 Ga0068871_100017231 3300006358 Bacteria 5462
499 Ga0068871_100234064 3300006358 Bacteria 1595
500 Ga0068871_100305471 3300006358 Bacteria 1397
501 Ga0068871_100315066 3300006358 Unclassified 1376
502 Ga0068871_100666139 3300006358 Bacteria 951
503 Ga0068871_100879666 3300006358 Bacteria 829
504 Ga0068871_100921890 3300006358 Unclassified 810
505 Ga0068871_101035164 3300006358 Bacteria 766
506 Ga0068871_101132280 3300006358 Bacteria 732
507 Ga0068871_101855873 3300006358 Bacteria 573
508 Ga0068871_101881755 3300006358 Bacteria 569
509 Ga0068871_102063601 3300006358 Unclassified 543
510 Ga0068871_102302527 3300006358 Unclassified 514
511 Ga0075428_100010497 3300006844 Bacteria 10291
512 Ga0075428_100043546 3300006844 Bacteria 4935
513 Ga0075428_100108035 3300006844 Unclassified 3032
514 Ga0075428_100477959 3300006844 Unclassified 1334
515 Ga0075428_102279292 3300006844 Bacteria 558
516 Ga0075430_100026460 3300006846 Bacteria 4935
517 Ga0075430_100084952 3300006846 Bacteria 2650
518 Ga0075431_100195236 3300006847 Bacteria 2072
519 Ga0075431_100563260 3300006847 Bacteria 1126
520 Ga0075434_100602397 3300006871 Bacteria 1118
521 Ga0075429_100016535 3300006880 Bacteria 6391
522 Ga0075429_100039595 3300006880 Bacteria 4102
523 Ga0075429_100311291 3300006880 Bacteria 1378
524 Ga0068865_100014264 3300006881 Bacteria 5046
525 Ga0068865_100115404 3300006881 Bacteria 1987
526 Ga0068865_100170998 3300006881 Bacteria 1666
527 Ga0068865_100221094 3300006881 Bacteria 1481
528 Ga0068865_100286972 3300006881 Unclassified 1312
529 Ga0068865_100357065 3300006881 Bacteria 1185
530 Ga0068865_100454330 3300006881 Bacteria 1060
531 Ga0068865_100482239 3300006881 Bacteria 1031
532 Ga0068865_100926891 3300006881 Bacteria 759
533 Ga0068865_101708111 3300006881 Unclassified 567
534 Ga0097620_100000013 3300006931 Bacteria 291126
535 Ga0097620_100010105 3300006931 Bacteria 9512
536 Ga0097620_100062249 3300006931 Bacteria 3761
537 Ga0097620_100069741 3300006931 Bacteria 3550
538 Ga0097620_100078715 3300006931 Bacteria 3337
539 Ga0097620_100086798 3300006931 Bacteria 3176
540 Ga0097620_100088052 3300006931 Bacteria 3154
541 Ga0097620_100270951 3300006931 Bacteria 1790
542 Ga0097620_100283331 3300006931 Bacteria 1750
543 Ga0097620_100325229 3300006931 Bacteria 1632
544 Ga0097620_100824180 3300006931 Bacteria 1015
545 Ga0097620_100899455 3300006931 Bacteria 970
546 Ga0097620_101414266 3300006931 Bacteria 767
547 Ga0097620_101686187 3300006931 Bacteria 700
548 Ga0097620_102260709 3300006931 Bacteria 600
549 Ga0097620_102326905 3300006931 Bacteria 591
550 Ga0097620_102869928 3300006931 Unclassified 528
551 Ga0105251_10117551 3300009011 Bacteria 1208
552 Ga0105251_10628716 3300009011 Bacteria 512
553 Ga0105240_10073897 3300009093 Bacteria 4209
554 Ga0105240_10330089 3300009093 Bacteria 1736
555 Ga0105240_10542894 3300009093 Bacteria 1287
556 Ga0105240_11380112 3300009093 Unclassified 741
557 Ga0105240_11550884 3300009093 Bacteria 694
558 Ga0111539_10021933 3300009094 Bacteria 7849
559 Ga0111539_10319434 3300009094 Unclassified 1807
560 Ga0111539_10929534 3300009094 Bacteria 1011
561 Ga0111539_10933982 3300009094 Bacteria 1009
562 Ga0111539_11718783 3300009094 Bacteria 728
563 Ga0111539_11830652 3300009094 Bacteria 704
564 Ga0111539_12544072 3300009094 Bacteria 594
565 Ga0111539_13226945 3300009094 Unclassified 526
566 Ga0105245_10204984 3300009098 Bacteria 1895
567 Ga0105247_10003653 3300009101 Bacteria 9994
568 Ga0105247_10006290 3300009101 Bacteria 7361
569 Ga0105247_10285655 3300009101 Bacteria 1140
570 Ga0105247_11555552 3300009101 Bacteria 541
571 Ga0105247_11705607 3300009101 Unclassified 521
572 Ga0114129_10006355 3300009147 Bacteria 16753
573 Ga0114129_10021381 3300009147 Bacteria 9184
574 Ga0114129_10048278 3300009147 Bacteria 5981
575 Ga0114129_10118770 3300009147 Bacteria 3642
576 Ga0114129_10612993 3300009147 Bacteria 1409
577 Ga0105243_10221980 3300009148 Bacteria 1671
578 Ga0105243_10622689 3300009148 Bacteria 1042
579 Ga0105243_10639247 3300009148 Bacteria 1030
580 Ga0105241_10000607 3300009174 Bacteria 27006
581 Ga0105241_10001739 3300009174 Bacteria 16527
582 Ga0105241_10026762 3300009174 Bacteria 4293
583 Ga0105241_10275544 3300009174 Bacteria 1435
584 Ga0105241_10405623 3300009174 Bacteria 1196
585 Ga0105241_10569829 3300009174 Bacteria 1019
586 Ga0105241_10762013 3300009174 Bacteria 888
587 Ga0105241_11505287 3300009174 Bacteria 648
588 Ga0105241_11538202 3300009174 Bacteria 641
589 Ga0105241_11538794 3300009174 Bacteria 641
590 Ga0105241_11834085 3300009174 Unclassified 593
591 Ga0105242_10007154 3300009176 Bacteria 8615
592 Ga0105242_10030421 3300009176 Bacteria 4311
593 Ga0105242_10147457 3300009176 Bacteria 2048
594 Ga0105242_10597639 3300009176 Unclassified 1065
595 Ga0105242_10844510 3300009176 Bacteria 911
596 Ga0105242_11358156 3300009176 Bacteria 736
597 Ga0105242_11713805 3300009176 Unclassified 665
598 Ga0105248_10261967 3300009177 Bacteria 1946
599 Ga0105237_10005546 3300009545 Bacteria 14228
600 Ga0105237_10011762 3300009545 Bacteria 9258
601 Ga0105237_10081869 3300009545 Bacteria 3219
602 Ga0105237_10358878 3300009545 Bacteria 1462
603 Ga0105237_11174810 3300009545 Unclassified 774
604 Ga0105249_10001440 3300009553 Bacteria 20815
605 Ga0105249_10001920 3300009553 Bacteria 18039
606 Ga0105249_10002116 3300009553 Bacteria 17248
607 Ga0105249_10006146 3300009553 Bacteria 10415
608 Ga0105249_10059447 3300009553 Bacteria 3505
609 Ga0105249_10115848 3300009553 Bacteria 2540
610 Ga0105249_10299911 3300009553 Bacteria 1611
611 Ga0105249_10718590 3300009553 Bacteria 1060
612 Ga0105249_10842509 3300009553 Bacteria 982
613 Ga0105249_12737691 3300009553 Bacteria 565
614 Ga0099796_10548998 3300010159 Bacteria 519
615 Ga0105239_10001030 3300010375 Bacteria 38874
616 Ga0105239_10121875 3300010375 Bacteria 2897
617 Ga0105239_10130222 3300010375 Bacteria 2798
618 Ga0105239_10188446 3300010375 Bacteria 2309
619 Ga0105239_10315190 3300010375 Bacteria 1763
620 Ga0105239_10328002 3300010375 Bacteria 1726
621 Ga0105239_11091723 3300010375 Bacteria 918
622 Ga0105239_12167462 3300010375 Bacteria 646
623 Ga0105239_12742352 3300010375 Bacteria 575
624 Ga0105246_10202600 3300011119 Unclassified 1544
625 Ga0105246_10225083 3300011119 Bacteria 1473
626 Ga0105246_10227029 3300011119 Bacteria 1468
627 Ga0105246_10262137 3300011119 Unclassified 1377
628 Ga0105246_10290881 3300011119 Unclassified 1314
629 Ga0105246_10439468 3300011119 Bacteria 1094
630 Ga0105246_11094778 3300011119 Bacteria 727
631 Ga0105246_11133743 3300011119 Bacteria 716
632 Ga0105246_11743308 3300011119 Bacteria 593
633 Ga0105246_11801505 3300011119 Bacteria 585
634 Ga0157373_10010111 3300013100 Bacteria 6950
635 Ga0157373_10010949 3300013100 Bacteria 6677
636 Ga0157373_10048518 3300013100 Bacteria 3027
637 Ga0157373_10054494 3300013100 Bacteria 2841
638 Ga0157373_10146381 3300013100 Bacteria 1662
639 Ga0157373_10166453 3300013100 Bacteria 1551
640 Ga0157373_10193034 3300013100 Bacteria 1435
641 Ga0157373_10341457 3300013100 Unclassified 1067
642 Ga0157373_10423336 3300013100 Bacteria 956
643 Ga0157373_10429817 3300013100 Unclassified 949
644 Ga0157373_11365537 3300013100 Bacteria 538
645 Ga0157371_10002605 3300013102 Bacteria 17116
646 Ga0157371_10006357 3300013102 Bacteria 9770
647 Ga0157371_10017441 3300013102 Bacteria 5332
648 Ga0157371_10039615 3300013102 Bacteria 3369
649 Ga0157371_10056378 3300013102 Bacteria 2787
650 Ga0157371_10087373 3300013102 Bacteria 2208
651 Ga0157371_10094817 3300013102 Bacteria 2115
652 Ga0157371_10168529 3300013102 Bacteria 1564
653 Ga0157371_10172783 3300013102 Bacteria 1544
654 Ga0157371_10183731 3300013102 Bacteria 1496
655 Ga0157371_10209688 3300013102 Bacteria 1398
656 Ga0157371_10272766 3300013102 Bacteria 1221
657 Ga0157371_10300057 3300013102 Bacteria 1163
658 Ga0157371_10748900 3300013102 Bacteria 734
659 Ga0157371_10893120 3300013102 Bacteria 673
660 Ga0157371_11323232 3300013102 Bacteria 558
661 Ga0157371_11366592 3300013102 Unclassified 549
662 Ga0157371_11615693 3300013102 Bacteria 508
663 Ga0157370_10001361 3300013104 Bacteria 30267
664 Ga0157370_10013762 3300013104 Bacteria 8313
665 Ga0157370_10100782 3300013104 Bacteria 2706
666 Ga0157370_10247715 3300013104 Unclassified 1648
667 Ga0157370_10251876 3300013104 Bacteria 1633
668 Ga0157370_10304121 3300013104 Unclassified 1472
669 Ga0157370_10352286 3300013104 Bacteria 1357
670 Ga0157370_10384508 3300013104 Bacteria 1293
671 Ga0157370_10425762 3300013104 Bacteria 1221
672 Ga0157370_10586891 3300013104 Bacteria 1021
673 Ga0157370_10769651 3300013104 Bacteria 877
674 Ga0157370_11320897 3300013104 Bacteria 650
675 Ga0157370_11390421 3300013104 Bacteria 632
676 Ga0157370_11704708 3300013104 Unclassified 566
677 Ga0157369_10019844 3300013105 Bacteria 7521
678 Ga0157369_10035272 3300013105 Bacteria 5486
679 Ga0157369_10069114 3300013105 Bacteria 3795
680 Ga0157369_10093086 3300013105 Bacteria 3217
681 Ga0157369_10133167 3300013105 Bacteria 2633
682 Ga0157369_10453116 3300013105 Bacteria 1329
683 Ga0157369_12259826 3300013105 Unclassified 551
684 Ga0157374_10006069 3300013296 Bacteria 10225
685 Ga0157374_10010105 3300013296 Bacteria 8104
686 Ga0157374_10035407 3300013296 Bacteria 4567
687 Ga0157374_10071484 3300013296 Bacteria 3271
688 Ga0157374_10089454 3300013296 Bacteria 2934
689 Ga0157374_10114491 3300013296 Bacteria 2597
690 Ga0157374_10159147 3300013296 Unclassified 2199
691 Ga0157374_10176423 3300013296 Bacteria 2086
692 Ga0157374_10798738 3300013296 Bacteria 959
693 Ga0157374_10815803 3300013296 Bacteria 949
694 Ga0157374_11004597 3300013296 Unclassified 853
695 Ga0157374_12180581 3300013296 Unclassified 581
696 Ga0157378_10003215 3300013297 Bacteria 14526
697 Ga0157378_10003796 3300013297 Bacteria 13379
698 Ga0157378_10026251 3300013297 Bacteria 5135
699 Ga0157378_10033953 3300013297 Bacteria 4512
700 Ga0157378_10067026 3300013297 Bacteria 3216
701 Ga0157378_10264251 3300013297 Bacteria 1652
702 Ga0157378_10377791 3300013297 Bacteria 1391
703 Ga0157378_10689944 3300013297 Bacteria 1040
704 Ga0157378_10720578 3300013297 Bacteria 1018
705 Ga0157378_10749144 3300013297 Unclassified 999
706 Ga0157378_10971219 3300013297 Bacteria 883
707 Ga0163162_10000722 3300013306 Bacteria 30672
708 Ga0163162_10011275 3300013306 Bacteria 8716
709 Ga0163162_10030877 3300013306 Bacteria 5311
710 Ga0163162_10053922 3300013306 Bacteria 4042
711 Ga0163162_10081748 3300013306 Bacteria 3302
712 Ga0163162_10117430 3300013306 Bacteria 2762
713 Ga0163162_10153728 3300013306 Bacteria 2419
714 Ga0163162_10233605 3300013306 Bacteria 1970
715 Ga0163162_10234643 3300013306 Bacteria 1965
716 Ga0163162_10353911 3300013306 Bacteria 1601
717 Ga0163162_10461057 3300013306 Bacteria 1402
718 Ga0163162_10773215 3300013306 Bacteria 1079
719 Ga0163162_11371591 3300013306 Unclassified 804
720 Ga0163162_11763586 3300013306 Unclassified 707
721 Ga0163162_12648402 3300013306 Bacteria 577
722 Ga0157372_10028035 3300013307 Bacteria 6142
723 Ga0157372_10068152 3300013307 Bacteria 4000
724 Ga0157372_10071721 3300013307 Bacteria 3902
725 Ga0157372_10080065 3300013307 Bacteria 3695
726 Ga0157372_10080397 3300013307 Bacteria 3687
727 Ga0157372_10112925 3300013307 Unclassified 3113
728 Ga0157372_10134535 3300013307 Bacteria 2846
729 Ga0157372_10265508 3300013307 Bacteria 1993
730 Ga0157372_10335751 3300013307 Bacteria 1760
731 Ga0157372_10449967 3300013307 Bacteria 1501
732 Ga0157372_10536633 3300013307 Bacteria 1364
733 Ga0157372_10549572 3300013307 Bacteria 1346
734 Ga0157372_10562714 3300013307 Bacteria 1329
735 Ga0157372_10697083 3300013307 Bacteria 1182
736 Ga0157372_10727683 3300013307 Unclassified 1154
737 Ga0157372_11114217 3300013307 Bacteria 913
738 Ga0157372_11246437 3300013307 Bacteria 859
739 Ga0157372_11279727 3300013307 Bacteria 846
740 Ga0157372_11356810 3300013307 Unclassified 820
741 Ga0157372_11578875 3300013307 Bacteria 755
742 Ga0157372_11780485 3300013307 Unclassified 708
743 Ga0157372_12493642 3300013307 Unclassified 594
744 Ga0157372_12705790 3300013307 Bacteria 569
745 Ga0157375_10002648 3300013308 Bacteria 15501
746 Ga0157375_10015089 3300013308 Bacteria 6911
747 Ga0157375_10031395 3300013308 Bacteria 5022
748 Ga0157375_10097407 3300013308 Bacteria 3016
749 Ga0157375_10127621 3300013308 Bacteria 2660
750 Ga0157375_10243083 3300013308 Bacteria 1960
751 Ga0157375_10255264 3300013308 Bacteria 1915
752 Ga0157375_10260512 3300013308 Bacteria 1896
753 Ga0157375_10395124 3300013308 Bacteria 1549
754 Ga0157375_10406190 3300013308 Unclassified 1528
755 Ga0157375_10510722 3300013308 Bacteria 1366
756 Ga0157375_10542186 3300013308 Bacteria 1325
757 Ga0157375_11273800 3300013308 Unclassified 864
758 Ga0157375_13053795 3300013308 Bacteria 559
759 Ga0163163_10001099 3300014325 Bacteria 22954
760 Ga0163163_10006617 3300014325 Bacteria 10148
761 Ga0163163_10103685 3300014325 Unclassified 2869
762 Ga0163163_10233436 3300014325 Bacteria 1889
763 Ga0163163_10235285 3300014325 Bacteria 1881
764 Ga0163163_10290652 3300014325 Bacteria 1686
765 Ga0163163_10303128 3300014325 Bacteria 1650
766 Ga0163163_10390588 3300014325 Bacteria 1449
767 Ga0163163_10669732 3300014325 Bacteria 1101
768 Ga0163163_10803951 3300014325 Bacteria 1004
769 Ga0163163_11920271 3300014325 Bacteria 652
770 Ga0163163_12168570 3300014325 Bacteria 615
771 Ga0157380_10063737 3300014326 Bacteria 2956
772 Ga0157380_10100646 3300014326 Bacteria 2407
773 Ga0157380_10105756 3300014326 Bacteria 2353
774 Ga0157380_10198436 3300014326 Bacteria 1778
775 Ga0157380_10211529 3300014326 Bacteria 1728
776 Ga0157380_10436095 3300014326 Bacteria 1254
777 Ga0157380_10507468 3300014326 Unclassified 1173
778 Ga0157380_10599292 3300014326 Bacteria 1090
779 Ga0157380_10692607 3300014326 Bacteria 1023
780 Ga0157380_10806587 3300014326 Bacteria 956
781 Ga0157380_10850544 3300014326 Bacteria 934
782 Ga0157380_10899160 3300014326 Unclassified 911
783 Ga0157380_10947884 3300014326 Bacteria 890
784 Ga0157380_11402009 3300014326 Unclassified 749
785 Ga0157380_11417247 3300014326 Bacteria 746
786 Ga0157380_11604824 3300014326 Bacteria 706
787 Ga0157377_10000916 3300014745 Bacteria 12300
788 Ga0157377_10015970 3300014745 Bacteria 3852
789 Ga0157377_10059777 3300014745 Bacteria 2174
790 Ga0157377_10136866 3300014745 Bacteria 1502
791 Ga0157377_10169948 3300014745 Bacteria 1363
792 Ga0157377_10209117 3300014745 Bacteria 1243
793 Ga0157377_10244516 3300014745 Bacteria 1160
794 Ga0157377_10598561 3300014745 Bacteria 786
795 Ga0157377_10698905 3300014745 Unclassified 736
796 Ga0157379_10065826 3300014968 Bacteria 3240
797 Ga0157379_10123465 3300014968 Bacteria 2330
798 Ga0157379_10216724 3300014968 Bacteria 1734
799 Ga0157379_10247188 3300014968 Bacteria 1619
800 Ga0157379_10705112 3300014968 Bacteria 947
801 Ga0157379_10822047 3300014968 Bacteria 878
802 Ga0157379_11046349 3300014968 Bacteria 780
803 Ga0157379_11256426 3300014968 Bacteria 714
804 Ga0157376_10030234 3300014969 Bacteria 4323
805 Ga0157376_10138281 3300014969 Bacteria 2182
806 Ga0157376_10243683 3300014969 Bacteria 1676
807 Ga0157376_10286984 3300014969 Bacteria 1552
808 Ga0157376_10397069 3300014969 Bacteria 1332
809 Ga0157376_10452433 3300014969 Bacteria 1253
810 Ga0157376_10806850 3300014969 Bacteria 951
811 Ga0157376_10858890 3300014969 Bacteria 923
812 Ga0157376_11042656 3300014969 Bacteria 842
813 Ga0163161_10138583 3300017792 Bacteria 1841
814 Ga0163161_10388731 3300017792 Bacteria 1116
815 Ga0163161_10579301 3300017792 Bacteria 923
816 Ga0163161_11126393 3300017792 Bacteria 676
817 Ga0163161_11268531 3300017792 Unclassified 639
818 Ga0163161_11316854 3300017792 Bacteria 628
819 Ga0163161_11855944 3300017792 Unclassified 536
820 Ga0209258_100032 3300025242 Bacteria 452764
821 Ga0207425_1006123 3300025245 Bacteria 3329
822 Ga0209646_1000050 3300025246 Bacteria 296599
823 Ga0209646_1026798 3300025246 Bacteria 797
824 Ga0209026_1000195 3300025250 Bacteria 84589
825 Ga0209148_1000525 3300025254 Bacteria 37785
826 Ga0209129_1013708 3300025258 Bacteria 1769
827 Ga0209673_1000339 3300025273 Bacteria 85906
828 Ga0209673_1047261 3300025273 Bacteria 1168
829 Ga0209564_1003365 3300025295 Bacteria 11060
830 Ga0209564_1011893 3300025295 Bacteria 3852
831 Ga0209758_1000653 3300025297 Bacteria 52393
832 Ga0209758_1005705 3300025297 Bacteria 9393
833 Ga0209050_1000256 3300025298 Bacteria 114192
834 Ga0207426_1001367 3300025302 Bacteria 20677
835 Ga0207426_1002135 3300025302 Bacteria 13503
836 Ga0207426_1010849 3300025302 Bacteria 3510
837 Ga0207426_1077809 3300025302 Bacteria 907
838 Ga0209051_1017223 3300025303 Bacteria 3235
839 Ga0209257_1000659 3300025304 Bacteria 54234
840 Ga0207697_10051134 3300025315 Bacteria 1707
841 Ga0207697_10188867 3300025315 Bacteria 904
842 Ga0207656_10004462 3300025321 Bacteria 4890
843 Ga0207656_10065766 3300025321 Bacteria 1601
844 Ga0207656_10429256 3300025321 Bacteria 666
845 Ga0207656_10432301 3300025321 Bacteria 664
846 Ga0207682_10038461 3300025893 Bacteria 1941
847 Ga0207682_10068997 3300025893 Bacteria 1494
848 Ga0207682_10203036 3300025893 Bacteria 912
849 Ga0207682_10243979 3300025893 Unclassified 835
850 Ga0207642_10043852 3300025899 Bacteria 1976
851 Ga0207642_10129380 3300025899 Bacteria 1315
852 Ga0207642_10365143 3300025899 Unclassified 855
853 Ga0207710_10000509 3300025900 Bacteria 24244
854 Ga0207688_10034747 3300025901 Bacteria 2791
855 Ga0207688_10228410 3300025901 Bacteria 1123
856 Ga0207688_10259500 3300025901 Bacteria 1054
857 Ga0207688_10302439 3300025901 Bacteria 978
858 Ga0207680_10000113 3300025903 Bacteria 37153
859 Ga0207680_10012344 3300025903 Bacteria 4348
860 Ga0207680_10050510 3300025903 Bacteria 2482
861 Ga0207680_10051558 3300025903 Bacteria 2461
862 Ga0207680_10385937 3300025903 Bacteria 988
863 Ga0207680_11130535 3300025903 Bacteria 559
864 Ga0207647_10005536 3300025904 Bacteria 9246
865 Ga0207685_10125551 3300025905 Unclassified 1132
866 Ga0207645_10000920 3300025907 Bacteria 24452
867 Ga0207645_10046411 3300025907 Bacteria 2775
868 Ga0207645_10320703 3300025907 Bacteria 1033
869 Ga0207643_10036267 3300025908 Bacteria 2765
870 Ga0207705_10069787 3300025909 Bacteria 2545
871 Ga0207705_10109588 3300025909 Bacteria 2039
872 Ga0207705_10232984 3300025909 Bacteria 1401
873 Ga0207705_10350379 3300025909 Bacteria 1137
874 Ga0207684_11145948 3300025910 Bacteria 646
875 Ga0207654_10007676 3300025911 Bacteria 5442
876 Ga0207654_10018791 3300025911 Bacteria 3633
877 Ga0207654_10722096 3300025911 Bacteria 717
878 Ga0207707_10046933 3300025912 Bacteria 3762
879 Ga0207707_10078348 3300025912 Bacteria 2886
880 Ga0207707_10420269 3300025912 Bacteria 1146
881 Ga0207695_10071320 3300025913 Bacteria 3548
882 Ga0207695_10440951 3300025913 Bacteria 1186
883 Ga0207695_10838035 3300025913 Bacteria 799
884 Ga0207671_10000965 3300025914 Bacteria 35673
885 Ga0207671_10330504 3300025914 Bacteria 1207
886 Ga0207660_10064310 3300025917 Bacteria 2648
887 Ga0207660_10069191 3300025917 Bacteria 2562
888 Ga0207662_10111795 3300025918 Bacteria 1704
889 Ga0207662_10501719 3300025918 Bacteria 836
890 Ga0207662_10652659 3300025918 Bacteria 735
891 Ga0207657_10030117 3300025919 Bacteria 4931
892 Ga0207657_10124366 3300025919 Bacteria 2119
893 Ga0207657_10124836 3300025919 Bacteria 2115
894 Ga0207649_10001633 3300025920 Bacteria 13025
895 Ga0207649_10001967 3300025920 Bacteria 11709
896 Ga0207649_10196919 3300025920 Bacteria 1420
897 Ga0207649_10623630 3300025920 Bacteria 831
898 Ga0207649_10746658 3300025920 Bacteria 761
899 Ga0207649_10872416 3300025920 Bacteria 705
900 Ga0207649_11149431 3300025920 Bacteria 613
901 Ga0207652_10010146 3300025921 Bacteria 7587
902 Ga0207652_10304548 3300025921 Bacteria 1438
903 Ga0207681_10050405 3300025923 Bacteria 2817
904 Ga0207681_10097741 3300025923 Bacteria 2111
905 Ga0207681_10158627 3300025923 Bacteria 1703
906 Ga0207681_10169106 3300025923 Bacteria 1656
907 Ga0207681_10407281 3300025923 Bacteria 1099
908 Ga0207650_10125219 3300025925 Bacteria 2005
909 Ga0207650_10289002 3300025925 Bacteria 1336
910 Ga0207650_10290916 3300025925 Bacteria 1332
911 Ga0207650_10296689 3300025925 Bacteria 1319
912 Ga0207650_10308011 3300025925 Bacteria 1295
913 Ga0207650_11774036 3300025925 Unclassified 522
914 Ga0207659_10013948 3300025926 Bacteria 5169
915 Ga0207659_10033422 3300025926 Bacteria 3540
916 Ga0207659_10081595 3300025926 Bacteria 2392
917 Ga0207659_10142609 3300025926 Bacteria 1861
918 Ga0207659_10157302 3300025926 Bacteria 1781
919 Ga0207659_10266662 3300025926 Bacteria 1395
920 Ga0207659_11221243 3300025926 Bacteria 646
921 Ga0207687_10186070 3300025927 Bacteria 1612
922 Ga0207644_10132991 3300025931 Bacteria 1907
923 Ga0207644_10200414 3300025931 Bacteria 1574
924 Ga0207644_10476686 3300025931 Bacteria 1027
925 Ga0207644_10575175 3300025931 Bacteria 934
926 Ga0207644_10649308 3300025931 Bacteria 878
927 Ga0207644_11809436 3300025931 Bacteria 511
928 Ga0207690_10077899 3300025932 Bacteria 2305
929 Ga0207690_10336867 3300025932 Bacteria 1189
930 Ga0207690_11431134 3300025932 Bacteria 578
931 Ga0207706_10002817 3300025933 Bacteria 16877
932 Ga0207706_10032029 3300025933 Bacteria 4683
933 Ga0207706_10301950 3300025933 Bacteria 1395
934 Ga0207706_10350292 3300025933 Bacteria 1284
935 Ga0207686_10000668 3300025934 Bacteria 21199
936 Ga0207686_10013149 3300025934 Bacteria 4572
937 Ga0207686_10039781 3300025934 Bacteria 2854
938 Ga0207686_10396132 3300025934 Bacteria 1050
939 Ga0207686_10549188 3300025934 Bacteria 903
940 Ga0207686_11200474 3300025934 Bacteria 621
941 Ga0207709_11004077 3300025935 Unclassified 682
942 Ga0207670_10003085 3300025936 Bacteria 8803
943 Ga0207670_10019316 3300025936 Bacteria 4161
944 Ga0207670_10023002 3300025936 Bacteria 3872
945 Ga0207670_10298847 3300025936 Bacteria 1260
946 Ga0207669_10226556 3300025937 Bacteria 1376
947 Ga0207669_10455882 3300025937 Bacteria 1014
948 Ga0207669_11018441 3300025937 Bacteria 696
949 Ga0207704_10057834 3300025938 Bacteria 2384
950 Ga0207704_10119076 3300025938 Bacteria 1802
951 Ga0207704_10311952 3300025938 Bacteria 1210
952 Ga0207704_10361327 3300025938 Bacteria 1134
953 Ga0207704_10479088 3300025938 Bacteria 999
954 Ga0207704_10702655 3300025938 Bacteria 837
955 Ga0207704_10803854 3300025938 Bacteria 785
956 Ga0207691_10011397 3300025940 Bacteria 8533
957 Ga0207691_10051341 3300025940 Bacteria 3771
958 Ga0207691_10072810 3300025940 Bacteria 3099
959 Ga0207691_10181325 3300025940 Bacteria 1840
960 Ga0207691_10443603 3300025940 Bacteria 1105
961 Ga0207691_10606945 3300025940 Bacteria 926
962 Ga0207689_10000380 3300025942 Bacteria 41875
963 Ga0207689_10001907 3300025942 Bacteria 19712
964 Ga0207689_10006453 3300025942 Bacteria 10370
965 Ga0207689_10016965 3300025942 Bacteria 6161
966 Ga0207689_10024943 3300025942 Bacteria 5012
967 Ga0207689_10035716 3300025942 Bacteria 4127
968 Ga0207689_10144686 3300025942 Bacteria 1958
969 Ga0207689_10149971 3300025942 Bacteria 1922
970 Ga0207689_10198149 3300025942 Bacteria 1657
971 Ga0207689_10599711 3300025942 Bacteria 926
972 Ga0207689_11222915 3300025942 Bacteria 632
973 Ga0207689_11710260 3300025942 Bacteria 521
974 Ga0207661_10000183 3300025944 Bacteria 40561
975 Ga0207661_10014178 3300025944 Bacteria 5834
976 Ga0207661_10034081 3300025944 Bacteria 3957
977 Ga0207661_10485509 3300025944 Bacteria 1128
978 Ga0207661_10762815 3300025944 Bacteria 890
979 Ga0207679_10000308 3300025945 Bacteria 36802
980 Ga0207679_10002211 3300025945 Bacteria 12015
981 Ga0207679_10071588 3300025945 Bacteria 2616
982 Ga0207679_10075877 3300025945 Bacteria 2552
983 Ga0207679_10667486 3300025945 Bacteria 941
984 Ga0207679_11119982 3300025945 Bacteria 722
985 Ga0207667_10032226 3300025949 Bacteria 5649
986 Ga0207667_10626676 3300025949 Bacteria 1083
987 Ga0207667_10670734 3300025949 Bacteria 1041
988 Ga0207667_10746546 3300025949 Bacteria 978
989 Ga0207667_10949716 3300025949 Bacteria 849
990 Ga0207667_11241413 3300025949 Bacteria 723
991 Ga0207651_10042406 3300025960 Bacteria 3028
992 Ga0207651_10077065 3300025960 Bacteria 2385
993 Ga0207651_10088586 3300025960 Bacteria 2257
994 Ga0207651_10092389 3300025960 Bacteria 2219
995 Ga0207651_10132861 3300025960 Unclassified 1908
996 Ga0207651_10436500 3300025960 Bacteria 1121
997 Ga0207651_10592206 3300025960 Bacteria 968
998 Ga0207651_10633236 3300025960 Bacteria 938
999 Ga0207712_10005082 3300025961 Bacteria 8319
1000 Ga0207712_10011763 3300025961 Bacteria 5578
1001 Ga0207712_10023854 3300025961 Bacteria 4043
1002 Ga0207712_10037862 3300025961 Bacteria 3294
1003 Ga0207712_10041820 3300025961 Bacteria 3152
1004 Ga0207712_10195793 3300025961 Bacteria 1598
1005 Ga0207668_10011523 3300025972 Bacteria 5376
1006 Ga0207640_10041907 3300025981 Bacteria 2915
1007 Ga0207640_10072082 3300025981 Bacteria 2329
1008 Ga0207640_10134118 3300025981 Unclassified 1794
1009 Ga0207640_10277372 3300025981 Bacteria 1315
1010 Ga0207640_10455830 3300025981 Bacteria 1055
1011 Ga0207640_11667235 3300025981 Bacteria 575
1012 Ga0207658_10003708 3300025986 Bacteria 10759
1013 Ga0207658_10020081 3300025986 Bacteria 4625
1014 Ga0207658_10024233 3300025986 Bacteria 4244
1015 Ga0207658_10253953 3300025986 Bacteria 1495
1016 Ga0207658_10826341 3300025986 Bacteria 842
1017 Ga0207658_10909420 3300025986 Bacteria 801
1018 Ga0207658_11253087 3300025986 Bacteria 678
1019 Ga0207677_10031330 3300026023 Bacteria 3405
1020 Ga0207677_10149174 3300026023 Bacteria 1801
1021 Ga0207677_10172688 3300026023 Bacteria 1692
1022 Ga0207677_10175441 3300026023 Bacteria 1680
1023 Ga0207677_10197959 3300026023 Bacteria 1595
1024 Ga0207677_10980906 3300026023 Bacteria 765
1025 Ga0207703_10036407 3300026035 Bacteria 3917
1026 Ga0207703_10081972 3300026035 Bacteria 2691
1027 Ga0207703_10620295 3300026035 Bacteria 1024
1028 Ga0207639_10014657 3300026041 Bacteria 5521
1029 Ga0207639_10044603 3300026041 Bacteria 3335
1030 Ga0207639_10165750 3300026041 Bacteria 1866
1031 Ga0207639_10193084 3300026041 Bacteria 1740
1032 Ga0207639_10558305 3300026041 Bacteria 1052
1033 Ga0207639_10767550 3300026041 Unclassified 897
1034 Ga0207639_11483709 3300026041 Bacteria 636
1035 Ga0207678_10065717 3300026067 Bacteria 3114
1036 Ga0207678_10677955 3300026067 Unclassified 906
1037 Ga0207708_10064969 3300026075 Bacteria 2789
1038 Ga0207708_10368180 3300026075 Bacteria 1182
1039 Ga0207708_10998639 3300026075 Bacteria 727
1040 Ga0207702_10562196 3300026078 Bacteria 1116
1041 Ga0207702_10789513 3300026078 Bacteria 938
1042 Ga0207702_11131392 3300026078 Bacteria 777
1043 Ga0207641_10000184 3300026088 Bacteria 86994
1044 Ga0207641_10001379 3300026088 Bacteria 23962
1045 Ga0207641_10011200 3300026088 Bacteria 7357
1046 Ga0207641_10024994 3300026088 Bacteria 4926
1047 Ga0207641_10249866 3300026088 Bacteria 1656
1048 Ga0207641_10339822 3300026088 Bacteria 1428
1049 Ga0207641_10573489 3300026088 Bacteria 1102
1050 Ga0207641_11311963 3300026088 Bacteria 724
1051 Ga0207641_11537856 3300026088 Bacteria 667
1052 Ga0207648_10000860 3300026089 Bacteria 34249
1053 Ga0207648_10017610 3300026089 Bacteria 6490
1054 Ga0207648_10037487 3300026089 Bacteria 4270
1055 Ga0207648_10045474 3300026089 Bacteria 3850
1056 Ga0207648_10096147 3300026089 Bacteria 2592
1057 Ga0207648_10110047 3300026089 Bacteria 2418
1058 Ga0207648_10245323 3300026089 Bacteria 1596
1059 Ga0207648_10255402 3300026089 Bacteria 1563
1060 Ga0207648_10842831 3300026089 Bacteria 855
1061 Ga0207648_11095681 3300026089 Bacteria 747
1062 Ga0207676_10001951 3300026095 Bacteria 15035
1063 Ga0207676_10015458 3300026095 Bacteria 5506
1064 Ga0207676_10022928 3300026095 Bacteria 4597
1065 Ga0207676_10080505 3300026095 Bacteria 2644
1066 Ga0207676_10115148 3300026095 Bacteria 2257
1067 Ga0207676_10124811 3300026095 Bacteria 2178
1068 Ga0207676_10138994 3300026095 Bacteria 2077
1069 Ga0207676_10240499 3300026095 Bacteria 1624
1070 Ga0207676_10498046 3300026095 Bacteria 1156
1071 Ga0207676_12008519 3300026095 Unclassified 577
1072 Ga0207674_10040364 3300026116 Bacteria 4834
1073 Ga0207674_10438952 3300026116 Bacteria 1262
1074 Ga0207674_10461806 3300026116 Bacteria 1227
1075 Ga0207674_10677807 3300026116 Bacteria 995
1076 Ga0207674_10826144 3300026116 Bacteria 894
1077 Ga0207674_10837534 3300026116 Unclassified 887
1078 Ga0207674_11900206 3300026116 Bacteria 561
1079 Ga0207675_100008623 3300026118 Bacteria 9586
1080 Ga0207675_100046352 3300026118 Bacteria 4061
1081 Ga0207675_100165080 3300026118 Bacteria 2114
1082 Ga0207675_100192685 3300026118 Bacteria 1955
1083 Ga0207675_100198755 3300026118 Bacteria 1925
1084 Ga0207675_100234637 3300026118 Bacteria 1771
1085 Ga0207675_100358061 3300026118 Bacteria 1431
1086 Ga0207675_100380016 3300026118 Bacteria 1389
1087 Ga0207675_100450760 3300026118 Bacteria 1275
1088 Ga0207675_100540226 3300026118 Bacteria 1164
1089 Ga0207683_10002839 3300026121 Bacteria 15129
1090 Ga0207683_10119924 3300026121 Bacteria 2360
1091 Ga0207683_10303018 3300026121 Bacteria 1462
1092 Ga0207683_10434463 3300026121 Bacteria 1210
1093 Ga0207683_10461829 3300026121 Bacteria 1171
1094 Ga0207683_10685936 3300026121 Bacteria 949
1095 Ga0207683_11488896 3300026121 Bacteria 625
1096 Ga0207683_11507889 3300026121 Bacteria 621
1097 Ga0207698_10058187 3300026142 Bacteria 2994
1098 Ga0207698_10069458 3300026142 Bacteria 2786
1099 Ga0207698_10285070 3300026142 Bacteria 1530
1100 Ga0207698_10645038 3300026142 Bacteria 1048
1101 Ga0207698_10775104 3300026142 Unclassified 959
1102 Ga0207698_11916651 3300026142 Bacteria 607
1103 Ga0209981_1066372 3300027378 Bacteria 555
1104 Ga0209968_1055835 3300027526 Bacteria 691
1105 Ga0209971_1100774 3300027682 Bacteria 707
1106 Ga0268266_10029288 3300028379 Bacteria 4681
1107 Ga0268266_10240746 3300028379 Bacteria 1670
1108 Ga0268266_10269250 3300028379 Bacteria 1581
1109 Ga0268266_10990619 3300028379 Bacteria 813
1110 Ga0268266_11490070 3300028379 Bacteria 652
1111 Ga0268266_11811590 3300028379 Bacteria 585
1112 Ga0268265_10218713 3300028380 Bacteria 1665
1113 Ga0268265_10258091 3300028380 Bacteria 1548
1114 Ga0268265_10947400 3300028380 Bacteria 848
1115 Ga0268265_10986228 3300028380 Bacteria 832
1116 Ga0268265_12149664 3300028380 Bacteria 565
1117 Ga0268264_10012233 3300028381 Bacteria 7060
1118 Ga0268264_10017697 3300028381 Bacteria 5834
1119 Ga0268264_10186287 3300028381 Bacteria 1889
1120 Ga0268264_10547591 3300028381 Bacteria 1134
1121 Ga0268264_10884539 3300028381 Bacteria 896
1122 Ga0268264_10930117 3300028381 Bacteria 874
1123 Ga0268264_10965040 3300028381 Bacteria 858
1124 Ga0307515_10000455 3300028794 Bacteria 97670
1125 Ga0307511_10328808 3300030521 Bacteria 671
1126 Ga0307509_10098473 3300031507 Bacteria 2969
1127 Ga0307509_10162480 3300031507 Bacteria 2128
1128 Ga0307408_100278443 3300031548 Bacteria 1392
1129 Ga0307508_10227058 3300031616 Unclassified 1466
1130 Ga0307516_10694501 3300031730 Unclassified 674
1131 Ga0307405_11177813 3300031731 Bacteria 662
1132 Ga0307413_10034923 3300031824 Bacteria 2879
1133 Ga0307413_10579210 3300031824 Unclassified 915
1134 Ga0307410_12026717 3300031852 Bacteria 514
1135 Ga0307407_10039492 3300031903 Bacteria 2625
1136 Ga0307412_11172441 3300031911 Bacteria 687
1137 Ga0307412_11510993 3300031911 Bacteria 611
1138 Ga0307409_102610784 3300031995 Bacteria 534
1139 Ga0307416_100330608 3300032002 Bacteria 1531
1140 Ga0307416_100902127 3300032002 Bacteria 984
1141 Ga0307416_102345531 3300032002 Bacteria 634
1142 Ga0307414_10317882 3300032004 Bacteria 1324
1143 Ga0307414_11342735 3300032004 Unclassified 664
1144 Ga0307414_11959103 3300032004 Bacteria 547
1145 Ga0307411_10261087 3300032005 Bacteria 1368
1146 Ga0307411_10316235 3300032005 Bacteria 1259
1147 Ga0307415_100142800 3300032126 Bacteria 1831
1148 Ga0307415_100538822 3300032126 Unclassified 1028
1149 Ga0373934_0104556 3300035086 Bacteria 1146
1150 Ga0373944_0066866 3300035089 Bacteria 1163
1151 Ga0373944_0445613 3300035089 Unclassified 504
1152 Ga0373953_0114597 3300035117 Bacteria 1142
1153 Ga0373943_0076049 3300035170 Bacteria 1712
1154 Ga0373943_0305686 3300035170 Bacteria 904
1155 Ga0373943_0651243 3300035170 Bacteria 622
1156 Ga0373946_0219715 3300035171 Bacteria 917
1157 Ga0373955_0071227 3300035172 Bacteria 1944
1158 Ga0373924_0162034 3300035410 Bacteria 981
1159 Ga0373931_0498748 3300035691 Bacteria 785
1160 Ga0373931_1140980 3300035691 Bacteria 532
1161 Ga0373935_0322514 3300035692 Bacteria 1096
1162 Ga0373933_0015285 3300035724 Bacteria 4279
1163 Ga0373947_0036116 3300035725 Bacteria 2929
1164 Ga0373947_0156700 3300035725 Bacteria 1470
1165 Ga0373937_0002667 3300036401 Bacteria 14878
1166 Ga0373937_0377229 3300036401 Bacteria 1345
1167 Ga0373925_0685544 3300037068 Bacteria 845
1168 Ga0395899_0184714 3300037312 Bacteria 1462
1169 Ga0395900_0470851 3300037418 Bacteria 1210
1170 Ga0395900_0747476 3300037418 Bacteria 908
1171 Ga0395900_1488485 3300037418 Unclassified 589
1172 Ga0395898_0285479 3300037466 Bacteria 1574
1173 Ga0395898_0344623 3300037466 Bacteria 1421
1174 Ga0395905_0034017 3300037471 Bacteria 4786
1175 Ga0436365_0149163 3300039437 Bacteria 3634
1176 Ga0436365_0613268 3300039437 Bacteria 2185
1177 Ga0439436_0020593 3300041404 Bacteria 1964
1178 Ga0439439_0003200 3300041406 Bacteria 3588
1179 Ga0439466_0051681 3300041411 Bacteria 1345
1180 Ga0451798_0524149 3300041458 Bacteria 663
1181 Ga0451807_1862478 3300041486 Bacteria 1383
1182 Ga0451807_2252505 3300041486 Bacteria 904
1183 Ga0451839_0915601 3300041496 Bacteria 1259
1184 Ga0451851_0544741 3300041507 Bacteria 1210
1185 Ga0451853_3011882 3300041512 Bacteria 609
1186 Ga0439431_0005153 3300041997 Bacteria 2882
1187 Ga0439431_0044376 3300041997 Bacteria 1139
1188 Ga0439433_0034434 3300041999 Bacteria 1166
1189 Ga0439433_0069896 3300041999 Bacteria 845
1190 Ga0439441_040452 3300042001 Unclassified 933
1191 Ga0439442_003302 3300042002 Bacteria 3188
1192 Ga0439454_056956 3300042011 Bacteria 671
1193 Ga0439457_057968 3300042014 Bacteria 875
1194 Ga0439457_161289 3300042014 Bacteria 542
1195 Ga0450890_057777 3300042127 Bacteria 603
1196 Ga0450894_065197 3300042131 Unclassified 552
1197 Ga0450898_002496 3300042134 Bacteria 2568
1198 Ga0450899_001155 3300042135 Bacteria 2998
1199 Ga0439434_0174820 3300042435 Unclassified 718
1200 Ga0450893_0020902 3300042532 Bacteria 1128
1201 Ga0466969_0002175 3300044656 Bacteria 10472
1202 Ga0466972_0172860 3300044658 Bacteria 1014
1203 Ga0466972_0311439 3300044658 Unclassified 735
1204 Ga0466965_0465645 3300044683 Bacteria 705
1205 Ga0466966_0000372 3300044684 Bacteria 29210
1206 Ga0466961_0619196 3300044693 Unclassified 650
1207 Ga0453684_1359317 3300044712 Bacteria 738
1208 Ga0466968_0175887 3300044735 Bacteria 993
1209 Ga0466968_0293421 3300044735 Bacteria 781
1210 Ga0466970_0573469 3300044765 Bacteria 653
1211 Ga0466960_0332200 3300044901 Bacteria 863
1212 Ga0466959_0000076 3300045049 Bacteria 62314
1213 Ga0466959_0030670 3300045049 Bacteria 3981
1214 Ga0451576_0317661 3300045051 Bacteria 1630
1215 Ga0466967_0069119 3300045976 Bacteria 3156
1216 Ga0495627_011163 3300046453 Bacteria 3233
1217 Ga0495592_0241459 3300046454 Bacteria 1198
1218 Ga0495638_0157372 3300046460 Bacteria 1313
1219 Ga0495651_0344036 3300046462 Bacteria 987
1220 Ga0495650_0284301 3300046471 Bacteria 556
1221 Ga0495664_0693636 3300046477 Bacteria 602
1222 Ga0495594_0416782 3300046499 Bacteria 764
1223 Ga0495608_0029638 3300046511 Bacteria 3710
1224 Ga0495618_0160524 3300046514 Bacteria 1433
1225 Ga0495628_0019670 3300046516 Bacteria 5578
1226 Ga0495630_0008167 3300046517 Bacteria 7518
1227 Ga0495652_0706674 3300046529 Unclassified 678
1228 Ga0495640_0105481 3300046533 Bacteria 1846
1229 Ga0495586_0011108 3300046535 Bacteria 4786
1230 Ga0495598_0229815 3300046537 Unclassified 680
1231 Ga0495598_0342498 3300046537 Bacteria 574
1232 Ga0495621_0031236 3300046539 Bacteria 1826
1233 Ga0495645_0128336 3300046543 Bacteria 1780
1234 Ga0495633_0000153 3300046558 Bacteria 90972
1235 Ga0495634_0016445 3300046642 Bacteria 5292
1236 Ga0495625_0394614 3300046660 Bacteria 866
1237 Ga0495635_0114621 3300046663 Bacteria 1840
1238 Ga0495635_0388559 3300046663 Bacteria 928
1239 Ga0495657_0072803 3300046675 Bacteria 2240
1240 Ga0495599_0071095 3300046678 Bacteria 2172
1241 Ga0495669_0636243 3300046684 Bacteria 519
1242 Ga0495649_0297039 3300046694 Bacteria 823
1243 Ga0495604_0340073 3300047317 Bacteria 999
1244 Ga0495604_0552022 3300047317 Bacteria 743
1245 Ga0495674_0333335 3300047319 Bacteria 1234
1246 Ga0495674_0814247 3300047319 Unclassified 726
1247 Ga0495672_0033415 3300047320 Bacteria 3187
1248 Ga0495676_0111372 3300047321 Bacteria 2008
1249 Ga0495676_0615514 3300047321 Bacteria 706
1250 Ga0495680_0250799 3300047322 Bacteria 1254
1251 Ga0495684_0467500 3300047471 Bacteria 873
1252 Ga0495686_0007526 3300047472 Bacteria 8155
1253 Ga0495686_0243458 3300047472 Bacteria 1013
1254 Ga0496100_0514053 3300048903 Bacteria 924
1255 Ga0496105_0564132 3300048908 Bacteria 887
1256 Ga0496108_0687936 3300048911 Bacteria 887
1257 Ga0496110_0030109 3300048913 Bacteria 4677
1258 Ga0496110_0336023 3300048913 Bacteria 1376
1259 Ga0496113_0663356 3300048916 Bacteria 834
1260 Ga0501292_041869 3300049515 Bacteria 793
1261 Ga0501298_015416 3300049521 Bacteria 1376
1262 Ga0501031_0024317 3300049568 Bacteria 3948
1263 Ga0501032_0003013 3300049569 Bacteria 13068
1264 Ga0501032_0149135 3300049569 Bacteria 1538
1265 Ga0501032_0160366 3300049569 Bacteria 1477
1266 Ga0501032_0235536 3300049569 Bacteria 1190
1267 Ga0501032_0307288 3300049569 Bacteria 1025
1268 Ga0501033_0168839 3300049570 Bacteria 1572
1269 Ga0501033_0171491 3300049570 Bacteria 1558
1270 Ga0501033_0622476 3300049570 Bacteria 739
1271 Ga0501034_0004054 3300049571 Bacteria 16437
1272 Ga0501034_0055740 3300049571 Bacteria 3977
1273 Ga0501034_0186464 3300049571 Bacteria 2038
1274 Ga0501034_0259589 3300049571 Bacteria 1680
1275 Ga0501034_0314242 3300049571 Bacteria 1500
1276 Ga0501036_0005975 3300049572 Bacteria 9870
1277 Ga0501036_0023640 3300049572 Bacteria 5178
1278 Ga0501036_0483018 3300049572 Bacteria 1031
1279 Ga0501036_1458061 3300049572 Bacteria 554
1280 Ga0501037_0008358 3300049573 Bacteria 7587
1281 Ga0501037_0019627 3300049573 Bacteria 4988
1282 Ga0501037_0129634 3300049573 Bacteria 1809
1283 Ga0501037_0247461 3300049573 Bacteria 1248
1284 Ga0501037_0705897 3300049573 Unclassified 671
1285 Ga0501038_0008230 3300049574 Bacteria 9598
1286 Ga0501038_0012975 3300049574 Bacteria 7602
1287 Ga0501038_0015492 3300049574 Bacteria 6930
1288 Ga0501038_0767055 3300049574 Bacteria 719
1289 Ga0501039_0004070 3300049575 Bacteria 10995
1290 Ga0501039_0110954 3300049575 Bacteria 2144
1291 Ga0501040_0377297 3300049576 Bacteria 1017
1292 Ga0501043_0010180 3300049579 Bacteria 7370
1293 Ga0501043_0042578 3300049579 Bacteria 3568
1294 Ga0501043_0078691 3300049579 Bacteria 2591
1295 Ga0501043_0374849 3300049579 Bacteria 1078
1296 Ga0501043_0465266 3300049579 Bacteria 948
1297 Ga0501043_0569927 3300049579 Unclassified 839
1298 Ga0501046_0021865 3300049580 Bacteria 5273
1299 Ga0501046_0041982 3300049580 Bacteria 3647
1300 Ga0501047_0002595 3300049581 Bacteria 17203
1301 Ga0501047_0071282 3300049581 Bacteria 3345
1302 Ga0501048_0060298 3300049582 Bacteria 2689
1303 Ga0501067_0019924 3300049583 Bacteria 3711
1304 Ga0501068_0101820 3300049584 Bacteria 1781
1305 Ga0501069_0701545 3300049585 Bacteria 610
1306 Ga0501070_0018561 3300049586 Bacteria 5834
1307 Ga0501070_0029610 3300049586 Bacteria 4588
1308 Ga0501073_0001021 3300049589 Bacteria 20249
1309 Ga0501073_0005193 3300049589 Bacteria 9762
1310 Ga0501074_0000870 3300049590 Bacteria 19252
1311 Ga0501074_0413113 3300049590 Bacteria 957
1312 Ga0501202_005335 3300049652 Bacteria 2276
1313 Ga0501207_007692 3300049654 Bacteria 1541
1314 Ga0501207_011460 3300049654 Bacteria 1321
1315 Ga0501207_037991 3300049654 Bacteria 829
1316 Ga0501214_089510 3300049659 Unclassified 529
1317 Ga0501223_106046 3300049663 Bacteria 583
1318 Ga0501227_023200 3300049665 Unclassified 1441
1319 Ga0501230_040675 3300049667 Bacteria 900
1320 Ga0501235_126253 3300049669 Bacteria 644
1321 Ga0501243_007566 3300049675 Bacteria 1662
1322 Ga0501250_000832 3300049680 Bacteria 2297
1323 Ga0501257_005190 3300049686 Bacteria 2865
1324 Ga0501257_011337 3300049686 Bacteria 2034
1325 Ga0501259_000638 3300049688 Bacteria 5621
1326 Ga0501221_048979 3300049704 Bacteria 947
1327 Ga0501225_0066659 3300049705 Bacteria 1018
1328 Ga0501234_008433 3300049707 Bacteria 1606
1329 Ga0501079_0038835 3300049741 Bacteria 3672
1330 Ga0501079_0999593 3300049741 Bacteria 659
1331 Ga0501080_0036451 3300049742 Bacteria 4590
1332 Ga0501080_0043692 3300049742 Bacteria 4172
1333 Ga0501080_0240935 3300049742 Bacteria 1651
1334 Ga0501080_0561930 3300049742 Bacteria 1015
1335 Ga0501080_0811575 3300049742 Bacteria 820
1336 Ga0501080_0999646 3300049742 Bacteria 725
1337 Ga0501083_0007806 3300049744 Bacteria 7580
1338 Ga0501083_0008173 3300049744 Bacteria 7401
1339 Ga0501083_0095690 3300049744 Bacteria 1959
1340 Ga0501083_0617478 3300049744 Unclassified 705
1341 Ga0501263_031172 3300049760 Bacteria 754
1342 Ga0501266_001664 3300049763 Bacteria 2830
1343 Ga0501268_098666 3300049765 Unclassified 624
1344 Ga0501274_015326 3300049771 Bacteria 751
1345 Ga0501275_028240 3300049772 Bacteria 729
1346 Ga0501280_053627 3300049776 Bacteria 684
1347 Ga0501035_0005968 3300049822 Bacteria 11465
1348 Ga0501035_0094735 3300049822 Bacteria 2625
1349 Ga0501035_0224160 3300049822 Bacteria 1604
1350 Ga0501035_0227358 3300049822 Bacteria 1591
1351 Ga0501044_0146125 3300049823 Bacteria 2350
1352 Ga0501044_0157297 3300049823 Bacteria 2251
1353 Ga0501044_0177558 3300049823 Unclassified 2098
1354 Ga0501044_0227564 3300049823 Bacteria 1814
1355 Ga0501044_0423672 3300049823 Bacteria 1241
1356 Ga0501044_0684884 3300049823 Bacteria 912
1357 Ga0501044_1107486 3300049823 Unclassified 661
1358 nmdc:mga0k408_22327_c1 3300050493 Bacteria 3563
1359 nmdc:mga0k408_236753_c1 3300050493 Bacteria 1090
1360 nmdc:mga06z11_485122_c1 3300050494 Bacteria 748
1361 nmdc:mga07m45_234658_c1 3300050496 Bacteria 1067
1362 nmdc:mga07m45_336562_c1 3300050496 Bacteria 877
1363 nmdc:mga05p37_217712_c1 3300050507 Bacteria 2306
1364 nmdc:mga05p37_313746_c1 3300050507 Bacteria 1858
1365 nmdc:mga05p37_7918_c1 3300050507 Bacteria 12540
1366 nmdc:mga09592_20923_c1 3300050508 Bacteria 5388
1367 nmdc:mga0qj67_17746_c1 3300050509 Bacteria 5413
1368 nmdc:mga0qj67_35454_c1 3300050509 Bacteria 3901
1369 nmdc:mga06r32_157804_c1 3300050510 Bacteria 2251
1370 nmdc:mga06r32_519977_c1 3300050510 Bacteria 1166
1371 nmdc:mga08y16_257358_c1 3300050511 Bacteria 1803
1372 nmdc:mga08y16_833950_c1 3300050511 Bacteria 912
1373 nmdc:mga08y16_872131_c1 3300050511 Bacteria 888
1374 nmdc:mga0n895_553712_c1 3300050512 Bacteria 1156
1375 Ga0500644_0002231 3300053088 Bacteria 4887
1376 Ga0500646_0022071 3300053090 Bacteria 1700
1377 Ga0500583_0055335 3300053092 Bacteria 1855
1378 Ga0500651_0173882 3300053093 Bacteria 1282
1379 Ga0500650_0430547 3300053098 Unclassified 568
1380 Ga0500660_151764 3300053100 Bacteria 897
1381 Ga0500569_000051 3300053109 Bacteria 21519
1382 Ga0500607_014523 3300053121 Bacteria 4561
1383 Ga0500652_002100 3300053131 Bacteria 5989
1384 Ga0500658_0006891 3300053134 Bacteria 4206
1385 Ga0500559_0020442 3300053136 Bacteria 2800
1386 Ga0500577_0006371 3300053142 Bacteria 3251
1387 Ga0500590_047126 3300053148 Bacteria 2201
1388 Ga0500604_0008066 3300053151 Bacteria 2794
1389 Ga0500616_0022833 3300053153 Bacteria 3492
1390 Ga0500622_0000673 3300053156 Bacteria 30220
1391 Ga0500622_0106563 3300053156 Bacteria 1374
1392 Ga0500633_0013450 3300053160 Bacteria 2294
1393 Ga0500633_0385861 3300053160 Bacteria 507
1394 Ga0500636_0011566 3300053177 Bacteria 5167
1395 Ga0500645_065201 3300053730 Bacteria 1049
1396 Ga0500645_076482 3300053730 Bacteria 957
1397 Ga0501084_0480161 3300054114 Bacteria 1050
1398 Ga0501084_0602857 3300054114 Bacteria 928
1399 Ga0500661_029755 3300055283 Unclassified 963
1400 Ga0501082_0015583 3300060353 Bacteria 6543
1401 2884796196 2884791551 Bacteria 8511252
1402 2929240596 2929239360 Bacteria 7745570
1403 2929922444 2929921140 Bacteria 8649150
1404 8003153868 8003151029 Bacteria 8187759
1405 Ga0439449_0126358
1406 SwRhRL3b_contig_139884
1407 SwRhRL2b_contig_1042660
1408 JGI24740J21852_10002875
1409 JGI24740J21852_10033689
1410 JGI24739J22299_10000573
1411 JGI24739J22299_10009027
1412 JGI24744J21845_10010154
1413 JGI24033J26618_1016177
1414 JGI25154J39366_1000021
1415 JGI25154J39366_1006212
1416 JGI25157J39369_1002591
1417 JGI25406J46586_10122729
1418 JGI25153J46596_10000222
1419 rootH1_10012114
1420 rootH1_10112267
1421 rootH1_10189234
1422 rootH2_10001833
1423 rootH2_10033753
1424 rootH2_10191781
1425 rootH2_10249049
1426 rootL2_10012010
1427 rootL2_10025600
1428 rootL2_10073523
1429 rootL2_10073524
1430 rootL2_10219317
1431 rootL2_10314317
1432 rootL2_10317203
1433 rootH1_10051194
1434 rootH1_10094721
1435 rootH1_10129380
1436 rootH1_10274667
1437 JGI25160J50197_1006628
1438 JGI25160J50197_1008451
1439 JGI25160J50197_1008565
1440 JGI25160J50197_1020538
1441 Ga0055535_1003814
1442 Ga0055526_1024154
1443 Ga0055528_1002059
1444 Ga0055530_10001651
1445 Ga0055543_1009549
1446 Ga0065165_1000579
1447 Ga0065714_10129073
1448 Ga0065704_10141375
1449 Ga0065704_10185428
1450 Ga0065712_10001362
1451 Ga0065712_10008351
1452 Ga0065712_10160108
1453 Ga0065712_10228679
1454 Ga0065715_10013855
1455 Ga0065707_10004405
1456 Ga0065707_10105293
1457 Ga0065707_10131851
1458 Ga0070658_10029219
1459 Ga0070658_10092767
1460 Ga0070658_10425663
1461 Ga0070676_10005217
1462 Ga0070676_10045937
1463 Ga0070676_10145306
1464 Ga0070676_10360534
1465 Ga0070676_11038170
1466 Ga0070683_100002359
1467 Ga0070683_100005979
1468 Ga0070683_100007262
1469 Ga0070683_100026768
1470 Ga0070683_100193767
1471 Ga0070683_100210525
1472 Ga0070683_100337058
1473 Ga0070683_100765835
1474 Ga0070683_101433181
1475 Ga0070683_101774651
1476 Ga0070690_100016204
1477 Ga0070690_100259426
1478 Ga0070690_100280524
1479 Ga0070690_100296129
1480 Ga0070690_100593920
1481 Ga0070690_100598769
1482 Ga0070690_101019879
1483 Ga0070670_100015785
1484 Ga0070670_100032493
1485 Ga0070670_100045331
1486 Ga0070670_100090508
1487 Ga0070670_100109318
1488 Ga0070670_100176567
1489 Ga0070670_100197725
1490 Ga0070670_100287355
1491 Ga0070670_100318516
1492 Ga0070670_100650309
1493 Ga0070670_100660965
1494 Ga0070670_100775135
1495 Ga0070670_100885825
1496 Ga0070677_10007969
1497 Ga0070677_10132731
1498 Ga0070677_10173723
1499 Ga0070677_10499685
1500 Ga0068869_100008418
1501 Ga0068869_100014754
1502 Ga0068869_100037107
1503 Ga0068869_100047138
1504 Ga0068869_100070957
1505 Ga0068869_100134454
1506 Ga0068869_100163058
1507 Ga0068869_100171602
1508 Ga0068869_100295430
1509 Ga0068869_100549808
1510 Ga0068869_100624182
1511 Ga0068869_100710832
1512 Ga0068869_100773993
1513 Ga0068869_100798371
1514 Ga0068869_101172520
1515 Ga0070666_10000019
1516 Ga0070666_10002676
1517 Ga0070666_10017990
1518 Ga0070666_10264070
1519 Ga0070666_10313812
1520 Ga0070666_10637358
1521 Ga0070680_100001352
1522 Ga0070680_100217894
1523 Ga0070680_100238448
1524 Ga0070682_100000934
1525 Ga0070682_100179206
1526 Ga0070682_100259229
1527 Ga0070682_100366595
1528 Ga0068868_100005373
1529 Ga0068868_100011564
1530 Ga0068868_100016289
1531 Ga0068868_100109067
1532 Ga0068868_100454250
1533 Ga0068868_100503970
1534 Ga0068868_100524087
1535 Ga0068868_100801433
1536 Ga0070660_100175208
1537 Ga0070660_100267402
1538 Ga0070660_100902364
1539 Ga0070660_100913152
1540 Ga0070660_101002380
1541 Ga0070660_101191157
1542 Ga0070689_100021838
1543 Ga0070689_100024989
1544 Ga0070689_100086957
1545 Ga0070689_100107571
1546 Ga0070689_100187848
1547 Ga0070689_100360884
1548 Ga0070689_100404445
1549 Ga0070689_100746492
1550 Ga0070689_100845023
1551 Ga0070689_101330076
1552 Ga0070691_10000160
1553 Ga0070687_100041534
1554 Ga0070687_100453255
1555 Ga0070687_100553019
1556 Ga0070687_100581185
1557 Ga0070661_100002162
1558 Ga0070661_100004509
1559 Ga0070661_100220538
1560 Ga0070661_100225332
1561 Ga0070661_100641735
1562 Ga0070661_100682279
1563 Ga0070661_100811809
1564 Ga0070668_100005318
1565 Ga0070668_100008164
1566 Ga0070668_100056832
1567 Ga0070668_100421066
1568 Ga0070669_100015572
1569 Ga0070669_100051623
1570 Ga0070669_100071414
1571 Ga0070669_100097908
1572 Ga0070669_100136893
1573 Ga0070669_100153192
1574 Ga0070669_100208420
1575 Ga0070669_100387929
1576 Ga0070669_100411834
1577 Ga0070669_100422220
1578 Ga0070669_100439709
1579 Ga0070675_100009953
1580 Ga0070675_100018596
1581 Ga0070675_100030391
1582 Ga0070675_100132999
1583 Ga0070675_100192221
1584 Ga0070675_100218099
1585 Ga0070675_100243153
1586 Ga0070675_100604987
1587 Ga0070675_101028937
1588 Ga0070675_101043029
1589 Ga0070675_101137723
1590 Ga0070671_100040747
1591 Ga0070671_100069414
1592 Ga0070671_100133278
1593 Ga0070671_100285295
1594 Ga0070671_100443364
1595 Ga0070671_100912242
1596 Ga0070671_101110595
1597 Ga0070671_101566408
1598 Ga0070671_101576720
1599 Ga0070674_100020556
1600 Ga0070674_100470652
1601 Ga0070673_100004592
1602 Ga0070673_100007862
1603 Ga0070673_100042190
1604 Ga0070673_100042736
1605 Ga0070673_100044249
1606 Ga0070673_100046399
1607 Ga0070673_100207789
1608 Ga0070673_100235135
1609 Ga0070673_101215611
1610 Ga0070673_101462557
1611 Ga0070673_102239188
1612 Ga0070688_100022281
1613 Ga0070688_100075143
1614 Ga0070688_100179297
1615 Ga0070688_100506415
1616 Ga0070688_100947223
1617 Ga0070659_100008080
1618 Ga0070659_100026990
1619 Ga0070659_100140711
1620 Ga0070659_100377949
1621 Ga0070659_101506732
1622 Ga0070659_101926145
1623 Ga0070667_100010175
1624 Ga0070667_100012137
1625 Ga0070667_100042945
1626 Ga0070667_100161448
1627 Ga0070667_100431772
1628 Ga0070667_100503754
1629 Ga0070667_100652968
1630 Ga0070667_100753343
1631 Ga0070667_100929864
1632 Ga0070667_100985772
1633 Ga0070701_10085487
1634 Ga0070711_100865591
1635 Ga0070700_100052053
1636 Ga0070700_100180068
1637 Ga0070700_100257657
1638 Ga0070708_101116930
1639 Ga0070663_100396287
1640 Ga0070663_100528834
1641 Ga0070678_100020735
1642 Ga0070678_100163084
1643 Ga0070678_100363368
1644 Ga0070678_100667507
1645 Ga0070678_100779674
1646 Ga0070678_100806103
1647 Ga0070678_101372825
1648 Ga0070678_101677587
1649 Ga0070678_101720517
1650 Ga0070662_100006375
1651 Ga0070662_100020905
1652 Ga0070662_100156874
1653 Ga0070662_100518771
1654 Ga0070681_10087439
1655 Ga0070681_10539602
1656 Ga0070681_10853129
1657 Ga0068867_100026488
1658 Ga0068867_100058811
1659 Ga0068867_100074210
1660 Ga0068867_100078793
1661 Ga0068867_100088793
1662 Ga0068867_100182308
1663 Ga0068867_100202053
1664 Ga0068867_100860576
1665 Ga0068867_100873588
1666 Ga0068867_100941715
1667 Ga0068867_101114020
1668 Ga0068867_102224129
1669 Ga0070685_10010718
1670 Ga0070685_10048572
1671 Ga0070685_10065169
1672 Ga0070685_10144908
1673 Ga0070685_10349408
1674 Ga0070685_10882106
1675 Ga0070707_100075842
1676 Ga0070707_100535603
1677 Ga0070698_100006956
1678 Ga0070698_100898800
1679 Ga0070699_100241967
1680 Ga0070699_101171228
1681 Ga0070679_100009634
1682 Ga0070679_100173836
1683 Ga0070679_100225680
1684 Ga0070679_100777218
1685 Ga0070679_100785224
1686 Ga0070679_101515727
1687 Ga0070684_100026097
1688 Ga0070684_100063337
1689 Ga0070684_100084135
1690 Ga0070684_100172922
1691 Ga0070684_100285191
1692 Ga0070684_100358565
1693 Ga0070684_100614193
1694 Ga0070684_100873833
1695 Ga0068853_100041942
1696 Ga0068853_100058156
1697 Ga0068853_100118870
1698 Ga0068853_100167512
1699 Ga0068853_100181658
1700 Ga0068853_100289574
1701 Ga0068853_100755091
1702 Ga0068853_101222534
1703 Ga0068853_101556740
1704 Ga0068853_102016465
1705 Ga0070672_100045424
1706 Ga0070672_100049195
1707 Ga0070672_100204888
1708 Ga0070672_100294496
1709 Ga0070672_100369043
1710 Ga0070672_100446829
1711 Ga0070672_100513370
1712 Ga0070672_100606064
1713 Ga0070672_100774942
1714 Ga0070686_100060375
1715 Ga0070686_100082764
1716 Ga0070686_100221273
1717 Ga0070686_100232825
1718 Ga0070686_101554685
1719 Ga0070693_100013640
1720 Ga0070693_100557487
1721 Ga0070693_101162752
1722 Ga0070665_100009994
1723 Ga0070665_100329485
1724 Ga0070665_101371568
1725 Ga0070665_102248713
1726 Ga0070704_100503663
1727 Ga0070704_100573948
1728 Ga0070704_100972542
1729 Ga0068855_100003963
1730 Ga0068855_100017499
1731 Ga0068855_100019154
1732 Ga0068855_100041940
1733 Ga0068855_100193800
1734 Ga0068855_100292651
1735 Ga0068855_100701628
1736 Ga0068855_100791892
1737 Ga0070664_100013799
1738 Ga0070664_100015152
1739 Ga0070664_100033788
1740 Ga0070664_100124560
1741 Ga0070664_100126729
1742 Ga0070664_100353355
1743 Ga0070664_100377346
1744 Ga0070664_100654244
1745 Ga0070664_101264124
1746 Ga0070664_101288177
1747 Ga0070664_101499985
1748 Ga0070664_101522935
1749 Ga0068857_100004299
1750 Ga0068857_100025400
1751 Ga0068857_100031073
1752 Ga0068857_100166907
1753 Ga0068857_100291360
1754 Ga0068857_100675898
1755 Ga0068857_100790722
1756 Ga0068857_100849247
1757 Ga0068857_101525160
1758 Ga0068854_100043187
1759 Ga0068854_100053069
1760 Ga0068854_100063939
1761 Ga0068854_100086163
1762 Ga0068854_100232725
1763 Ga0068854_100498467
1764 Ga0068854_100672854
1765 Ga0068856_100024151
1766 Ga0068856_100372503
1767 Ga0068856_100494438
1768 Ga0068856_101142107
1769 Ga0068856_101314682
1770 Ga0070702_100025541
1771 Ga0070702_100650045
1772 Ga0068852_100059907
1773 Ga0068852_100088967
1774 Ga0068852_100094839
1775 Ga0068852_100099119
1776 Ga0068852_100167408
1777 Ga0068852_100557525
1778 Ga0068852_100563656
1779 Ga0068852_100660036
1780 Ga0068852_100695370
1781 Ga0068852_100895584
1782 Ga0068852_101356885
1783 Ga0068852_101528089
1784 Ga0068852_101567735
1785 Ga0068852_102034474
1786 Ga0068859_100000013
1787 Ga0068859_100010105
1788 Ga0068859_100062252
1789 Ga0068859_100069743
1790 Ga0068859_100078718
1791 Ga0068859_100086803
1792 Ga0068859_100088052
1793 Ga0068859_100270926
1794 Ga0068859_100283340
1795 Ga0068859_100325223
1796 Ga0068859_100899595
1797 Ga0068859_101414457
1798 Ga0068859_101686273
1799 Ga0068859_102259506
1800 Ga0068859_102327114
1801 Ga0068859_102870796
1802 Ga0068864_100002531
1803 Ga0068864_100013970
1804 Ga0068864_100287296
1805 Ga0068864_100465577
1806 Ga0068864_100543744
1807 Ga0068864_100564470
1808 Ga0068864_100606492
1809 Ga0068864_100698741
1810 Ga0068864_100805098
1811 Ga0068864_101022781
1812 Ga0068864_101405234
1813 Ga0068866_10157062
1814 Ga0068866_10176469
1815 Ga0068866_10180903
1816 Ga0068866_10377838
1817 Ga0068861_100015324
1818 Ga0068861_100160774
1819 Ga0068861_100248230
1820 Ga0068861_100280117
1821 Ga0068861_100374226
1822 Ga0068861_100402138
1823 Ga0068861_100535381
1824 Ga0068861_100623591
1825 Ga0068861_100780097
1826 Ga0068861_100790175
1827 Ga0068861_101185912
1828 Ga0068861_101380584
1829 Ga0068851_10008282
1830 Ga0068851_10196750
1831 Ga0068851_10205639
1832 Ga0068851_10650934
1833 Ga0068851_10653719
1834 Ga0068851_10718384
1835 Ga0068851_10775410
1836 Ga0068851_10923005
1837 Ga0068870_10015883
1838 Ga0068870_10073950
1839 Ga0068870_10247517
1840 Ga0068870_10333595
1841 Ga0068870_10392520
1842 Ga0068870_10724423
1843 Ga0068870_10847201
1844 Ga0068870_11106325
1845 Ga0068863_100001058
1846 Ga0068863_100016960
1847 Ga0068863_100031954
1848 Ga0068863_100032772
1849 Ga0068863_100179888
1850 Ga0068863_100374779
1851 Ga0068858_100008721
1852 Ga0068858_100173445
1853 Ga0068858_100323671
1854 Ga0068858_100770485
1855 Ga0068858_101040636
1856 Ga0068858_102281426
1857 Ga0068860_100007046
1858 Ga0068860_100010577
1859 Ga0068860_100010672
1860 Ga0068860_100244255
1861 Ga0068860_100257354
1862 Ga0068860_100507055
1863 Ga0068860_100525491
1864 Ga0068860_100569259
1865 Ga0068860_101437052
1866 Ga0068860_101471452
1867 Ga0068862_100001187
1868 Ga0068862_100081363
1869 Ga0068862_100133333
1870 Ga0068862_101008145
1871 Ga0068862_101321141
1872 Ga0068862_101477169
1873 Ga0068862_102286085
1874 Ga0081539_10031023
1875 Ga0081539_10255293
1876 Ga0070715_10163182
1877 Ga0070715_10171973
1878 Ga0070716_100740546
1879 Ga0075366_10019812
1880 Ga0075366_10067705
1881 Ga0075366_10354904
1882 Ga0075366_10376516
1883 Ga0075366_10526986
1884 Ga0075366_10715853
1885 Ga0097621_100001972
1886 Ga0097621_100027113
1887 Ga0097621_100041789
1888 Ga0097621_100063981
1889 Ga0097621_100273291
1890 Ga0097621_100286377
1891 Ga0097621_100540733
1892 Ga0097621_100602203
1893 Ga0097621_100698998
1894 Ga0097621_100710364
1895 Ga0097621_101245509
1896 Ga0097621_101509884
1897 Ga0075370_10212574
1898 Ga0075370_10490689
1899 Ga0068871_100003860
1900 Ga0068871_100015010
1901 Ga0068871_100017231
1902 Ga0068871_100234064
1903 Ga0068871_100305471
1904 Ga0068871_100315066
1905 Ga0068871_100666139
1906 Ga0068871_100879666
1907 Ga0068871_100921890
1908 Ga0068871_101035164
1909 Ga0068871_101132280
1910 Ga0068871_101855873
1911 Ga0068871_101881755
1912 Ga0068871_102063601
1913 Ga0068871_102302527
1914 Ga0075428_100010497
1915 Ga0075428_100043546
1916 Ga0075428_100108035
1917 Ga0075428_100477959
1918 Ga0075428_102279292
1919 Ga0075430_100026460
1920 Ga0075430_100084952
1921 Ga0075431_100195236
1922 Ga0075431_100563260
1923 Ga0075434_100602397
1924 Ga0075429_100016535
1925 Ga0075429_100039595
1926 Ga0075429_100311291
1927 Ga0068865_100014264
1928 Ga0068865_100115404
1929 Ga0068865_100170998
1930 Ga0068865_100221094
1931 Ga0068865_100286972
1932 Ga0068865_100357065
1933 Ga0068865_100454330
1934 Ga0068865_100482239
1935 Ga0068865_100926891
1936 Ga0068865_101708111
1937 Ga0097620_100000013
1938 Ga0097620_100010105
1939 Ga0097620_100062249
1940 Ga0097620_100069741
1941 Ga0097620_100078715
1942 Ga0097620_100086798
1943 Ga0097620_100088052
1944 Ga0097620_100270951
1945 Ga0097620_100283331
1946 Ga0097620_100325229
1947 Ga0097620_100824180
1948 Ga0097620_100899455
1949 Ga0097620_101414266
1950 Ga0097620_101686187
1951 Ga0097620_102260709
1952 Ga0097620_102326905
1953 Ga0097620_102869928
1954 Ga0105251_10117551
1955 Ga0105251_10628716
1956 Ga0105240_10073897
1957 Ga0105240_10330089
1958 Ga0105240_10542894
1959 Ga0105240_11380112
1960 Ga0105240_11550884
1961 Ga0111539_10021933
1962 Ga0111539_10319434
1963 Ga0111539_10929534
1964 Ga0111539_10933982
1965 Ga0111539_11718783
1966 Ga0111539_11830652
1967 Ga0111539_12544072
1968 Ga0111539_13226945
1969 Ga0105245_10204984
1970 Ga0105247_10003653
1971 Ga0105247_10006290
1972 Ga0105247_10285655
1973 Ga0105247_11555552
1974 Ga0105247_11705607
1975 Ga0114129_10006355
1976 Ga0114129_10021381
1977 Ga0114129_10048278
1978 Ga0114129_10118770
1979 Ga0114129_10612993
1980 Ga0105243_10221980
1981 Ga0105243_10622689
1982 Ga0105243_10639247
1983 Ga0105241_10000607
1984 Ga0105241_10001739
1985 Ga0105241_10026762
1986 Ga0105241_10275544
1987 Ga0105241_10405623
1988 Ga0105241_10569829
1989 Ga0105241_10762013
1990 Ga0105241_11505287
1991 Ga0105241_11538202
1992 Ga0105241_11538794
1993 Ga0105241_11834085
1994 Ga0105242_10007154
1995 Ga0105242_10030421
1996 Ga0105242_10147457
1997 Ga0105242_10597639
1998 Ga0105242_10844510
1999 Ga0105242_11358156
2000 Ga0105242_11713805
2001 Ga0105248_10261967
2002 Ga0105237_10005546
2003 Ga0105237_10011762
2004 Ga0105237_10081869
2005 Ga0105237_10358878
2006 Ga0105237_11174810
2007 Ga0105249_10001440
2008 Ga0105249_10001920
2009 Ga0105249_10002116
2010 Ga0105249_10006146
2011 Ga0105249_10059447
2012 Ga0105249_10115848
2013 Ga0105249_10299911
2014 Ga0105249_10718590
2015 Ga0105249_10842509
2016 Ga0105249_12737691
2017 Ga0099796_10548998
2018 Ga0105239_10001030
2019 Ga0105239_10121875
2020 Ga0105239_10130222
2021 Ga0105239_10188446
2022 Ga0105239_10315190
2023 Ga0105239_10328002
2024 Ga0105239_11091723
2025 Ga0105239_12167462
2026 Ga0105239_12742352
2027 Ga0105246_10202600
2028 Ga0105246_10225083
2029 Ga0105246_10227029
2030 Ga0105246_10262137
2031 Ga0105246_10290881
2032 Ga0105246_10439468
2033 Ga0105246_11094778
2034 Ga0105246_11133743
2035 Ga0105246_11743308
2036 Ga0105246_11801505
2037 Ga0157373_10010111
2038 Ga0157373_10010949
2039 Ga0157373_10048518
2040 Ga0157373_10054494
2041 Ga0157373_10146381
2042 Ga0157373_10166453
2043 Ga0157373_10193034
2044 Ga0157373_10341457
2045 Ga0157373_10423336
2046 Ga0157373_10429817
2047 Ga0157373_11365537
2048 Ga0157371_10002605
2049 Ga0157371_10006357
2050 Ga0157371_10017441
2051 Ga0157371_10039615
2052 Ga0157371_10056378
2053 Ga0157371_10087373
2054 Ga0157371_10094817
2055 Ga0157371_10168529
2056 Ga0157371_10172783
2057 Ga0157371_10183731
2058 Ga0157371_10209688
2059 Ga0157371_10272766
2060 Ga0157371_10300057
2061 Ga0157371_10748900
2062 Ga0157371_10893120
2063 Ga0157371_11323232
2064 Ga0157371_11366592
2065 Ga0157371_11615693
2066 Ga0157370_10001361
2067 Ga0157370_10013762
2068 Ga0157370_10100782
2069 Ga0157370_10247715
2070 Ga0157370_10251876
2071 Ga0157370_10304121
2072 Ga0157370_10352286
2073 Ga0157370_10384508
2074 Ga0157370_10425762
2075 Ga0157370_10586891
2076 Ga0157370_10769651
2077 Ga0157370_11320897
2078 Ga0157370_11390421
2079 Ga0157370_11704708
2080 Ga0157369_10019844
2081 Ga0157369_10035272
2082 Ga0157369_10069114
2083 Ga0157369_10093086
2084 Ga0157369_10133167
2085 Ga0157369_10453116
2086 Ga0157369_12259826
2087 Ga0157374_10006069
2088 Ga0157374_10010105
2089 Ga0157374_10035407
2090 Ga0157374_10071484
2091 Ga0157374_10089454
2092 Ga0157374_10114491
2093 Ga0157374_10159147
2094 Ga0157374_10176423
2095 Ga0157374_10798738
2096 Ga0157374_10815803
2097 Ga0157374_11004597
2098 Ga0157374_12180581
2099 Ga0157378_10003215
2100 Ga0157378_10003796
2101 Ga0157378_10026251
2102 Ga0157378_10033953
2103 Ga0157378_10067026
2104 Ga0157378_10264251
2105 Ga0157378_10377791
2106 Ga0157378_10689944
2107 Ga0157378_10720578
2108 Ga0157378_10749144
2109 Ga0157378_10971219
2110 Ga0163162_10000722
2111 Ga0163162_10011275
2112 Ga0163162_10030877
2113 Ga0163162_10053922
2114 Ga0163162_10081748
2115 Ga0163162_10117430
2116 Ga0163162_10153728
2117 Ga0163162_10233605
2118 Ga0163162_10234643
2119 Ga0163162_10353911
2120 Ga0163162_10461057
2121 Ga0163162_10773215
2122 Ga0163162_11371591
2123 Ga0163162_11763586
2124 Ga0163162_12648402
2125 Ga0157372_10028035
2126 Ga0157372_10068152
2127 Ga0157372_10071721
2128 Ga0157372_10080065
2129 Ga0157372_10080397
2130 Ga0157372_10112925
2131 Ga0157372_10134535
2132 Ga0157372_10265508
2133 Ga0157372_10335751
2134 Ga0157372_10449967
2135 Ga0157372_10536633
2136 Ga0157372_10549572
2137 Ga0157372_10562714
2138 Ga0157372_10697083
2139 Ga0157372_10727683
2140 Ga0157372_11114217
2141 Ga0157372_11246437
2142 Ga0157372_11279727
2143 Ga0157372_11356810
2144 Ga0157372_11578875
2145 Ga0157372_11780485
2146 Ga0157372_12493642
2147 Ga0157372_12705790
2148 Ga0157375_10002648
2149 Ga0157375_10015089
2150 Ga0157375_10031395
2151 Ga0157375_10097407
2152 Ga0157375_10127621
2153 Ga0157375_10243083
2154 Ga0157375_10255264
2155 Ga0157375_10260512
2156 Ga0157375_10395124
2157 Ga0157375_10406190
2158 Ga0157375_10510722
2159 Ga0157375_10542186
2160 Ga0157375_11273800
2161 Ga0157375_13053795
2162 Ga0163163_10001099
2163 Ga0163163_10006617
2164 Ga0163163_10103685
2165 Ga0163163_10233436
2166 Ga0163163_10235285
2167 Ga0163163_10290652
2168 Ga0163163_10303128
2169 Ga0163163_10390588
2170 Ga0163163_10669732
2171 Ga0163163_10803951
2172 Ga0163163_11920271
2173 Ga0163163_12168570
2174 Ga0157380_10063737
2175 Ga0157380_10100646
2176 Ga0157380_10105756
2177 Ga0157380_10198436
2178 Ga0157380_10211529
2179 Ga0157380_10436095
2180 Ga0157380_10507468
2181 Ga0157380_10599292
2182 Ga0157380_10692607
2183 Ga0157380_10806587
2184 Ga0157380_10850544
2185 Ga0157380_10899160
2186 Ga0157380_10947884
2187 Ga0157380_11402009
2188 Ga0157380_11417247
2189 Ga0157380_11604824
2190 Ga0157377_10000916
2191 Ga0157377_10015970
2192 Ga0157377_10059777
2193 Ga0157377_10136866
2194 Ga0157377_10169948
2195 Ga0157377_10209117
2196 Ga0157377_10244516
2197 Ga0157377_10598561
2198 Ga0157377_10698905
2199 Ga0157379_10065826
2200 Ga0157379_10123465
2201 Ga0157379_10216724
2202 Ga0157379_10247188
2203 Ga0157379_10705112
2204 Ga0157379_10822047
2205 Ga0157379_11046349
2206 Ga0157379_11256426
2207 Ga0157376_10030234
2208 Ga0157376_10138281
2209 Ga0157376_10243683
2210 Ga0157376_10286984
2211 Ga0157376_10397069
2212 Ga0157376_10452433
2213 Ga0157376_10806850
2214 Ga0157376_10858890
2215 Ga0157376_11042656
2216 Ga0163161_10138583
2217 Ga0163161_10388731
2218 Ga0163161_10579301
2219 Ga0163161_11126393
2220 Ga0163161_11268531
2221 Ga0163161_11316854
2222 Ga0163161_11855944
2223 Ga0209258_100032
2224 Ga0207425_1006123
2225 Ga0209646_1000050
2226 Ga0209646_1026798
2227 Ga0209026_1000195
2228 Ga0209148_1000525
2229 Ga0209129_1013708
2230 Ga0209673_1000339
2231 Ga0209673_1047261
2232 Ga0209564_1003365
2233 Ga0209564_1011893
2234 Ga0209758_1000653
2235 Ga0209758_1005705
2236 Ga0209050_1000256
2237 Ga0207426_1001367
2238 Ga0207426_1002135
2239 Ga0207426_1010849
2240 Ga0207426_1077809
2241 Ga0209051_1017223
2242 Ga0209257_1000659
2243 Ga0207697_10051134
2244 Ga0207697_10188867
2245 Ga0207656_10004462
2246 Ga0207656_10065766
2247 Ga0207656_10429256
2248 Ga0207656_10432301
2249 Ga0207682_10038461
2250 Ga0207682_10068997
2251 Ga0207682_10203036
2252 Ga0207682_10243979
2253 Ga0207642_10043852
2254 Ga0207642_10129380
2255 Ga0207642_10365143
2256 Ga0207710_10000509
2257 Ga0207688_10034747
2258 Ga0207688_10228410
2259 Ga0207688_10259500
2260 Ga0207688_10302439
2261 Ga0207680_10000113
2262 Ga0207680_10012344
2263 Ga0207680_10050510
2264 Ga0207680_10051558
2265 Ga0207680_10385937
2266 Ga0207680_11130535
2267 Ga0207647_10005536
2268 Ga0207685_10125551
2269 Ga0207645_10000920
2270 Ga0207645_10046411
2271 Ga0207645_10320703
2272 Ga0207643_10036267
2273 Ga0207705_10069787
2274 Ga0207705_10109588
2275 Ga0207705_10232984
2276 Ga0207705_10350379
2277 Ga0207684_11145948
2278 Ga0207654_10007676
2279 Ga0207654_10018791
2280 Ga0207654_10722096
2281 Ga0207707_10046933
2282 Ga0207707_10078348
2283 Ga0207707_10420269
2284 Ga0207695_10071320
2285 Ga0207695_10440951
2286 Ga0207695_10838035
2287 Ga0207671_10000965
2288 Ga0207671_10330504
2289 Ga0207660_10064310
2290 Ga0207660_10069191
2291 Ga0207662_10111795
2292 Ga0207662_10501719
2293 Ga0207662_10652659
2294 Ga0207657_10030117
2295 Ga0207657_10124366
2296 Ga0207657_10124836
2297 Ga0207649_10001633
2298 Ga0207649_10001967
2299 Ga0207649_10196919
2300 Ga0207649_10623630
2301 Ga0207649_10746658
2302 Ga0207649_10872416
2303 Ga0207649_11149431
2304 Ga0207652_10010146
2305 Ga0207652_10304548
2306 Ga0207681_10050405
2307 Ga0207681_10097741
2308 Ga0207681_10158627
2309 Ga0207681_10169106
2310 Ga0207681_10407281
2311 Ga0207650_10125219
2312 Ga0207650_10289002
2313 Ga0207650_10290916
2314 Ga0207650_10296689
2315 Ga0207650_10308011
2316 Ga0207650_11774036
2317 Ga0207659_10013948
2318 Ga0207659_10033422
2319 Ga0207659_10081595
2320 Ga0207659_10142609
2321 Ga0207659_10157302
2322 Ga0207659_10266662
2323 Ga0207659_11221243
2324 Ga0207687_10186070
2325 Ga0207644_10132991
2326 Ga0207644_10200414
2327 Ga0207644_10476686
2328 Ga0207644_10575175
2329 Ga0207644_10649308
2330 Ga0207644_11809436
2331 Ga0207690_10077899
2332 Ga0207690_10336867
2333 Ga0207690_11431134
2334 Ga0207706_10002817
2335 Ga0207706_10032029
2336 Ga0207706_10301950
2337 Ga0207706_10350292
2338 Ga0207686_10000668
2339 Ga0207686_10013149
2340 Ga0207686_10039781
2341 Ga0207686_10396132
2342 Ga0207686_10549188
2343 Ga0207686_11200474
2344 Ga0207709_11004077
2345 Ga0207670_10003085
2346 Ga0207670_10019316
2347 Ga0207670_10023002
2348 Ga0207670_10298847
2349 Ga0207669_10226556
2350 Ga0207669_10455882
2351 Ga0207669_11018441
2352 Ga0207704_10057834
2353 Ga0207704_10119076
2354 Ga0207704_10311952
2355 Ga0207704_10361327
2356 Ga0207704_10479088
2357 Ga0207704_10702655
2358 Ga0207704_10803854
2359 Ga0207691_10011397
2360 Ga0207691_10051341
2361 Ga0207691_10072810
2362 Ga0207691_10181325
2363 Ga0207691_10443603
2364 Ga0207691_10606945
2365 Ga0207689_10000380
2366 Ga0207689_10001907
2367 Ga0207689_10006453
2368 Ga0207689_10016965
2369 Ga0207689_10024943
2370 Ga0207689_10035716
2371 Ga0207689_10144686
2372 Ga0207689_10149971
2373 Ga0207689_10198149
2374 Ga0207689_10599711
2375 Ga0207689_11222915
2376 Ga0207689_11710260
2377 Ga0207661_10000183
2378 Ga0207661_10014178
2379 Ga0207661_10034081
2380 Ga0207661_10485509
2381 Ga0207661_10762815
2382 Ga0207679_10000308
2383 Ga0207679_10002211
2384 Ga0207679_10071588
2385 Ga0207679_10075877
2386 Ga0207679_10667486
2387 Ga0207679_11119982
2388 Ga0207667_10032226
2389 Ga0207667_10626676
2390 Ga0207667_10670734
2391 Ga0207667_10746546
2392 Ga0207667_10949716
2393 Ga0207667_11241413
2394 Ga0207651_10042406
2395 Ga0207651_10077065
2396 Ga0207651_10088586
2397 Ga0207651_10092389
2398 Ga0207651_10132861
2399 Ga0207651_10436500
2400 Ga0207651_10592206
2401 Ga0207651_10633236
2402 Ga0207712_10005082
2403 Ga0207712_10011763
2404 Ga0207712_10023854
2405 Ga0207712_10037862
2406 Ga0207712_10041820
2407 Ga0207712_10195793
2408 Ga0207668_10011523
2409 Ga0207640_10041907
2410 Ga0207640_10072082
2411 Ga0207640_10134118
2412 Ga0207640_10277372
2413 Ga0207640_10455830
2414 Ga0207640_11667235
2415 Ga0207658_10003708
2416 Ga0207658_10020081
2417 Ga0207658_10024233
2418 Ga0207658_10253953
2419 Ga0207658_10826341
2420 Ga0207658_10909420
2421 Ga0207658_11253087
2422 Ga0207677_10031330
2423 Ga0207677_10149174
2424 Ga0207677_10172688
2425 Ga0207677_10175441
2426 Ga0207677_10197959
2427 Ga0207677_10980906
2428 Ga0207703_10036407
2429 Ga0207703_10081972
2430 Ga0207703_10620295
2431 Ga0207639_10014657
2432 Ga0207639_10044603
2433 Ga0207639_10165750
2434 Ga0207639_10193084
2435 Ga0207639_10558305
2436 Ga0207639_10767550
2437 Ga0207639_11483709
2438 Ga0207678_10065717
2439 Ga0207678_10677955
2440 Ga0207708_10064969
2441 Ga0207708_10368180
2442 Ga0207708_10998639
2443 Ga0207702_10562196
2444 Ga0207702_10789513
2445 Ga0207702_11131392
2446 Ga0207641_10000184
2447 Ga0207641_10001379
2448 Ga0207641_10011200
2449 Ga0207641_10024994
2450 Ga0207641_10249866
2451 Ga0207641_10339822
2452 Ga0207641_10573489
2453 Ga0207641_11311963
2454 Ga0207641_11537856
2455 Ga0207648_10000860
2456 Ga0207648_10017610
2457 Ga0207648_10037487
2458 Ga0207648_10045474
2459 Ga0207648_10096147
2460 Ga0207648_10110047
2461 Ga0207648_10245323
2462 Ga0207648_10255402
2463 Ga0207648_10842831
2464 Ga0207648_11095681
2465 Ga0207676_10001951
2466 Ga0207676_10015458
2467 Ga0207676_10022928
2468 Ga0207676_10080505
2469 Ga0207676_10115148
2470 Ga0207676_10124811
2471 Ga0207676_10138994
2472 Ga0207676_10240499
2473 Ga0207676_10498046
2474 Ga0207676_12008519
2475 Ga0207674_10040364
2476 Ga0207674_10438952
2477 Ga0207674_10461806
2478 Ga0207674_10677807
2479 Ga0207674_10826144
2480 Ga0207674_10837534
2481 Ga0207674_11900206
2482 Ga0207675_100008623
2483 Ga0207675_100046352
2484 Ga0207675_100165080
2485 Ga0207675_100192685
2486 Ga0207675_100198755
2487 Ga0207675_100234637
2488 Ga0207675_100358061
2489 Ga0207675_100380016
2490 Ga0207675_100450760
2491 Ga0207675_100540226
2492 Ga0207683_10002839
2493 Ga0207683_10119924
2494 Ga0207683_10303018
2495 Ga0207683_10434463
2496 Ga0207683_10461829
2497 Ga0207683_10685936
2498 Ga0207683_11488896
2499 Ga0207683_11507889
2500 Ga0207698_10058187
2501 Ga0207698_10069458
2502 Ga0207698_10285070
2503 Ga0207698_10645038
2504 Ga0207698_10775104
2505 Ga0207698_11916651
2506 Ga0209981_1066372
2507 Ga0209968_1055835
2508 Ga0209971_1100774
2509 Ga0268266_10029288
2510 Ga0268266_10240746
2511 Ga0268266_10269250
2512 Ga0268266_10990619
2513 Ga0268266_11490070
2514 Ga0268266_11811590
2515 Ga0268265_10218713
2516 Ga0268265_10258091
2517 Ga0268265_10947400
2518 Ga0268265_10986228
2519 Ga0268265_12149664
2520 Ga0268264_10012233
2521 Ga0268264_10017697
2522 Ga0268264_10186287
2523 Ga0268264_10547591
2524 Ga0268264_10884539
2525 Ga0268264_10930117
2526 Ga0268264_10965040
2527 Ga0307515_10000455
2528 Ga0307511_10328808
2529 Ga0307509_10098473
2530 Ga0307509_10162480
2531 Ga0307408_100278443
2532 Ga0307508_10227058
2533 Ga0307516_10694501
2534 Ga0307405_11177813
2535 Ga0307413_10034923
2536 Ga0307413_10579210
2537 Ga0307410_12026717
2538 Ga0307407_10039492
2539 Ga0307412_11172441
2540 Ga0307412_11510993
2541 Ga0307409_102610784
2542 Ga0307416_100330608
2543 Ga0307416_100902127
2544 Ga0307416_102345531
2545 Ga0307414_10317882
2546 Ga0307414_11342735
2547 Ga0307414_11959103
2548 Ga0307411_10261087
2549 Ga0307411_10316235
2550 Ga0307415_100142800
2551 Ga0307415_100538822
2552 Ga0373934_0104556
2553 Ga0373944_0066866
2554 Ga0373944_0445613
2555 Ga0373953_0114597
2556 Ga0373943_0076049
2557 Ga0373943_0305686
2558 Ga0373943_0651243
2559 Ga0373946_0219715
2560 Ga0373955_0071227
2561 Ga0373924_0162034
2562 Ga0373931_0498748
2563 Ga0373931_1140980
2564 Ga0373935_0322514
2565 Ga0373933_0015285
2566 Ga0373947_0036116
2567 Ga0373947_0156700
2568 Ga0373937_0002667
2569 Ga0373937_0377229
2570 Ga0373925_0685544
2571 Ga0395899_0184714
2572 Ga0395900_0470851
2573 Ga0395900_0747476
2574 Ga0395900_1488485
2575 Ga0395898_0285479
2576 Ga0395898_0344623
2577 Ga0395905_0034017
2578 Ga0436365_0149163
2579 Ga0436365_0613268
2580 Ga0439436_0020593
2581 Ga0439439_0003200
2582 Ga0439466_0051681
2583 Ga0451798_0524149
2584 Ga0451807_1862478
2585 Ga0451807_2252505
2586 Ga0451839_0915601
2587 Ga0451851_0544741
2588 Ga0451853_3011882
2589 Ga0439431_0005153
2590 Ga0439431_0044376
2591 Ga0439433_0034434
2592 Ga0439433_0069896
2593 Ga0439441_040452
2594 Ga0439442_003302
2595 Ga0439454_056956
2596 Ga0439457_057968
2597 Ga0439457_161289
2598 Ga0450890_057777
2599 Ga0450894_065197
2600 Ga0450898_002496
2601 Ga0450899_001155
2602 Ga0439434_0174820
2603 Ga0450893_0020902
2604 Ga0466969_0002175
2605 Ga0466972_0172860
2606 Ga0466972_0311439
2607 Ga0466965_0465645
2608 Ga0466966_0000372
2609 Ga0466961_0619196
2610 Ga0453684_1359317
2611 Ga0466968_0175887
2612 Ga0466968_0293421
2613 Ga0466970_0573469
2614 Ga0466960_0332200
2615 Ga0466959_0000076
2616 Ga0466959_0030670
2617 Ga0451576_0317661
2618 Ga0466967_0069119
2619 Ga0495627_011163
2620 Ga0495592_0241459
2621 Ga0495638_0157372
2622 Ga0495651_0344036
2623 Ga0495650_0284301
2624 Ga0495664_0693636
2625 Ga0495594_0416782
2626 Ga0495608_0029638
2627 Ga0495618_0160524
2628 Ga0495628_0019670
2629 Ga0495630_0008167
2630 Ga0495652_0706674
2631 Ga0495640_0105481
2632 Ga0495586_0011108
2633 Ga0495598_0229815
2634 Ga0495598_0342498
2635 Ga0495621_0031236
2636 Ga0495645_0128336
2637 Ga0495633_0000153
2638 Ga0495634_0016445
2639 Ga0495625_0394614
2640 Ga0495635_0114621
2641 Ga0495635_0388559
2642 Ga0495657_0072803
2643 Ga0495599_0071095
2644 Ga0495669_0636243
2645 Ga0495649_0297039
2646 Ga0495604_0340073
2647 Ga0495604_0552022
2648 Ga0495674_0333335
2649 Ga0495674_0814247
2650 Ga0495672_0033415
2651 Ga0495676_0111372
2652 Ga0495676_0615514
2653 Ga0495680_0250799
2654 Ga0495684_0467500
2655 Ga0495686_0007526
2656 Ga0495686_0243458
2657 Ga0496100_0514053
2658 Ga0496105_0564132
2659 Ga0496108_0687936
2660 Ga0496110_0030109
2661 Ga0496110_0336023
2662 Ga0496113_0663356
2663 Ga0501292_041869
2664 Ga0501298_015416
2665 Ga0501031_0024317
2666 Ga0501032_0003013
2667 Ga0501032_0149135
2668 Ga0501032_0160366
2669 Ga0501032_0235536
2670 Ga0501032_0307288
2671 Ga0501033_0168839
2672 Ga0501033_0171491
2673 Ga0501033_0622476
2674 Ga0501034_0004054
2675 Ga0501034_0055740
2676 Ga0501034_0186464
2677 Ga0501034_0259589
2678 Ga0501034_0314242
2679 Ga0501036_0005975
2680 Ga0501036_0023640
2681 Ga0501036_0483018
2682 Ga0501036_1458061
2683 Ga0501037_0008358
2684 Ga0501037_0019627
2685 Ga0501037_0129634
2686 Ga0501037_0247461
2687 Ga0501037_0705897
2688 Ga0501038_0008230
2689 Ga0501038_0012975
2690 Ga0501038_0015492
2691 Ga0501038_0767055
2692 Ga0501039_0004070
2693 Ga0501039_0110954
2694 Ga0501040_0377297
2695 Ga0501043_0010180
2696 Ga0501043_0042578
2697 Ga0501043_0078691
2698 Ga0501043_0374849
2699 Ga0501043_0465266
2700 Ga0501043_0569927
2701 Ga0501046_0021865
2702 Ga0501046_0041982
2703 Ga0501047_0002595
2704 Ga0501047_0071282
2705 Ga0501048_0060298
2706 Ga0501067_0019924
2707 Ga0501068_0101820
2708 Ga0501069_0701545
2709 Ga0501070_0018561
2710 Ga0501070_0029610
2711 Ga0501073_0001021
2712 Ga0501073_0005193
2713 Ga0501074_0000870
2714 Ga0501074_0413113
2715 Ga0501202_005335
2716 Ga0501207_007692
2717 Ga0501207_011460
2718 Ga0501207_037991
2719 Ga0501214_089510
2720 Ga0501223_106046
2721 Ga0501227_023200
2722 Ga0501230_040675
2723 Ga0501235_126253
2724 Ga0501243_007566
2725 Ga0501250_000832
2726 Ga0501257_005190
2727 Ga0501257_011337
2728 Ga0501259_000638
2729 Ga0501221_048979
2730 Ga0501225_0066659
2731 Ga0501234_008433
2732 Ga0501079_0038835
2733 Ga0501079_0999593
2734 Ga0501080_0036451
2735 Ga0501080_0043692
2736 Ga0501080_0240935
2737 Ga0501080_0561930
2738 Ga0501080_0811575
2739 Ga0501080_0999646
2740 Ga0501083_0007806
2741 Ga0501083_0008173
2742 Ga0501083_0095690
2743 Ga0501083_0617478
2744 Ga0501263_031172
2745 Ga0501266_001664
2746 Ga0501268_098666
2747 Ga0501274_015326
2748 Ga0501275_028240
2749 Ga0501280_053627
2750 Ga0501035_0005968
2751 Ga0501035_0094735
2752 Ga0501035_0224160
2753 Ga0501035_0227358
2754 Ga0501044_0146125
2755 Ga0501044_0157297
2756 Ga0501044_0177558
2757 Ga0501044_0227564
2758 Ga0501044_0423672
2759 Ga0501044_0684884
2760 Ga0501044_1107486
2761 nmdc:mga0k408_22327_c1
2762 nmdc:mga0k408_236753_c1
2763 nmdc:mga06z11_485122_c1
2764 nmdc:mga07m45_234658_c1
2765 nmdc:mga07m45_336562_c1
2766 nmdc:mga05p37_217712_c1
2767 nmdc:mga05p37_313746_c1
2768 nmdc:mga05p37_7918_c1
2769 nmdc:mga09592_20923_c1
2770 nmdc:mga0qj67_17746_c1
2771 nmdc:mga0qj67_35454_c1
2772 nmdc:mga06r32_157804_c1
2773 nmdc:mga06r32_519977_c1
2774 nmdc:mga08y16_257358_c1
2775 nmdc:mga08y16_833950_c1
2776 nmdc:mga08y16_872131_c1
2777 nmdc:mga0n895_553712_c1
2778 Ga0500644_0002231
2779 Ga0500646_0022071
2780 Ga0500583_0055335
2781 Ga0500651_0173882
2782 Ga0500650_0430547
2783 Ga0500660_151764
2784 Ga0500569_000051
2785 Ga0500607_014523
2786 Ga0500652_002100
2787 Ga0500658_0006891
2788 Ga0500559_0020442
2789 Ga0500577_0006371
2790 Ga0500590_047126
2791 Ga0500604_0008066
2792 Ga0500616_0022833
2793 Ga0500622_0000673
2794 Ga0500622_0106563
2795 Ga0500633_0013450
2796 Ga0500633_0385861
2797 Ga0500636_0011566
2798 Ga0500645_065201
2799 Ga0500645_076482
2800 Ga0501084_0480161
2801 Ga0501084_0602857
2802 Ga0500661_029755
2803 Ga0501082_0015583
2804 2884796196
2805 2929240596
2806 2929922444
2807 8003153868

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00166

Cpn10

Chaperonin 10 Kd subunit

34

141

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nx6-assembly1.cif.gz_A crystal structure of co-chaperonin, groes (xoo4289) from xanthomonas oryzae pv. oryzae kacc10331 0.9277 12 117
1wnr-assembly1.cif.gz_E crystal structure of the cpn10 from thermus thermophilus hb8 0.9151 12 119
1wnr-assembly1.cif.gz_E crystal structure of the cpn10 from thermus thermophilus hb8 0.8922 12 119
3nx6-assembly1.cif.gz_A crystal structure of co-chaperonin, groes (xoo4289) from xanthomonas oryzae pv. oryzae kacc10331 0.8807 12 117
1lep-assembly1.cif.gz_G three-dimensional structure of the immunodominant heat-shock protein chaperonin-10 of mycobacterium leprae 0.8368 11 120
ID Description Score Start End Superfamily
3nx6A00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.9277 12 117 2.30.33.40
1wnrD00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.9152 12 119 2.30.33.40
1wnrD00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.8922 12 119 2.30.33.40
3nx6A00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.8807 12 117 2.30.33.40
1hx5A00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.7689 12 118 2.30.33.40
ID Description Score Start End GO Terms
AF-A0A285QKV6-F1-model_v4 10 kDa chaperonin 0.8588 11 120 GO:0005524
GO:0044183
AF-X6K773-F1-model_v4 10 kDa chaperonin 0.8419 43 119 GO:0005524
GO:0044183
GO:0046872
GO:0051082
GO:0051085
GO:0051087
AF-A0A4Q3SIF6-F1-model_v4 Co-chaperone GroES 0.8389 50 123 GO:0006457
AF-A0A285QKV6-F1-model_v4 10 kDa chaperonin 0.8306 11 120 GO:0005524
GO:0044183
AF-X6K773-F1-model_v4 10 kDa chaperonin 0.8306 43 119 GO:0005524
GO:0044183
GO:0046872
GO:0051082
GO:0051085
GO:0051087

Map