F493675

General Info

Members Datasets Scaffolds Average Seq Length
1400 410 2800 113

Family's Representative Sequence

Representative Sequence 3300053080|Ga0500635_0320462|Ga0500635_0320462_99_521
Length 140
Sequence MSTCPDAGRRAAAEPSSGRSTVAGYRARMKLVTAIIKPHQLDRVKDALKQAGLHGMTVDEVKGFGRQGGHTETYRGAEYVVDLLPKVKVETVVPDELADQVADIIVNAARTGNIGDGKVWISSIDKVIRIRTGELDGDAV

Samples

Sample ID Description Type Environment
1 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
113 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
114 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
115 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
116 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
211 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
218 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
219 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
220 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
221 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
222 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
223 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
224 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
225 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
226 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
227 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
228 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
229 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
230 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
231 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
232 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
235 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
236 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
237 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
238 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
239 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
242 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
243 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
244 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
245 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
246 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
247 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
248 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
249 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
250 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
251 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
252 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
253 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
254 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
255 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
256 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
257 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
258 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
259 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
260 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
261 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
262 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
263 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
264 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
265 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
266 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
267 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
268 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
269 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
270 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
271 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
272 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
273 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
274 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
275 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
276 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
277 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
278 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
279 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
280 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
281 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
282 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
283 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
284 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
285 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
286 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
287 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
288 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
289 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
290 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
291 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
292 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
293 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
294 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
295 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
296 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
297 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
298 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
299 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
300 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
301 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
302 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
303 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
304 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
305 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
306 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
307 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
308 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
309 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
310 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
311 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
312 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
313 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
314 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
315 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
316 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
317 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
318 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
319 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
320 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
321 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
322 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
323 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
324 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
325 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
326 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
327 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
328 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
329 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
330 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
331 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
332 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
333 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
334 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
335 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
336 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
337 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
338 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
339 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
356 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
357 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
358 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
359 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
360 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
361 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
362 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
363 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
364 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
365 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
366 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
367 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
368 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
369 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
372 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
373 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
374 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
375 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
376 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
377 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
378 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
379 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
380 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
381 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
382 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
383 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
384 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
385 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
386 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
387 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
388 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
389 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
390 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
391 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
392 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
393 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
410 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.79
Metatranscriptomes 2.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.14
Nodule 0.07
Rhizoplane 6.43
Rhizosphere 81.64
Stem 0
Stem Tuber 0
Unclassified 3.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500635_0320462 3300053080 Bacteria 612
2 JGI24736J21556_1020459 3300001904 Bacteria 1040
3 JGI25151J46595_10020691 3300003187 Bacteria 2769
4 JGI25153J46596_10142022 3300003215 Bacteria 523
5 Ga0007409J51694_1091639 3300003575 Bacteria 740
6 Ga0055524_1013072 3300003775 Bacteria 3152
7 Ga0055524_1016559 3300003775 Bacteria 2638
8 Ga0055536_1001953 3300003781 Bacteria 11878
9 Ga0055536_1021661 3300003781 Bacteria 1942
10 Ga0055536_1022461 3300003781 Bacteria 1882
11 Ga0055534_1008037 3300003784 Bacteria 2435
12 Ga0055534_1014588 3300003784 Bacteria 1466
13 Ga0055530_10000578 3300003791 Bacteria 31757
14 Ga0055540_1059529 3300003792 Bacteria 766
15 Ga0055531_10005972 3300003794 Bacteria 6996
16 Ga0055531_10076138 3300003794 Bacteria 755
17 Ga0055531_10083302 3300003794 Bacteria 698
18 Ga0058860_11886216 3300004801 Bacteria 513
19 Ga0070658_10230542 3300005327 Bacteria 1568
20 Ga0070658_10271818 3300005327 Bacteria 1441
21 Ga0070658_10320468 3300005327 Bacteria 1324
22 Ga0070676_10035996 3300005328 Bacteria 2850
23 Ga0070683_100009342 3300005329 Bacteria 8380
24 Ga0070683_100164501 3300005329 Bacteria 2105
25 Ga0070683_100193432 3300005329 Bacteria 1932
26 Ga0070683_100702525 3300005329 Bacteria 968
27 Ga0070683_100841158 3300005329 Bacteria 880
28 Ga0070683_101019396 3300005329 Bacteria 795
29 Ga0070690_100152737 3300005330 Bacteria 1577
30 Ga0070690_100561832 3300005330 Bacteria 862
31 Ga0070670_100008384 3300005331 Bacteria 8810
32 Ga0070670_100020647 3300005331 Bacteria 5666
33 Ga0070670_100301931 3300005331 Bacteria 1401
34 Ga0070670_100879245 3300005331 Bacteria 812
35 Ga0070677_10585781 3300005333 Bacteria 616
36 Ga0068869_100082842 3300005334 Bacteria 2398
37 Ga0068869_100089544 3300005334 Bacteria 2311
38 Ga0068869_101175118 3300005334 Bacteria 673
39 Ga0068869_101456232 3300005334 Bacteria 607
40 Ga0070666_10001853 3300005335 Bacteria 12883
41 Ga0070666_10001858 3300005335 Bacteria 12867
42 Ga0070666_10104933 3300005335 Bacteria 1951
43 Ga0070666_10106699 3300005335 Bacteria 1935
44 Ga0070666_10152584 3300005335 Bacteria 1612
45 Ga0070666_10313345 3300005335 Bacteria 1118
46 Ga0070666_11518868 3300005335 Bacteria 501
47 Ga0070680_100168007 3300005336 Bacteria 1845
48 Ga0070680_100783916 3300005336 Bacteria 821
49 Ga0070680_101370827 3300005336 Bacteria 612
50 Ga0070682_100702611 3300005337 Bacteria 811
51 Ga0068868_100002892 3300005338 Bacteria 11916
52 Ga0068868_100023407 3300005338 Bacteria 4675
53 Ga0068868_100052388 3300005338 Bacteria 3213
54 Ga0068868_100073533 3300005338 Bacteria 2730
55 Ga0068868_100245090 3300005338 Bacteria 1507
56 Ga0068868_100917469 3300005338 Bacteria 797
57 Ga0070660_100309699 3300005339 Bacteria 1295
58 Ga0070660_100526478 3300005339 Bacteria 985
59 Ga0070689_100062330 3300005340 Bacteria 2901
60 Ga0070689_100118587 3300005340 Bacteria 2112
61 Ga0070691_10437858 3300005341 Bacteria 744
62 Ga0070661_100317167 3300005344 Bacteria 1217
63 Ga0070661_100744294 3300005344 Bacteria 801
64 Ga0070661_100797306 3300005344 Bacteria 775
65 Ga0070661_101488612 3300005344 Bacteria 571
66 Ga0070692_11101637 3300005345 Bacteria 561
67 Ga0070668_100061913 3300005347 Bacteria 2899
68 Ga0070668_100123105 3300005347 Bacteria 2075
69 Ga0070668_100158266 3300005347 Bacteria 1836
70 Ga0070668_100470118 3300005347 Bacteria 1084
71 Ga0070668_101156304 3300005347 Bacteria 700
72 Ga0070675_100131501 3300005354 Bacteria 2133
73 Ga0070675_100580587 3300005354 Unclassified 1016
74 Ga0070675_102075178 3300005354 Bacteria 524
75 Ga0070671_100216956 3300005355 Bacteria 1623
76 Ga0070671_100478445 3300005355 Bacteria 1070
77 Ga0070671_100555740 3300005355 Unclassified 990
78 Ga0070671_100594802 3300005355 Bacteria 956
79 Ga0070671_100623307 3300005355 Bacteria 933
80 Ga0070671_100651630 3300005355 Bacteria 912
81 Ga0070671_100794062 3300005355 Bacteria 824
82 Ga0070671_101128638 3300005355 Bacteria 689
83 Ga0070674_100055299 3300005356 Bacteria 2748
84 Ga0070674_100096952 3300005356 Bacteria 2141
85 Ga0070674_100242595 3300005356 Bacteria 1411
86 Ga0070674_101047912 3300005356 Bacteria 718
87 Ga0070674_101842572 3300005356 Bacteria 549
88 Ga0070673_100200402 3300005364 Bacteria 1719
89 Ga0070673_100229682 3300005364 Bacteria 1609
90 Ga0070673_100243952 3300005364 Bacteria 1563
91 Ga0070688_100035680 3300005365 Bacteria 3021
92 Ga0070659_100070335 3300005366 Bacteria 2780
93 Ga0070659_100396649 3300005366 Unclassified 1164
94 Ga0070667_100012108 3300005367 Bacteria 7140
95 Ga0070667_100050487 3300005367 Bacteria 3506
96 Ga0070667_100168848 3300005367 Bacteria 1930
97 Ga0070667_100239742 3300005367 Bacteria 1619
98 Ga0070667_100601514 3300005367 Bacteria 1013
99 Ga0070667_101972865 3300005367 Bacteria 550
100 Ga0070709_10040805 3300005434 Bacteria 2856
101 Ga0070709_10190549 3300005434 Bacteria 1446
102 Ga0070709_10250424 3300005434 Bacteria 1276
103 Ga0070714_100222825 3300005435 Bacteria 1734
104 Ga0070713_100398392 3300005436 Bacteria 1285
105 Ga0070713_101274783 3300005436 Bacteria 712
106 Ga0070710_11204827 3300005437 Bacteria 560
107 Ga0070701_11217311 3300005438 Bacteria 535
108 Ga0070711_100502744 3300005439 Bacteria 1000
109 Ga0070711_100646771 3300005439 Bacteria 886
110 Ga0070705_100606260 3300005440 Bacteria 848
111 Ga0070700_100090819 3300005441 Bacteria 1992
112 Ga0070700_100356404 3300005441 Bacteria 1086
113 Ga0070700_101307374 3300005441 Bacteria 609
114 Ga0070700_101810937 3300005441 Bacteria 526
115 Ga0070694_100356639 3300005444 Bacteria 1134
116 Ga0070694_100888618 3300005444 Bacteria 735
117 Ga0070708_100790466 3300005445 Bacteria 892
118 Ga0070663_100006966 3300005455 Bacteria 6844
119 Ga0070663_100431874 3300005455 Bacteria 1082
120 Ga0070663_100600003 3300005455 Bacteria 926
121 Ga0070663_100839526 3300005455 Bacteria 790
122 Ga0070663_101834212 3300005455 Bacteria 544
123 Ga0070678_100184141 3300005456 Bacteria 1712
124 Ga0070678_100185081 3300005456 Bacteria 1708
125 Ga0070678_100251181 3300005456 Bacteria 1483
126 Ga0070678_100264027 3300005456 Bacteria 1449
127 Ga0070678_100837154 3300005456 Bacteria 837
128 Ga0070662_100089159 3300005457 Unclassified 2313
129 Ga0070662_100191719 3300005457 Bacteria 1617
130 Ga0070662_100235573 3300005457 Bacteria 1466
131 Ga0070662_100598881 3300005457 Bacteria 927
132 Ga0070662_101272128 3300005457 Bacteria 633
133 Ga0070662_101306613 3300005457 Unclassified 624
134 Ga0070681_10032389 3300005458 Bacteria 5246
135 Ga0070681_10434936 3300005458 Bacteria 1224
136 Ga0070681_10844164 3300005458 Bacteria 834
137 Ga0068867_100009183 3300005459 Bacteria 6980
138 Ga0068867_100025867 3300005459 Bacteria 4210
139 Ga0068867_100084237 3300005459 Bacteria 2401
140 Ga0068867_100376064 3300005459 Bacteria 1192
141 Ga0068867_102387584 3300005459 Bacteria 503
142 Ga0070685_10000451 3300005466 Bacteria 23864
143 Ga0070685_10513131 3300005466 Bacteria 850
144 Ga0070685_11574634 3300005466 Bacteria 508
145 Ga0070698_101333024 3300005471 Bacteria 668
146 Ga0070679_100097653 3300005530 Bacteria 2925
147 Ga0070679_100466649 3300005530 Bacteria 1207
148 Ga0070679_100682259 3300005530 Bacteria 970
149 Ga0070679_101148126 3300005530 Bacteria 722
150 Ga0070684_100116954 3300005535 Bacteria 2395
151 Ga0070684_100175239 3300005535 Bacteria 1949
152 Ga0070684_100559071 3300005535 Bacteria 1062
153 Ga0070684_100756026 3300005535 Bacteria 907
154 Ga0070684_101091014 3300005535 Bacteria 750
155 Ga0070684_101526321 3300005535 Bacteria 630
156 Ga0068853_100071363 3300005539 Bacteria 3024
157 Ga0068853_100100623 3300005539 Bacteria 2555
158 Ga0068853_100136744 3300005539 Bacteria 2197
159 Ga0068853_100371171 3300005539 Bacteria 1335
160 Ga0068853_100411923 3300005539 Bacteria 1266
161 Ga0068853_100464408 3300005539 Bacteria 1192
162 Ga0068853_100562116 3300005539 Bacteria 1081
163 Ga0068853_100624342 3300005539 Bacteria 1024
164 Ga0068853_100734184 3300005539 Bacteria 943
165 Ga0068853_101527667 3300005539 Bacteria 647
166 Ga0070672_100001795 3300005543 Bacteria 13422
167 Ga0070672_100146908 3300005543 Bacteria 1948
168 Ga0070672_100191976 3300005543 Bacteria 1705
169 Ga0070672_100683935 3300005543 Bacteria 898
170 Ga0070686_100011927 3300005544 Bacteria 4941
171 Ga0070686_100048036 3300005544 Bacteria 2702
172 Ga0070686_100525036 3300005544 Bacteria 922
173 Ga0070686_100596289 3300005544 Bacteria 870
174 Ga0070693_100100982 3300005547 Bacteria 1757
175 Ga0070693_100121565 3300005547 Bacteria 1620
176 Ga0070693_100357862 3300005547 Bacteria 1001
177 Ga0070693_100536104 3300005547 Bacteria 836
178 Ga0070693_100542601 3300005547 Bacteria 831
179 Ga0070665_100004571 3300005548 Bacteria 14495
180 Ga0070665_100103330 3300005548 Bacteria 2853
181 Ga0070665_100223338 3300005548 Bacteria 1884
182 Ga0070665_100685398 3300005548 Bacteria 1038
183 Ga0070665_101429234 3300005548 Bacteria 701
184 Ga0070704_101360420 3300005549 Bacteria 651
185 Ga0068855_100000432 3300005563 Bacteria 51912
186 Ga0068855_100002034 3300005563 Bacteria 25069
187 Ga0068855_100132552 3300005563 Bacteria 2845
188 Ga0068855_100238567 3300005563 Bacteria 2032
189 Ga0068855_100672786 3300005563 Bacteria 1110
190 Ga0068855_100777737 3300005563 Bacteria 1019
191 Ga0068855_100823119 3300005563 Bacteria 985
192 Ga0068855_102299715 3300005563 Bacteria 539
193 Ga0068855_102359364 3300005563 Bacteria 531
194 Ga0070664_100000726 3300005564 Bacteria 25332
195 Ga0070664_100114705 3300005564 Bacteria 2354
196 Ga0070664_100403208 3300005564 Bacteria 1251
197 Ga0070664_100463468 3300005564 Bacteria 1164
198 Ga0070664_100567162 3300005564 Bacteria 1051
199 Ga0068857_100000096 3300005577 Bacteria 51376
200 Ga0068857_100047219 3300005577 Bacteria 3822
201 Ga0068857_100060204 3300005577 Bacteria 3373
202 Ga0068857_100133139 3300005577 Bacteria 2243
203 Ga0068857_100386761 3300005577 Bacteria 1300
204 Ga0068857_100407995 3300005577 Archaea 1265
205 Ga0068857_100698433 3300005577 Bacteria 964
206 Ga0068857_102017329 3300005577 Bacteria 566
207 Ga0068854_100000554 3300005578 Bacteria 22552
208 Ga0068854_100024664 3300005578 Bacteria 4120
209 Ga0068854_100045641 3300005578 Bacteria 3117
210 Ga0068854_100223761 3300005578 Bacteria 1490
211 Ga0068854_100464268 3300005578 Bacteria 1060
212 Ga0068854_101042823 3300005578 Bacteria 726
213 Ga0068856_100000179 3300005614 Bacteria 66149
214 Ga0068856_100002175 3300005614 Bacteria 20318
215 Ga0068856_100193004 3300005614 Bacteria 2050
216 Ga0068856_100386850 3300005614 Bacteria 1418
217 Ga0068856_100539649 3300005614 Bacteria 1187
218 Ga0070702_100024290 3300005615 Bacteria 3232
219 Ga0070702_100055642 3300005615 Bacteria 2282
220 Ga0070702_100122007 3300005615 Bacteria 1633
221 Ga0070702_100167315 3300005615 Bacteria 1427
222 Ga0070702_100520411 3300005615 Unclassified 877
223 Ga0068852_100010460 3300005616 Bacteria 6937
224 Ga0068852_100035832 3300005616 Bacteria 4144
225 Ga0068852_100209869 3300005616 Bacteria 1847
226 Ga0068852_100400190 3300005616 Bacteria 1350
227 Ga0068852_100627068 3300005616 Bacteria 1081
228 Ga0068859_100010599 3300005617 Bacteria 9278
229 Ga0068859_100136484 3300005617 Bacteria 2526
230 Ga0068859_100237623 3300005617 Bacteria 1911
231 Ga0068859_101049795 3300005617 Bacteria 896
232 Ga0068859_101855626 3300005617 Bacteria 666
233 Ga0068864_100000129 3300005618 Bacteria 73206
234 Ga0068864_100011149 3300005618 Bacteria 7430
235 Ga0068864_100227870 3300005618 Bacteria 1722
236 Ga0068864_100602769 3300005618 Bacteria 1066
237 Ga0068864_101270974 3300005618 Unclassified 736
238 Ga0068866_10007138 3300005718 Bacteria 4671
239 Ga0068866_10010050 3300005718 Unclassified 4045
240 Ga0068866_10064147 3300005718 Bacteria 1917
241 Ga0068866_10343585 3300005718 Bacteria 946
242 Ga0068861_100038831 3300005719 Unclassified 3550
243 Ga0068861_100039875 3300005719 Bacteria 3508
244 Ga0068861_100153483 3300005719 Bacteria 1892
245 Ga0068861_100244554 3300005719 Bacteria 1528
246 Ga0068861_100647643 3300005719 Bacteria 976
247 Ga0068851_10003554 3300005834 Bacteria 6940
248 Ga0068870_10045752 3300005840 Bacteria 2293
249 Ga0068870_10089992 3300005840 Bacteria 1714
250 Ga0068870_10448127 3300005840 Bacteria 850
251 Ga0068863_100005116 3300005841 Bacteria 12931
252 Ga0068863_100026366 3300005841 Bacteria 5545
253 Ga0068863_100090500 3300005841 Bacteria 2901
254 Ga0068863_100170884 3300005841 Bacteria 2085
255 Ga0068863_100183012 3300005841 Bacteria 2011
256 Ga0068863_100243488 3300005841 Bacteria 1736
257 Ga0068863_100423207 3300005841 Bacteria 1305
258 Ga0068863_100458082 3300005841 Unclassified 1252
259 Ga0068863_100595675 3300005841 Bacteria 1094
260 Ga0068863_100870858 3300005841 Bacteria 900
261 Ga0068863_101287007 3300005841 Bacteria 738
262 Ga0068858_100025071 3300005842 Bacteria 5550
263 Ga0068858_100030716 3300005842 Unclassified 4989
264 Ga0068858_100124922 3300005842 Bacteria 2408
265 Ga0068858_100213797 3300005842 Bacteria 1825
266 Ga0068858_100255257 3300005842 Bacteria 1666
267 Ga0068858_100627282 3300005842 Bacteria 1044
268 Ga0068858_100635556 3300005842 Bacteria 1037
269 Ga0068858_100725982 3300005842 Bacteria 967
270 Ga0068858_100744839 3300005842 Bacteria 954
271 Ga0068858_100828650 3300005842 Bacteria 903
272 Ga0068858_102369603 3300005842 Bacteria 524
273 Ga0068860_100004438 3300005843 Bacteria 14325
274 Ga0068860_100027327 3300005843 Bacteria 5497
275 Ga0068860_100091037 3300005843 Bacteria 2906
276 Ga0068860_100365661 3300005843 Bacteria 1422
277 Ga0068860_100510384 3300005843 Bacteria 1201
278 Ga0068860_100603674 3300005843 Bacteria 1103
279 Ga0068860_102397800 3300005843 Bacteria 548
280 Ga0068862_101456482 3300005844 Bacteria 689
281 Ga0068862_101952538 3300005844 Bacteria 597
282 Ga0081455_10799957 3300005937 Bacteria 592
283 Ga0081540_1001046 3300005983 Bacteria 24692
284 Ga0081540_1117627 3300005983 Bacteria 1110
285 Ga0075365_10009641 3300006038 Bacteria 5571
286 Ga0075365_10021278 3300006038 Bacteria 4043
287 Ga0075365_10042348 3300006038 Bacteria 2977
288 Ga0075365_10066208 3300006038 Bacteria 2423
289 Ga0075365_10081217 3300006038 Bacteria 2196
290 Ga0075365_10171080 3300006038 Bacteria 1516
291 Ga0075365_10195685 3300006038 Bacteria 1415
292 Ga0075365_10209985 3300006038 Bacteria 1365
293 Ga0075365_10229439 3300006038 Bacteria 1303
294 Ga0075365_10239001 3300006038 Bacteria 1276
295 Ga0075365_10271012 3300006038 Bacteria 1194
296 Ga0075365_10273148 3300006038 Bacteria 1189
297 Ga0075365_11035369 3300006038 Bacteria 578
298 Ga0075368_10018412 3300006042 Bacteria 2624
299 Ga0075368_10274749 3300006042 Bacteria 723
300 Ga0075368_10329156 3300006042 Bacteria 663
301 Ga0075368_10342364 3300006042 Bacteria 650
302 Ga0075368_10398090 3300006042 Bacteria 604
303 Ga0075363_100024237 3300006048 Bacteria 3083
304 Ga0075363_100071908 3300006048 Bacteria 1881
305 Ga0075363_100347545 3300006048 Bacteria 866
306 Ga0075364_10001125 3300006051 Bacteria 14277
307 Ga0075364_10018799 3300006051 Bacteria 4332
308 Ga0075364_10086675 3300006051 Bacteria 2075
309 Ga0075364_10181730 3300006051 Bacteria 1423
310 Ga0075364_10387297 3300006051 Bacteria 954
311 Ga0075364_10402584 3300006051 Bacteria 934
312 Ga0075364_10493870 3300006051 Bacteria 837
313 Ga0075364_11249850 3300006051 Bacteria 503
314 Ga0070715_10154698 3300006163 Bacteria 1127
315 Ga0070712_100264735 3300006175 Bacteria 1379
316 Ga0075367_10017493 3300006178 Bacteria 3935
317 Ga0075367_10032975 3300006178 Bacteria 2983
318 Ga0075367_10067400 3300006178 Bacteria 2146
319 Ga0075367_10088617 3300006178 Bacteria 1881
320 Ga0075367_10210472 3300006178 Bacteria 1216
321 Ga0075367_10243957 3300006178 Bacteria 1126
322 Ga0075367_10515075 3300006178 Bacteria 759
323 Ga0075367_10697495 3300006178 Bacteria 646
324 Ga0075366_10711803 3300006195 Bacteria 623
325 Ga0097621_100000196 3300006237 Bacteria 39296
326 Ga0097621_100002114 3300006237 Bacteria 13601
327 Ga0097621_100019556 3300006237 Bacteria 5200
328 Ga0097621_100159978 3300006237 Bacteria 1935
329 Ga0097621_100288304 3300006237 Bacteria 1447
330 Ga0097621_100385197 3300006237 Bacteria 1253
331 Ga0097621_100407750 3300006237 Unclassified 1218
332 Ga0075370_10623732 3300006353 Bacteria 654
333 Ga0068871_100000049 3300006358 Bacteria 65954
334 Ga0068871_100027217 3300006358 Unclassified 4469
335 Ga0068871_100047305 3300006358 Bacteria 3469
336 Ga0068871_100071763 3300006358 Bacteria 2849
337 Ga0068871_100133563 3300006358 Bacteria 2106
338 Ga0068871_100138395 3300006358 Bacteria 2069
339 Ga0068871_100227044 3300006358 Bacteria 1619
340 Ga0068871_100338812 3300006358 Bacteria 1327
341 Ga0075428_100101055 3300006844 Bacteria 3144
342 Ga0075431_101115607 3300006847 Bacteria 753
343 Ga0075429_100456305 3300006880 Bacteria 1120
344 Ga0075429_100756886 3300006880 Bacteria 851
345 Ga0068865_100016213 3300006881 Bacteria 4763
346 Ga0068865_100070890 3300006881 Bacteria 2470
347 Ga0068865_100077435 3300006881 Bacteria 2376
348 Ga0068865_100179459 3300006881 Bacteria 1630
349 Ga0068865_100188845 3300006881 Bacteria 1592
350 Ga0068865_100398524 3300006881 Bacteria 1127
351 Ga0068865_100742490 3300006881 Bacteria 842
352 Ga0068865_100750310 3300006881 Bacteria 838
353 Ga0097620_100010599 3300006931 Bacteria 9278
354 Ga0097620_100136488 3300006931 Bacteria 2526
355 Ga0097620_100237623 3300006931 Bacteria 1911
356 Ga0097620_101049746 3300006931 Bacteria 896
357 Ga0097620_101855547 3300006931 Bacteria 666
358 Ga0099824_1019323 3300006942 Bacteria 5344
359 Ga0105240_10000906 3300009093 Bacteria 52979
360 Ga0105240_10004993 3300009093 Bacteria 19922
361 Ga0105240_10027081 3300009093 Bacteria 7512
362 Ga0105240_10027316 3300009093 Bacteria 7473
363 Ga0105240_10088014 3300009093 Bacteria 3801
364 Ga0105240_10155563 3300009093 Bacteria 2719
365 Ga0105240_10251728 3300009093 Bacteria 2042
366 Ga0105240_10265229 3300009093 Bacteria 1980
367 Ga0105240_10279530 3300009093 Bacteria 1918
368 Ga0105240_11861069 3300009093 Bacteria 627
369 Ga0105240_12426867 3300009093 Bacteria 543
370 Ga0111539_10175933 3300009094 Bacteria 2500
371 Ga0111539_10371110 3300009094 Bacteria 1665
372 Ga0111539_11274521 3300009094 Bacteria 853
373 Ga0105245_10187338 3300009098 Bacteria 1980
374 Ga0105245_10188072 3300009098 Bacteria 1976
375 Ga0105245_10896004 3300009098 Unclassified 929
376 Ga0105245_11019902 3300009098 Bacteria 872
377 Ga0105247_10288387 3300009101 Bacteria 1134
378 Ga0105247_10778532 3300009101 Bacteria 728
379 Ga0105247_11601429 3300009101 Bacteria 535
380 Ga0114129_10604548 3300009147 Bacteria 1420
381 Ga0105243_10041324 3300009148 Bacteria 3606
382 Ga0105243_10042566 3300009148 Bacteria 3555
383 Ga0105243_10090932 3300009148 Bacteria 2512
384 Ga0105243_10408280 3300009148 Bacteria 1263
385 Ga0105243_10501008 3300009148 Bacteria 1151
386 Ga0105243_10657632 3300009148 Unclassified 1016
387 Ga0105243_11165715 3300009148 Bacteria 782
388 Ga0105243_11231758 3300009148 Bacteria 763
389 Ga0105241_10032759 3300009174 Bacteria 3899
390 Ga0105241_10120160 3300009174 Bacteria 2114
391 Ga0105241_10431342 3300009174 Bacteria 1162
392 Ga0105241_10644028 3300009174 Bacteria 962
393 Ga0105241_11338911 3300009174 Bacteria 683
394 Ga0105241_12560117 3300009174 Bacteria 512
395 Ga0105242_10012056 3300009176 Bacteria 6653
396 Ga0105242_10042305 3300009176 Bacteria 3678
397 Ga0105242_10423519 3300009176 Bacteria 1248
398 Ga0105242_10886616 3300009176 Bacteria 891
399 Ga0105242_11228100 3300009176 Unclassified 770
400 Ga0105242_11832603 3300009176 Archaea 646
401 Ga0105242_12312340 3300009176 Bacteria 584
402 Ga0105248_10010283 3300009177 Bacteria 10301
403 Ga0105248_10017949 3300009177 Bacteria 7809
404 Ga0105248_10081498 3300009177 Bacteria 3637
405 Ga0105248_10164087 3300009177 Bacteria 2505
406 Ga0105248_10242008 3300009177 Bacteria 2031
407 Ga0105248_10310979 3300009177 Bacteria 1774
408 Ga0105248_10415691 3300009177 Bacteria 1514
409 Ga0105248_10640126 3300009177 Bacteria 1200
410 Ga0105248_10992361 3300009177 Bacteria 949
411 Ga0105237_10009430 3300009545 Bacteria 10456
412 Ga0105237_10066651 3300009545 Bacteria 3595
413 Ga0105237_10333521 3300009545 Bacteria 1521
414 Ga0105237_10628663 3300009545 Bacteria 1080
415 Ga0105237_10672051 3300009545 Bacteria 1042
416 Ga0105237_10898148 3300009545 Bacteria 893
417 Ga0105237_11075995 3300009545 Bacteria 811
418 Ga0105238_10009376 3300009551 Bacteria 9795
419 Ga0105238_10023690 3300009551 Bacteria 6256
420 Ga0105238_10036707 3300009551 Bacteria 4982
421 Ga0105238_10052956 3300009551 Bacteria 4079
422 Ga0105238_10082010 3300009551 Bacteria 3215
423 Ga0105238_10097773 3300009551 Bacteria 2920
424 Ga0105238_10327534 3300009551 Bacteria 1518
425 Ga0105238_10452257 3300009551 Bacteria 1281
426 Ga0105238_10495788 3300009551 Bacteria 1222
427 Ga0105238_10790803 3300009551 Bacteria 964
428 Ga0105249_10048096 3300009553 Bacteria 3889
429 Ga0105249_10159404 3300009553 Bacteria 2179
430 Ga0105249_10179568 3300009553 Bacteria 2058
431 Ga0105249_10279928 3300009553 Bacteria 1665
432 Ga0105249_10300706 3300009553 Bacteria 1609
433 Ga0105249_10594681 3300009553 Bacteria 1160
434 Ga0105239_10038937 3300010375 Bacteria 5208
435 Ga0105239_10049542 3300010375 Bacteria 4606
436 Ga0105239_10134538 3300010375 Bacteria 2752
437 Ga0105239_10134956 3300010375 Bacteria 2747
438 Ga0105239_10150239 3300010375 Bacteria 2600
439 Ga0105239_10275935 3300010375 Bacteria 1891
440 Ga0105239_11043199 3300010375 Bacteria 940
441 Ga0105239_11424567 3300010375 Bacteria 800
442 Ga0105246_10016866 3300011119 Bacteria 4633
443 Ga0105246_10077748 3300011119 Bacteria 2355
444 Ga0105246_10121355 3300011119 Bacteria 1937
445 Ga0105246_10767720 3300011119 Bacteria 852
446 Ga0105246_11133405 3300011119 Bacteria 716
447 Ga0105246_11474086 3300011119 Bacteria 638
448 Ga0157318_1007034 3300012482 Bacteria 757
449 Ga0157339_1003561 3300012505 Bacteria 1132
450 Ga0157316_1050929 3300012510 Bacteria 571
451 Ga0157327_1005852 3300012512 Bacteria 1012
452 Ga0157338_1007600 3300012515 Bacteria 1032
453 Ga0157373_10130661 3300013100 Bacteria 1766
454 Ga0157371_10163129 3300013102 Bacteria 1592
455 Ga0157371_10189802 3300013102 Bacteria 1471
456 Ga0157371_10695988 3300013102 Unclassified 761
457 Ga0157371_10790493 3300013102 Bacteria 715
458 Ga0157370_10110028 3300013104 Bacteria 2575
459 Ga0157370_10617216 3300013104 Bacteria 992
460 Ga0157370_11946286 3300013104 Bacteria 527
461 Ga0157369_10019968 3300013105 Bacteria 7491
462 Ga0157369_10075339 3300013105 Bacteria 3618
463 Ga0157369_10360373 3300013105 Bacteria 1510
464 Ga0157369_10425283 3300013105 Bacteria 1377
465 Ga0157369_10431777 3300013105 Bacteria 1365
466 Ga0157369_10442977 3300013105 Bacteria 1345
467 Ga0157369_10599162 3300013105 Bacteria 1137
468 Ga0157374_10000062 3300013296 Bacteria 112028
469 Ga0157374_10021722 3300013296 Bacteria 5715
470 Ga0157374_10106725 3300013296 Bacteria 2691
471 Ga0157374_10150309 3300013296 Bacteria 2264
472 Ga0157374_10253738 3300013296 Bacteria 1731
473 Ga0157374_10518609 3300013296 Bacteria 1197
474 Ga0157374_10816210 3300013296 Bacteria 949
475 Ga0157378_10000009 3300013297 Bacteria 161557
476 Ga0157378_10000366 3300013297 Bacteria 44698
477 Ga0157378_10002258 3300013297 Bacteria 17116
478 Ga0157378_10025295 3300013297 Bacteria 5228
479 Ga0157378_10106770 3300013297 Bacteria 2562
480 Ga0157378_10245045 3300013297 Bacteria 1714
481 Ga0157378_10818152 3300013297 Bacteria 958
482 Ga0157378_10997973 3300013297 Bacteria 871
483 Ga0163162_10000028 3300013306 Bacteria 175501
484 Ga0163162_10071763 3300013306 Bacteria 3516
485 Ga0163162_10082672 3300013306 Bacteria 3284
486 Ga0163162_10151115 3300013306 Bacteria 2440
487 Ga0163162_10329599 3300013306 Bacteria 1659
488 Ga0163162_10605705 3300013306 Bacteria 1221
489 Ga0163162_10651778 3300013306 Bacteria 1177
490 Ga0163162_11730171 3300013306 Bacteria 714
491 Ga0163162_11925388 3300013306 Bacteria 677
492 Ga0163162_12515910 3300013306 Bacteria 592
493 Ga0163162_12811305 3300013306 Unclassified 560
494 Ga0157372_10001184 3300013307 Bacteria 28212
495 Ga0157372_10002204 3300013307 Bacteria 21156
496 Ga0157372_10008186 3300013307 Bacteria 11112
497 Ga0157372_10111977 3300013307 Bacteria 3127
498 Ga0157372_10292790 3300013307 Bacteria 1893
499 Ga0157372_10303986 3300013307 Bacteria 1856
500 Ga0157372_10307674 3300013307 Bacteria 1844
501 Ga0157372_10334834 3300013307 Bacteria 1763
502 Ga0157375_10001583 3300013308 Bacteria 19576
503 Ga0157375_10031568 3300013308 Bacteria 5010
504 Ga0157375_10072749 3300013308 Bacteria 3455
505 Ga0157375_10084786 3300013308 Bacteria 3217
506 Ga0157375_10213455 3300013308 Bacteria 2087
507 Ga0157375_10730150 3300013308 Bacteria 1143
508 Ga0157375_11076585 3300013308 Bacteria 940
509 Ga0157375_12341202 3300013308 Bacteria 637
510 Ga0157375_13165977 3300013308 Bacteria 549
511 Ga0163163_10001955 3300014325 Bacteria 17429
512 Ga0163163_10004520 3300014325 Bacteria 11868
513 Ga0163163_10103355 3300014325 Bacteria 2874
514 Ga0163163_10270330 3300014325 Bacteria 1751
515 Ga0163163_10495605 3300014325 Bacteria 1283
516 Ga0163163_12569231 3300014325 Bacteria 567
517 Ga0157380_10020607 3300014326 Bacteria 4931
518 Ga0157380_10269114 3300014326 Bacteria 1552
519 Ga0157380_10505670 3300014326 Bacteria 1175
520 Ga0157380_10770206 3300014326 Bacteria 976
521 Ga0157380_11276160 3300014326 Bacteria 781
522 Ga0182008_10049225 3300014497 Bacteria 2092
523 Ga0182008_10481120 3300014497 Bacteria 680
524 Ga0182008_10525419 3300014497 Bacteria 654
525 Ga0157377_10151536 3300014745 Bacteria 1434
526 Ga0157377_10279058 3300014745 Bacteria 1094
527 Ga0157379_10000319 3300014968 Bacteria 38313
528 Ga0157379_10030697 3300014968 Bacteria 4786
529 Ga0157379_10245833 3300014968 Bacteria 1623
530 Ga0157379_10365956 3300014968 Bacteria 1322
531 Ga0157379_10548003 3300014968 Bacteria 1076
532 Ga0157379_11033142 3300014968 Bacteria 785
533 Ga0157379_11298238 3300014968 Bacteria 703
534 Ga0157376_10082837 3300014969 Bacteria 2758
535 Ga0157376_10093047 3300014969 Bacteria 2616
536 Ga0157376_10105381 3300014969 Bacteria 2472
537 Ga0157376_10122466 3300014969 Bacteria 2307
538 Ga0157376_10189556 3300014969 Bacteria 1885
539 Ga0157376_10258581 3300014969 Bacteria 1630
540 Ga0157376_10260700 3300014969 Bacteria 1624
541 Ga0157376_10484450 3300014969 Bacteria 1213
542 Ga0157376_10508205 3300014969 Bacteria 1185
543 Ga0157376_11043313 3300014969 Bacteria 842
544 Ga0157376_11139105 3300014969 Bacteria 807
545 Ga0163161_10005516 3300017792 Bacteria 8769
546 Ga0163161_10015892 3300017792 Bacteria 5251
547 Ga0163161_10201622 3300017792 Bacteria 1534
548 Ga0163161_10203088 3300017792 Bacteria 1528
549 Ga0163161_10363611 3300017792 Bacteria 1153
550 Ga0163161_10554401 3300017792 Bacteria 942
551 Ga0163161_11628128 3300017792 Bacteria 570
552 Ga0163161_11943241 3300017792 Bacteria 523
553 Ga0206356_11689876 3300020070 Bacteria 952
554 Ga0206349_1714749 3300020075 Bacteria 502
555 Ga0206353_11171569 3300020082 Bacteria 818
556 Ga0206353_11366746 3300020082 Bacteria 1196
557 Ga0206353_11586967 3300020082 Bacteria 1761
558 Ga0209673_1007174 3300025273 Bacteria 5202
559 Ga0209673_1072312 3300025273 Bacteria 816
560 Ga0209130_1011708 3300025284 Bacteria 2334
561 Ga0209675_1004813 3300025291 Bacteria 5859
562 Ga0209675_1004817 3300025291 Bacteria 5855
563 Ga0209676_1001568 3300025292 Bacteria 20438
564 Ga0209676_1002588 3300025292 Bacteria 12442
565 Ga0209676_1002747 3300025292 Bacteria 11792
566 Ga0209676_1003093 3300025292 Bacteria 10710
567 Ga0209676_1033031 3300025292 Bacteria 1547
568 Ga0209676_1068054 3300025292 Bacteria 857
569 Ga0209025_1000454 3300025294 Bacteria 80042
570 Ga0209025_1011745 3300025294 Bacteria 5716
571 Ga0209025_1020449 3300025294 Bacteria 3622
572 Ga0209025_1033207 3300025294 Bacteria 2391
573 Ga0209025_1067527 3300025294 Bacteria 1291
574 Ga0209025_1191523 3300025294 Bacteria 513
575 Ga0209564_1003082 3300025295 Bacteria 11815
576 Ga0209758_1053082 3300025297 Bacteria 1395
577 Ga0209758_1112180 3300025297 Bacteria 752
578 Ga0209050_1000865 3300025298 Bacteria 40908
579 Ga0209050_1008800 3300025298 Bacteria 5302
580 Ga0209256_1005269 3300025299 Bacteria 7545
581 Ga0209256_1006382 3300025299 Bacteria 6275
582 Ga0209051_1029660 3300025303 Bacteria 2137
583 Ga0209257_1000154 3300025304 Bacteria 185887
584 Ga0209257_1001025 3300025304 Bacteria 37552
585 Ga0209257_1001296 3300025304 Bacteria 30463
586 Ga0209257_1015047 3300025304 Bacteria 3258
587 Ga0207697_10157211 3300025315 Bacteria 991
588 Ga0207656_10001724 3300025321 Bacteria 7270
589 Ga0207656_10112803 3300025321 Bacteria 1258
590 Ga0207682_10143516 3300025893 Bacteria 1073
591 Ga0207682_10171017 3300025893 Bacteria 988
592 Ga0207692_10969175 3300025898 Bacteria 561
593 Ga0207642_10007476 3300025899 Bacteria 3694
594 Ga0207642_10118473 3300025899 Bacteria 1361
595 Ga0207642_10741856 3300025899 Bacteria 621
596 Ga0207688_10044138 3300025901 Bacteria 2484
597 Ga0207680_10001162 3300025903 Bacteria 12407
598 Ga0207680_10007152 3300025903 Bacteria 5427
599 Ga0207680_10359870 3300025903 Bacteria 1023
600 Ga0207680_10456999 3300025903 Bacteria 907
601 Ga0207680_10704104 3300025903 Bacteria 724
602 Ga0207647_10000024 3300025904 Bacteria 115153
603 Ga0207647_10002046 3300025904 Bacteria 15407
604 Ga0207647_10063045 3300025904 Bacteria 2256
605 Ga0207647_10487124 3300025904 Bacteria 688
606 Ga0207647_10548242 3300025904 Bacteria 641
607 Ga0207647_10801934 3300025904 Bacteria 506
608 Ga0207699_10070829 3300025906 Bacteria 2130
609 Ga0207699_10341074 3300025906 Bacteria 1056
610 Ga0207699_10429108 3300025906 Bacteria 945
611 Ga0207645_10025001 3300025907 Bacteria 3868
612 Ga0207643_10125350 3300025908 Bacteria 1525
613 Ga0207643_10127157 3300025908 Bacteria 1513
614 Ga0207643_10380027 3300025908 Bacteria 890
615 Ga0207705_10149766 3300025909 Bacteria 1748
616 Ga0207705_10373572 3300025909 Bacteria 1101
617 Ga0207705_10634513 3300025909 Bacteria 831
618 Ga0207705_11074411 3300025909 Bacteria 620
619 Ga0207654_10006477 3300025911 Bacteria 5893
620 Ga0207654_10015692 3300025911 Bacteria 3935
621 Ga0207654_10065026 3300025911 Bacteria 2146
622 Ga0207654_10100463 3300025911 Bacteria 1782
623 Ga0207654_10266358 3300025911 Bacteria 1154
624 Ga0207707_10001452 3300025912 Bacteria 21916
625 Ga0207707_10052277 3300025912 Unclassified 3558
626 Ga0207695_10000040 3300025913 Bacteria 452787
627 Ga0207695_10002176 3300025913 Bacteria 29640
628 Ga0207695_10006210 3300025913 Bacteria 15563
629 Ga0207695_10016274 3300025913 Bacteria 8712
630 Ga0207695_10022021 3300025913 Bacteria 7252
631 Ga0207695_10025623 3300025913 Bacteria 6597
632 Ga0207695_10038774 3300025913 Bacteria 5125
633 Ga0207695_10040956 3300025913 Unclassified 4961
634 Ga0207695_10533362 3300025913 Bacteria 1055
635 Ga0207695_10827735 3300025913 Bacteria 806
636 Ga0207671_10002984 3300025914 Bacteria 17350
637 Ga0207671_10009442 3300025914 Bacteria 8155
638 Ga0207671_10018841 3300025914 Bacteria 5290
639 Ga0207671_10405775 3300025914 Bacteria 1084
640 Ga0207671_10496425 3300025914 Bacteria 973
641 Ga0207671_10577850 3300025914 Bacteria 896
642 Ga0207671_11167927 3300025914 Bacteria 603
643 Ga0207693_10286913 3300025915 Bacteria 1290
644 Ga0207663_10152669 3300025916 Bacteria 1622
645 Ga0207663_11091975 3300025916 Bacteria 641
646 Ga0207660_10416195 3300025917 Bacteria 1084
647 Ga0207660_10722308 3300025917 Bacteria 813
648 Ga0207660_11349006 3300025917 Unclassified 579
649 Ga0207662_10040240 3300025918 Bacteria 2747
650 Ga0207657_10000326 3300025919 Bacteria 50694
651 Ga0207657_10511310 3300025919 Bacteria 940
652 Ga0207657_11111319 3300025919 Bacteria 604
653 Ga0207649_10004643 3300025920 Bacteria 7437
654 Ga0207649_10159208 3300025920 Bacteria 1563
655 Ga0207649_10270891 3300025920 Unclassified 1231
656 Ga0207649_10532696 3300025920 Bacteria 897
657 Ga0207649_10585098 3300025920 Bacteria 857
658 Ga0207649_10788992 3300025920 Bacteria 741
659 Ga0207649_10869496 3300025920 Bacteria 706
660 Ga0207652_10016784 3300025921 Bacteria 5983
661 Ga0207652_10203273 3300025921 Bacteria 1783
662 Ga0207652_11194063 3300025921 Bacteria 662
663 Ga0207652_11427174 3300025921 Bacteria 596
664 Ga0207652_11478752 3300025921 Bacteria 583
665 Ga0207681_10137587 3300025923 Bacteria 1815
666 Ga0207681_10552603 3300025923 Bacteria 948
667 Ga0207681_11511191 3300025923 Unclassified 563
668 Ga0207694_10001319 3300025924 Bacteria 21340
669 Ga0207694_10006000 3300025924 Bacteria 9302
670 Ga0207694_10010865 3300025924 Bacteria 6874
671 Ga0207694_10040794 3300025924 Bacteria 3576
672 Ga0207694_10041105 3300025924 Unclassified 3562
673 Ga0207694_10143818 3300025924 Bacteria 1919
674 Ga0207694_10358811 3300025924 Bacteria 1207
675 Ga0207694_10591577 3300025924 Unclassified 933
676 Ga0207694_11250158 3300025924 Bacteria 628
677 Ga0207650_10003597 3300025925 Bacteria 10636
678 Ga0207650_10007026 3300025925 Bacteria 7676
679 Ga0207650_10150236 3300025925 Bacteria 1838
680 Ga0207650_10162989 3300025925 Bacteria 1768
681 Ga0207659_10277557 3300025926 Bacteria 1369
682 Ga0207659_10518814 3300025926 Bacteria 1010
683 Ga0207659_10995151 3300025926 Bacteria 721
684 Ga0207659_11649400 3300025926 Bacteria 547
685 Ga0207687_10140730 3300025927 Bacteria 1830
686 Ga0207687_10158132 3300025927 Bacteria 1736
687 Ga0207687_10583760 3300025927 Bacteria 940
688 Ga0207687_10584936 3300025927 Bacteria 939
689 Ga0207687_10676723 3300025927 Bacteria 874
690 Ga0207687_10888147 3300025927 Bacteria 762
691 Ga0207700_10353069 3300025928 Bacteria 1281
692 Ga0207700_10595647 3300025928 Bacteria 983
693 Ga0207644_10174600 3300025931 Bacteria 1680
694 Ga0207644_10251177 3300025931 Bacteria 1411
695 Ga0207644_10344765 3300025931 Bacteria 1209
696 Ga0207644_10873267 3300025931 Bacteria 753
697 Ga0207690_10833288 3300025932 Bacteria 763
698 Ga0207690_10838427 3300025932 Bacteria 761
699 Ga0207690_10909924 3300025932 Unclassified 730
700 Ga0207706_10006512 3300025933 Bacteria 10832
701 Ga0207706_10113646 3300025933 Bacteria 2381
702 Ga0207706_10261519 3300025933 Bacteria 1511
703 Ga0207706_10400407 3300025933 Bacteria 1190
704 Ga0207706_11139690 3300025933 Bacteria 650
705 Ga0207706_11167617 3300025933 Unclassified 641
706 Ga0207706_11392604 3300025933 Bacteria 576
707 Ga0207686_10015548 3300025934 Bacteria 4256
708 Ga0207686_10138086 3300025934 Bacteria 1681
709 Ga0207686_10416366 3300025934 Bacteria 1027
710 Ga0207686_10450316 3300025934 Bacteria 990
711 Ga0207686_10767744 3300025934 Unclassified 771
712 Ga0207686_11279916 3300025934 Bacteria 602
713 Ga0207686_11737595 3300025934 Bacteria 516
714 Ga0207709_10027510 3300025935 Bacteria 3278
715 Ga0207709_10213470 3300025935 Bacteria 1387
716 Ga0207670_10293221 3300025936 Bacteria 1271
717 Ga0207669_10025336 3300025937 Bacteria 3204
718 Ga0207669_10159282 3300025937 Bacteria 1592
719 Ga0207669_10258036 3300025937 Bacteria 1302
720 Ga0207704_10018725 3300025938 Bacteria 3621
721 Ga0207704_10021380 3300025938 Bacteria 3444
722 Ga0207704_10064222 3300025938 Bacteria 2292
723 Ga0207704_10096787 3300025938 Bacteria 1955
724 Ga0207704_10381941 3300025938 Bacteria 1106
725 Ga0207704_10741225 3300025938 Bacteria 816
726 Ga0207704_11001374 3300025938 Unclassified 707
727 Ga0207704_11484772 3300025938 Unclassified 581
728 Ga0207704_11852943 3300025938 Unclassified 519
729 Ga0207665_11018767 3300025939 Bacteria 659
730 Ga0207691_10027848 3300025940 Bacteria 5296
731 Ga0207691_10062400 3300025940 Bacteria 3382
732 Ga0207691_10101776 3300025940 Bacteria 2563
733 Ga0207691_10300986 3300025940 Bacteria 1378
734 Ga0207691_10345714 3300025940 Bacteria 1273
735 Ga0207691_10437193 3300025940 Bacteria 1114
736 Ga0207691_10612968 3300025940 Bacteria 921
737 Ga0207711_10001544 3300025941 Bacteria 21341
738 Ga0207711_10006123 3300025941 Bacteria 10160
739 Ga0207711_10009684 3300025941 Bacteria 8027
740 Ga0207711_10019526 3300025941 Bacteria 5641
741 Ga0207711_10203021 3300025941 Bacteria 1809
742 Ga0207711_10261515 3300025941 Bacteria 1591
743 Ga0207711_10328735 3300025941 Bacteria 1414
744 Ga0207711_10721443 3300025941 Bacteria 930
745 Ga0207689_10169299 3300025942 Bacteria 1800
746 Ga0207689_10192430 3300025942 Bacteria 1683
747 Ga0207689_11024129 3300025942 Unclassified 696
748 Ga0207689_11253393 3300025942 Bacteria 624
749 Ga0207661_10059158 3300025944 Bacteria 3087
750 Ga0207661_10059225 3300025944 Unclassified 3085
751 Ga0207661_10115744 3300025944 Bacteria 2275
752 Ga0207661_10992832 3300025944 Bacteria 773
753 Ga0207661_11739692 3300025944 Bacteria 569
754 Ga0207679_10001856 3300025945 Bacteria 13125
755 Ga0207679_10204991 3300025945 Bacteria 1650
756 Ga0207679_10290784 3300025945 Bacteria 1405
757 Ga0207679_10447035 3300025945 Bacteria 1145
758 Ga0207679_11688830 3300025945 Bacteria 580
759 Ga0207667_10000465 3300025949 Bacteria 54509
760 Ga0207667_10001399 3300025949 Bacteria 30243
761 Ga0207667_10027253 3300025949 Bacteria 6224
762 Ga0207667_10080008 3300025949 Bacteria 3386
763 Ga0207667_10141308 3300025949 Bacteria 2478
764 Ga0207667_10373465 3300025949 Bacteria 1453
765 Ga0207667_11036637 3300025949 Bacteria 806
766 Ga0207667_11127458 3300025949 Bacteria 767
767 Ga0207651_10320214 3300025960 Bacteria 1296
768 Ga0207651_10334158 3300025960 Bacteria 1271
769 Ga0207651_10485762 3300025960 Bacteria 1065
770 Ga0207651_10882676 3300025960 Bacteria 796
771 Ga0207651_11719631 3300025960 Bacteria 565
772 Ga0207712_10000275 3300025961 Bacteria 49090
773 Ga0207712_10030485 3300025961 Bacteria 3626
774 Ga0207712_10040634 3300025961 Bacteria 3194
775 Ga0207712_10177825 3300025961 Bacteria 1669
776 Ga0207712_10688910 3300025961 Bacteria 891
777 Ga0207712_10882859 3300025961 Bacteria 789
778 Ga0207668_10072961 3300025972 Bacteria 2458
779 Ga0207668_10316378 3300025972 Bacteria 1294
780 Ga0207668_10461821 3300025972 Bacteria 1086
781 Ga0207640_10003205 3300025981 Bacteria 8813
782 Ga0207640_10018145 3300025981 Bacteria 4129
783 Ga0207640_10030688 3300025981 Bacteria 3313
784 Ga0207640_10056429 3300025981 Bacteria 2578
785 Ga0207640_10065293 3300025981 Bacteria 2428
786 Ga0207640_10098411 3300025981 Bacteria 2045
787 Ga0207640_10212413 3300025981 Unclassified 1475
788 Ga0207658_10011118 3300025986 Bacteria 6130
789 Ga0207658_10097209 3300025986 Bacteria 2298
790 Ga0207658_10200064 3300025986 Bacteria 1667
791 Ga0207658_10511296 3300025986 Bacteria 1071
792 Ga0207658_10788387 3300025986 Bacteria 862
793 Ga0207658_11393045 3300025986 Bacteria 641
794 Ga0207658_11677120 3300025986 Bacteria 581
795 Ga0207677_10010569 3300026023 Bacteria 5231
796 Ga0207677_10096166 3300026023 Bacteria 2166
797 Ga0207677_10096831 3300026023 Bacteria 2160
798 Ga0207677_10207950 3300026023 Bacteria 1560
799 Ga0207677_10460226 3300026023 Bacteria 1092
800 Ga0207677_10486879 3300026023 Bacteria 1064
801 Ga0207677_10871921 3300026023 Unclassified 810
802 Ga0207703_10001612 3300026035 Bacteria 20384
803 Ga0207703_10013731 3300026035 Bacteria 6313
804 Ga0207703_10022458 3300026035 Bacteria 4949
805 Ga0207703_10026541 3300026035 Bacteria 4560
806 Ga0207703_10068511 3300026035 Bacteria 2924
807 Ga0207703_10413352 3300026035 Bacteria 1254
808 Ga0207703_10426585 3300026035 Bacteria 1235
809 Ga0207703_10536610 3300026035 Bacteria 1102
810 Ga0207703_10546625 3300026035 Bacteria 1092
811 Ga0207703_11229443 3300026035 Bacteria 720
812 Ga0207639_10000116 3300026041 Bacteria 61688
813 Ga0207639_10001494 3300026041 Bacteria 15734
814 Ga0207639_10005911 3300026041 Bacteria 8292
815 Ga0207639_10050029 3300026041 Bacteria 3172
816 Ga0207639_10180619 3300026041 Bacteria 1795
817 Ga0207639_10330641 3300026041 Bacteria 1356
818 Ga0207639_11875370 3300026041 Bacteria 560
819 Ga0207678_10005905 3300026067 Bacteria 10906
820 Ga0207678_10223153 3300026067 Bacteria 1613
821 Ga0207678_10707280 3300026067 Bacteria 887
822 Ga0207678_11491716 3300026067 Bacteria 597
823 Ga0207678_11662131 3300026067 Unclassified 561
824 Ga0207708_10161011 3300026075 Bacteria 1772
825 Ga0207708_10294154 3300026075 Bacteria 1319
826 Ga0207702_10001051 3300026078 Bacteria 28280
827 Ga0207702_10008697 3300026078 Bacteria 8562
828 Ga0207702_10013885 3300026078 Bacteria 6690
829 Ga0207702_10036300 3300026078 Bacteria 4122
830 Ga0207702_10216397 3300026078 Bacteria 1783
831 Ga0207702_10549727 3300026078 Bacteria 1129
832 Ga0207641_10020771 3300026088 Bacteria 5397
833 Ga0207641_10022745 3300026088 Bacteria 5161
834 Ga0207641_10025422 3300026088 Bacteria 4882
835 Ga0207641_10073518 3300026088 Bacteria 2946
836 Ga0207641_10140241 3300026088 Bacteria 2180
837 Ga0207641_10529347 3300026088 Unclassified 1147
838 Ga0207641_10973412 3300026088 Bacteria 844
839 Ga0207641_11150095 3300026088 Bacteria 775
840 Ga0207641_11827313 3300026088 Bacteria 609
841 Ga0207641_11922758 3300026088 Bacteria 593
842 Ga0207648_10028264 3300026089 Bacteria 4974
843 Ga0207648_10071363 3300026089 Bacteria 3026
844 Ga0207648_10092387 3300026089 Bacteria 2646
845 Ga0207648_10141728 3300026089 Bacteria 2119
846 Ga0207648_10161034 3300026089 Bacteria 1982
847 Ga0207648_10958181 3300026089 Bacteria 800
848 Ga0207648_11640543 3300026089 Bacteria 604
849 Ga0207676_10015306 3300026095 Bacteria 5531
850 Ga0207676_10020158 3300026095 Bacteria 4874
851 Ga0207676_10084369 3300026095 Bacteria 2589
852 Ga0207676_10095677 3300026095 Bacteria 2450
853 Ga0207676_10230810 3300026095 Bacteria 1654
854 Ga0207676_10472482 3300026095 Bacteria 1186
855 Ga0207676_11236738 3300026095 Bacteria 741
856 Ga0207676_11707682 3300026095 Unclassified 628
857 Ga0207676_12201449 3300026095 Bacteria 549
858 Ga0207676_12594716 3300026095 Bacteria 503
859 Ga0207674_10002111 3300026116 Bacteria 25147
860 Ga0207674_10003692 3300026116 Bacteria 18684
861 Ga0207674_10180643 3300026116 Bacteria 2061
862 Ga0207674_10181195 3300026116 Bacteria 2058
863 Ga0207674_10186230 3300026116 Bacteria 2026
864 Ga0207674_10390820 3300026116 Bacteria 1345
865 Ga0207674_10532582 3300026116 Bacteria 1135
866 Ga0207674_10938633 3300026116 Bacteria 834
867 Ga0207674_11210336 3300026116 Bacteria 725
868 Ga0207674_11655389 3300026116 Bacteria 608
869 Ga0207674_11848943 3300026116 Bacteria 570
870 Ga0207675_100010284 3300026118 Bacteria 8766
871 Ga0207675_100069455 3300026118 Bacteria 3293
872 Ga0207675_100080251 3300026118 Unclassified 3059
873 Ga0207675_100797267 3300026118 Unclassified 958
874 Ga0207675_100975801 3300026118 Bacteria 865
875 Ga0207683_10041514 3300026121 Bacteria 4017
876 Ga0207683_10174299 3300026121 Bacteria 1949
877 Ga0207683_10224289 3300026121 Bacteria 1713
878 Ga0207683_10245372 3300026121 Bacteria 1634
879 Ga0207683_10353144 3300026121 Bacteria 1349
880 Ga0207683_10460767 3300026121 Bacteria 1172
881 Ga0207683_10934410 3300026121 Bacteria 805
882 Ga0207683_11450479 3300026121 Bacteria 634
883 Ga0207698_10025790 3300026142 Bacteria 4148
884 Ga0207698_10189561 3300026142 Bacteria 1830
885 Ga0207698_10296992 3300026142 Bacteria 1502
886 Ga0207698_10369316 3300026142 Bacteria 1361
887 Ga0207698_10387578 3300026142 Bacteria 1331
888 Ga0207698_10668990 3300026142 Bacteria 1030
889 Ga0207698_11360110 3300026142 Bacteria 725
890 Ga0207698_12368509 3300026142 Bacteria 542
891 Ga0209971_1180016 3300027682 Bacteria 521
892 Ga0209813_10144077 3300027866 Bacteria 848
893 Ga0209813_10254670 3300027866 Bacteria 668
894 Ga0209813_10271466 3300027866 Bacteria 650
895 Ga0209813_10345713 3300027866 Bacteria 588
896 Ga0209974_10066110 3300027876 Bacteria 1228
897 Ga0209974_10251929 3300027876 Bacteria 665
898 Ga0207428_10499733 3300027907 Bacteria 883
899 Ga0268266_10000008 3300028379 Bacteria 1161875
900 Ga0268266_10048529 3300028379 Bacteria 3640
901 Ga0268266_10144893 3300028379 Bacteria 2135
902 Ga0268266_10221390 3300028379 Bacteria 1740
903 Ga0268265_10143946 3300028380 Bacteria 2000
904 Ga0268265_12096315 3300028380 Bacteria 573
905 Ga0268264_10017059 3300028381 Bacteria 5946
906 Ga0268264_10035419 3300028381 Bacteria 4110
907 Ga0268264_10050247 3300028381 Bacteria 3471
908 Ga0268264_10065648 3300028381 Bacteria 3058
909 Ga0268264_10278908 3300028381 Unclassified 1564
910 Ga0268264_10601297 3300028381 Bacteria 1084
911 Ga0268264_11809743 3300028381 Bacteria 621
912 Ga0268264_12478561 3300028381 Bacteria 524
913 Ga0265766_1022650 3300030863 Bacteria 526
914 Ga0307513_11103177 3300031456 Bacteria 506
915 Ga0307408_100078352 3300031548 Bacteria 2463
916 Ga0307408_100503230 3300031548 Bacteria 1061
917 Ga0307508_10009148 3300031616 Bacteria 9123
918 Ga0316575_10067027 3300031665 Bacteria 1438
919 Ga0316575_10145067 3300031665 Bacteria 978
920 Ga0316575_10177475 3300031665 Bacteria 884
921 Ga0316579_10035148 3300031691 Bacteria 2309
922 Ga0316579_10042354 3300031691 Bacteria 2115
923 Ga0316579_10391337 3300031691 Bacteria 672
924 Ga0316576_10005896 3300031727 Bacteria 7563
925 Ga0316576_10006214 3300031727 Bacteria 7410
926 Ga0316576_10035004 3300031727 Bacteria 3582
927 Ga0316576_10097808 3300031727 Bacteria 2191
928 Ga0316576_10097962 3300031727 Bacteria 2190
929 Ga0316576_10101454 3300031727 Bacteria 2151
930 Ga0316576_10623041 3300031727 Bacteria 786
931 Ga0316578_10000785 3300031728 Bacteria 11729
932 Ga0316578_10031889 3300031728 Bacteria 3006
933 Ga0316578_10035472 3300031728 Bacteria 2867
934 Ga0316578_10036064 3300031728 Bacteria 2846
935 Ga0316578_10050639 3300031728 Bacteria 2430
936 Ga0316578_10401498 3300031728 Bacteria 812
937 Ga0316578_10462580 3300031728 Bacteria 749
938 Ga0307516_10045126 3300031730 Bacteria 4355
939 Ga0307405_10011566 3300031731 Bacteria 4634
940 Ga0307405_10085176 3300031731 Bacteria 2077
941 Ga0307405_10414640 3300031731 Bacteria 1058
942 Ga0307405_10432868 3300031731 Bacteria 1038
943 Ga0307405_11405812 3300031731 Bacteria 610
944 Ga0316577_10023857 3300031733 Bacteria 3396
945 Ga0316577_10070727 3300031733 Bacteria 1947
946 Ga0316577_10567628 3300031733 Bacteria 645
947 Ga0307413_10005154 3300031824 Bacteria 5793
948 Ga0307410_10003872 3300031852 Bacteria 7613
949 Ga0307410_10050867 3300031852 Bacteria 2789
950 Ga0307410_10822939 3300031852 Bacteria 791
951 Ga0307410_11283329 3300031852 Bacteria 640
952 Ga0307406_10004191 3300031901 Bacteria 7847
953 Ga0307406_10145381 3300031901 Bacteria 1684
954 Ga0307406_10303100 3300031901 Bacteria 1228
955 Ga0307407_10716221 3300031903 Bacteria 755
956 Ga0307412_10269682 3300031911 Bacteria 1331
957 Ga0307409_100001007 3300031995 Bacteria 13200
958 Ga0307409_100673996 3300031995 Bacteria 1030
959 Ga0307409_101468556 3300031995 Bacteria 709
960 Ga0307416_100019061 3300032002 Bacteria 4854
961 Ga0307416_100056399 3300032002 Bacteria 3170
962 Ga0307416_100367485 3300032002 Bacteria 1463
963 Ga0307416_101019506 3300032002 Bacteria 931
964 Ga0307414_11040822 3300032004 Bacteria 754
965 Ga0307411_10377180 3300032005 Bacteria 1165
966 Ga0307411_10731470 3300032005 Bacteria 865
967 Ga0307415_100000190 3300032126 Bacteria 27293
968 Ga0307415_100131400 3300032126 Bacteria 1896
969 Ga0307415_100318770 3300032126 Bacteria 1295
970 Ga0307415_100363344 3300032126 Bacteria 1223
971 Ga0307415_101520076 3300032126 Bacteria 641
972 Ga0307415_101814762 3300032126 Bacteria 590
973 Ga0316585_10005493 3300032137 Bacteria 3580
974 Ga0316580_10001392 3300032139 Bacteria 6309
975 Ga0316592_1031132 3300033524 Bacteria 1161
976 Ga0316596_1012403 3300033541 Bacteria 2095
977 Ga0373938_0122376 3300034957 Bacteria 672
978 Ga0373928_0001559 3300035084 Bacteria 4444
979 Ga0373929_0005769 3300035085 Bacteria 2235
980 Ga0373944_0040699 3300035089 Bacteria 1435
981 Ga0373949_0106882 3300035090 Bacteria 772
982 Ga0373932_0012957 3300035112 Bacteria 2063
983 Ga0373956_0576659 3300035119 Bacteria 537
984 Ga0373943_0365343 3300035170 Bacteria 829
985 Ga0373943_0610319 3300035170 Bacteria 643
986 Ga0373946_0328855 3300035171 Bacteria 761
987 Ga0316574_0009298 3300035398 Bacteria 5499
988 Ga0316574_0012164 3300035398 Bacteria 4917
989 Ga0316574_0028980 3300035398 Bacteria 3342
990 Ga0316574_0043707 3300035398 Bacteria 2769
991 Ga0316574_0044640 3300035398 Bacteria 2742
992 Ga0316574_0068255 3300035398 Bacteria 2242
993 Ga0316574_0104517 3300035398 Bacteria 1813
994 Ga0316574_0166127 3300035398 Bacteria 1421
995 Ga0316574_0252697 3300035398 Bacteria 1126
996 Ga0316574_0296427 3300035398 Bacteria 1029
997 Ga0316574_0771780 3300035398 Bacteria 586
998 Ga0316574_0777003 3300035398 Bacteria 584
999 Ga0316574_0796423 3300035398 Bacteria 575
1000 Ga0373931_0000006 3300035691 Bacteria 437006
1001 Ga0373931_0012253 3300035691 Bacteria 4153
1002 Ga0373931_0452825 3300035691 Bacteria 821
1003 Ga0373931_0732471 3300035691 Unclassified 655
1004 Ga0373933_0009250 3300035724 Bacteria 5379
1005 Ga0373937_0139768 3300036401 Bacteria 2265
1006 Ga0373937_1280912 3300036401 Bacteria 681
1007 Ga0373937_1528419 3300036401 Unclassified 615
1008 Ga0316582_0013632 3300036647 Bacteria 4582
1009 Ga0316582_0016194 3300036647 Bacteria 4284
1010 Ga0316582_0209094 3300036647 Bacteria 1333
1011 Ga0316584_0005439 3300036712 Bacteria 8547
1012 Ga0316584_0017406 3300036712 Bacteria 5165
1013 Ga0316584_0023461 3300036712 Bacteria 4507
1014 Ga0316584_0024065 3300036712 Bacteria 4453
1015 Ga0316584_0076261 3300036712 Bacteria 2512
1016 Ga0316584_0086520 3300036712 Bacteria 2346
1017 Ga0316584_0112103 3300036712 Bacteria 2041
1018 Ga0316584_0146323 3300036712 Bacteria 1760
1019 Ga0395900_0155816 3300037418 Bacteria 2333
1020 Ga0395898_0002525 3300037466 Bacteria 21479
1021 Ga0395901_0047958 3300038443 Bacteria 4435
1022 Ga0395901_0079626 3300038443 Bacteria 3421
1023 Ga0395901_0607616 3300038443 Bacteria 1102
1024 Ga0400485_10787 3300038735 Bacteria 3970
1025 Ga0400483_017383 3300039062 Bacteria 3271
1026 Ga0400483_035347 3300039062 Bacteria 5529
1027 Ga0400483_088865 3300039062 Bacteria 1740
1028 Ga0400483_136168 3300039062 Bacteria 1367
1029 Ga0400483_136484 3300039062 Bacteria 6669
1030 Ga0400483_182325 3300039062 Bacteria 71334
1031 Ga0400483_190738 3300039062 Bacteria 1016
1032 Ga0400483_259065 3300039062 Bacteria 8084
1033 Ga0436363_1130565 3300039450 Bacteria 3870
1034 Ga0439439_0022419 3300041406 Bacteria 1577
1035 Ga0439439_0058660 3300041406 Bacteria 1019
1036 Ga0439447_001969 3300041407 Bacteria 7533
1037 Ga0439465_0013327 3300041413 Bacteria 2565
1038 Ga0451789_0048425 3300041443 Bacteria 563
1039 Ga0451793_0938620 3300041452 Bacteria 546
1040 Ga0451795_0181400 3300041456 Bacteria 603
1041 Ga0451795_0262903 3300041456 Bacteria 595
1042 Ga0451802_0012644 3300041460 Bacteria 924
1043 Ga0451802_1786781 3300041460 Bacteria 553
1044 Ga0451807_1450121 3300041486 Bacteria 958
1045 Ga0451837_0416935 3300041494 Bacteria 753
1046 Ga0451839_0458029 3300041496 Bacteria 600
1047 Ga0451841_0462125 3300041498 Bacteria 584
1048 Ga0451841_0883188 3300041498 Bacteria 774
1049 Ga0451843_0500007 3300041509 Bacteria 2246
1050 Ga0451855_1137734 3300041511 Bacteria 565
1051 Ga0451853_1377382 3300041512 Bacteria 846
1052 Ga0451853_2288329 3300041512 Bacteria 1102
1053 Ga0439445_0014698 3300042004 Bacteria 1909
1054 Ga0439432_007407 3300042006 Bacteria 3890
1055 Ga0439449_0017784 3300042007 Bacteria 2669
1056 Ga0439449_0057595 3300042007 Bacteria 1434
1057 Ga0439452_037293 3300042010 Bacteria 1160
1058 Ga0439457_006216 3300042014 Bacteria 2938
1059 Ga0439462_0001718 3300042015 Bacteria 4948
1060 Ga0439462_0057892 3300042015 Bacteria 1047
1061 Ga0439434_0068503 3300042435 Bacteria 1115
1062 Ga0439459_0223947 3300042438 Bacteria 522
1063 Ga0451577_0192413 3300042876 Bacteria 1840
1064 Ga0453684_0066899 3300044712 Bacteria 4573
1065 Ga0466960_0008210 3300044901 Bacteria 4270
1066 Ga0451576_2035645 3300045051 Bacteria 591
1067 Ga0466967_0272865 3300045976 Bacteria 1621
1068 Ga0466967_0606373 3300045976 Bacteria 1081
1069 Ga0495603_0066211 3300046455 Bacteria 2128
1070 Ga0495603_0102592 3300046455 Bacteria 1670
1071 Ga0495603_0306184 3300046455 Bacteria 913
1072 Ga0495603_0499510 3300046455 Bacteria 697
1073 Ga0495629_0123477 3300046459 Bacteria 1804
1074 Ga0495629_0277441 3300046459 Bacteria 1151
1075 Ga0495638_0048881 3300046460 Bacteria 2646
1076 Ga0495641_0124434 3300046461 Bacteria 1150
1077 Ga0495641_0245869 3300046461 Bacteria 804
1078 Ga0495641_0276304 3300046461 Bacteria 756
1079 Ga0495641_0538751 3300046461 Bacteria 533
1080 Ga0495653_0607863 3300046463 Bacteria 671
1081 Ga0495580_0068995 3300046472 Bacteria 2471
1082 Ga0495580_0953227 3300046472 Bacteria 549
1083 Ga0495582_0238331 3300046473 Bacteria 1042
1084 Ga0495582_0390489 3300046473 Bacteria 802
1085 Ga0495582_0563126 3300046473 Bacteria 659
1086 Ga0495582_0774064 3300046473 Bacteria 555
1087 Ga0495639_0015183 3300046475 Bacteria 3338
1088 Ga0495639_0064913 3300046475 Bacteria 1679
1089 Ga0495639_0294519 3300046475 Bacteria 808
1090 Ga0495618_0297807 3300046514 Bacteria 1003
1091 Ga0495630_0342084 3300046517 Bacteria 1145
1092 Ga0495630_0531377 3300046517 Bacteria 902
1093 Ga0495630_0672644 3300046517 Bacteria 792
1094 Ga0495663_0018871 3300046525 Bacteria 1967
1095 Ga0495663_0090410 3300046525 Bacteria 997
1096 Ga0495640_0822817 3300046533 Bacteria 553
1097 Ga0495586_0316555 3300046535 Bacteria 895
1098 Ga0495645_0091479 3300046543 Bacteria 2173
1099 Ga0495656_0014399 3300046615 Bacteria 2964
1100 Ga0495656_0054619 3300046615 Bacteria 1719
1101 Ga0495668_0002220 3300046616 Bacteria 16493
1102 Ga0495635_0093830 3300046663 Bacteria 2052
1103 Ga0495635_0458871 3300046663 Bacteria 842
1104 Ga0495659_0078425 3300046664 Bacteria 1249
1105 Ga0495647_0004042 3300046681 Bacteria 4738
1106 Ga0495647_0093151 3300046681 Bacteria 1238
1107 Ga0495658_0017764 3300046683 Bacteria 3682
1108 Ga0495658_0121517 3300046683 Bacteria 1580
1109 Ga0495658_0512428 3300046683 Bacteria 768
1110 Ga0495658_0748182 3300046683 Bacteria 626
1111 Ga0495613_0149419 3300046689 Bacteria 1667
1112 Ga0495613_0442118 3300046689 Bacteria 882
1113 Ga0495624_0138992 3300046690 Bacteria 1488
1114 Ga0495600_0204295 3300046809 Bacteria 1268
1115 Ga0495600_0322823 3300046809 Bacteria 971
1116 Ga0495600_0755611 3300046809 Bacteria 582
1117 Ga0495581_0153104 3300047315 Bacteria 1347
1118 Ga0495636_0000737 3300047318 Bacteria 12026
1119 Ga0495674_0778352 3300047319 Bacteria 746
1120 Ga0495674_1192807 3300047319 Bacteria 576
1121 Ga0495676_0177492 3300047321 Bacteria 1495
1122 Ga0495680_0069330 3300047322 Bacteria 2691
1123 Ga0495680_0545177 3300047322 Bacteria 782
1124 Ga0495680_0699847 3300047322 Bacteria 669
1125 Ga0495680_0862077 3300047322 Bacteria 588
1126 Ga0495680_1039112 3300047322 Bacteria 521
1127 Ga0495677_0372904 3300047445 Bacteria 564
1128 Ga0495685_123213 3300047447 Bacteria 850
1129 Ga0495684_0404789 3300047471 Bacteria 957
1130 Ga0495615_0123734 3300048090 Bacteria 750
1131 Ga0496100_0017223 3300048903 Bacteria 4262
1132 Ga0496100_0112917 3300048903 Bacteria 1890
1133 Ga0496100_0454616 3300048903 Bacteria 982
1134 Ga0496100_0945288 3300048903 Bacteria 677
1135 Ga0496101_0022651 3300048904 Bacteria 4327
1136 Ga0496101_0101460 3300048904 Bacteria 2155
1137 Ga0496101_0118636 3300048904 Bacteria 1998
1138 Ga0496101_0467569 3300048904 Bacteria 995
1139 Ga0496101_0539321 3300048904 Bacteria 922
1140 Ga0496101_1003099 3300048904 Bacteria 657
1141 Ga0496102_0002523 3300048905 Bacteria 15633
1142 Ga0496102_0014211 3300048905 Bacteria 6917
1143 Ga0496102_0026145 3300048905 Bacteria 5203
1144 Ga0496102_0047874 3300048905 Bacteria 3887
1145 Ga0496102_0101380 3300048905 Bacteria 2674
1146 Ga0496102_0414857 3300048905 Bacteria 1265
1147 Ga0496102_1195471 3300048905 Bacteria 680
1148 Ga0496102_1898216 3300048905 Bacteria 512
1149 Ga0496103_0014389 3300048906 Bacteria 4699
1150 Ga0496103_0051737 3300048906 Bacteria 2543
1151 Ga0496103_0125082 3300048906 Bacteria 1639
1152 Ga0496104_0011522 3300048907 Bacteria 7922
1153 Ga0496104_0021521 3300048907 Bacteria 5921
1154 Ga0496104_0035075 3300048907 Bacteria 4682
1155 Ga0496104_0059896 3300048907 Bacteria 3605
1156 Ga0496104_0091472 3300048907 Bacteria 2908
1157 Ga0496104_0205045 3300048907 Bacteria 1883
1158 Ga0496104_0340483 3300048907 Bacteria 1413
1159 Ga0496104_0589094 3300048907 Bacteria 1022
1160 Ga0496104_1100843 3300048907 Bacteria 698
1161 Ga0496105_0000093 3300048908 Bacteria 61223
1162 Ga0496105_0011016 3300048908 Bacteria 7126
1163 Ga0496105_0065159 3300048908 Bacteria 3007
1164 Ga0496105_0079322 3300048908 Bacteria 2711
1165 Ga0496105_0160368 3300048908 Bacteria 1846
1166 Ga0496105_0184867 3300048908 Bacteria 1705
1167 Ga0496105_0429277 3300048908 Bacteria 1045
1168 Ga0496106_0037656 3300048909 Bacteria 3619
1169 Ga0496106_0535048 3300048909 Bacteria 941
1170 Ga0496106_0688249 3300048909 Bacteria 815
1171 Ga0496106_0884300 3300048909 Bacteria 706
1172 Ga0496106_1522924 3300048909 Bacteria 514
1173 Ga0496107_0061581 3300048910 Bacteria 2717
1174 Ga0496108_0092806 3300048911 Bacteria 2567
1175 Ga0496108_0115049 3300048911 Bacteria 2303
1176 Ga0496108_0145395 3300048911 Bacteria 2044
1177 Ga0496108_0986043 3300048911 Bacteria 720
1178 Ga0496108_1090210 3300048911 Bacteria 679
1179 Ga0496108_1165399 3300048911 Bacteria 653
1180 Ga0496109_0006477 3300048912 Bacteria 9858
1181 Ga0496109_0110257 3300048912 Bacteria 2559
1182 Ga0496109_0154790 3300048912 Bacteria 2147
1183 Ga0496109_0218292 3300048912 Bacteria 1793
1184 Ga0496109_0599588 3300048912 Bacteria 1038
1185 Ga0496109_0988008 3300048912 Archaea 779
1186 Ga0496109_0997018 3300048912 Bacteria 775
1187 Ga0496110_0019788 3300048913 Bacteria 5671
1188 Ga0496110_0087106 3300048913 Bacteria 2789
1189 Ga0496110_0123611 3300048913 Bacteria 2333
1190 Ga0496110_0257166 3300048913 Bacteria 1589
1191 Ga0496110_0457117 3300048913 Bacteria 1163
1192 Ga0496110_0582361 3300048913 Unclassified 1016
1193 Ga0496110_0828153 3300048913 Bacteria 830
1194 Ga0496110_1092236 3300048913 Bacteria 706
1195 Ga0496110_1113678 3300048913 Unclassified 698
1196 Ga0496111_0012225 3300048914 Bacteria 5807
1197 Ga0496111_0014093 3300048914 Bacteria 5453
1198 Ga0496112_0013357 3300048915 Bacteria 7580
1199 Ga0496112_0035217 3300048915 Unclassified 4874
1200 Ga0496112_0101325 3300048915 Bacteria 2850
1201 Ga0496113_0002034 3300048916 Bacteria 11613
1202 Ga0496113_0227730 3300048916 Bacteria 1486
1203 Ga0496114_0008479 3300048917 Bacteria 8145
1204 Ga0496114_0017914 3300048917 Bacteria 5724
1205 Ga0496114_0106393 3300048917 Bacteria 2400
1206 Ga0496114_0107510 3300048917 Bacteria 2387
1207 Ga0496114_0162541 3300048917 Bacteria 1942
1208 Ga0496114_0298336 3300048917 Bacteria 1422
1209 Ga0496114_0336745 3300048917 Bacteria 1334
1210 Ga0496114_0564554 3300048917 Bacteria 1005
1211 Ga0496114_0575057 3300048917 Bacteria 994
1212 Ga0496115_0258610 3300048918 Bacteria 1432
1213 Ga0496115_1123948 3300048918 Bacteria 594
1214 Ga0496118_0003924 3300048921 Bacteria 18203
1215 Ga0496126_0442804 3300048929 Bacteria 1047
1216 Ga0501314_028898 3300049530 Bacteria 609
1217 Ga0501315_059501 3300049531 Bacteria 615
1218 Ga0501031_0022036 3300049568 Bacteria 4152
1219 Ga0501031_0077430 3300049568 Bacteria 2166
1220 Ga0501031_0422046 3300049568 Bacteria 862
1221 Ga0501031_0786072 3300049568 Bacteria 610
1222 Ga0501031_0811625 3300049568 Bacteria 600
1223 Ga0501033_0069737 3300049570 Bacteria 2584
1224 Ga0501033_1101516 3300049570 Bacteria 528
1225 Ga0501034_0963015 3300049571 Bacteria 739
1226 Ga0501036_0033281 3300049572 Bacteria 4359
1227 Ga0501036_0066082 3300049572 Bacteria 3060
1228 Ga0501036_0087561 3300049572 Bacteria 2632
1229 Ga0501036_0129136 3300049572 Bacteria 2134
1230 Ga0501036_0189321 3300049572 Bacteria 1731
1231 Ga0501037_0096698 3300049573 Bacteria 2134
1232 Ga0501038_0671360 3300049574 Bacteria 779
1233 Ga0501039_0038137 3300049575 Bacteria 3712
1234 Ga0501039_0092526 3300049575 Bacteria 2357
1235 Ga0501039_0586062 3300049575 Bacteria 874
1236 Ga0501040_0025352 3300049576 Bacteria 3986
1237 Ga0501040_0052625 3300049576 Bacteria 2788
1238 Ga0501040_0189872 3300049576 Bacteria 1457
1239 Ga0501040_0880828 3300049576 Bacteria 648
1240 Ga0501040_1093674 3300049576 Bacteria 578
1241 Ga0501041_0017307 3300049577 Bacteria 4289
1242 Ga0501041_0034669 3300049577 Bacteria 3056
1243 Ga0501041_0585753 3300049577 Bacteria 712
1244 Ga0501042_0017993 3300049578 Bacteria 4888
1245 Ga0501042_0366331 3300049578 Bacteria 1043
1246 Ga0501042_0387232 3300049578 Bacteria 1012
1247 Ga0501042_1408528 3300049578 Bacteria 508
1248 Ga0501043_0002433 3300049579 Bacteria 15753
1249 Ga0501043_0446569 3300049579 Bacteria 972
1250 Ga0501046_0248181 3300049580 Bacteria 1311
1251 Ga0501046_0595739 3300049580 Bacteria 785
1252 Ga0501047_0056717 3300049581 Bacteria 3789
1253 Ga0501047_0080871 3300049581 Bacteria 3124
1254 Ga0501048_0021837 3300049582 Bacteria 4685
1255 Ga0501048_0023263 3300049582 Bacteria 4532
1256 Ga0501048_0126426 3300049582 Bacteria 1807
1257 Ga0501048_1221988 3300049582 Bacteria 540
1258 Ga0501067_0017974 3300049583 Bacteria 3915
1259 Ga0501067_0078234 3300049583 Bacteria 1833
1260 Ga0501067_0257350 3300049583 Bacteria 972
1261 Ga0501067_0802052 3300049583 Bacteria 530
1262 Ga0501068_0314003 3300049584 Bacteria 1004
1263 Ga0501069_0036372 3300049585 Bacteria 2715
1264 Ga0501071_0004493 3300049587 Bacteria 8848
1265 Ga0501071_0119000 3300049587 Bacteria 1957
1266 Ga0501071_0131328 3300049587 Bacteria 1861
1267 Ga0501071_0942044 3300049587 Bacteria 666
1268 Ga0501071_1436483 3300049587 Bacteria 532
1269 Ga0501071_1616005 3300049587 Bacteria 500
1270 Ga0501072_0015466 3300049588 Bacteria 5849
1271 Ga0501072_0020892 3300049588 Bacteria 5075
1272 Ga0501072_0021691 3300049588 Bacteria 4982
1273 Ga0501072_0095697 3300049588 Bacteria 2360
1274 Ga0501072_0805640 3300049588 Bacteria 735
1275 Ga0501072_1260303 3300049588 Bacteria 573
1276 Ga0501073_0266650 3300049589 Bacteria 1182
1277 Ga0501073_0867191 3300049589 Bacteria 622
1278 Ga0501074_0094434 3300049590 Bacteria 2142
1279 Ga0501074_0296706 3300049590 Bacteria 1148
1280 Ga0501074_0467167 3300049590 Bacteria 894
1281 Ga0501075_0040980 3300049591 Bacteria 3470
1282 Ga0501075_0063619 3300049591 Bacteria 2782
1283 Ga0501075_0283479 3300049591 Bacteria 1262
1284 Ga0501075_0617104 3300049591 Bacteria 827
1285 Ga0501076_0016244 3300049592 Bacteria 5640
1286 Ga0501076_0546443 3300049592 Bacteria 955
1287 Ga0501076_0564578 3300049592 Bacteria 938
1288 Ga0501077_0199150 3300049593 Bacteria 1272
1289 Ga0501077_0627696 3300049593 Bacteria 690
1290 Ga0501077_0680884 3300049593 Bacteria 661
1291 Ga0501233_131170 3300049668 Bacteria 685
1292 Ga0501079_0011823 3300049741 Bacteria 6664
1293 Ga0501079_0097220 3300049741 Bacteria 2283
1294 Ga0501079_0238445 3300049741 Bacteria 1421
1295 Ga0501079_0409211 3300049741 Bacteria 1064
1296 Ga0501079_0602016 3300049741 Bacteria 865
1297 Ga0501080_0249732 3300049742 Bacteria 1618
1298 Ga0501080_0532856 3300049742 Bacteria 1047
1299 Ga0501080_1769455 3300049742 Bacteria 520
1300 Ga0501081_0042676 3300049743 Bacteria 3109
1301 Ga0501081_0170953 3300049743 Bacteria 1569
1302 Ga0501035_0619261 3300049822 Bacteria 880
1303 Ga0501044_0004942 3300049823 Bacteria 14911
1304 Ga0501045_0047261 3300049824 Bacteria 3135
1305 Ga0501045_0051324 3300049824 Bacteria 3010
1306 Ga0501045_0088902 3300049824 Bacteria 2282
1307 Ga0501045_0976161 3300049824 Bacteria 621
1308 nmdc:mga03683_34547_c1 3300050489 Bacteria 2046
1309 nmdc:mga03683_89783_c1 3300050489 Bacteria 1338
1310 nmdc:mga03n38_441130_c1 3300050490 Bacteria 723
1311 nmdc:mga03n38_58928_c1 3300050490 Bacteria 1163
1312 nmdc:mga03n38_757860_c1 3300050490 Bacteria 563
1313 nmdc:mga03n38_9489_c1 3300050490 Bacteria 3543
1314 nmdc:mga03n38_962247_c1 3300050490 Bacteria 504
1315 nmdc:mga00v17_1029218_c1 3300050491 Bacteria 518
1316 nmdc:mga00v17_120558_c1 3300050491 Bacteria 1669
1317 nmdc:mga00v17_229031_c1 3300050491 Bacteria 1204
1318 nmdc:mga00v17_2601_c1 3300050491 Bacteria 9255
1319 nmdc:mga00v17_340293_c1 3300050491 Bacteria 975
1320 nmdc:mga00v17_390796_c1 3300050491 Bacteria 904
1321 nmdc:mga00v17_465849_c1 3300050491 Bacteria 820
1322 nmdc:mga00v17_665_c1 3300050491 Bacteria 18923
1323 nmdc:mga00v17_85970_c1 3300050491 Bacteria 1970
1324 nmdc:mga0yw44_100143_c1 3300050492 Bacteria 1845
1325 nmdc:mga0yw44_116064_c1 3300050492 Bacteria 1720
1326 nmdc:mga0yw44_136706_c2 3300050492 Bacteria 1063
1327 nmdc:mga0yw44_1398_c1 3300050492 Bacteria 9570
1328 nmdc:mga0yw44_20263_c1 3300050492 Bacteria 3687
1329 nmdc:mga0yw44_23801_c1 3300050492 Bacteria 3455
1330 nmdc:mga0yw44_264923_c1 3300050492 Bacteria 1146
1331 nmdc:mga0yw44_266490_c1 3300050492 Bacteria 1143
1332 nmdc:mga0yw44_266629_c1 3300050492 Bacteria 1142
1333 nmdc:mga0yw44_291750_c1 3300050492 Bacteria 1092
1334 nmdc:mga0yw44_30363_c1 3300050492 Bacteria 3130
1335 nmdc:mga0yw44_350254_c1 3300050492 Bacteria 994
1336 nmdc:mga0yw44_351579_c1 3300050492 Bacteria 992
1337 nmdc:mga0yw44_44_c1 3300050492 Bacteria 41809
1338 nmdc:mga0yw44_5924_c1 3300050492 Bacteria 5845
1339 nmdc:mga0yw44_671996_c1 3300050492 Bacteria 704
1340 nmdc:mga0yw44_78724_c1 3300050492 Bacteria 1242
1341 nmdc:mga0yw44_890002_c1 3300050492 Bacteria 604
1342 nmdc:mga0k408_128180_c1 3300050493 Bacteria 1505
1343 nmdc:mga06z11_243384_c1 3300050494 Bacteria 758
1344 nmdc:mga06z11_433103_c1 3300050494 Bacteria 793
1345 nmdc:mga06z11_5925_c1 3300050494 Bacteria 4938
1346 nmdc:mga06z11_87353_c1 3300050494 Bacteria 1686
1347 nmdc:mga04h51_10254_c1 3300050495 Bacteria 2568
1348 nmdc:mga04h51_162539_c1 3300050495 Bacteria 860
1349 nmdc:mga04h51_240725_c1 3300050495 Bacteria 722
1350 nmdc:mga04h51_305950_c1 3300050495 Bacteria 649
1351 nmdc:mga04h51_380778_c1 3300050495 Bacteria 588
1352 nmdc:mga05p37_1308842_c1 3300050507 Bacteria 738
1353 nmdc:mga05p37_557454_c1 3300050507 Bacteria 1303
1354 nmdc:mga09592_800048_c1 3300050508 Bacteria 797
1355 nmdc:mga08y16_393274_c1 3300050511 Bacteria 1420
1356 nmdc:mga08y16_880295_c1 3300050511 Bacteria 883
1357 nmdc:mga0rr50_1129583_c1 3300050513 Bacteria 666
1358 Ga0500635_0006792 3300053080 Bacteria 3070
1359 Ga0495595_0279429 3300053084 Bacteria 838
1360 Ga0495595_0336813 3300053084 Bacteria 761
1361 Ga0495595_0705211 3300053084 Bacteria 517
1362 Ga0495619_0263881 3300053085 Bacteria 1193
1363 Ga0495619_0773339 3300053085 Bacteria 650
1364 Ga0500644_0375618 3300053088 Bacteria 617
1365 Ga0500646_0026544 3300053090 Bacteria 1571
1366 Ga0500646_0122618 3300053090 Bacteria 837
1367 Ga0500583_0139854 3300053092 Bacteria 1203
1368 Ga0500583_0197939 3300053092 Bacteria 999
1369 Ga0500566_0000532 3300053094 Bacteria 21366
1370 Ga0500566_0120764 3300053094 Bacteria 1413
1371 Ga0500628_210638 3300053129 Bacteria 563
1372 Ga0500655_036960 3300053133 Bacteria 952
1373 Ga0500620_031846 3300053155 Bacteria 1675
1374 Ga0501084_0271980 3300054114 Bacteria 1430
1375 Ga0501084_0326735 3300054114 Bacteria 1295
1376 Ga0501084_1328679 3300054114 Bacteria 602
1377 Ga0587066_108309 3300059490 Bacteria 641
1378 Ga0587077_171293 3300059493 Bacteria 582
1379 Ga0587082_033158 3300059504 Bacteria 911
1380 Ga0587082_037518 3300059504 Bacteria 874
1381 Ga0587083_0019282 3300059505 Bacteria 1244
1382 Ga0587086_020163 3300059507 Bacteria 903
1383 Ga0587088_133956 3300059508 Bacteria 585
1384 Ga0587098_077308 3300059604 Bacteria 549
1385 Ga0587106_136637 3300059605 Bacteria 534
1386 Ga0587101_081851 3300059623 Bacteria 613
1387 Ga0587128_097622 3300059630 Bacteria 611
1388 Ga0587068_037772 3300059641 Bacteria 863
1389 Ga0587068_090856 3300059641 Bacteria 629
1390 Ga0587072_044446 3300059643 Bacteria 873
1391 Ga0587076_189371 3300059645 Bacteria 523
1392 Ga0587079_088058 3300059647 Bacteria 722
1393 Ga0587079_176608 3300059647 Bacteria 569
1394 Ga0587107_022277 3300059652 Bacteria 895
1395 Ga0587110_009122 3300059654 Bacteria 969
1396 Ga0501082_0197947 3300060353 Bacteria 1748
1397 Ga0501082_0862328 3300060353 Bacteria 792
1398 Ga0530510_0008292 3300061734 Bacteria 7245
1399 Ga0530510_0298484 3300061734 Bacteria 1205
1400 Ga0530510_0937047 3300061734 Bacteria 662
1401 Ga0500635_0320462
1402 JGI24736J21556_1020459
1403 JGI25151J46595_10020691
1404 JGI25153J46596_10142022
1405 Ga0007409J51694_1091639
1406 Ga0055524_1013072
1407 Ga0055524_1016559
1408 Ga0055536_1001953
1409 Ga0055536_1021661
1410 Ga0055536_1022461
1411 Ga0055534_1008037
1412 Ga0055534_1014588
1413 Ga0055530_10000578
1414 Ga0055540_1059529
1415 Ga0055531_10005972
1416 Ga0055531_10076138
1417 Ga0055531_10083302
1418 Ga0058860_11886216
1419 Ga0070658_10230542
1420 Ga0070658_10271818
1421 Ga0070658_10320468
1422 Ga0070676_10035996
1423 Ga0070683_100009342
1424 Ga0070683_100164501
1425 Ga0070683_100193432
1426 Ga0070683_100702525
1427 Ga0070683_100841158
1428 Ga0070683_101019396
1429 Ga0070690_100152737
1430 Ga0070690_100561832
1431 Ga0070670_100008384
1432 Ga0070670_100020647
1433 Ga0070670_100301931
1434 Ga0070670_100879245
1435 Ga0070677_10585781
1436 Ga0068869_100082842
1437 Ga0068869_100089544
1438 Ga0068869_101175118
1439 Ga0068869_101456232
1440 Ga0070666_10001853
1441 Ga0070666_10001858
1442 Ga0070666_10104933
1443 Ga0070666_10106699
1444 Ga0070666_10152584
1445 Ga0070666_10313345
1446 Ga0070666_11518868
1447 Ga0070680_100168007
1448 Ga0070680_100783916
1449 Ga0070680_101370827
1450 Ga0070682_100702611
1451 Ga0068868_100002892
1452 Ga0068868_100023407
1453 Ga0068868_100052388
1454 Ga0068868_100073533
1455 Ga0068868_100245090
1456 Ga0068868_100917469
1457 Ga0070660_100309699
1458 Ga0070660_100526478
1459 Ga0070689_100062330
1460 Ga0070689_100118587
1461 Ga0070691_10437858
1462 Ga0070661_100317167
1463 Ga0070661_100744294
1464 Ga0070661_100797306
1465 Ga0070661_101488612
1466 Ga0070692_11101637
1467 Ga0070668_100061913
1468 Ga0070668_100123105
1469 Ga0070668_100158266
1470 Ga0070668_100470118
1471 Ga0070668_101156304
1472 Ga0070675_100131501
1473 Ga0070675_100580587
1474 Ga0070675_102075178
1475 Ga0070671_100216956
1476 Ga0070671_100478445
1477 Ga0070671_100555740
1478 Ga0070671_100594802
1479 Ga0070671_100623307
1480 Ga0070671_100651630
1481 Ga0070671_100794062
1482 Ga0070671_101128638
1483 Ga0070674_100055299
1484 Ga0070674_100096952
1485 Ga0070674_100242595
1486 Ga0070674_101047912
1487 Ga0070674_101842572
1488 Ga0070673_100200402
1489 Ga0070673_100229682
1490 Ga0070673_100243952
1491 Ga0070688_100035680
1492 Ga0070659_100070335
1493 Ga0070659_100396649
1494 Ga0070667_100012108
1495 Ga0070667_100050487
1496 Ga0070667_100168848
1497 Ga0070667_100239742
1498 Ga0070667_100601514
1499 Ga0070667_101972865
1500 Ga0070709_10040805
1501 Ga0070709_10190549
1502 Ga0070709_10250424
1503 Ga0070714_100222825
1504 Ga0070713_100398392
1505 Ga0070713_101274783
1506 Ga0070710_11204827
1507 Ga0070701_11217311
1508 Ga0070711_100502744
1509 Ga0070711_100646771
1510 Ga0070705_100606260
1511 Ga0070700_100090819
1512 Ga0070700_100356404
1513 Ga0070700_101307374
1514 Ga0070700_101810937
1515 Ga0070694_100356639
1516 Ga0070694_100888618
1517 Ga0070708_100790466
1518 Ga0070663_100006966
1519 Ga0070663_100431874
1520 Ga0070663_100600003
1521 Ga0070663_100839526
1522 Ga0070663_101834212
1523 Ga0070678_100184141
1524 Ga0070678_100185081
1525 Ga0070678_100251181
1526 Ga0070678_100264027
1527 Ga0070678_100837154
1528 Ga0070662_100089159
1529 Ga0070662_100191719
1530 Ga0070662_100235573
1531 Ga0070662_100598881
1532 Ga0070662_101272128
1533 Ga0070662_101306613
1534 Ga0070681_10032389
1535 Ga0070681_10434936
1536 Ga0070681_10844164
1537 Ga0068867_100009183
1538 Ga0068867_100025867
1539 Ga0068867_100084237
1540 Ga0068867_100376064
1541 Ga0068867_102387584
1542 Ga0070685_10000451
1543 Ga0070685_10513131
1544 Ga0070685_11574634
1545 Ga0070698_101333024
1546 Ga0070679_100097653
1547 Ga0070679_100466649
1548 Ga0070679_100682259
1549 Ga0070679_101148126
1550 Ga0070684_100116954
1551 Ga0070684_100175239
1552 Ga0070684_100559071
1553 Ga0070684_100756026
1554 Ga0070684_101091014
1555 Ga0070684_101526321
1556 Ga0068853_100071363
1557 Ga0068853_100100623
1558 Ga0068853_100136744
1559 Ga0068853_100371171
1560 Ga0068853_100411923
1561 Ga0068853_100464408
1562 Ga0068853_100562116
1563 Ga0068853_100624342
1564 Ga0068853_100734184
1565 Ga0068853_101527667
1566 Ga0070672_100001795
1567 Ga0070672_100146908
1568 Ga0070672_100191976
1569 Ga0070672_100683935
1570 Ga0070686_100011927
1571 Ga0070686_100048036
1572 Ga0070686_100525036
1573 Ga0070686_100596289
1574 Ga0070693_100100982
1575 Ga0070693_100121565
1576 Ga0070693_100357862
1577 Ga0070693_100536104
1578 Ga0070693_100542601
1579 Ga0070665_100004571
1580 Ga0070665_100103330
1581 Ga0070665_100223338
1582 Ga0070665_100685398
1583 Ga0070665_101429234
1584 Ga0070704_101360420
1585 Ga0068855_100000432
1586 Ga0068855_100002034
1587 Ga0068855_100132552
1588 Ga0068855_100238567
1589 Ga0068855_100672786
1590 Ga0068855_100777737
1591 Ga0068855_100823119
1592 Ga0068855_102299715
1593 Ga0068855_102359364
1594 Ga0070664_100000726
1595 Ga0070664_100114705
1596 Ga0070664_100403208
1597 Ga0070664_100463468
1598 Ga0070664_100567162
1599 Ga0068857_100000096
1600 Ga0068857_100047219
1601 Ga0068857_100060204
1602 Ga0068857_100133139
1603 Ga0068857_100386761
1604 Ga0068857_100407995
1605 Ga0068857_100698433
1606 Ga0068857_102017329
1607 Ga0068854_100000554
1608 Ga0068854_100024664
1609 Ga0068854_100045641
1610 Ga0068854_100223761
1611 Ga0068854_100464268
1612 Ga0068854_101042823
1613 Ga0068856_100000179
1614 Ga0068856_100002175
1615 Ga0068856_100193004
1616 Ga0068856_100386850
1617 Ga0068856_100539649
1618 Ga0070702_100024290
1619 Ga0070702_100055642
1620 Ga0070702_100122007
1621 Ga0070702_100167315
1622 Ga0070702_100520411
1623 Ga0068852_100010460
1624 Ga0068852_100035832
1625 Ga0068852_100209869
1626 Ga0068852_100400190
1627 Ga0068852_100627068
1628 Ga0068859_100010599
1629 Ga0068859_100136484
1630 Ga0068859_100237623
1631 Ga0068859_101049795
1632 Ga0068859_101855626
1633 Ga0068864_100000129
1634 Ga0068864_100011149
1635 Ga0068864_100227870
1636 Ga0068864_100602769
1637 Ga0068864_101270974
1638 Ga0068866_10007138
1639 Ga0068866_10010050
1640 Ga0068866_10064147
1641 Ga0068866_10343585
1642 Ga0068861_100038831
1643 Ga0068861_100039875
1644 Ga0068861_100153483
1645 Ga0068861_100244554
1646 Ga0068861_100647643
1647 Ga0068851_10003554
1648 Ga0068870_10045752
1649 Ga0068870_10089992
1650 Ga0068870_10448127
1651 Ga0068863_100005116
1652 Ga0068863_100026366
1653 Ga0068863_100090500
1654 Ga0068863_100170884
1655 Ga0068863_100183012
1656 Ga0068863_100243488
1657 Ga0068863_100423207
1658 Ga0068863_100458082
1659 Ga0068863_100595675
1660 Ga0068863_100870858
1661 Ga0068863_101287007
1662 Ga0068858_100025071
1663 Ga0068858_100030716
1664 Ga0068858_100124922
1665 Ga0068858_100213797
1666 Ga0068858_100255257
1667 Ga0068858_100627282
1668 Ga0068858_100635556
1669 Ga0068858_100725982
1670 Ga0068858_100744839
1671 Ga0068858_100828650
1672 Ga0068858_102369603
1673 Ga0068860_100004438
1674 Ga0068860_100027327
1675 Ga0068860_100091037
1676 Ga0068860_100365661
1677 Ga0068860_100510384
1678 Ga0068860_100603674
1679 Ga0068860_102397800
1680 Ga0068862_101456482
1681 Ga0068862_101952538
1682 Ga0081455_10799957
1683 Ga0081540_1001046
1684 Ga0081540_1117627
1685 Ga0075365_10009641
1686 Ga0075365_10021278
1687 Ga0075365_10042348
1688 Ga0075365_10066208
1689 Ga0075365_10081217
1690 Ga0075365_10171080
1691 Ga0075365_10195685
1692 Ga0075365_10209985
1693 Ga0075365_10229439
1694 Ga0075365_10239001
1695 Ga0075365_10271012
1696 Ga0075365_10273148
1697 Ga0075365_11035369
1698 Ga0075368_10018412
1699 Ga0075368_10274749
1700 Ga0075368_10329156
1701 Ga0075368_10342364
1702 Ga0075368_10398090
1703 Ga0075363_100024237
1704 Ga0075363_100071908
1705 Ga0075363_100347545
1706 Ga0075364_10001125
1707 Ga0075364_10018799
1708 Ga0075364_10086675
1709 Ga0075364_10181730
1710 Ga0075364_10387297
1711 Ga0075364_10402584
1712 Ga0075364_10493870
1713 Ga0075364_11249850
1714 Ga0070715_10154698
1715 Ga0070712_100264735
1716 Ga0075367_10017493
1717 Ga0075367_10032975
1718 Ga0075367_10067400
1719 Ga0075367_10088617
1720 Ga0075367_10210472
1721 Ga0075367_10243957
1722 Ga0075367_10515075
1723 Ga0075367_10697495
1724 Ga0075366_10711803
1725 Ga0097621_100000196
1726 Ga0097621_100002114
1727 Ga0097621_100019556
1728 Ga0097621_100159978
1729 Ga0097621_100288304
1730 Ga0097621_100385197
1731 Ga0097621_100407750
1732 Ga0075370_10623732
1733 Ga0068871_100000049
1734 Ga0068871_100027217
1735 Ga0068871_100047305
1736 Ga0068871_100071763
1737 Ga0068871_100133563
1738 Ga0068871_100138395
1739 Ga0068871_100227044
1740 Ga0068871_100338812
1741 Ga0075428_100101055
1742 Ga0075431_101115607
1743 Ga0075429_100456305
1744 Ga0075429_100756886
1745 Ga0068865_100016213
1746 Ga0068865_100070890
1747 Ga0068865_100077435
1748 Ga0068865_100179459
1749 Ga0068865_100188845
1750 Ga0068865_100398524
1751 Ga0068865_100742490
1752 Ga0068865_100750310
1753 Ga0097620_100010599
1754 Ga0097620_100136488
1755 Ga0097620_100237623
1756 Ga0097620_101049746
1757 Ga0097620_101855547
1758 Ga0099824_1019323
1759 Ga0105240_10000906
1760 Ga0105240_10004993
1761 Ga0105240_10027081
1762 Ga0105240_10027316
1763 Ga0105240_10088014
1764 Ga0105240_10155563
1765 Ga0105240_10251728
1766 Ga0105240_10265229
1767 Ga0105240_10279530
1768 Ga0105240_11861069
1769 Ga0105240_12426867
1770 Ga0111539_10175933
1771 Ga0111539_10371110
1772 Ga0111539_11274521
1773 Ga0105245_10187338
1774 Ga0105245_10188072
1775 Ga0105245_10896004
1776 Ga0105245_11019902
1777 Ga0105247_10288387
1778 Ga0105247_10778532
1779 Ga0105247_11601429
1780 Ga0114129_10604548
1781 Ga0105243_10041324
1782 Ga0105243_10042566
1783 Ga0105243_10090932
1784 Ga0105243_10408280
1785 Ga0105243_10501008
1786 Ga0105243_10657632
1787 Ga0105243_11165715
1788 Ga0105243_11231758
1789 Ga0105241_10032759
1790 Ga0105241_10120160
1791 Ga0105241_10431342
1792 Ga0105241_10644028
1793 Ga0105241_11338911
1794 Ga0105241_12560117
1795 Ga0105242_10012056
1796 Ga0105242_10042305
1797 Ga0105242_10423519
1798 Ga0105242_10886616
1799 Ga0105242_11228100
1800 Ga0105242_11832603
1801 Ga0105242_12312340
1802 Ga0105248_10010283
1803 Ga0105248_10017949
1804 Ga0105248_10081498
1805 Ga0105248_10164087
1806 Ga0105248_10242008
1807 Ga0105248_10310979
1808 Ga0105248_10415691
1809 Ga0105248_10640126
1810 Ga0105248_10992361
1811 Ga0105237_10009430
1812 Ga0105237_10066651
1813 Ga0105237_10333521
1814 Ga0105237_10628663
1815 Ga0105237_10672051
1816 Ga0105237_10898148
1817 Ga0105237_11075995
1818 Ga0105238_10009376
1819 Ga0105238_10023690
1820 Ga0105238_10036707
1821 Ga0105238_10052956
1822 Ga0105238_10082010
1823 Ga0105238_10097773
1824 Ga0105238_10327534
1825 Ga0105238_10452257
1826 Ga0105238_10495788
1827 Ga0105238_10790803
1828 Ga0105249_10048096
1829 Ga0105249_10159404
1830 Ga0105249_10179568
1831 Ga0105249_10279928
1832 Ga0105249_10300706
1833 Ga0105249_10594681
1834 Ga0105239_10038937
1835 Ga0105239_10049542
1836 Ga0105239_10134538
1837 Ga0105239_10134956
1838 Ga0105239_10150239
1839 Ga0105239_10275935
1840 Ga0105239_11043199
1841 Ga0105239_11424567
1842 Ga0105246_10016866
1843 Ga0105246_10077748
1844 Ga0105246_10121355
1845 Ga0105246_10767720
1846 Ga0105246_11133405
1847 Ga0105246_11474086
1848 Ga0157318_1007034
1849 Ga0157339_1003561
1850 Ga0157316_1050929
1851 Ga0157327_1005852
1852 Ga0157338_1007600
1853 Ga0157373_10130661
1854 Ga0157371_10163129
1855 Ga0157371_10189802
1856 Ga0157371_10695988
1857 Ga0157371_10790493
1858 Ga0157370_10110028
1859 Ga0157370_10617216
1860 Ga0157370_11946286
1861 Ga0157369_10019968
1862 Ga0157369_10075339
1863 Ga0157369_10360373
1864 Ga0157369_10425283
1865 Ga0157369_10431777
1866 Ga0157369_10442977
1867 Ga0157369_10599162
1868 Ga0157374_10000062
1869 Ga0157374_10021722
1870 Ga0157374_10106725
1871 Ga0157374_10150309
1872 Ga0157374_10253738
1873 Ga0157374_10518609
1874 Ga0157374_10816210
1875 Ga0157378_10000009
1876 Ga0157378_10000366
1877 Ga0157378_10002258
1878 Ga0157378_10025295
1879 Ga0157378_10106770
1880 Ga0157378_10245045
1881 Ga0157378_10818152
1882 Ga0157378_10997973
1883 Ga0163162_10000028
1884 Ga0163162_10071763
1885 Ga0163162_10082672
1886 Ga0163162_10151115
1887 Ga0163162_10329599
1888 Ga0163162_10605705
1889 Ga0163162_10651778
1890 Ga0163162_11730171
1891 Ga0163162_11925388
1892 Ga0163162_12515910
1893 Ga0163162_12811305
1894 Ga0157372_10001184
1895 Ga0157372_10002204
1896 Ga0157372_10008186
1897 Ga0157372_10111977
1898 Ga0157372_10292790
1899 Ga0157372_10303986
1900 Ga0157372_10307674
1901 Ga0157372_10334834
1902 Ga0157375_10001583
1903 Ga0157375_10031568
1904 Ga0157375_10072749
1905 Ga0157375_10084786
1906 Ga0157375_10213455
1907 Ga0157375_10730150
1908 Ga0157375_11076585
1909 Ga0157375_12341202
1910 Ga0157375_13165977
1911 Ga0163163_10001955
1912 Ga0163163_10004520
1913 Ga0163163_10103355
1914 Ga0163163_10270330
1915 Ga0163163_10495605
1916 Ga0163163_12569231
1917 Ga0157380_10020607
1918 Ga0157380_10269114
1919 Ga0157380_10505670
1920 Ga0157380_10770206
1921 Ga0157380_11276160
1922 Ga0182008_10049225
1923 Ga0182008_10481120
1924 Ga0182008_10525419
1925 Ga0157377_10151536
1926 Ga0157377_10279058
1927 Ga0157379_10000319
1928 Ga0157379_10030697
1929 Ga0157379_10245833
1930 Ga0157379_10365956
1931 Ga0157379_10548003
1932 Ga0157379_11033142
1933 Ga0157379_11298238
1934 Ga0157376_10082837
1935 Ga0157376_10093047
1936 Ga0157376_10105381
1937 Ga0157376_10122466
1938 Ga0157376_10189556
1939 Ga0157376_10258581
1940 Ga0157376_10260700
1941 Ga0157376_10484450
1942 Ga0157376_10508205
1943 Ga0157376_11043313
1944 Ga0157376_11139105
1945 Ga0163161_10005516
1946 Ga0163161_10015892
1947 Ga0163161_10201622
1948 Ga0163161_10203088
1949 Ga0163161_10363611
1950 Ga0163161_10554401
1951 Ga0163161_11628128
1952 Ga0163161_11943241
1953 Ga0206356_11689876
1954 Ga0206349_1714749
1955 Ga0206353_11171569
1956 Ga0206353_11366746
1957 Ga0206353_11586967
1958 Ga0209673_1007174
1959 Ga0209673_1072312
1960 Ga0209130_1011708
1961 Ga0209675_1004813
1962 Ga0209675_1004817
1963 Ga0209676_1001568
1964 Ga0209676_1002588
1965 Ga0209676_1002747
1966 Ga0209676_1003093
1967 Ga0209676_1033031
1968 Ga0209676_1068054
1969 Ga0209025_1000454
1970 Ga0209025_1011745
1971 Ga0209025_1020449
1972 Ga0209025_1033207
1973 Ga0209025_1067527
1974 Ga0209025_1191523
1975 Ga0209564_1003082
1976 Ga0209758_1053082
1977 Ga0209758_1112180
1978 Ga0209050_1000865
1979 Ga0209050_1008800
1980 Ga0209256_1005269
1981 Ga0209256_1006382
1982 Ga0209051_1029660
1983 Ga0209257_1000154
1984 Ga0209257_1001025
1985 Ga0209257_1001296
1986 Ga0209257_1015047
1987 Ga0207697_10157211
1988 Ga0207656_10001724
1989 Ga0207656_10112803
1990 Ga0207682_10143516
1991 Ga0207682_10171017
1992 Ga0207692_10969175
1993 Ga0207642_10007476
1994 Ga0207642_10118473
1995 Ga0207642_10741856
1996 Ga0207688_10044138
1997 Ga0207680_10001162
1998 Ga0207680_10007152
1999 Ga0207680_10359870
2000 Ga0207680_10456999
2001 Ga0207680_10704104
2002 Ga0207647_10000024
2003 Ga0207647_10002046
2004 Ga0207647_10063045
2005 Ga0207647_10487124
2006 Ga0207647_10548242
2007 Ga0207647_10801934
2008 Ga0207699_10070829
2009 Ga0207699_10341074
2010 Ga0207699_10429108
2011 Ga0207645_10025001
2012 Ga0207643_10125350
2013 Ga0207643_10127157
2014 Ga0207643_10380027
2015 Ga0207705_10149766
2016 Ga0207705_10373572
2017 Ga0207705_10634513
2018 Ga0207705_11074411
2019 Ga0207654_10006477
2020 Ga0207654_10015692
2021 Ga0207654_10065026
2022 Ga0207654_10100463
2023 Ga0207654_10266358
2024 Ga0207707_10001452
2025 Ga0207707_10052277
2026 Ga0207695_10000040
2027 Ga0207695_10002176
2028 Ga0207695_10006210
2029 Ga0207695_10016274
2030 Ga0207695_10022021
2031 Ga0207695_10025623
2032 Ga0207695_10038774
2033 Ga0207695_10040956
2034 Ga0207695_10533362
2035 Ga0207695_10827735
2036 Ga0207671_10002984
2037 Ga0207671_10009442
2038 Ga0207671_10018841
2039 Ga0207671_10405775
2040 Ga0207671_10496425
2041 Ga0207671_10577850
2042 Ga0207671_11167927
2043 Ga0207693_10286913
2044 Ga0207663_10152669
2045 Ga0207663_11091975
2046 Ga0207660_10416195
2047 Ga0207660_10722308
2048 Ga0207660_11349006
2049 Ga0207662_10040240
2050 Ga0207657_10000326
2051 Ga0207657_10511310
2052 Ga0207657_11111319
2053 Ga0207649_10004643
2054 Ga0207649_10159208
2055 Ga0207649_10270891
2056 Ga0207649_10532696
2057 Ga0207649_10585098
2058 Ga0207649_10788992
2059 Ga0207649_10869496
2060 Ga0207652_10016784
2061 Ga0207652_10203273
2062 Ga0207652_11194063
2063 Ga0207652_11427174
2064 Ga0207652_11478752
2065 Ga0207681_10137587
2066 Ga0207681_10552603
2067 Ga0207681_11511191
2068 Ga0207694_10001319
2069 Ga0207694_10006000
2070 Ga0207694_10010865
2071 Ga0207694_10040794
2072 Ga0207694_10041105
2073 Ga0207694_10143818
2074 Ga0207694_10358811
2075 Ga0207694_10591577
2076 Ga0207694_11250158
2077 Ga0207650_10003597
2078 Ga0207650_10007026
2079 Ga0207650_10150236
2080 Ga0207650_10162989
2081 Ga0207659_10277557
2082 Ga0207659_10518814
2083 Ga0207659_10995151
2084 Ga0207659_11649400
2085 Ga0207687_10140730
2086 Ga0207687_10158132
2087 Ga0207687_10583760
2088 Ga0207687_10584936
2089 Ga0207687_10676723
2090 Ga0207687_10888147
2091 Ga0207700_10353069
2092 Ga0207700_10595647
2093 Ga0207644_10174600
2094 Ga0207644_10251177
2095 Ga0207644_10344765
2096 Ga0207644_10873267
2097 Ga0207690_10833288
2098 Ga0207690_10838427
2099 Ga0207690_10909924
2100 Ga0207706_10006512
2101 Ga0207706_10113646
2102 Ga0207706_10261519
2103 Ga0207706_10400407
2104 Ga0207706_11139690
2105 Ga0207706_11167617
2106 Ga0207706_11392604
2107 Ga0207686_10015548
2108 Ga0207686_10138086
2109 Ga0207686_10416366
2110 Ga0207686_10450316
2111 Ga0207686_10767744
2112 Ga0207686_11279916
2113 Ga0207686_11737595
2114 Ga0207709_10027510
2115 Ga0207709_10213470
2116 Ga0207670_10293221
2117 Ga0207669_10025336
2118 Ga0207669_10159282
2119 Ga0207669_10258036
2120 Ga0207704_10018725
2121 Ga0207704_10021380
2122 Ga0207704_10064222
2123 Ga0207704_10096787
2124 Ga0207704_10381941
2125 Ga0207704_10741225
2126 Ga0207704_11001374
2127 Ga0207704_11484772
2128 Ga0207704_11852943
2129 Ga0207665_11018767
2130 Ga0207691_10027848
2131 Ga0207691_10062400
2132 Ga0207691_10101776
2133 Ga0207691_10300986
2134 Ga0207691_10345714
2135 Ga0207691_10437193
2136 Ga0207691_10612968
2137 Ga0207711_10001544
2138 Ga0207711_10006123
2139 Ga0207711_10009684
2140 Ga0207711_10019526
2141 Ga0207711_10203021
2142 Ga0207711_10261515
2143 Ga0207711_10328735
2144 Ga0207711_10721443
2145 Ga0207689_10169299
2146 Ga0207689_10192430
2147 Ga0207689_11024129
2148 Ga0207689_11253393
2149 Ga0207661_10059158
2150 Ga0207661_10059225
2151 Ga0207661_10115744
2152 Ga0207661_10992832
2153 Ga0207661_11739692
2154 Ga0207679_10001856
2155 Ga0207679_10204991
2156 Ga0207679_10290784
2157 Ga0207679_10447035
2158 Ga0207679_11688830
2159 Ga0207667_10000465
2160 Ga0207667_10001399
2161 Ga0207667_10027253
2162 Ga0207667_10080008
2163 Ga0207667_10141308
2164 Ga0207667_10373465
2165 Ga0207667_11036637
2166 Ga0207667_11127458
2167 Ga0207651_10320214
2168 Ga0207651_10334158
2169 Ga0207651_10485762
2170 Ga0207651_10882676
2171 Ga0207651_11719631
2172 Ga0207712_10000275
2173 Ga0207712_10030485
2174 Ga0207712_10040634
2175 Ga0207712_10177825
2176 Ga0207712_10688910
2177 Ga0207712_10882859
2178 Ga0207668_10072961
2179 Ga0207668_10316378
2180 Ga0207668_10461821
2181 Ga0207640_10003205
2182 Ga0207640_10018145
2183 Ga0207640_10030688
2184 Ga0207640_10056429
2185 Ga0207640_10065293
2186 Ga0207640_10098411
2187 Ga0207640_10212413
2188 Ga0207658_10011118
2189 Ga0207658_10097209
2190 Ga0207658_10200064
2191 Ga0207658_10511296
2192 Ga0207658_10788387
2193 Ga0207658_11393045
2194 Ga0207658_11677120
2195 Ga0207677_10010569
2196 Ga0207677_10096166
2197 Ga0207677_10096831
2198 Ga0207677_10207950
2199 Ga0207677_10460226
2200 Ga0207677_10486879
2201 Ga0207677_10871921
2202 Ga0207703_10001612
2203 Ga0207703_10013731
2204 Ga0207703_10022458
2205 Ga0207703_10026541
2206 Ga0207703_10068511
2207 Ga0207703_10413352
2208 Ga0207703_10426585
2209 Ga0207703_10536610
2210 Ga0207703_10546625
2211 Ga0207703_11229443
2212 Ga0207639_10000116
2213 Ga0207639_10001494
2214 Ga0207639_10005911
2215 Ga0207639_10050029
2216 Ga0207639_10180619
2217 Ga0207639_10330641
2218 Ga0207639_11875370
2219 Ga0207678_10005905
2220 Ga0207678_10223153
2221 Ga0207678_10707280
2222 Ga0207678_11491716
2223 Ga0207678_11662131
2224 Ga0207708_10161011
2225 Ga0207708_10294154
2226 Ga0207702_10001051
2227 Ga0207702_10008697
2228 Ga0207702_10013885
2229 Ga0207702_10036300
2230 Ga0207702_10216397
2231 Ga0207702_10549727
2232 Ga0207641_10020771
2233 Ga0207641_10022745
2234 Ga0207641_10025422
2235 Ga0207641_10073518
2236 Ga0207641_10140241
2237 Ga0207641_10529347
2238 Ga0207641_10973412
2239 Ga0207641_11150095
2240 Ga0207641_11827313
2241 Ga0207641_11922758
2242 Ga0207648_10028264
2243 Ga0207648_10071363
2244 Ga0207648_10092387
2245 Ga0207648_10141728
2246 Ga0207648_10161034
2247 Ga0207648_10958181
2248 Ga0207648_11640543
2249 Ga0207676_10015306
2250 Ga0207676_10020158
2251 Ga0207676_10084369
2252 Ga0207676_10095677
2253 Ga0207676_10230810
2254 Ga0207676_10472482
2255 Ga0207676_11236738
2256 Ga0207676_11707682
2257 Ga0207676_12201449
2258 Ga0207676_12594716
2259 Ga0207674_10002111
2260 Ga0207674_10003692
2261 Ga0207674_10180643
2262 Ga0207674_10181195
2263 Ga0207674_10186230
2264 Ga0207674_10390820
2265 Ga0207674_10532582
2266 Ga0207674_10938633
2267 Ga0207674_11210336
2268 Ga0207674_11655389
2269 Ga0207674_11848943
2270 Ga0207675_100010284
2271 Ga0207675_100069455
2272 Ga0207675_100080251
2273 Ga0207675_100797267
2274 Ga0207675_100975801
2275 Ga0207683_10041514
2276 Ga0207683_10174299
2277 Ga0207683_10224289
2278 Ga0207683_10245372
2279 Ga0207683_10353144
2280 Ga0207683_10460767
2281 Ga0207683_10934410
2282 Ga0207683_11450479
2283 Ga0207698_10025790
2284 Ga0207698_10189561
2285 Ga0207698_10296992
2286 Ga0207698_10369316
2287 Ga0207698_10387578
2288 Ga0207698_10668990
2289 Ga0207698_11360110
2290 Ga0207698_12368509
2291 Ga0209971_1180016
2292 Ga0209813_10144077
2293 Ga0209813_10254670
2294 Ga0209813_10271466
2295 Ga0209813_10345713
2296 Ga0209974_10066110
2297 Ga0209974_10251929
2298 Ga0207428_10499733
2299 Ga0268266_10000008
2300 Ga0268266_10048529
2301 Ga0268266_10144893
2302 Ga0268266_10221390
2303 Ga0268265_10143946
2304 Ga0268265_12096315
2305 Ga0268264_10017059
2306 Ga0268264_10035419
2307 Ga0268264_10050247
2308 Ga0268264_10065648
2309 Ga0268264_10278908
2310 Ga0268264_10601297
2311 Ga0268264_11809743
2312 Ga0268264_12478561
2313 Ga0265766_1022650
2314 Ga0307513_11103177
2315 Ga0307408_100078352
2316 Ga0307408_100503230
2317 Ga0307508_10009148
2318 Ga0316575_10067027
2319 Ga0316575_10145067
2320 Ga0316575_10177475
2321 Ga0316579_10035148
2322 Ga0316579_10042354
2323 Ga0316579_10391337
2324 Ga0316576_10005896
2325 Ga0316576_10006214
2326 Ga0316576_10035004
2327 Ga0316576_10097808
2328 Ga0316576_10097962
2329 Ga0316576_10101454
2330 Ga0316576_10623041
2331 Ga0316578_10000785
2332 Ga0316578_10031889
2333 Ga0316578_10035472
2334 Ga0316578_10036064
2335 Ga0316578_10050639
2336 Ga0316578_10401498
2337 Ga0316578_10462580
2338 Ga0307516_10045126
2339 Ga0307405_10011566
2340 Ga0307405_10085176
2341 Ga0307405_10414640
2342 Ga0307405_10432868
2343 Ga0307405_11405812
2344 Ga0316577_10023857
2345 Ga0316577_10070727
2346 Ga0316577_10567628
2347 Ga0307413_10005154
2348 Ga0307410_10003872
2349 Ga0307410_10050867
2350 Ga0307410_10822939
2351 Ga0307410_11283329
2352 Ga0307406_10004191
2353 Ga0307406_10145381
2354 Ga0307406_10303100
2355 Ga0307407_10716221
2356 Ga0307412_10269682
2357 Ga0307409_100001007
2358 Ga0307409_100673996
2359 Ga0307409_101468556
2360 Ga0307416_100019061
2361 Ga0307416_100056399
2362 Ga0307416_100367485
2363 Ga0307416_101019506
2364 Ga0307414_11040822
2365 Ga0307411_10377180
2366 Ga0307411_10731470
2367 Ga0307415_100000190
2368 Ga0307415_100131400
2369 Ga0307415_100318770
2370 Ga0307415_100363344
2371 Ga0307415_101520076
2372 Ga0307415_101814762
2373 Ga0316585_10005493
2374 Ga0316580_10001392
2375 Ga0316592_1031132
2376 Ga0316596_1012403
2377 Ga0373938_0122376
2378 Ga0373928_0001559
2379 Ga0373929_0005769
2380 Ga0373944_0040699
2381 Ga0373949_0106882
2382 Ga0373932_0012957
2383 Ga0373956_0576659
2384 Ga0373943_0365343
2385 Ga0373943_0610319
2386 Ga0373946_0328855
2387 Ga0316574_0009298
2388 Ga0316574_0012164
2389 Ga0316574_0028980
2390 Ga0316574_0043707
2391 Ga0316574_0044640
2392 Ga0316574_0068255
2393 Ga0316574_0104517
2394 Ga0316574_0166127
2395 Ga0316574_0252697
2396 Ga0316574_0296427
2397 Ga0316574_0771780
2398 Ga0316574_0777003
2399 Ga0316574_0796423
2400 Ga0373931_0000006
2401 Ga0373931_0012253
2402 Ga0373931_0452825
2403 Ga0373931_0732471
2404 Ga0373933_0009250
2405 Ga0373937_0139768
2406 Ga0373937_1280912
2407 Ga0373937_1528419
2408 Ga0316582_0013632
2409 Ga0316582_0016194
2410 Ga0316582_0209094
2411 Ga0316584_0005439
2412 Ga0316584_0017406
2413 Ga0316584_0023461
2414 Ga0316584_0024065
2415 Ga0316584_0076261
2416 Ga0316584_0086520
2417 Ga0316584_0112103
2418 Ga0316584_0146323
2419 Ga0395900_0155816
2420 Ga0395898_0002525
2421 Ga0395901_0047958
2422 Ga0395901_0079626
2423 Ga0395901_0607616
2424 Ga0400485_10787
2425 Ga0400483_017383
2426 Ga0400483_035347
2427 Ga0400483_088865
2428 Ga0400483_136168
2429 Ga0400483_136484
2430 Ga0400483_182325
2431 Ga0400483_190738
2432 Ga0400483_259065
2433 Ga0436363_1130565
2434 Ga0439439_0022419
2435 Ga0439439_0058660
2436 Ga0439447_001969
2437 Ga0439465_0013327
2438 Ga0451789_0048425
2439 Ga0451793_0938620
2440 Ga0451795_0181400
2441 Ga0451795_0262903
2442 Ga0451802_0012644
2443 Ga0451802_1786781
2444 Ga0451807_1450121
2445 Ga0451837_0416935
2446 Ga0451839_0458029
2447 Ga0451841_0462125
2448 Ga0451841_0883188
2449 Ga0451843_0500007
2450 Ga0451855_1137734
2451 Ga0451853_1377382
2452 Ga0451853_2288329
2453 Ga0439445_0014698
2454 Ga0439432_007407
2455 Ga0439449_0017784
2456 Ga0439449_0057595
2457 Ga0439452_037293
2458 Ga0439457_006216
2459 Ga0439462_0001718
2460 Ga0439462_0057892
2461 Ga0439434_0068503
2462 Ga0439459_0223947
2463 Ga0451577_0192413
2464 Ga0453684_0066899
2465 Ga0466960_0008210
2466 Ga0451576_2035645
2467 Ga0466967_0272865
2468 Ga0466967_0606373
2469 Ga0495603_0066211
2470 Ga0495603_0102592
2471 Ga0495603_0306184
2472 Ga0495603_0499510
2473 Ga0495629_0123477
2474 Ga0495629_0277441
2475 Ga0495638_0048881
2476 Ga0495641_0124434
2477 Ga0495641_0245869
2478 Ga0495641_0276304
2479 Ga0495641_0538751
2480 Ga0495653_0607863
2481 Ga0495580_0068995
2482 Ga0495580_0953227
2483 Ga0495582_0238331
2484 Ga0495582_0390489
2485 Ga0495582_0563126
2486 Ga0495582_0774064
2487 Ga0495639_0015183
2488 Ga0495639_0064913
2489 Ga0495639_0294519
2490 Ga0495618_0297807
2491 Ga0495630_0342084
2492 Ga0495630_0531377
2493 Ga0495630_0672644
2494 Ga0495663_0018871
2495 Ga0495663_0090410
2496 Ga0495640_0822817
2497 Ga0495586_0316555
2498 Ga0495645_0091479
2499 Ga0495656_0014399
2500 Ga0495656_0054619
2501 Ga0495668_0002220
2502 Ga0495635_0093830
2503 Ga0495635_0458871
2504 Ga0495659_0078425
2505 Ga0495647_0004042
2506 Ga0495647_0093151
2507 Ga0495658_0017764
2508 Ga0495658_0121517
2509 Ga0495658_0512428
2510 Ga0495658_0748182
2511 Ga0495613_0149419
2512 Ga0495613_0442118
2513 Ga0495624_0138992
2514 Ga0495600_0204295
2515 Ga0495600_0322823
2516 Ga0495600_0755611
2517 Ga0495581_0153104
2518 Ga0495636_0000737
2519 Ga0495674_0778352
2520 Ga0495674_1192807
2521 Ga0495676_0177492
2522 Ga0495680_0069330
2523 Ga0495680_0545177
2524 Ga0495680_0699847
2525 Ga0495680_0862077
2526 Ga0495680_1039112
2527 Ga0495677_0372904
2528 Ga0495685_123213
2529 Ga0495684_0404789
2530 Ga0495615_0123734
2531 Ga0496100_0017223
2532 Ga0496100_0112917
2533 Ga0496100_0454616
2534 Ga0496100_0945288
2535 Ga0496101_0022651
2536 Ga0496101_0101460
2537 Ga0496101_0118636
2538 Ga0496101_0467569
2539 Ga0496101_0539321
2540 Ga0496101_1003099
2541 Ga0496102_0002523
2542 Ga0496102_0014211
2543 Ga0496102_0026145
2544 Ga0496102_0047874
2545 Ga0496102_0101380
2546 Ga0496102_0414857
2547 Ga0496102_1195471
2548 Ga0496102_1898216
2549 Ga0496103_0014389
2550 Ga0496103_0051737
2551 Ga0496103_0125082
2552 Ga0496104_0011522
2553 Ga0496104_0021521
2554 Ga0496104_0035075
2555 Ga0496104_0059896
2556 Ga0496104_0091472
2557 Ga0496104_0205045
2558 Ga0496104_0340483
2559 Ga0496104_0589094
2560 Ga0496104_1100843
2561 Ga0496105_0000093
2562 Ga0496105_0011016
2563 Ga0496105_0065159
2564 Ga0496105_0079322
2565 Ga0496105_0160368
2566 Ga0496105_0184867
2567 Ga0496105_0429277
2568 Ga0496106_0037656
2569 Ga0496106_0535048
2570 Ga0496106_0688249
2571 Ga0496106_0884300
2572 Ga0496106_1522924
2573 Ga0496107_0061581
2574 Ga0496108_0092806
2575 Ga0496108_0115049
2576 Ga0496108_0145395
2577 Ga0496108_0986043
2578 Ga0496108_1090210
2579 Ga0496108_1165399
2580 Ga0496109_0006477
2581 Ga0496109_0110257
2582 Ga0496109_0154790
2583 Ga0496109_0218292
2584 Ga0496109_0599588
2585 Ga0496109_0988008
2586 Ga0496109_0997018
2587 Ga0496110_0019788
2588 Ga0496110_0087106
2589 Ga0496110_0123611
2590 Ga0496110_0257166
2591 Ga0496110_0457117
2592 Ga0496110_0582361
2593 Ga0496110_0828153
2594 Ga0496110_1092236
2595 Ga0496110_1113678
2596 Ga0496111_0012225
2597 Ga0496111_0014093
2598 Ga0496112_0013357
2599 Ga0496112_0035217
2600 Ga0496112_0101325
2601 Ga0496113_0002034
2602 Ga0496113_0227730
2603 Ga0496114_0008479
2604 Ga0496114_0017914
2605 Ga0496114_0106393
2606 Ga0496114_0107510
2607 Ga0496114_0162541
2608 Ga0496114_0298336
2609 Ga0496114_0336745
2610 Ga0496114_0564554
2611 Ga0496114_0575057
2612 Ga0496115_0258610
2613 Ga0496115_1123948
2614 Ga0496118_0003924
2615 Ga0496126_0442804
2616 Ga0501314_028898
2617 Ga0501315_059501
2618 Ga0501031_0022036
2619 Ga0501031_0077430
2620 Ga0501031_0422046
2621 Ga0501031_0786072
2622 Ga0501031_0811625
2623 Ga0501033_0069737
2624 Ga0501033_1101516
2625 Ga0501034_0963015
2626 Ga0501036_0033281
2627 Ga0501036_0066082
2628 Ga0501036_0087561
2629 Ga0501036_0129136
2630 Ga0501036_0189321
2631 Ga0501037_0096698
2632 Ga0501038_0671360
2633 Ga0501039_0038137
2634 Ga0501039_0092526
2635 Ga0501039_0586062
2636 Ga0501040_0025352
2637 Ga0501040_0052625
2638 Ga0501040_0189872
2639 Ga0501040_0880828
2640 Ga0501040_1093674
2641 Ga0501041_0017307
2642 Ga0501041_0034669
2643 Ga0501041_0585753
2644 Ga0501042_0017993
2645 Ga0501042_0366331
2646 Ga0501042_0387232
2647 Ga0501042_1408528
2648 Ga0501043_0002433
2649 Ga0501043_0446569
2650 Ga0501046_0248181
2651 Ga0501046_0595739
2652 Ga0501047_0056717
2653 Ga0501047_0080871
2654 Ga0501048_0021837
2655 Ga0501048_0023263
2656 Ga0501048_0126426
2657 Ga0501048_1221988
2658 Ga0501067_0017974
2659 Ga0501067_0078234
2660 Ga0501067_0257350
2661 Ga0501067_0802052
2662 Ga0501068_0314003
2663 Ga0501069_0036372
2664 Ga0501071_0004493
2665 Ga0501071_0119000
2666 Ga0501071_0131328
2667 Ga0501071_0942044
2668 Ga0501071_1436483
2669 Ga0501071_1616005
2670 Ga0501072_0015466
2671 Ga0501072_0020892
2672 Ga0501072_0021691
2673 Ga0501072_0095697
2674 Ga0501072_0805640
2675 Ga0501072_1260303
2676 Ga0501073_0266650
2677 Ga0501073_0867191
2678 Ga0501074_0094434
2679 Ga0501074_0296706
2680 Ga0501074_0467167
2681 Ga0501075_0040980
2682 Ga0501075_0063619
2683 Ga0501075_0283479
2684 Ga0501075_0617104
2685 Ga0501076_0016244
2686 Ga0501076_0546443
2687 Ga0501076_0564578
2688 Ga0501077_0199150
2689 Ga0501077_0627696
2690 Ga0501077_0680884
2691 Ga0501233_131170
2692 Ga0501079_0011823
2693 Ga0501079_0097220
2694 Ga0501079_0238445
2695 Ga0501079_0409211
2696 Ga0501079_0602016
2697 Ga0501080_0249732
2698 Ga0501080_0532856
2699 Ga0501080_1769455
2700 Ga0501081_0042676
2701 Ga0501081_0170953
2702 Ga0501035_0619261
2703 Ga0501044_0004942
2704 Ga0501045_0047261
2705 Ga0501045_0051324
2706 Ga0501045_0088902
2707 Ga0501045_0976161
2708 nmdc:mga03683_34547_c1
2709 nmdc:mga03683_89783_c1
2710 nmdc:mga03n38_441130_c1
2711 nmdc:mga03n38_58928_c1
2712 nmdc:mga03n38_757860_c1
2713 nmdc:mga03n38_9489_c1
2714 nmdc:mga03n38_962247_c1
2715 nmdc:mga00v17_1029218_c1
2716 nmdc:mga00v17_120558_c1
2717 nmdc:mga00v17_229031_c1
2718 nmdc:mga00v17_2601_c1
2719 nmdc:mga00v17_340293_c1
2720 nmdc:mga00v17_390796_c1
2721 nmdc:mga00v17_465849_c1
2722 nmdc:mga00v17_665_c1
2723 nmdc:mga00v17_85970_c1
2724 nmdc:mga0yw44_100143_c1
2725 nmdc:mga0yw44_116064_c1
2726 nmdc:mga0yw44_136706_c2
2727 nmdc:mga0yw44_1398_c1
2728 nmdc:mga0yw44_20263_c1
2729 nmdc:mga0yw44_23801_c1
2730 nmdc:mga0yw44_264923_c1
2731 nmdc:mga0yw44_266490_c1
2732 nmdc:mga0yw44_266629_c1
2733 nmdc:mga0yw44_291750_c1
2734 nmdc:mga0yw44_30363_c1
2735 nmdc:mga0yw44_350254_c1
2736 nmdc:mga0yw44_351579_c1
2737 nmdc:mga0yw44_44_c1
2738 nmdc:mga0yw44_5924_c1
2739 nmdc:mga0yw44_671996_c1
2740 nmdc:mga0yw44_78724_c1
2741 nmdc:mga0yw44_890002_c1
2742 nmdc:mga0k408_128180_c1
2743 nmdc:mga06z11_243384_c1
2744 nmdc:mga06z11_433103_c1
2745 nmdc:mga06z11_5925_c1
2746 nmdc:mga06z11_87353_c1
2747 nmdc:mga04h51_10254_c1
2748 nmdc:mga04h51_162539_c1
2749 nmdc:mga04h51_240725_c1
2750 nmdc:mga04h51_305950_c1
2751 nmdc:mga04h51_380778_c1
2752 nmdc:mga05p37_1308842_c1
2753 nmdc:mga05p37_557454_c1
2754 nmdc:mga09592_800048_c1
2755 nmdc:mga08y16_393274_c1
2756 nmdc:mga08y16_880295_c1
2757 nmdc:mga0rr50_1129583_c1
2758 Ga0500635_0006792
2759 Ga0495595_0279429
2760 Ga0495595_0336813
2761 Ga0495595_0705211
2762 Ga0495619_0263881
2763 Ga0495619_0773339
2764 Ga0500644_0375618
2765 Ga0500646_0026544
2766 Ga0500646_0122618
2767 Ga0500583_0139854
2768 Ga0500583_0197939
2769 Ga0500566_0000532
2770 Ga0500566_0120764
2771 Ga0500628_210638
2772 Ga0500655_036960
2773 Ga0500620_031846
2774 Ga0501084_0271980
2775 Ga0501084_0326735
2776 Ga0501084_1328679
2777 Ga0587066_108309
2778 Ga0587077_171293
2779 Ga0587082_033158
2780 Ga0587082_037518
2781 Ga0587083_0019282
2782 Ga0587086_020163
2783 Ga0587088_133956
2784 Ga0587098_077308
2785 Ga0587106_136637
2786 Ga0587101_081851
2787 Ga0587128_097622
2788 Ga0587068_037772
2789 Ga0587068_090856
2790 Ga0587072_044446
2791 Ga0587076_189371
2792 Ga0587079_088058
2793 Ga0587079_176608
2794 Ga0587107_022277
2795 Ga0587110_009122
2796 Ga0501082_0197947
2797 Ga0501082_0862328
2798 Ga0530510_0008292
2799 Ga0530510_0298484
2800 Ga0530510_0937047

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00543

P-II

Nitrogen regulatory protein P-II

29

134

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1hwu-assembly3.cif.gz_C structure of pii protein from herbaspirillum seropedicae 0.9983 1 112
3lf0-assembly1.cif.gz_A crystal structure of the atp bound mycobacterium tuberculosis nitrogen regulatory pii protein 0.9899 2 112
1hwu-assembly3.cif.gz_C structure of pii protein from herbaspirillum seropedicae 0.9876 1 112
2xzw-assembly2.cif.gz_E structure of pii from synechococcus elongatus in complex with 2- oxoglutarate at low 2-og concentrations 0.9835 1 111
2eg1-assembly1.cif.gz_A the crystal structure of pii protein 0.9829 1 112
ID Description Score Start End Superfamily
2o66C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9735 2 111 3.30.70.120
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9687 1 111 3.30.70.120
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.959 1 111 3.30.70.120
4oznB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9553 2 112 3.30.70.120
4usiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9097 2 108 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A7Y8HQB2-F1-model_v4 P-II family nitrogen regulator 0.9768 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-W0I613-F1-model_v4 Putative Nitrogen regulatory protein P-II 0.976 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A2N3F8I2-F1-model_v4 Transcriptional regulator 0.9757 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0009399
GO:0030234
AF-A0A181C720-F1-model_v4 deleted 0.9755 2 112
AF-A0A7G9KTM8-F1-model_v4 deleted 0.9745 2 112

Map