F493675
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1400 | 410 | 2800 | 113 |
Family's Representative Sequence
| Representative Sequence | 3300053080|Ga0500635_0320462|Ga0500635_0320462_99_521 |
| Length | 140 |
| Sequence | MSTCPDAGRRAAAEPSSGRSTVAGYRARMKLVTAIIKPHQLDRVKDALKQAGLHGMTVDEVKGFGRQGGHTETYRGAEYVVDLLPKVKVETVVPDELADQVADIIVNAARTGNIGDGKVWISSIDKVIRIRTGELDGDAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 85 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 113 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 114 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 115 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 116 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 213 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 218 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 219 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 220 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 221 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 222 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 223 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 224 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 225 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 226 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 227 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 228 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 229 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 230 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 231 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 232 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 233 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 234 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 235 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 236 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 237 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 238 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 239 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 242 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 243 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 244 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 245 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 246 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 249 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 251 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 253 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 255 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 256 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 257 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 258 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 259 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 260 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 261 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 262 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 263 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 264 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 265 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 267 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 268 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 271 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 272 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 273 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 274 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 275 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 276 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 277 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 278 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 279 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 280 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 281 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 282 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 283 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 284 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 285 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 286 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 287 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 288 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 289 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 324 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 325 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 326 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 327 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 328 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 329 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 332 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 333 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 334 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 335 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 336 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 337 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 338 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 339 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 366 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 373 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 374 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 375 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 376 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 377 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 378 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 379 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 386 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 387 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 388 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 389 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 390 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 391 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 392 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.79 |
| Metatranscriptomes | 2.21 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.14 |
| Nodule | 0.07 |
| Rhizoplane | 6.43 |
| Rhizosphere | 81.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500635_0320462 | 3300053080 | Bacteria | 612 |
| 2 | JGI24736J21556_1020459 | 3300001904 | Bacteria | 1040 |
| 3 | JGI25151J46595_10020691 | 3300003187 | Bacteria | 2769 |
| 4 | JGI25153J46596_10142022 | 3300003215 | Bacteria | 523 |
| 5 | Ga0007409J51694_1091639 | 3300003575 | Bacteria | 740 |
| 6 | Ga0055524_1013072 | 3300003775 | Bacteria | 3152 |
| 7 | Ga0055524_1016559 | 3300003775 | Bacteria | 2638 |
| 8 | Ga0055536_1001953 | 3300003781 | Bacteria | 11878 |
| 9 | Ga0055536_1021661 | 3300003781 | Bacteria | 1942 |
| 10 | Ga0055536_1022461 | 3300003781 | Bacteria | 1882 |
| 11 | Ga0055534_1008037 | 3300003784 | Bacteria | 2435 |
| 12 | Ga0055534_1014588 | 3300003784 | Bacteria | 1466 |
| 13 | Ga0055530_10000578 | 3300003791 | Bacteria | 31757 |
| 14 | Ga0055540_1059529 | 3300003792 | Bacteria | 766 |
| 15 | Ga0055531_10005972 | 3300003794 | Bacteria | 6996 |
| 16 | Ga0055531_10076138 | 3300003794 | Bacteria | 755 |
| 17 | Ga0055531_10083302 | 3300003794 | Bacteria | 698 |
| 18 | Ga0058860_11886216 | 3300004801 | Bacteria | 513 |
| 19 | Ga0070658_10230542 | 3300005327 | Bacteria | 1568 |
| 20 | Ga0070658_10271818 | 3300005327 | Bacteria | 1441 |
| 21 | Ga0070658_10320468 | 3300005327 | Bacteria | 1324 |
| 22 | Ga0070676_10035996 | 3300005328 | Bacteria | 2850 |
| 23 | Ga0070683_100009342 | 3300005329 | Bacteria | 8380 |
| 24 | Ga0070683_100164501 | 3300005329 | Bacteria | 2105 |
| 25 | Ga0070683_100193432 | 3300005329 | Bacteria | 1932 |
| 26 | Ga0070683_100702525 | 3300005329 | Bacteria | 968 |
| 27 | Ga0070683_100841158 | 3300005329 | Bacteria | 880 |
| 28 | Ga0070683_101019396 | 3300005329 | Bacteria | 795 |
| 29 | Ga0070690_100152737 | 3300005330 | Bacteria | 1577 |
| 30 | Ga0070690_100561832 | 3300005330 | Bacteria | 862 |
| 31 | Ga0070670_100008384 | 3300005331 | Bacteria | 8810 |
| 32 | Ga0070670_100020647 | 3300005331 | Bacteria | 5666 |
| 33 | Ga0070670_100301931 | 3300005331 | Bacteria | 1401 |
| 34 | Ga0070670_100879245 | 3300005331 | Bacteria | 812 |
| 35 | Ga0070677_10585781 | 3300005333 | Bacteria | 616 |
| 36 | Ga0068869_100082842 | 3300005334 | Bacteria | 2398 |
| 37 | Ga0068869_100089544 | 3300005334 | Bacteria | 2311 |
| 38 | Ga0068869_101175118 | 3300005334 | Bacteria | 673 |
| 39 | Ga0068869_101456232 | 3300005334 | Bacteria | 607 |
| 40 | Ga0070666_10001853 | 3300005335 | Bacteria | 12883 |
| 41 | Ga0070666_10001858 | 3300005335 | Bacteria | 12867 |
| 42 | Ga0070666_10104933 | 3300005335 | Bacteria | 1951 |
| 43 | Ga0070666_10106699 | 3300005335 | Bacteria | 1935 |
| 44 | Ga0070666_10152584 | 3300005335 | Bacteria | 1612 |
| 45 | Ga0070666_10313345 | 3300005335 | Bacteria | 1118 |
| 46 | Ga0070666_11518868 | 3300005335 | Bacteria | 501 |
| 47 | Ga0070680_100168007 | 3300005336 | Bacteria | 1845 |
| 48 | Ga0070680_100783916 | 3300005336 | Bacteria | 821 |
| 49 | Ga0070680_101370827 | 3300005336 | Bacteria | 612 |
| 50 | Ga0070682_100702611 | 3300005337 | Bacteria | 811 |
| 51 | Ga0068868_100002892 | 3300005338 | Bacteria | 11916 |
| 52 | Ga0068868_100023407 | 3300005338 | Bacteria | 4675 |
| 53 | Ga0068868_100052388 | 3300005338 | Bacteria | 3213 |
| 54 | Ga0068868_100073533 | 3300005338 | Bacteria | 2730 |
| 55 | Ga0068868_100245090 | 3300005338 | Bacteria | 1507 |
| 56 | Ga0068868_100917469 | 3300005338 | Bacteria | 797 |
| 57 | Ga0070660_100309699 | 3300005339 | Bacteria | 1295 |
| 58 | Ga0070660_100526478 | 3300005339 | Bacteria | 985 |
| 59 | Ga0070689_100062330 | 3300005340 | Bacteria | 2901 |
| 60 | Ga0070689_100118587 | 3300005340 | Bacteria | 2112 |
| 61 | Ga0070691_10437858 | 3300005341 | Bacteria | 744 |
| 62 | Ga0070661_100317167 | 3300005344 | Bacteria | 1217 |
| 63 | Ga0070661_100744294 | 3300005344 | Bacteria | 801 |
| 64 | Ga0070661_100797306 | 3300005344 | Bacteria | 775 |
| 65 | Ga0070661_101488612 | 3300005344 | Bacteria | 571 |
| 66 | Ga0070692_11101637 | 3300005345 | Bacteria | 561 |
| 67 | Ga0070668_100061913 | 3300005347 | Bacteria | 2899 |
| 68 | Ga0070668_100123105 | 3300005347 | Bacteria | 2075 |
| 69 | Ga0070668_100158266 | 3300005347 | Bacteria | 1836 |
| 70 | Ga0070668_100470118 | 3300005347 | Bacteria | 1084 |
| 71 | Ga0070668_101156304 | 3300005347 | Bacteria | 700 |
| 72 | Ga0070675_100131501 | 3300005354 | Bacteria | 2133 |
| 73 | Ga0070675_100580587 | 3300005354 | Unclassified | 1016 |
| 74 | Ga0070675_102075178 | 3300005354 | Bacteria | 524 |
| 75 | Ga0070671_100216956 | 3300005355 | Bacteria | 1623 |
| 76 | Ga0070671_100478445 | 3300005355 | Bacteria | 1070 |
| 77 | Ga0070671_100555740 | 3300005355 | Unclassified | 990 |
| 78 | Ga0070671_100594802 | 3300005355 | Bacteria | 956 |
| 79 | Ga0070671_100623307 | 3300005355 | Bacteria | 933 |
| 80 | Ga0070671_100651630 | 3300005355 | Bacteria | 912 |
| 81 | Ga0070671_100794062 | 3300005355 | Bacteria | 824 |
| 82 | Ga0070671_101128638 | 3300005355 | Bacteria | 689 |
| 83 | Ga0070674_100055299 | 3300005356 | Bacteria | 2748 |
| 84 | Ga0070674_100096952 | 3300005356 | Bacteria | 2141 |
| 85 | Ga0070674_100242595 | 3300005356 | Bacteria | 1411 |
| 86 | Ga0070674_101047912 | 3300005356 | Bacteria | 718 |
| 87 | Ga0070674_101842572 | 3300005356 | Bacteria | 549 |
| 88 | Ga0070673_100200402 | 3300005364 | Bacteria | 1719 |
| 89 | Ga0070673_100229682 | 3300005364 | Bacteria | 1609 |
| 90 | Ga0070673_100243952 | 3300005364 | Bacteria | 1563 |
| 91 | Ga0070688_100035680 | 3300005365 | Bacteria | 3021 |
| 92 | Ga0070659_100070335 | 3300005366 | Bacteria | 2780 |
| 93 | Ga0070659_100396649 | 3300005366 | Unclassified | 1164 |
| 94 | Ga0070667_100012108 | 3300005367 | Bacteria | 7140 |
| 95 | Ga0070667_100050487 | 3300005367 | Bacteria | 3506 |
| 96 | Ga0070667_100168848 | 3300005367 | Bacteria | 1930 |
| 97 | Ga0070667_100239742 | 3300005367 | Bacteria | 1619 |
| 98 | Ga0070667_100601514 | 3300005367 | Bacteria | 1013 |
| 99 | Ga0070667_101972865 | 3300005367 | Bacteria | 550 |
| 100 | Ga0070709_10040805 | 3300005434 | Bacteria | 2856 |
| 101 | Ga0070709_10190549 | 3300005434 | Bacteria | 1446 |
| 102 | Ga0070709_10250424 | 3300005434 | Bacteria | 1276 |
| 103 | Ga0070714_100222825 | 3300005435 | Bacteria | 1734 |
| 104 | Ga0070713_100398392 | 3300005436 | Bacteria | 1285 |
| 105 | Ga0070713_101274783 | 3300005436 | Bacteria | 712 |
| 106 | Ga0070710_11204827 | 3300005437 | Bacteria | 560 |
| 107 | Ga0070701_11217311 | 3300005438 | Bacteria | 535 |
| 108 | Ga0070711_100502744 | 3300005439 | Bacteria | 1000 |
| 109 | Ga0070711_100646771 | 3300005439 | Bacteria | 886 |
| 110 | Ga0070705_100606260 | 3300005440 | Bacteria | 848 |
| 111 | Ga0070700_100090819 | 3300005441 | Bacteria | 1992 |
| 112 | Ga0070700_100356404 | 3300005441 | Bacteria | 1086 |
| 113 | Ga0070700_101307374 | 3300005441 | Bacteria | 609 |
| 114 | Ga0070700_101810937 | 3300005441 | Bacteria | 526 |
| 115 | Ga0070694_100356639 | 3300005444 | Bacteria | 1134 |
| 116 | Ga0070694_100888618 | 3300005444 | Bacteria | 735 |
| 117 | Ga0070708_100790466 | 3300005445 | Bacteria | 892 |
| 118 | Ga0070663_100006966 | 3300005455 | Bacteria | 6844 |
| 119 | Ga0070663_100431874 | 3300005455 | Bacteria | 1082 |
| 120 | Ga0070663_100600003 | 3300005455 | Bacteria | 926 |
| 121 | Ga0070663_100839526 | 3300005455 | Bacteria | 790 |
| 122 | Ga0070663_101834212 | 3300005455 | Bacteria | 544 |
| 123 | Ga0070678_100184141 | 3300005456 | Bacteria | 1712 |
| 124 | Ga0070678_100185081 | 3300005456 | Bacteria | 1708 |
| 125 | Ga0070678_100251181 | 3300005456 | Bacteria | 1483 |
| 126 | Ga0070678_100264027 | 3300005456 | Bacteria | 1449 |
| 127 | Ga0070678_100837154 | 3300005456 | Bacteria | 837 |
| 128 | Ga0070662_100089159 | 3300005457 | Unclassified | 2313 |
| 129 | Ga0070662_100191719 | 3300005457 | Bacteria | 1617 |
| 130 | Ga0070662_100235573 | 3300005457 | Bacteria | 1466 |
| 131 | Ga0070662_100598881 | 3300005457 | Bacteria | 927 |
| 132 | Ga0070662_101272128 | 3300005457 | Bacteria | 633 |
| 133 | Ga0070662_101306613 | 3300005457 | Unclassified | 624 |
| 134 | Ga0070681_10032389 | 3300005458 | Bacteria | 5246 |
| 135 | Ga0070681_10434936 | 3300005458 | Bacteria | 1224 |
| 136 | Ga0070681_10844164 | 3300005458 | Bacteria | 834 |
| 137 | Ga0068867_100009183 | 3300005459 | Bacteria | 6980 |
| 138 | Ga0068867_100025867 | 3300005459 | Bacteria | 4210 |
| 139 | Ga0068867_100084237 | 3300005459 | Bacteria | 2401 |
| 140 | Ga0068867_100376064 | 3300005459 | Bacteria | 1192 |
| 141 | Ga0068867_102387584 | 3300005459 | Bacteria | 503 |
| 142 | Ga0070685_10000451 | 3300005466 | Bacteria | 23864 |
| 143 | Ga0070685_10513131 | 3300005466 | Bacteria | 850 |
| 144 | Ga0070685_11574634 | 3300005466 | Bacteria | 508 |
| 145 | Ga0070698_101333024 | 3300005471 | Bacteria | 668 |
| 146 | Ga0070679_100097653 | 3300005530 | Bacteria | 2925 |
| 147 | Ga0070679_100466649 | 3300005530 | Bacteria | 1207 |
| 148 | Ga0070679_100682259 | 3300005530 | Bacteria | 970 |
| 149 | Ga0070679_101148126 | 3300005530 | Bacteria | 722 |
| 150 | Ga0070684_100116954 | 3300005535 | Bacteria | 2395 |
| 151 | Ga0070684_100175239 | 3300005535 | Bacteria | 1949 |
| 152 | Ga0070684_100559071 | 3300005535 | Bacteria | 1062 |
| 153 | Ga0070684_100756026 | 3300005535 | Bacteria | 907 |
| 154 | Ga0070684_101091014 | 3300005535 | Bacteria | 750 |
| 155 | Ga0070684_101526321 | 3300005535 | Bacteria | 630 |
| 156 | Ga0068853_100071363 | 3300005539 | Bacteria | 3024 |
| 157 | Ga0068853_100100623 | 3300005539 | Bacteria | 2555 |
| 158 | Ga0068853_100136744 | 3300005539 | Bacteria | 2197 |
| 159 | Ga0068853_100371171 | 3300005539 | Bacteria | 1335 |
| 160 | Ga0068853_100411923 | 3300005539 | Bacteria | 1266 |
| 161 | Ga0068853_100464408 | 3300005539 | Bacteria | 1192 |
| 162 | Ga0068853_100562116 | 3300005539 | Bacteria | 1081 |
| 163 | Ga0068853_100624342 | 3300005539 | Bacteria | 1024 |
| 164 | Ga0068853_100734184 | 3300005539 | Bacteria | 943 |
| 165 | Ga0068853_101527667 | 3300005539 | Bacteria | 647 |
| 166 | Ga0070672_100001795 | 3300005543 | Bacteria | 13422 |
| 167 | Ga0070672_100146908 | 3300005543 | Bacteria | 1948 |
| 168 | Ga0070672_100191976 | 3300005543 | Bacteria | 1705 |
| 169 | Ga0070672_100683935 | 3300005543 | Bacteria | 898 |
| 170 | Ga0070686_100011927 | 3300005544 | Bacteria | 4941 |
| 171 | Ga0070686_100048036 | 3300005544 | Bacteria | 2702 |
| 172 | Ga0070686_100525036 | 3300005544 | Bacteria | 922 |
| 173 | Ga0070686_100596289 | 3300005544 | Bacteria | 870 |
| 174 | Ga0070693_100100982 | 3300005547 | Bacteria | 1757 |
| 175 | Ga0070693_100121565 | 3300005547 | Bacteria | 1620 |
| 176 | Ga0070693_100357862 | 3300005547 | Bacteria | 1001 |
| 177 | Ga0070693_100536104 | 3300005547 | Bacteria | 836 |
| 178 | Ga0070693_100542601 | 3300005547 | Bacteria | 831 |
| 179 | Ga0070665_100004571 | 3300005548 | Bacteria | 14495 |
| 180 | Ga0070665_100103330 | 3300005548 | Bacteria | 2853 |
| 181 | Ga0070665_100223338 | 3300005548 | Bacteria | 1884 |
| 182 | Ga0070665_100685398 | 3300005548 | Bacteria | 1038 |
| 183 | Ga0070665_101429234 | 3300005548 | Bacteria | 701 |
| 184 | Ga0070704_101360420 | 3300005549 | Bacteria | 651 |
| 185 | Ga0068855_100000432 | 3300005563 | Bacteria | 51912 |
| 186 | Ga0068855_100002034 | 3300005563 | Bacteria | 25069 |
| 187 | Ga0068855_100132552 | 3300005563 | Bacteria | 2845 |
| 188 | Ga0068855_100238567 | 3300005563 | Bacteria | 2032 |
| 189 | Ga0068855_100672786 | 3300005563 | Bacteria | 1110 |
| 190 | Ga0068855_100777737 | 3300005563 | Bacteria | 1019 |
| 191 | Ga0068855_100823119 | 3300005563 | Bacteria | 985 |
| 192 | Ga0068855_102299715 | 3300005563 | Bacteria | 539 |
| 193 | Ga0068855_102359364 | 3300005563 | Bacteria | 531 |
| 194 | Ga0070664_100000726 | 3300005564 | Bacteria | 25332 |
| 195 | Ga0070664_100114705 | 3300005564 | Bacteria | 2354 |
| 196 | Ga0070664_100403208 | 3300005564 | Bacteria | 1251 |
| 197 | Ga0070664_100463468 | 3300005564 | Bacteria | 1164 |
| 198 | Ga0070664_100567162 | 3300005564 | Bacteria | 1051 |
| 199 | Ga0068857_100000096 | 3300005577 | Bacteria | 51376 |
| 200 | Ga0068857_100047219 | 3300005577 | Bacteria | 3822 |
| 201 | Ga0068857_100060204 | 3300005577 | Bacteria | 3373 |
| 202 | Ga0068857_100133139 | 3300005577 | Bacteria | 2243 |
| 203 | Ga0068857_100386761 | 3300005577 | Bacteria | 1300 |
| 204 | Ga0068857_100407995 | 3300005577 | Archaea | 1265 |
| 205 | Ga0068857_100698433 | 3300005577 | Bacteria | 964 |
| 206 | Ga0068857_102017329 | 3300005577 | Bacteria | 566 |
| 207 | Ga0068854_100000554 | 3300005578 | Bacteria | 22552 |
| 208 | Ga0068854_100024664 | 3300005578 | Bacteria | 4120 |
| 209 | Ga0068854_100045641 | 3300005578 | Bacteria | 3117 |
| 210 | Ga0068854_100223761 | 3300005578 | Bacteria | 1490 |
| 211 | Ga0068854_100464268 | 3300005578 | Bacteria | 1060 |
| 212 | Ga0068854_101042823 | 3300005578 | Bacteria | 726 |
| 213 | Ga0068856_100000179 | 3300005614 | Bacteria | 66149 |
| 214 | Ga0068856_100002175 | 3300005614 | Bacteria | 20318 |
| 215 | Ga0068856_100193004 | 3300005614 | Bacteria | 2050 |
| 216 | Ga0068856_100386850 | 3300005614 | Bacteria | 1418 |
| 217 | Ga0068856_100539649 | 3300005614 | Bacteria | 1187 |
| 218 | Ga0070702_100024290 | 3300005615 | Bacteria | 3232 |
| 219 | Ga0070702_100055642 | 3300005615 | Bacteria | 2282 |
| 220 | Ga0070702_100122007 | 3300005615 | Bacteria | 1633 |
| 221 | Ga0070702_100167315 | 3300005615 | Bacteria | 1427 |
| 222 | Ga0070702_100520411 | 3300005615 | Unclassified | 877 |
| 223 | Ga0068852_100010460 | 3300005616 | Bacteria | 6937 |
| 224 | Ga0068852_100035832 | 3300005616 | Bacteria | 4144 |
| 225 | Ga0068852_100209869 | 3300005616 | Bacteria | 1847 |
| 226 | Ga0068852_100400190 | 3300005616 | Bacteria | 1350 |
| 227 | Ga0068852_100627068 | 3300005616 | Bacteria | 1081 |
| 228 | Ga0068859_100010599 | 3300005617 | Bacteria | 9278 |
| 229 | Ga0068859_100136484 | 3300005617 | Bacteria | 2526 |
| 230 | Ga0068859_100237623 | 3300005617 | Bacteria | 1911 |
| 231 | Ga0068859_101049795 | 3300005617 | Bacteria | 896 |
| 232 | Ga0068859_101855626 | 3300005617 | Bacteria | 666 |
| 233 | Ga0068864_100000129 | 3300005618 | Bacteria | 73206 |
| 234 | Ga0068864_100011149 | 3300005618 | Bacteria | 7430 |
| 235 | Ga0068864_100227870 | 3300005618 | Bacteria | 1722 |
| 236 | Ga0068864_100602769 | 3300005618 | Bacteria | 1066 |
| 237 | Ga0068864_101270974 | 3300005618 | Unclassified | 736 |
| 238 | Ga0068866_10007138 | 3300005718 | Bacteria | 4671 |
| 239 | Ga0068866_10010050 | 3300005718 | Unclassified | 4045 |
| 240 | Ga0068866_10064147 | 3300005718 | Bacteria | 1917 |
| 241 | Ga0068866_10343585 | 3300005718 | Bacteria | 946 |
| 242 | Ga0068861_100038831 | 3300005719 | Unclassified | 3550 |
| 243 | Ga0068861_100039875 | 3300005719 | Bacteria | 3508 |
| 244 | Ga0068861_100153483 | 3300005719 | Bacteria | 1892 |
| 245 | Ga0068861_100244554 | 3300005719 | Bacteria | 1528 |
| 246 | Ga0068861_100647643 | 3300005719 | Bacteria | 976 |
| 247 | Ga0068851_10003554 | 3300005834 | Bacteria | 6940 |
| 248 | Ga0068870_10045752 | 3300005840 | Bacteria | 2293 |
| 249 | Ga0068870_10089992 | 3300005840 | Bacteria | 1714 |
| 250 | Ga0068870_10448127 | 3300005840 | Bacteria | 850 |
| 251 | Ga0068863_100005116 | 3300005841 | Bacteria | 12931 |
| 252 | Ga0068863_100026366 | 3300005841 | Bacteria | 5545 |
| 253 | Ga0068863_100090500 | 3300005841 | Bacteria | 2901 |
| 254 | Ga0068863_100170884 | 3300005841 | Bacteria | 2085 |
| 255 | Ga0068863_100183012 | 3300005841 | Bacteria | 2011 |
| 256 | Ga0068863_100243488 | 3300005841 | Bacteria | 1736 |
| 257 | Ga0068863_100423207 | 3300005841 | Bacteria | 1305 |
| 258 | Ga0068863_100458082 | 3300005841 | Unclassified | 1252 |
| 259 | Ga0068863_100595675 | 3300005841 | Bacteria | 1094 |
| 260 | Ga0068863_100870858 | 3300005841 | Bacteria | 900 |
| 261 | Ga0068863_101287007 | 3300005841 | Bacteria | 738 |
| 262 | Ga0068858_100025071 | 3300005842 | Bacteria | 5550 |
| 263 | Ga0068858_100030716 | 3300005842 | Unclassified | 4989 |
| 264 | Ga0068858_100124922 | 3300005842 | Bacteria | 2408 |
| 265 | Ga0068858_100213797 | 3300005842 | Bacteria | 1825 |
| 266 | Ga0068858_100255257 | 3300005842 | Bacteria | 1666 |
| 267 | Ga0068858_100627282 | 3300005842 | Bacteria | 1044 |
| 268 | Ga0068858_100635556 | 3300005842 | Bacteria | 1037 |
| 269 | Ga0068858_100725982 | 3300005842 | Bacteria | 967 |
| 270 | Ga0068858_100744839 | 3300005842 | Bacteria | 954 |
| 271 | Ga0068858_100828650 | 3300005842 | Bacteria | 903 |
| 272 | Ga0068858_102369603 | 3300005842 | Bacteria | 524 |
| 273 | Ga0068860_100004438 | 3300005843 | Bacteria | 14325 |
| 274 | Ga0068860_100027327 | 3300005843 | Bacteria | 5497 |
| 275 | Ga0068860_100091037 | 3300005843 | Bacteria | 2906 |
| 276 | Ga0068860_100365661 | 3300005843 | Bacteria | 1422 |
| 277 | Ga0068860_100510384 | 3300005843 | Bacteria | 1201 |
| 278 | Ga0068860_100603674 | 3300005843 | Bacteria | 1103 |
| 279 | Ga0068860_102397800 | 3300005843 | Bacteria | 548 |
| 280 | Ga0068862_101456482 | 3300005844 | Bacteria | 689 |
| 281 | Ga0068862_101952538 | 3300005844 | Bacteria | 597 |
| 282 | Ga0081455_10799957 | 3300005937 | Bacteria | 592 |
| 283 | Ga0081540_1001046 | 3300005983 | Bacteria | 24692 |
| 284 | Ga0081540_1117627 | 3300005983 | Bacteria | 1110 |
| 285 | Ga0075365_10009641 | 3300006038 | Bacteria | 5571 |
| 286 | Ga0075365_10021278 | 3300006038 | Bacteria | 4043 |
| 287 | Ga0075365_10042348 | 3300006038 | Bacteria | 2977 |
| 288 | Ga0075365_10066208 | 3300006038 | Bacteria | 2423 |
| 289 | Ga0075365_10081217 | 3300006038 | Bacteria | 2196 |
| 290 | Ga0075365_10171080 | 3300006038 | Bacteria | 1516 |
| 291 | Ga0075365_10195685 | 3300006038 | Bacteria | 1415 |
| 292 | Ga0075365_10209985 | 3300006038 | Bacteria | 1365 |
| 293 | Ga0075365_10229439 | 3300006038 | Bacteria | 1303 |
| 294 | Ga0075365_10239001 | 3300006038 | Bacteria | 1276 |
| 295 | Ga0075365_10271012 | 3300006038 | Bacteria | 1194 |
| 296 | Ga0075365_10273148 | 3300006038 | Bacteria | 1189 |
| 297 | Ga0075365_11035369 | 3300006038 | Bacteria | 578 |
| 298 | Ga0075368_10018412 | 3300006042 | Bacteria | 2624 |
| 299 | Ga0075368_10274749 | 3300006042 | Bacteria | 723 |
| 300 | Ga0075368_10329156 | 3300006042 | Bacteria | 663 |
| 301 | Ga0075368_10342364 | 3300006042 | Bacteria | 650 |
| 302 | Ga0075368_10398090 | 3300006042 | Bacteria | 604 |
| 303 | Ga0075363_100024237 | 3300006048 | Bacteria | 3083 |
| 304 | Ga0075363_100071908 | 3300006048 | Bacteria | 1881 |
| 305 | Ga0075363_100347545 | 3300006048 | Bacteria | 866 |
| 306 | Ga0075364_10001125 | 3300006051 | Bacteria | 14277 |
| 307 | Ga0075364_10018799 | 3300006051 | Bacteria | 4332 |
| 308 | Ga0075364_10086675 | 3300006051 | Bacteria | 2075 |
| 309 | Ga0075364_10181730 | 3300006051 | Bacteria | 1423 |
| 310 | Ga0075364_10387297 | 3300006051 | Bacteria | 954 |
| 311 | Ga0075364_10402584 | 3300006051 | Bacteria | 934 |
| 312 | Ga0075364_10493870 | 3300006051 | Bacteria | 837 |
| 313 | Ga0075364_11249850 | 3300006051 | Bacteria | 503 |
| 314 | Ga0070715_10154698 | 3300006163 | Bacteria | 1127 |
| 315 | Ga0070712_100264735 | 3300006175 | Bacteria | 1379 |
| 316 | Ga0075367_10017493 | 3300006178 | Bacteria | 3935 |
| 317 | Ga0075367_10032975 | 3300006178 | Bacteria | 2983 |
| 318 | Ga0075367_10067400 | 3300006178 | Bacteria | 2146 |
| 319 | Ga0075367_10088617 | 3300006178 | Bacteria | 1881 |
| 320 | Ga0075367_10210472 | 3300006178 | Bacteria | 1216 |
| 321 | Ga0075367_10243957 | 3300006178 | Bacteria | 1126 |
| 322 | Ga0075367_10515075 | 3300006178 | Bacteria | 759 |
| 323 | Ga0075367_10697495 | 3300006178 | Bacteria | 646 |
| 324 | Ga0075366_10711803 | 3300006195 | Bacteria | 623 |
| 325 | Ga0097621_100000196 | 3300006237 | Bacteria | 39296 |
| 326 | Ga0097621_100002114 | 3300006237 | Bacteria | 13601 |
| 327 | Ga0097621_100019556 | 3300006237 | Bacteria | 5200 |
| 328 | Ga0097621_100159978 | 3300006237 | Bacteria | 1935 |
| 329 | Ga0097621_100288304 | 3300006237 | Bacteria | 1447 |
| 330 | Ga0097621_100385197 | 3300006237 | Bacteria | 1253 |
| 331 | Ga0097621_100407750 | 3300006237 | Unclassified | 1218 |
| 332 | Ga0075370_10623732 | 3300006353 | Bacteria | 654 |
| 333 | Ga0068871_100000049 | 3300006358 | Bacteria | 65954 |
| 334 | Ga0068871_100027217 | 3300006358 | Unclassified | 4469 |
| 335 | Ga0068871_100047305 | 3300006358 | Bacteria | 3469 |
| 336 | Ga0068871_100071763 | 3300006358 | Bacteria | 2849 |
| 337 | Ga0068871_100133563 | 3300006358 | Bacteria | 2106 |
| 338 | Ga0068871_100138395 | 3300006358 | Bacteria | 2069 |
| 339 | Ga0068871_100227044 | 3300006358 | Bacteria | 1619 |
| 340 | Ga0068871_100338812 | 3300006358 | Bacteria | 1327 |
| 341 | Ga0075428_100101055 | 3300006844 | Bacteria | 3144 |
| 342 | Ga0075431_101115607 | 3300006847 | Bacteria | 753 |
| 343 | Ga0075429_100456305 | 3300006880 | Bacteria | 1120 |
| 344 | Ga0075429_100756886 | 3300006880 | Bacteria | 851 |
| 345 | Ga0068865_100016213 | 3300006881 | Bacteria | 4763 |
| 346 | Ga0068865_100070890 | 3300006881 | Bacteria | 2470 |
| 347 | Ga0068865_100077435 | 3300006881 | Bacteria | 2376 |
| 348 | Ga0068865_100179459 | 3300006881 | Bacteria | 1630 |
| 349 | Ga0068865_100188845 | 3300006881 | Bacteria | 1592 |
| 350 | Ga0068865_100398524 | 3300006881 | Bacteria | 1127 |
| 351 | Ga0068865_100742490 | 3300006881 | Bacteria | 842 |
| 352 | Ga0068865_100750310 | 3300006881 | Bacteria | 838 |
| 353 | Ga0097620_100010599 | 3300006931 | Bacteria | 9278 |
| 354 | Ga0097620_100136488 | 3300006931 | Bacteria | 2526 |
| 355 | Ga0097620_100237623 | 3300006931 | Bacteria | 1911 |
| 356 | Ga0097620_101049746 | 3300006931 | Bacteria | 896 |
| 357 | Ga0097620_101855547 | 3300006931 | Bacteria | 666 |
| 358 | Ga0099824_1019323 | 3300006942 | Bacteria | 5344 |
| 359 | Ga0105240_10000906 | 3300009093 | Bacteria | 52979 |
| 360 | Ga0105240_10004993 | 3300009093 | Bacteria | 19922 |
| 361 | Ga0105240_10027081 | 3300009093 | Bacteria | 7512 |
| 362 | Ga0105240_10027316 | 3300009093 | Bacteria | 7473 |
| 363 | Ga0105240_10088014 | 3300009093 | Bacteria | 3801 |
| 364 | Ga0105240_10155563 | 3300009093 | Bacteria | 2719 |
| 365 | Ga0105240_10251728 | 3300009093 | Bacteria | 2042 |
| 366 | Ga0105240_10265229 | 3300009093 | Bacteria | 1980 |
| 367 | Ga0105240_10279530 | 3300009093 | Bacteria | 1918 |
| 368 | Ga0105240_11861069 | 3300009093 | Bacteria | 627 |
| 369 | Ga0105240_12426867 | 3300009093 | Bacteria | 543 |
| 370 | Ga0111539_10175933 | 3300009094 | Bacteria | 2500 |
| 371 | Ga0111539_10371110 | 3300009094 | Bacteria | 1665 |
| 372 | Ga0111539_11274521 | 3300009094 | Bacteria | 853 |
| 373 | Ga0105245_10187338 | 3300009098 | Bacteria | 1980 |
| 374 | Ga0105245_10188072 | 3300009098 | Bacteria | 1976 |
| 375 | Ga0105245_10896004 | 3300009098 | Unclassified | 929 |
| 376 | Ga0105245_11019902 | 3300009098 | Bacteria | 872 |
| 377 | Ga0105247_10288387 | 3300009101 | Bacteria | 1134 |
| 378 | Ga0105247_10778532 | 3300009101 | Bacteria | 728 |
| 379 | Ga0105247_11601429 | 3300009101 | Bacteria | 535 |
| 380 | Ga0114129_10604548 | 3300009147 | Bacteria | 1420 |
| 381 | Ga0105243_10041324 | 3300009148 | Bacteria | 3606 |
| 382 | Ga0105243_10042566 | 3300009148 | Bacteria | 3555 |
| 383 | Ga0105243_10090932 | 3300009148 | Bacteria | 2512 |
| 384 | Ga0105243_10408280 | 3300009148 | Bacteria | 1263 |
| 385 | Ga0105243_10501008 | 3300009148 | Bacteria | 1151 |
| 386 | Ga0105243_10657632 | 3300009148 | Unclassified | 1016 |
| 387 | Ga0105243_11165715 | 3300009148 | Bacteria | 782 |
| 388 | Ga0105243_11231758 | 3300009148 | Bacteria | 763 |
| 389 | Ga0105241_10032759 | 3300009174 | Bacteria | 3899 |
| 390 | Ga0105241_10120160 | 3300009174 | Bacteria | 2114 |
| 391 | Ga0105241_10431342 | 3300009174 | Bacteria | 1162 |
| 392 | Ga0105241_10644028 | 3300009174 | Bacteria | 962 |
| 393 | Ga0105241_11338911 | 3300009174 | Bacteria | 683 |
| 394 | Ga0105241_12560117 | 3300009174 | Bacteria | 512 |
| 395 | Ga0105242_10012056 | 3300009176 | Bacteria | 6653 |
| 396 | Ga0105242_10042305 | 3300009176 | Bacteria | 3678 |
| 397 | Ga0105242_10423519 | 3300009176 | Bacteria | 1248 |
| 398 | Ga0105242_10886616 | 3300009176 | Bacteria | 891 |
| 399 | Ga0105242_11228100 | 3300009176 | Unclassified | 770 |
| 400 | Ga0105242_11832603 | 3300009176 | Archaea | 646 |
| 401 | Ga0105242_12312340 | 3300009176 | Bacteria | 584 |
| 402 | Ga0105248_10010283 | 3300009177 | Bacteria | 10301 |
| 403 | Ga0105248_10017949 | 3300009177 | Bacteria | 7809 |
| 404 | Ga0105248_10081498 | 3300009177 | Bacteria | 3637 |
| 405 | Ga0105248_10164087 | 3300009177 | Bacteria | 2505 |
| 406 | Ga0105248_10242008 | 3300009177 | Bacteria | 2031 |
| 407 | Ga0105248_10310979 | 3300009177 | Bacteria | 1774 |
| 408 | Ga0105248_10415691 | 3300009177 | Bacteria | 1514 |
| 409 | Ga0105248_10640126 | 3300009177 | Bacteria | 1200 |
| 410 | Ga0105248_10992361 | 3300009177 | Bacteria | 949 |
| 411 | Ga0105237_10009430 | 3300009545 | Bacteria | 10456 |
| 412 | Ga0105237_10066651 | 3300009545 | Bacteria | 3595 |
| 413 | Ga0105237_10333521 | 3300009545 | Bacteria | 1521 |
| 414 | Ga0105237_10628663 | 3300009545 | Bacteria | 1080 |
| 415 | Ga0105237_10672051 | 3300009545 | Bacteria | 1042 |
| 416 | Ga0105237_10898148 | 3300009545 | Bacteria | 893 |
| 417 | Ga0105237_11075995 | 3300009545 | Bacteria | 811 |
| 418 | Ga0105238_10009376 | 3300009551 | Bacteria | 9795 |
| 419 | Ga0105238_10023690 | 3300009551 | Bacteria | 6256 |
| 420 | Ga0105238_10036707 | 3300009551 | Bacteria | 4982 |
| 421 | Ga0105238_10052956 | 3300009551 | Bacteria | 4079 |
| 422 | Ga0105238_10082010 | 3300009551 | Bacteria | 3215 |
| 423 | Ga0105238_10097773 | 3300009551 | Bacteria | 2920 |
| 424 | Ga0105238_10327534 | 3300009551 | Bacteria | 1518 |
| 425 | Ga0105238_10452257 | 3300009551 | Bacteria | 1281 |
| 426 | Ga0105238_10495788 | 3300009551 | Bacteria | 1222 |
| 427 | Ga0105238_10790803 | 3300009551 | Bacteria | 964 |
| 428 | Ga0105249_10048096 | 3300009553 | Bacteria | 3889 |
| 429 | Ga0105249_10159404 | 3300009553 | Bacteria | 2179 |
| 430 | Ga0105249_10179568 | 3300009553 | Bacteria | 2058 |
| 431 | Ga0105249_10279928 | 3300009553 | Bacteria | 1665 |
| 432 | Ga0105249_10300706 | 3300009553 | Bacteria | 1609 |
| 433 | Ga0105249_10594681 | 3300009553 | Bacteria | 1160 |
| 434 | Ga0105239_10038937 | 3300010375 | Bacteria | 5208 |
| 435 | Ga0105239_10049542 | 3300010375 | Bacteria | 4606 |
| 436 | Ga0105239_10134538 | 3300010375 | Bacteria | 2752 |
| 437 | Ga0105239_10134956 | 3300010375 | Bacteria | 2747 |
| 438 | Ga0105239_10150239 | 3300010375 | Bacteria | 2600 |
| 439 | Ga0105239_10275935 | 3300010375 | Bacteria | 1891 |
| 440 | Ga0105239_11043199 | 3300010375 | Bacteria | 940 |
| 441 | Ga0105239_11424567 | 3300010375 | Bacteria | 800 |
| 442 | Ga0105246_10016866 | 3300011119 | Bacteria | 4633 |
| 443 | Ga0105246_10077748 | 3300011119 | Bacteria | 2355 |
| 444 | Ga0105246_10121355 | 3300011119 | Bacteria | 1937 |
| 445 | Ga0105246_10767720 | 3300011119 | Bacteria | 852 |
| 446 | Ga0105246_11133405 | 3300011119 | Bacteria | 716 |
| 447 | Ga0105246_11474086 | 3300011119 | Bacteria | 638 |
| 448 | Ga0157318_1007034 | 3300012482 | Bacteria | 757 |
| 449 | Ga0157339_1003561 | 3300012505 | Bacteria | 1132 |
| 450 | Ga0157316_1050929 | 3300012510 | Bacteria | 571 |
| 451 | Ga0157327_1005852 | 3300012512 | Bacteria | 1012 |
| 452 | Ga0157338_1007600 | 3300012515 | Bacteria | 1032 |
| 453 | Ga0157373_10130661 | 3300013100 | Bacteria | 1766 |
| 454 | Ga0157371_10163129 | 3300013102 | Bacteria | 1592 |
| 455 | Ga0157371_10189802 | 3300013102 | Bacteria | 1471 |
| 456 | Ga0157371_10695988 | 3300013102 | Unclassified | 761 |
| 457 | Ga0157371_10790493 | 3300013102 | Bacteria | 715 |
| 458 | Ga0157370_10110028 | 3300013104 | Bacteria | 2575 |
| 459 | Ga0157370_10617216 | 3300013104 | Bacteria | 992 |
| 460 | Ga0157370_11946286 | 3300013104 | Bacteria | 527 |
| 461 | Ga0157369_10019968 | 3300013105 | Bacteria | 7491 |
| 462 | Ga0157369_10075339 | 3300013105 | Bacteria | 3618 |
| 463 | Ga0157369_10360373 | 3300013105 | Bacteria | 1510 |
| 464 | Ga0157369_10425283 | 3300013105 | Bacteria | 1377 |
| 465 | Ga0157369_10431777 | 3300013105 | Bacteria | 1365 |
| 466 | Ga0157369_10442977 | 3300013105 | Bacteria | 1345 |
| 467 | Ga0157369_10599162 | 3300013105 | Bacteria | 1137 |
| 468 | Ga0157374_10000062 | 3300013296 | Bacteria | 112028 |
| 469 | Ga0157374_10021722 | 3300013296 | Bacteria | 5715 |
| 470 | Ga0157374_10106725 | 3300013296 | Bacteria | 2691 |
| 471 | Ga0157374_10150309 | 3300013296 | Bacteria | 2264 |
| 472 | Ga0157374_10253738 | 3300013296 | Bacteria | 1731 |
| 473 | Ga0157374_10518609 | 3300013296 | Bacteria | 1197 |
| 474 | Ga0157374_10816210 | 3300013296 | Bacteria | 949 |
| 475 | Ga0157378_10000009 | 3300013297 | Bacteria | 161557 |
| 476 | Ga0157378_10000366 | 3300013297 | Bacteria | 44698 |
| 477 | Ga0157378_10002258 | 3300013297 | Bacteria | 17116 |
| 478 | Ga0157378_10025295 | 3300013297 | Bacteria | 5228 |
| 479 | Ga0157378_10106770 | 3300013297 | Bacteria | 2562 |
| 480 | Ga0157378_10245045 | 3300013297 | Bacteria | 1714 |
| 481 | Ga0157378_10818152 | 3300013297 | Bacteria | 958 |
| 482 | Ga0157378_10997973 | 3300013297 | Bacteria | 871 |
| 483 | Ga0163162_10000028 | 3300013306 | Bacteria | 175501 |
| 484 | Ga0163162_10071763 | 3300013306 | Bacteria | 3516 |
| 485 | Ga0163162_10082672 | 3300013306 | Bacteria | 3284 |
| 486 | Ga0163162_10151115 | 3300013306 | Bacteria | 2440 |
| 487 | Ga0163162_10329599 | 3300013306 | Bacteria | 1659 |
| 488 | Ga0163162_10605705 | 3300013306 | Bacteria | 1221 |
| 489 | Ga0163162_10651778 | 3300013306 | Bacteria | 1177 |
| 490 | Ga0163162_11730171 | 3300013306 | Bacteria | 714 |
| 491 | Ga0163162_11925388 | 3300013306 | Bacteria | 677 |
| 492 | Ga0163162_12515910 | 3300013306 | Bacteria | 592 |
| 493 | Ga0163162_12811305 | 3300013306 | Unclassified | 560 |
| 494 | Ga0157372_10001184 | 3300013307 | Bacteria | 28212 |
| 495 | Ga0157372_10002204 | 3300013307 | Bacteria | 21156 |
| 496 | Ga0157372_10008186 | 3300013307 | Bacteria | 11112 |
| 497 | Ga0157372_10111977 | 3300013307 | Bacteria | 3127 |
| 498 | Ga0157372_10292790 | 3300013307 | Bacteria | 1893 |
| 499 | Ga0157372_10303986 | 3300013307 | Bacteria | 1856 |
| 500 | Ga0157372_10307674 | 3300013307 | Bacteria | 1844 |
| 501 | Ga0157372_10334834 | 3300013307 | Bacteria | 1763 |
| 502 | Ga0157375_10001583 | 3300013308 | Bacteria | 19576 |
| 503 | Ga0157375_10031568 | 3300013308 | Bacteria | 5010 |
| 504 | Ga0157375_10072749 | 3300013308 | Bacteria | 3455 |
| 505 | Ga0157375_10084786 | 3300013308 | Bacteria | 3217 |
| 506 | Ga0157375_10213455 | 3300013308 | Bacteria | 2087 |
| 507 | Ga0157375_10730150 | 3300013308 | Bacteria | 1143 |
| 508 | Ga0157375_11076585 | 3300013308 | Bacteria | 940 |
| 509 | Ga0157375_12341202 | 3300013308 | Bacteria | 637 |
| 510 | Ga0157375_13165977 | 3300013308 | Bacteria | 549 |
| 511 | Ga0163163_10001955 | 3300014325 | Bacteria | 17429 |
| 512 | Ga0163163_10004520 | 3300014325 | Bacteria | 11868 |
| 513 | Ga0163163_10103355 | 3300014325 | Bacteria | 2874 |
| 514 | Ga0163163_10270330 | 3300014325 | Bacteria | 1751 |
| 515 | Ga0163163_10495605 | 3300014325 | Bacteria | 1283 |
| 516 | Ga0163163_12569231 | 3300014325 | Bacteria | 567 |
| 517 | Ga0157380_10020607 | 3300014326 | Bacteria | 4931 |
| 518 | Ga0157380_10269114 | 3300014326 | Bacteria | 1552 |
| 519 | Ga0157380_10505670 | 3300014326 | Bacteria | 1175 |
| 520 | Ga0157380_10770206 | 3300014326 | Bacteria | 976 |
| 521 | Ga0157380_11276160 | 3300014326 | Bacteria | 781 |
| 522 | Ga0182008_10049225 | 3300014497 | Bacteria | 2092 |
| 523 | Ga0182008_10481120 | 3300014497 | Bacteria | 680 |
| 524 | Ga0182008_10525419 | 3300014497 | Bacteria | 654 |
| 525 | Ga0157377_10151536 | 3300014745 | Bacteria | 1434 |
| 526 | Ga0157377_10279058 | 3300014745 | Bacteria | 1094 |
| 527 | Ga0157379_10000319 | 3300014968 | Bacteria | 38313 |
| 528 | Ga0157379_10030697 | 3300014968 | Bacteria | 4786 |
| 529 | Ga0157379_10245833 | 3300014968 | Bacteria | 1623 |
| 530 | Ga0157379_10365956 | 3300014968 | Bacteria | 1322 |
| 531 | Ga0157379_10548003 | 3300014968 | Bacteria | 1076 |
| 532 | Ga0157379_11033142 | 3300014968 | Bacteria | 785 |
| 533 | Ga0157379_11298238 | 3300014968 | Bacteria | 703 |
| 534 | Ga0157376_10082837 | 3300014969 | Bacteria | 2758 |
| 535 | Ga0157376_10093047 | 3300014969 | Bacteria | 2616 |
| 536 | Ga0157376_10105381 | 3300014969 | Bacteria | 2472 |
| 537 | Ga0157376_10122466 | 3300014969 | Bacteria | 2307 |
| 538 | Ga0157376_10189556 | 3300014969 | Bacteria | 1885 |
| 539 | Ga0157376_10258581 | 3300014969 | Bacteria | 1630 |
| 540 | Ga0157376_10260700 | 3300014969 | Bacteria | 1624 |
| 541 | Ga0157376_10484450 | 3300014969 | Bacteria | 1213 |
| 542 | Ga0157376_10508205 | 3300014969 | Bacteria | 1185 |
| 543 | Ga0157376_11043313 | 3300014969 | Bacteria | 842 |
| 544 | Ga0157376_11139105 | 3300014969 | Bacteria | 807 |
| 545 | Ga0163161_10005516 | 3300017792 | Bacteria | 8769 |
| 546 | Ga0163161_10015892 | 3300017792 | Bacteria | 5251 |
| 547 | Ga0163161_10201622 | 3300017792 | Bacteria | 1534 |
| 548 | Ga0163161_10203088 | 3300017792 | Bacteria | 1528 |
| 549 | Ga0163161_10363611 | 3300017792 | Bacteria | 1153 |
| 550 | Ga0163161_10554401 | 3300017792 | Bacteria | 942 |
| 551 | Ga0163161_11628128 | 3300017792 | Bacteria | 570 |
| 552 | Ga0163161_11943241 | 3300017792 | Bacteria | 523 |
| 553 | Ga0206356_11689876 | 3300020070 | Bacteria | 952 |
| 554 | Ga0206349_1714749 | 3300020075 | Bacteria | 502 |
| 555 | Ga0206353_11171569 | 3300020082 | Bacteria | 818 |
| 556 | Ga0206353_11366746 | 3300020082 | Bacteria | 1196 |
| 557 | Ga0206353_11586967 | 3300020082 | Bacteria | 1761 |
| 558 | Ga0209673_1007174 | 3300025273 | Bacteria | 5202 |
| 559 | Ga0209673_1072312 | 3300025273 | Bacteria | 816 |
| 560 | Ga0209130_1011708 | 3300025284 | Bacteria | 2334 |
| 561 | Ga0209675_1004813 | 3300025291 | Bacteria | 5859 |
| 562 | Ga0209675_1004817 | 3300025291 | Bacteria | 5855 |
| 563 | Ga0209676_1001568 | 3300025292 | Bacteria | 20438 |
| 564 | Ga0209676_1002588 | 3300025292 | Bacteria | 12442 |
| 565 | Ga0209676_1002747 | 3300025292 | Bacteria | 11792 |
| 566 | Ga0209676_1003093 | 3300025292 | Bacteria | 10710 |
| 567 | Ga0209676_1033031 | 3300025292 | Bacteria | 1547 |
| 568 | Ga0209676_1068054 | 3300025292 | Bacteria | 857 |
| 569 | Ga0209025_1000454 | 3300025294 | Bacteria | 80042 |
| 570 | Ga0209025_1011745 | 3300025294 | Bacteria | 5716 |
| 571 | Ga0209025_1020449 | 3300025294 | Bacteria | 3622 |
| 572 | Ga0209025_1033207 | 3300025294 | Bacteria | 2391 |
| 573 | Ga0209025_1067527 | 3300025294 | Bacteria | 1291 |
| 574 | Ga0209025_1191523 | 3300025294 | Bacteria | 513 |
| 575 | Ga0209564_1003082 | 3300025295 | Bacteria | 11815 |
| 576 | Ga0209758_1053082 | 3300025297 | Bacteria | 1395 |
| 577 | Ga0209758_1112180 | 3300025297 | Bacteria | 752 |
| 578 | Ga0209050_1000865 | 3300025298 | Bacteria | 40908 |
| 579 | Ga0209050_1008800 | 3300025298 | Bacteria | 5302 |
| 580 | Ga0209256_1005269 | 3300025299 | Bacteria | 7545 |
| 581 | Ga0209256_1006382 | 3300025299 | Bacteria | 6275 |
| 582 | Ga0209051_1029660 | 3300025303 | Bacteria | 2137 |
| 583 | Ga0209257_1000154 | 3300025304 | Bacteria | 185887 |
| 584 | Ga0209257_1001025 | 3300025304 | Bacteria | 37552 |
| 585 | Ga0209257_1001296 | 3300025304 | Bacteria | 30463 |
| 586 | Ga0209257_1015047 | 3300025304 | Bacteria | 3258 |
| 587 | Ga0207697_10157211 | 3300025315 | Bacteria | 991 |
| 588 | Ga0207656_10001724 | 3300025321 | Bacteria | 7270 |
| 589 | Ga0207656_10112803 | 3300025321 | Bacteria | 1258 |
| 590 | Ga0207682_10143516 | 3300025893 | Bacteria | 1073 |
| 591 | Ga0207682_10171017 | 3300025893 | Bacteria | 988 |
| 592 | Ga0207692_10969175 | 3300025898 | Bacteria | 561 |
| 593 | Ga0207642_10007476 | 3300025899 | Bacteria | 3694 |
| 594 | Ga0207642_10118473 | 3300025899 | Bacteria | 1361 |
| 595 | Ga0207642_10741856 | 3300025899 | Bacteria | 621 |
| 596 | Ga0207688_10044138 | 3300025901 | Bacteria | 2484 |
| 597 | Ga0207680_10001162 | 3300025903 | Bacteria | 12407 |
| 598 | Ga0207680_10007152 | 3300025903 | Bacteria | 5427 |
| 599 | Ga0207680_10359870 | 3300025903 | Bacteria | 1023 |
| 600 | Ga0207680_10456999 | 3300025903 | Bacteria | 907 |
| 601 | Ga0207680_10704104 | 3300025903 | Bacteria | 724 |
| 602 | Ga0207647_10000024 | 3300025904 | Bacteria | 115153 |
| 603 | Ga0207647_10002046 | 3300025904 | Bacteria | 15407 |
| 604 | Ga0207647_10063045 | 3300025904 | Bacteria | 2256 |
| 605 | Ga0207647_10487124 | 3300025904 | Bacteria | 688 |
| 606 | Ga0207647_10548242 | 3300025904 | Bacteria | 641 |
| 607 | Ga0207647_10801934 | 3300025904 | Bacteria | 506 |
| 608 | Ga0207699_10070829 | 3300025906 | Bacteria | 2130 |
| 609 | Ga0207699_10341074 | 3300025906 | Bacteria | 1056 |
| 610 | Ga0207699_10429108 | 3300025906 | Bacteria | 945 |
| 611 | Ga0207645_10025001 | 3300025907 | Bacteria | 3868 |
| 612 | Ga0207643_10125350 | 3300025908 | Bacteria | 1525 |
| 613 | Ga0207643_10127157 | 3300025908 | Bacteria | 1513 |
| 614 | Ga0207643_10380027 | 3300025908 | Bacteria | 890 |
| 615 | Ga0207705_10149766 | 3300025909 | Bacteria | 1748 |
| 616 | Ga0207705_10373572 | 3300025909 | Bacteria | 1101 |
| 617 | Ga0207705_10634513 | 3300025909 | Bacteria | 831 |
| 618 | Ga0207705_11074411 | 3300025909 | Bacteria | 620 |
| 619 | Ga0207654_10006477 | 3300025911 | Bacteria | 5893 |
| 620 | Ga0207654_10015692 | 3300025911 | Bacteria | 3935 |
| 621 | Ga0207654_10065026 | 3300025911 | Bacteria | 2146 |
| 622 | Ga0207654_10100463 | 3300025911 | Bacteria | 1782 |
| 623 | Ga0207654_10266358 | 3300025911 | Bacteria | 1154 |
| 624 | Ga0207707_10001452 | 3300025912 | Bacteria | 21916 |
| 625 | Ga0207707_10052277 | 3300025912 | Unclassified | 3558 |
| 626 | Ga0207695_10000040 | 3300025913 | Bacteria | 452787 |
| 627 | Ga0207695_10002176 | 3300025913 | Bacteria | 29640 |
| 628 | Ga0207695_10006210 | 3300025913 | Bacteria | 15563 |
| 629 | Ga0207695_10016274 | 3300025913 | Bacteria | 8712 |
| 630 | Ga0207695_10022021 | 3300025913 | Bacteria | 7252 |
| 631 | Ga0207695_10025623 | 3300025913 | Bacteria | 6597 |
| 632 | Ga0207695_10038774 | 3300025913 | Bacteria | 5125 |
| 633 | Ga0207695_10040956 | 3300025913 | Unclassified | 4961 |
| 634 | Ga0207695_10533362 | 3300025913 | Bacteria | 1055 |
| 635 | Ga0207695_10827735 | 3300025913 | Bacteria | 806 |
| 636 | Ga0207671_10002984 | 3300025914 | Bacteria | 17350 |
| 637 | Ga0207671_10009442 | 3300025914 | Bacteria | 8155 |
| 638 | Ga0207671_10018841 | 3300025914 | Bacteria | 5290 |
| 639 | Ga0207671_10405775 | 3300025914 | Bacteria | 1084 |
| 640 | Ga0207671_10496425 | 3300025914 | Bacteria | 973 |
| 641 | Ga0207671_10577850 | 3300025914 | Bacteria | 896 |
| 642 | Ga0207671_11167927 | 3300025914 | Bacteria | 603 |
| 643 | Ga0207693_10286913 | 3300025915 | Bacteria | 1290 |
| 644 | Ga0207663_10152669 | 3300025916 | Bacteria | 1622 |
| 645 | Ga0207663_11091975 | 3300025916 | Bacteria | 641 |
| 646 | Ga0207660_10416195 | 3300025917 | Bacteria | 1084 |
| 647 | Ga0207660_10722308 | 3300025917 | Bacteria | 813 |
| 648 | Ga0207660_11349006 | 3300025917 | Unclassified | 579 |
| 649 | Ga0207662_10040240 | 3300025918 | Bacteria | 2747 |
| 650 | Ga0207657_10000326 | 3300025919 | Bacteria | 50694 |
| 651 | Ga0207657_10511310 | 3300025919 | Bacteria | 940 |
| 652 | Ga0207657_11111319 | 3300025919 | Bacteria | 604 |
| 653 | Ga0207649_10004643 | 3300025920 | Bacteria | 7437 |
| 654 | Ga0207649_10159208 | 3300025920 | Bacteria | 1563 |
| 655 | Ga0207649_10270891 | 3300025920 | Unclassified | 1231 |
| 656 | Ga0207649_10532696 | 3300025920 | Bacteria | 897 |
| 657 | Ga0207649_10585098 | 3300025920 | Bacteria | 857 |
| 658 | Ga0207649_10788992 | 3300025920 | Bacteria | 741 |
| 659 | Ga0207649_10869496 | 3300025920 | Bacteria | 706 |
| 660 | Ga0207652_10016784 | 3300025921 | Bacteria | 5983 |
| 661 | Ga0207652_10203273 | 3300025921 | Bacteria | 1783 |
| 662 | Ga0207652_11194063 | 3300025921 | Bacteria | 662 |
| 663 | Ga0207652_11427174 | 3300025921 | Bacteria | 596 |
| 664 | Ga0207652_11478752 | 3300025921 | Bacteria | 583 |
| 665 | Ga0207681_10137587 | 3300025923 | Bacteria | 1815 |
| 666 | Ga0207681_10552603 | 3300025923 | Bacteria | 948 |
| 667 | Ga0207681_11511191 | 3300025923 | Unclassified | 563 |
| 668 | Ga0207694_10001319 | 3300025924 | Bacteria | 21340 |
| 669 | Ga0207694_10006000 | 3300025924 | Bacteria | 9302 |
| 670 | Ga0207694_10010865 | 3300025924 | Bacteria | 6874 |
| 671 | Ga0207694_10040794 | 3300025924 | Bacteria | 3576 |
| 672 | Ga0207694_10041105 | 3300025924 | Unclassified | 3562 |
| 673 | Ga0207694_10143818 | 3300025924 | Bacteria | 1919 |
| 674 | Ga0207694_10358811 | 3300025924 | Bacteria | 1207 |
| 675 | Ga0207694_10591577 | 3300025924 | Unclassified | 933 |
| 676 | Ga0207694_11250158 | 3300025924 | Bacteria | 628 |
| 677 | Ga0207650_10003597 | 3300025925 | Bacteria | 10636 |
| 678 | Ga0207650_10007026 | 3300025925 | Bacteria | 7676 |
| 679 | Ga0207650_10150236 | 3300025925 | Bacteria | 1838 |
| 680 | Ga0207650_10162989 | 3300025925 | Bacteria | 1768 |
| 681 | Ga0207659_10277557 | 3300025926 | Bacteria | 1369 |
| 682 | Ga0207659_10518814 | 3300025926 | Bacteria | 1010 |
| 683 | Ga0207659_10995151 | 3300025926 | Bacteria | 721 |
| 684 | Ga0207659_11649400 | 3300025926 | Bacteria | 547 |
| 685 | Ga0207687_10140730 | 3300025927 | Bacteria | 1830 |
| 686 | Ga0207687_10158132 | 3300025927 | Bacteria | 1736 |
| 687 | Ga0207687_10583760 | 3300025927 | Bacteria | 940 |
| 688 | Ga0207687_10584936 | 3300025927 | Bacteria | 939 |
| 689 | Ga0207687_10676723 | 3300025927 | Bacteria | 874 |
| 690 | Ga0207687_10888147 | 3300025927 | Bacteria | 762 |
| 691 | Ga0207700_10353069 | 3300025928 | Bacteria | 1281 |
| 692 | Ga0207700_10595647 | 3300025928 | Bacteria | 983 |
| 693 | Ga0207644_10174600 | 3300025931 | Bacteria | 1680 |
| 694 | Ga0207644_10251177 | 3300025931 | Bacteria | 1411 |
| 695 | Ga0207644_10344765 | 3300025931 | Bacteria | 1209 |
| 696 | Ga0207644_10873267 | 3300025931 | Bacteria | 753 |
| 697 | Ga0207690_10833288 | 3300025932 | Bacteria | 763 |
| 698 | Ga0207690_10838427 | 3300025932 | Bacteria | 761 |
| 699 | Ga0207690_10909924 | 3300025932 | Unclassified | 730 |
| 700 | Ga0207706_10006512 | 3300025933 | Bacteria | 10832 |
| 701 | Ga0207706_10113646 | 3300025933 | Bacteria | 2381 |
| 702 | Ga0207706_10261519 | 3300025933 | Bacteria | 1511 |
| 703 | Ga0207706_10400407 | 3300025933 | Bacteria | 1190 |
| 704 | Ga0207706_11139690 | 3300025933 | Bacteria | 650 |
| 705 | Ga0207706_11167617 | 3300025933 | Unclassified | 641 |
| 706 | Ga0207706_11392604 | 3300025933 | Bacteria | 576 |
| 707 | Ga0207686_10015548 | 3300025934 | Bacteria | 4256 |
| 708 | Ga0207686_10138086 | 3300025934 | Bacteria | 1681 |
| 709 | Ga0207686_10416366 | 3300025934 | Bacteria | 1027 |
| 710 | Ga0207686_10450316 | 3300025934 | Bacteria | 990 |
| 711 | Ga0207686_10767744 | 3300025934 | Unclassified | 771 |
| 712 | Ga0207686_11279916 | 3300025934 | Bacteria | 602 |
| 713 | Ga0207686_11737595 | 3300025934 | Bacteria | 516 |
| 714 | Ga0207709_10027510 | 3300025935 | Bacteria | 3278 |
| 715 | Ga0207709_10213470 | 3300025935 | Bacteria | 1387 |
| 716 | Ga0207670_10293221 | 3300025936 | Bacteria | 1271 |
| 717 | Ga0207669_10025336 | 3300025937 | Bacteria | 3204 |
| 718 | Ga0207669_10159282 | 3300025937 | Bacteria | 1592 |
| 719 | Ga0207669_10258036 | 3300025937 | Bacteria | 1302 |
| 720 | Ga0207704_10018725 | 3300025938 | Bacteria | 3621 |
| 721 | Ga0207704_10021380 | 3300025938 | Bacteria | 3444 |
| 722 | Ga0207704_10064222 | 3300025938 | Bacteria | 2292 |
| 723 | Ga0207704_10096787 | 3300025938 | Bacteria | 1955 |
| 724 | Ga0207704_10381941 | 3300025938 | Bacteria | 1106 |
| 725 | Ga0207704_10741225 | 3300025938 | Bacteria | 816 |
| 726 | Ga0207704_11001374 | 3300025938 | Unclassified | 707 |
| 727 | Ga0207704_11484772 | 3300025938 | Unclassified | 581 |
| 728 | Ga0207704_11852943 | 3300025938 | Unclassified | 519 |
| 729 | Ga0207665_11018767 | 3300025939 | Bacteria | 659 |
| 730 | Ga0207691_10027848 | 3300025940 | Bacteria | 5296 |
| 731 | Ga0207691_10062400 | 3300025940 | Bacteria | 3382 |
| 732 | Ga0207691_10101776 | 3300025940 | Bacteria | 2563 |
| 733 | Ga0207691_10300986 | 3300025940 | Bacteria | 1378 |
| 734 | Ga0207691_10345714 | 3300025940 | Bacteria | 1273 |
| 735 | Ga0207691_10437193 | 3300025940 | Bacteria | 1114 |
| 736 | Ga0207691_10612968 | 3300025940 | Bacteria | 921 |
| 737 | Ga0207711_10001544 | 3300025941 | Bacteria | 21341 |
| 738 | Ga0207711_10006123 | 3300025941 | Bacteria | 10160 |
| 739 | Ga0207711_10009684 | 3300025941 | Bacteria | 8027 |
| 740 | Ga0207711_10019526 | 3300025941 | Bacteria | 5641 |
| 741 | Ga0207711_10203021 | 3300025941 | Bacteria | 1809 |
| 742 | Ga0207711_10261515 | 3300025941 | Bacteria | 1591 |
| 743 | Ga0207711_10328735 | 3300025941 | Bacteria | 1414 |
| 744 | Ga0207711_10721443 | 3300025941 | Bacteria | 930 |
| 745 | Ga0207689_10169299 | 3300025942 | Bacteria | 1800 |
| 746 | Ga0207689_10192430 | 3300025942 | Bacteria | 1683 |
| 747 | Ga0207689_11024129 | 3300025942 | Unclassified | 696 |
| 748 | Ga0207689_11253393 | 3300025942 | Bacteria | 624 |
| 749 | Ga0207661_10059158 | 3300025944 | Bacteria | 3087 |
| 750 | Ga0207661_10059225 | 3300025944 | Unclassified | 3085 |
| 751 | Ga0207661_10115744 | 3300025944 | Bacteria | 2275 |
| 752 | Ga0207661_10992832 | 3300025944 | Bacteria | 773 |
| 753 | Ga0207661_11739692 | 3300025944 | Bacteria | 569 |
| 754 | Ga0207679_10001856 | 3300025945 | Bacteria | 13125 |
| 755 | Ga0207679_10204991 | 3300025945 | Bacteria | 1650 |
| 756 | Ga0207679_10290784 | 3300025945 | Bacteria | 1405 |
| 757 | Ga0207679_10447035 | 3300025945 | Bacteria | 1145 |
| 758 | Ga0207679_11688830 | 3300025945 | Bacteria | 580 |
| 759 | Ga0207667_10000465 | 3300025949 | Bacteria | 54509 |
| 760 | Ga0207667_10001399 | 3300025949 | Bacteria | 30243 |
| 761 | Ga0207667_10027253 | 3300025949 | Bacteria | 6224 |
| 762 | Ga0207667_10080008 | 3300025949 | Bacteria | 3386 |
| 763 | Ga0207667_10141308 | 3300025949 | Bacteria | 2478 |
| 764 | Ga0207667_10373465 | 3300025949 | Bacteria | 1453 |
| 765 | Ga0207667_11036637 | 3300025949 | Bacteria | 806 |
| 766 | Ga0207667_11127458 | 3300025949 | Bacteria | 767 |
| 767 | Ga0207651_10320214 | 3300025960 | Bacteria | 1296 |
| 768 | Ga0207651_10334158 | 3300025960 | Bacteria | 1271 |
| 769 | Ga0207651_10485762 | 3300025960 | Bacteria | 1065 |
| 770 | Ga0207651_10882676 | 3300025960 | Bacteria | 796 |
| 771 | Ga0207651_11719631 | 3300025960 | Bacteria | 565 |
| 772 | Ga0207712_10000275 | 3300025961 | Bacteria | 49090 |
| 773 | Ga0207712_10030485 | 3300025961 | Bacteria | 3626 |
| 774 | Ga0207712_10040634 | 3300025961 | Bacteria | 3194 |
| 775 | Ga0207712_10177825 | 3300025961 | Bacteria | 1669 |
| 776 | Ga0207712_10688910 | 3300025961 | Bacteria | 891 |
| 777 | Ga0207712_10882859 | 3300025961 | Bacteria | 789 |
| 778 | Ga0207668_10072961 | 3300025972 | Bacteria | 2458 |
| 779 | Ga0207668_10316378 | 3300025972 | Bacteria | 1294 |
| 780 | Ga0207668_10461821 | 3300025972 | Bacteria | 1086 |
| 781 | Ga0207640_10003205 | 3300025981 | Bacteria | 8813 |
| 782 | Ga0207640_10018145 | 3300025981 | Bacteria | 4129 |
| 783 | Ga0207640_10030688 | 3300025981 | Bacteria | 3313 |
| 784 | Ga0207640_10056429 | 3300025981 | Bacteria | 2578 |
| 785 | Ga0207640_10065293 | 3300025981 | Bacteria | 2428 |
| 786 | Ga0207640_10098411 | 3300025981 | Bacteria | 2045 |
| 787 | Ga0207640_10212413 | 3300025981 | Unclassified | 1475 |
| 788 | Ga0207658_10011118 | 3300025986 | Bacteria | 6130 |
| 789 | Ga0207658_10097209 | 3300025986 | Bacteria | 2298 |
| 790 | Ga0207658_10200064 | 3300025986 | Bacteria | 1667 |
| 791 | Ga0207658_10511296 | 3300025986 | Bacteria | 1071 |
| 792 | Ga0207658_10788387 | 3300025986 | Bacteria | 862 |
| 793 | Ga0207658_11393045 | 3300025986 | Bacteria | 641 |
| 794 | Ga0207658_11677120 | 3300025986 | Bacteria | 581 |
| 795 | Ga0207677_10010569 | 3300026023 | Bacteria | 5231 |
| 796 | Ga0207677_10096166 | 3300026023 | Bacteria | 2166 |
| 797 | Ga0207677_10096831 | 3300026023 | Bacteria | 2160 |
| 798 | Ga0207677_10207950 | 3300026023 | Bacteria | 1560 |
| 799 | Ga0207677_10460226 | 3300026023 | Bacteria | 1092 |
| 800 | Ga0207677_10486879 | 3300026023 | Bacteria | 1064 |
| 801 | Ga0207677_10871921 | 3300026023 | Unclassified | 810 |
| 802 | Ga0207703_10001612 | 3300026035 | Bacteria | 20384 |
| 803 | Ga0207703_10013731 | 3300026035 | Bacteria | 6313 |
| 804 | Ga0207703_10022458 | 3300026035 | Bacteria | 4949 |
| 805 | Ga0207703_10026541 | 3300026035 | Bacteria | 4560 |
| 806 | Ga0207703_10068511 | 3300026035 | Bacteria | 2924 |
| 807 | Ga0207703_10413352 | 3300026035 | Bacteria | 1254 |
| 808 | Ga0207703_10426585 | 3300026035 | Bacteria | 1235 |
| 809 | Ga0207703_10536610 | 3300026035 | Bacteria | 1102 |
| 810 | Ga0207703_10546625 | 3300026035 | Bacteria | 1092 |
| 811 | Ga0207703_11229443 | 3300026035 | Bacteria | 720 |
| 812 | Ga0207639_10000116 | 3300026041 | Bacteria | 61688 |
| 813 | Ga0207639_10001494 | 3300026041 | Bacteria | 15734 |
| 814 | Ga0207639_10005911 | 3300026041 | Bacteria | 8292 |
| 815 | Ga0207639_10050029 | 3300026041 | Bacteria | 3172 |
| 816 | Ga0207639_10180619 | 3300026041 | Bacteria | 1795 |
| 817 | Ga0207639_10330641 | 3300026041 | Bacteria | 1356 |
| 818 | Ga0207639_11875370 | 3300026041 | Bacteria | 560 |
| 819 | Ga0207678_10005905 | 3300026067 | Bacteria | 10906 |
| 820 | Ga0207678_10223153 | 3300026067 | Bacteria | 1613 |
| 821 | Ga0207678_10707280 | 3300026067 | Bacteria | 887 |
| 822 | Ga0207678_11491716 | 3300026067 | Bacteria | 597 |
| 823 | Ga0207678_11662131 | 3300026067 | Unclassified | 561 |
| 824 | Ga0207708_10161011 | 3300026075 | Bacteria | 1772 |
| 825 | Ga0207708_10294154 | 3300026075 | Bacteria | 1319 |
| 826 | Ga0207702_10001051 | 3300026078 | Bacteria | 28280 |
| 827 | Ga0207702_10008697 | 3300026078 | Bacteria | 8562 |
| 828 | Ga0207702_10013885 | 3300026078 | Bacteria | 6690 |
| 829 | Ga0207702_10036300 | 3300026078 | Bacteria | 4122 |
| 830 | Ga0207702_10216397 | 3300026078 | Bacteria | 1783 |
| 831 | Ga0207702_10549727 | 3300026078 | Bacteria | 1129 |
| 832 | Ga0207641_10020771 | 3300026088 | Bacteria | 5397 |
| 833 | Ga0207641_10022745 | 3300026088 | Bacteria | 5161 |
| 834 | Ga0207641_10025422 | 3300026088 | Bacteria | 4882 |
| 835 | Ga0207641_10073518 | 3300026088 | Bacteria | 2946 |
| 836 | Ga0207641_10140241 | 3300026088 | Bacteria | 2180 |
| 837 | Ga0207641_10529347 | 3300026088 | Unclassified | 1147 |
| 838 | Ga0207641_10973412 | 3300026088 | Bacteria | 844 |
| 839 | Ga0207641_11150095 | 3300026088 | Bacteria | 775 |
| 840 | Ga0207641_11827313 | 3300026088 | Bacteria | 609 |
| 841 | Ga0207641_11922758 | 3300026088 | Bacteria | 593 |
| 842 | Ga0207648_10028264 | 3300026089 | Bacteria | 4974 |
| 843 | Ga0207648_10071363 | 3300026089 | Bacteria | 3026 |
| 844 | Ga0207648_10092387 | 3300026089 | Bacteria | 2646 |
| 845 | Ga0207648_10141728 | 3300026089 | Bacteria | 2119 |
| 846 | Ga0207648_10161034 | 3300026089 | Bacteria | 1982 |
| 847 | Ga0207648_10958181 | 3300026089 | Bacteria | 800 |
| 848 | Ga0207648_11640543 | 3300026089 | Bacteria | 604 |
| 849 | Ga0207676_10015306 | 3300026095 | Bacteria | 5531 |
| 850 | Ga0207676_10020158 | 3300026095 | Bacteria | 4874 |
| 851 | Ga0207676_10084369 | 3300026095 | Bacteria | 2589 |
| 852 | Ga0207676_10095677 | 3300026095 | Bacteria | 2450 |
| 853 | Ga0207676_10230810 | 3300026095 | Bacteria | 1654 |
| 854 | Ga0207676_10472482 | 3300026095 | Bacteria | 1186 |
| 855 | Ga0207676_11236738 | 3300026095 | Bacteria | 741 |
| 856 | Ga0207676_11707682 | 3300026095 | Unclassified | 628 |
| 857 | Ga0207676_12201449 | 3300026095 | Bacteria | 549 |
| 858 | Ga0207676_12594716 | 3300026095 | Bacteria | 503 |
| 859 | Ga0207674_10002111 | 3300026116 | Bacteria | 25147 |
| 860 | Ga0207674_10003692 | 3300026116 | Bacteria | 18684 |
| 861 | Ga0207674_10180643 | 3300026116 | Bacteria | 2061 |
| 862 | Ga0207674_10181195 | 3300026116 | Bacteria | 2058 |
| 863 | Ga0207674_10186230 | 3300026116 | Bacteria | 2026 |
| 864 | Ga0207674_10390820 | 3300026116 | Bacteria | 1345 |
| 865 | Ga0207674_10532582 | 3300026116 | Bacteria | 1135 |
| 866 | Ga0207674_10938633 | 3300026116 | Bacteria | 834 |
| 867 | Ga0207674_11210336 | 3300026116 | Bacteria | 725 |
| 868 | Ga0207674_11655389 | 3300026116 | Bacteria | 608 |
| 869 | Ga0207674_11848943 | 3300026116 | Bacteria | 570 |
| 870 | Ga0207675_100010284 | 3300026118 | Bacteria | 8766 |
| 871 | Ga0207675_100069455 | 3300026118 | Bacteria | 3293 |
| 872 | Ga0207675_100080251 | 3300026118 | Unclassified | 3059 |
| 873 | Ga0207675_100797267 | 3300026118 | Unclassified | 958 |
| 874 | Ga0207675_100975801 | 3300026118 | Bacteria | 865 |
| 875 | Ga0207683_10041514 | 3300026121 | Bacteria | 4017 |
| 876 | Ga0207683_10174299 | 3300026121 | Bacteria | 1949 |
| 877 | Ga0207683_10224289 | 3300026121 | Bacteria | 1713 |
| 878 | Ga0207683_10245372 | 3300026121 | Bacteria | 1634 |
| 879 | Ga0207683_10353144 | 3300026121 | Bacteria | 1349 |
| 880 | Ga0207683_10460767 | 3300026121 | Bacteria | 1172 |
| 881 | Ga0207683_10934410 | 3300026121 | Bacteria | 805 |
| 882 | Ga0207683_11450479 | 3300026121 | Bacteria | 634 |
| 883 | Ga0207698_10025790 | 3300026142 | Bacteria | 4148 |
| 884 | Ga0207698_10189561 | 3300026142 | Bacteria | 1830 |
| 885 | Ga0207698_10296992 | 3300026142 | Bacteria | 1502 |
| 886 | Ga0207698_10369316 | 3300026142 | Bacteria | 1361 |
| 887 | Ga0207698_10387578 | 3300026142 | Bacteria | 1331 |
| 888 | Ga0207698_10668990 | 3300026142 | Bacteria | 1030 |
| 889 | Ga0207698_11360110 | 3300026142 | Bacteria | 725 |
| 890 | Ga0207698_12368509 | 3300026142 | Bacteria | 542 |
| 891 | Ga0209971_1180016 | 3300027682 | Bacteria | 521 |
| 892 | Ga0209813_10144077 | 3300027866 | Bacteria | 848 |
| 893 | Ga0209813_10254670 | 3300027866 | Bacteria | 668 |
| 894 | Ga0209813_10271466 | 3300027866 | Bacteria | 650 |
| 895 | Ga0209813_10345713 | 3300027866 | Bacteria | 588 |
| 896 | Ga0209974_10066110 | 3300027876 | Bacteria | 1228 |
| 897 | Ga0209974_10251929 | 3300027876 | Bacteria | 665 |
| 898 | Ga0207428_10499733 | 3300027907 | Bacteria | 883 |
| 899 | Ga0268266_10000008 | 3300028379 | Bacteria | 1161875 |
| 900 | Ga0268266_10048529 | 3300028379 | Bacteria | 3640 |
| 901 | Ga0268266_10144893 | 3300028379 | Bacteria | 2135 |
| 902 | Ga0268266_10221390 | 3300028379 | Bacteria | 1740 |
| 903 | Ga0268265_10143946 | 3300028380 | Bacteria | 2000 |
| 904 | Ga0268265_12096315 | 3300028380 | Bacteria | 573 |
| 905 | Ga0268264_10017059 | 3300028381 | Bacteria | 5946 |
| 906 | Ga0268264_10035419 | 3300028381 | Bacteria | 4110 |
| 907 | Ga0268264_10050247 | 3300028381 | Bacteria | 3471 |
| 908 | Ga0268264_10065648 | 3300028381 | Bacteria | 3058 |
| 909 | Ga0268264_10278908 | 3300028381 | Unclassified | 1564 |
| 910 | Ga0268264_10601297 | 3300028381 | Bacteria | 1084 |
| 911 | Ga0268264_11809743 | 3300028381 | Bacteria | 621 |
| 912 | Ga0268264_12478561 | 3300028381 | Bacteria | 524 |
| 913 | Ga0265766_1022650 | 3300030863 | Bacteria | 526 |
| 914 | Ga0307513_11103177 | 3300031456 | Bacteria | 506 |
| 915 | Ga0307408_100078352 | 3300031548 | Bacteria | 2463 |
| 916 | Ga0307408_100503230 | 3300031548 | Bacteria | 1061 |
| 917 | Ga0307508_10009148 | 3300031616 | Bacteria | 9123 |
| 918 | Ga0316575_10067027 | 3300031665 | Bacteria | 1438 |
| 919 | Ga0316575_10145067 | 3300031665 | Bacteria | 978 |
| 920 | Ga0316575_10177475 | 3300031665 | Bacteria | 884 |
| 921 | Ga0316579_10035148 | 3300031691 | Bacteria | 2309 |
| 922 | Ga0316579_10042354 | 3300031691 | Bacteria | 2115 |
| 923 | Ga0316579_10391337 | 3300031691 | Bacteria | 672 |
| 924 | Ga0316576_10005896 | 3300031727 | Bacteria | 7563 |
| 925 | Ga0316576_10006214 | 3300031727 | Bacteria | 7410 |
| 926 | Ga0316576_10035004 | 3300031727 | Bacteria | 3582 |
| 927 | Ga0316576_10097808 | 3300031727 | Bacteria | 2191 |
| 928 | Ga0316576_10097962 | 3300031727 | Bacteria | 2190 |
| 929 | Ga0316576_10101454 | 3300031727 | Bacteria | 2151 |
| 930 | Ga0316576_10623041 | 3300031727 | Bacteria | 786 |
| 931 | Ga0316578_10000785 | 3300031728 | Bacteria | 11729 |
| 932 | Ga0316578_10031889 | 3300031728 | Bacteria | 3006 |
| 933 | Ga0316578_10035472 | 3300031728 | Bacteria | 2867 |
| 934 | Ga0316578_10036064 | 3300031728 | Bacteria | 2846 |
| 935 | Ga0316578_10050639 | 3300031728 | Bacteria | 2430 |
| 936 | Ga0316578_10401498 | 3300031728 | Bacteria | 812 |
| 937 | Ga0316578_10462580 | 3300031728 | Bacteria | 749 |
| 938 | Ga0307516_10045126 | 3300031730 | Bacteria | 4355 |
| 939 | Ga0307405_10011566 | 3300031731 | Bacteria | 4634 |
| 940 | Ga0307405_10085176 | 3300031731 | Bacteria | 2077 |
| 941 | Ga0307405_10414640 | 3300031731 | Bacteria | 1058 |
| 942 | Ga0307405_10432868 | 3300031731 | Bacteria | 1038 |
| 943 | Ga0307405_11405812 | 3300031731 | Bacteria | 610 |
| 944 | Ga0316577_10023857 | 3300031733 | Bacteria | 3396 |
| 945 | Ga0316577_10070727 | 3300031733 | Bacteria | 1947 |
| 946 | Ga0316577_10567628 | 3300031733 | Bacteria | 645 |
| 947 | Ga0307413_10005154 | 3300031824 | Bacteria | 5793 |
| 948 | Ga0307410_10003872 | 3300031852 | Bacteria | 7613 |
| 949 | Ga0307410_10050867 | 3300031852 | Bacteria | 2789 |
| 950 | Ga0307410_10822939 | 3300031852 | Bacteria | 791 |
| 951 | Ga0307410_11283329 | 3300031852 | Bacteria | 640 |
| 952 | Ga0307406_10004191 | 3300031901 | Bacteria | 7847 |
| 953 | Ga0307406_10145381 | 3300031901 | Bacteria | 1684 |
| 954 | Ga0307406_10303100 | 3300031901 | Bacteria | 1228 |
| 955 | Ga0307407_10716221 | 3300031903 | Bacteria | 755 |
| 956 | Ga0307412_10269682 | 3300031911 | Bacteria | 1331 |
| 957 | Ga0307409_100001007 | 3300031995 | Bacteria | 13200 |
| 958 | Ga0307409_100673996 | 3300031995 | Bacteria | 1030 |
| 959 | Ga0307409_101468556 | 3300031995 | Bacteria | 709 |
| 960 | Ga0307416_100019061 | 3300032002 | Bacteria | 4854 |
| 961 | Ga0307416_100056399 | 3300032002 | Bacteria | 3170 |
| 962 | Ga0307416_100367485 | 3300032002 | Bacteria | 1463 |
| 963 | Ga0307416_101019506 | 3300032002 | Bacteria | 931 |
| 964 | Ga0307414_11040822 | 3300032004 | Bacteria | 754 |
| 965 | Ga0307411_10377180 | 3300032005 | Bacteria | 1165 |
| 966 | Ga0307411_10731470 | 3300032005 | Bacteria | 865 |
| 967 | Ga0307415_100000190 | 3300032126 | Bacteria | 27293 |
| 968 | Ga0307415_100131400 | 3300032126 | Bacteria | 1896 |
| 969 | Ga0307415_100318770 | 3300032126 | Bacteria | 1295 |
| 970 | Ga0307415_100363344 | 3300032126 | Bacteria | 1223 |
| 971 | Ga0307415_101520076 | 3300032126 | Bacteria | 641 |
| 972 | Ga0307415_101814762 | 3300032126 | Bacteria | 590 |
| 973 | Ga0316585_10005493 | 3300032137 | Bacteria | 3580 |
| 974 | Ga0316580_10001392 | 3300032139 | Bacteria | 6309 |
| 975 | Ga0316592_1031132 | 3300033524 | Bacteria | 1161 |
| 976 | Ga0316596_1012403 | 3300033541 | Bacteria | 2095 |
| 977 | Ga0373938_0122376 | 3300034957 | Bacteria | 672 |
| 978 | Ga0373928_0001559 | 3300035084 | Bacteria | 4444 |
| 979 | Ga0373929_0005769 | 3300035085 | Bacteria | 2235 |
| 980 | Ga0373944_0040699 | 3300035089 | Bacteria | 1435 |
| 981 | Ga0373949_0106882 | 3300035090 | Bacteria | 772 |
| 982 | Ga0373932_0012957 | 3300035112 | Bacteria | 2063 |
| 983 | Ga0373956_0576659 | 3300035119 | Bacteria | 537 |
| 984 | Ga0373943_0365343 | 3300035170 | Bacteria | 829 |
| 985 | Ga0373943_0610319 | 3300035170 | Bacteria | 643 |
| 986 | Ga0373946_0328855 | 3300035171 | Bacteria | 761 |
| 987 | Ga0316574_0009298 | 3300035398 | Bacteria | 5499 |
| 988 | Ga0316574_0012164 | 3300035398 | Bacteria | 4917 |
| 989 | Ga0316574_0028980 | 3300035398 | Bacteria | 3342 |
| 990 | Ga0316574_0043707 | 3300035398 | Bacteria | 2769 |
| 991 | Ga0316574_0044640 | 3300035398 | Bacteria | 2742 |
| 992 | Ga0316574_0068255 | 3300035398 | Bacteria | 2242 |
| 993 | Ga0316574_0104517 | 3300035398 | Bacteria | 1813 |
| 994 | Ga0316574_0166127 | 3300035398 | Bacteria | 1421 |
| 995 | Ga0316574_0252697 | 3300035398 | Bacteria | 1126 |
| 996 | Ga0316574_0296427 | 3300035398 | Bacteria | 1029 |
| 997 | Ga0316574_0771780 | 3300035398 | Bacteria | 586 |
| 998 | Ga0316574_0777003 | 3300035398 | Bacteria | 584 |
| 999 | Ga0316574_0796423 | 3300035398 | Bacteria | 575 |
| 1000 | Ga0373931_0000006 | 3300035691 | Bacteria | 437006 |
| 1001 | Ga0373931_0012253 | 3300035691 | Bacteria | 4153 |
| 1002 | Ga0373931_0452825 | 3300035691 | Bacteria | 821 |
| 1003 | Ga0373931_0732471 | 3300035691 | Unclassified | 655 |
| 1004 | Ga0373933_0009250 | 3300035724 | Bacteria | 5379 |
| 1005 | Ga0373937_0139768 | 3300036401 | Bacteria | 2265 |
| 1006 | Ga0373937_1280912 | 3300036401 | Bacteria | 681 |
| 1007 | Ga0373937_1528419 | 3300036401 | Unclassified | 615 |
| 1008 | Ga0316582_0013632 | 3300036647 | Bacteria | 4582 |
| 1009 | Ga0316582_0016194 | 3300036647 | Bacteria | 4284 |
| 1010 | Ga0316582_0209094 | 3300036647 | Bacteria | 1333 |
| 1011 | Ga0316584_0005439 | 3300036712 | Bacteria | 8547 |
| 1012 | Ga0316584_0017406 | 3300036712 | Bacteria | 5165 |
| 1013 | Ga0316584_0023461 | 3300036712 | Bacteria | 4507 |
| 1014 | Ga0316584_0024065 | 3300036712 | Bacteria | 4453 |
| 1015 | Ga0316584_0076261 | 3300036712 | Bacteria | 2512 |
| 1016 | Ga0316584_0086520 | 3300036712 | Bacteria | 2346 |
| 1017 | Ga0316584_0112103 | 3300036712 | Bacteria | 2041 |
| 1018 | Ga0316584_0146323 | 3300036712 | Bacteria | 1760 |
| 1019 | Ga0395900_0155816 | 3300037418 | Bacteria | 2333 |
| 1020 | Ga0395898_0002525 | 3300037466 | Bacteria | 21479 |
| 1021 | Ga0395901_0047958 | 3300038443 | Bacteria | 4435 |
| 1022 | Ga0395901_0079626 | 3300038443 | Bacteria | 3421 |
| 1023 | Ga0395901_0607616 | 3300038443 | Bacteria | 1102 |
| 1024 | Ga0400485_10787 | 3300038735 | Bacteria | 3970 |
| 1025 | Ga0400483_017383 | 3300039062 | Bacteria | 3271 |
| 1026 | Ga0400483_035347 | 3300039062 | Bacteria | 5529 |
| 1027 | Ga0400483_088865 | 3300039062 | Bacteria | 1740 |
| 1028 | Ga0400483_136168 | 3300039062 | Bacteria | 1367 |
| 1029 | Ga0400483_136484 | 3300039062 | Bacteria | 6669 |
| 1030 | Ga0400483_182325 | 3300039062 | Bacteria | 71334 |
| 1031 | Ga0400483_190738 | 3300039062 | Bacteria | 1016 |
| 1032 | Ga0400483_259065 | 3300039062 | Bacteria | 8084 |
| 1033 | Ga0436363_1130565 | 3300039450 | Bacteria | 3870 |
| 1034 | Ga0439439_0022419 | 3300041406 | Bacteria | 1577 |
| 1035 | Ga0439439_0058660 | 3300041406 | Bacteria | 1019 |
| 1036 | Ga0439447_001969 | 3300041407 | Bacteria | 7533 |
| 1037 | Ga0439465_0013327 | 3300041413 | Bacteria | 2565 |
| 1038 | Ga0451789_0048425 | 3300041443 | Bacteria | 563 |
| 1039 | Ga0451793_0938620 | 3300041452 | Bacteria | 546 |
| 1040 | Ga0451795_0181400 | 3300041456 | Bacteria | 603 |
| 1041 | Ga0451795_0262903 | 3300041456 | Bacteria | 595 |
| 1042 | Ga0451802_0012644 | 3300041460 | Bacteria | 924 |
| 1043 | Ga0451802_1786781 | 3300041460 | Bacteria | 553 |
| 1044 | Ga0451807_1450121 | 3300041486 | Bacteria | 958 |
| 1045 | Ga0451837_0416935 | 3300041494 | Bacteria | 753 |
| 1046 | Ga0451839_0458029 | 3300041496 | Bacteria | 600 |
| 1047 | Ga0451841_0462125 | 3300041498 | Bacteria | 584 |
| 1048 | Ga0451841_0883188 | 3300041498 | Bacteria | 774 |
| 1049 | Ga0451843_0500007 | 3300041509 | Bacteria | 2246 |
| 1050 | Ga0451855_1137734 | 3300041511 | Bacteria | 565 |
| 1051 | Ga0451853_1377382 | 3300041512 | Bacteria | 846 |
| 1052 | Ga0451853_2288329 | 3300041512 | Bacteria | 1102 |
| 1053 | Ga0439445_0014698 | 3300042004 | Bacteria | 1909 |
| 1054 | Ga0439432_007407 | 3300042006 | Bacteria | 3890 |
| 1055 | Ga0439449_0017784 | 3300042007 | Bacteria | 2669 |
| 1056 | Ga0439449_0057595 | 3300042007 | Bacteria | 1434 |
| 1057 | Ga0439452_037293 | 3300042010 | Bacteria | 1160 |
| 1058 | Ga0439457_006216 | 3300042014 | Bacteria | 2938 |
| 1059 | Ga0439462_0001718 | 3300042015 | Bacteria | 4948 |
| 1060 | Ga0439462_0057892 | 3300042015 | Bacteria | 1047 |
| 1061 | Ga0439434_0068503 | 3300042435 | Bacteria | 1115 |
| 1062 | Ga0439459_0223947 | 3300042438 | Bacteria | 522 |
| 1063 | Ga0451577_0192413 | 3300042876 | Bacteria | 1840 |
| 1064 | Ga0453684_0066899 | 3300044712 | Bacteria | 4573 |
| 1065 | Ga0466960_0008210 | 3300044901 | Bacteria | 4270 |
| 1066 | Ga0451576_2035645 | 3300045051 | Bacteria | 591 |
| 1067 | Ga0466967_0272865 | 3300045976 | Bacteria | 1621 |
| 1068 | Ga0466967_0606373 | 3300045976 | Bacteria | 1081 |
| 1069 | Ga0495603_0066211 | 3300046455 | Bacteria | 2128 |
| 1070 | Ga0495603_0102592 | 3300046455 | Bacteria | 1670 |
| 1071 | Ga0495603_0306184 | 3300046455 | Bacteria | 913 |
| 1072 | Ga0495603_0499510 | 3300046455 | Bacteria | 697 |
| 1073 | Ga0495629_0123477 | 3300046459 | Bacteria | 1804 |
| 1074 | Ga0495629_0277441 | 3300046459 | Bacteria | 1151 |
| 1075 | Ga0495638_0048881 | 3300046460 | Bacteria | 2646 |
| 1076 | Ga0495641_0124434 | 3300046461 | Bacteria | 1150 |
| 1077 | Ga0495641_0245869 | 3300046461 | Bacteria | 804 |
| 1078 | Ga0495641_0276304 | 3300046461 | Bacteria | 756 |
| 1079 | Ga0495641_0538751 | 3300046461 | Bacteria | 533 |
| 1080 | Ga0495653_0607863 | 3300046463 | Bacteria | 671 |
| 1081 | Ga0495580_0068995 | 3300046472 | Bacteria | 2471 |
| 1082 | Ga0495580_0953227 | 3300046472 | Bacteria | 549 |
| 1083 | Ga0495582_0238331 | 3300046473 | Bacteria | 1042 |
| 1084 | Ga0495582_0390489 | 3300046473 | Bacteria | 802 |
| 1085 | Ga0495582_0563126 | 3300046473 | Bacteria | 659 |
| 1086 | Ga0495582_0774064 | 3300046473 | Bacteria | 555 |
| 1087 | Ga0495639_0015183 | 3300046475 | Bacteria | 3338 |
| 1088 | Ga0495639_0064913 | 3300046475 | Bacteria | 1679 |
| 1089 | Ga0495639_0294519 | 3300046475 | Bacteria | 808 |
| 1090 | Ga0495618_0297807 | 3300046514 | Bacteria | 1003 |
| 1091 | Ga0495630_0342084 | 3300046517 | Bacteria | 1145 |
| 1092 | Ga0495630_0531377 | 3300046517 | Bacteria | 902 |
| 1093 | Ga0495630_0672644 | 3300046517 | Bacteria | 792 |
| 1094 | Ga0495663_0018871 | 3300046525 | Bacteria | 1967 |
| 1095 | Ga0495663_0090410 | 3300046525 | Bacteria | 997 |
| 1096 | Ga0495640_0822817 | 3300046533 | Bacteria | 553 |
| 1097 | Ga0495586_0316555 | 3300046535 | Bacteria | 895 |
| 1098 | Ga0495645_0091479 | 3300046543 | Bacteria | 2173 |
| 1099 | Ga0495656_0014399 | 3300046615 | Bacteria | 2964 |
| 1100 | Ga0495656_0054619 | 3300046615 | Bacteria | 1719 |
| 1101 | Ga0495668_0002220 | 3300046616 | Bacteria | 16493 |
| 1102 | Ga0495635_0093830 | 3300046663 | Bacteria | 2052 |
| 1103 | Ga0495635_0458871 | 3300046663 | Bacteria | 842 |
| 1104 | Ga0495659_0078425 | 3300046664 | Bacteria | 1249 |
| 1105 | Ga0495647_0004042 | 3300046681 | Bacteria | 4738 |
| 1106 | Ga0495647_0093151 | 3300046681 | Bacteria | 1238 |
| 1107 | Ga0495658_0017764 | 3300046683 | Bacteria | 3682 |
| 1108 | Ga0495658_0121517 | 3300046683 | Bacteria | 1580 |
| 1109 | Ga0495658_0512428 | 3300046683 | Bacteria | 768 |
| 1110 | Ga0495658_0748182 | 3300046683 | Bacteria | 626 |
| 1111 | Ga0495613_0149419 | 3300046689 | Bacteria | 1667 |
| 1112 | Ga0495613_0442118 | 3300046689 | Bacteria | 882 |
| 1113 | Ga0495624_0138992 | 3300046690 | Bacteria | 1488 |
| 1114 | Ga0495600_0204295 | 3300046809 | Bacteria | 1268 |
| 1115 | Ga0495600_0322823 | 3300046809 | Bacteria | 971 |
| 1116 | Ga0495600_0755611 | 3300046809 | Bacteria | 582 |
| 1117 | Ga0495581_0153104 | 3300047315 | Bacteria | 1347 |
| 1118 | Ga0495636_0000737 | 3300047318 | Bacteria | 12026 |
| 1119 | Ga0495674_0778352 | 3300047319 | Bacteria | 746 |
| 1120 | Ga0495674_1192807 | 3300047319 | Bacteria | 576 |
| 1121 | Ga0495676_0177492 | 3300047321 | Bacteria | 1495 |
| 1122 | Ga0495680_0069330 | 3300047322 | Bacteria | 2691 |
| 1123 | Ga0495680_0545177 | 3300047322 | Bacteria | 782 |
| 1124 | Ga0495680_0699847 | 3300047322 | Bacteria | 669 |
| 1125 | Ga0495680_0862077 | 3300047322 | Bacteria | 588 |
| 1126 | Ga0495680_1039112 | 3300047322 | Bacteria | 521 |
| 1127 | Ga0495677_0372904 | 3300047445 | Bacteria | 564 |
| 1128 | Ga0495685_123213 | 3300047447 | Bacteria | 850 |
| 1129 | Ga0495684_0404789 | 3300047471 | Bacteria | 957 |
| 1130 | Ga0495615_0123734 | 3300048090 | Bacteria | 750 |
| 1131 | Ga0496100_0017223 | 3300048903 | Bacteria | 4262 |
| 1132 | Ga0496100_0112917 | 3300048903 | Bacteria | 1890 |
| 1133 | Ga0496100_0454616 | 3300048903 | Bacteria | 982 |
| 1134 | Ga0496100_0945288 | 3300048903 | Bacteria | 677 |
| 1135 | Ga0496101_0022651 | 3300048904 | Bacteria | 4327 |
| 1136 | Ga0496101_0101460 | 3300048904 | Bacteria | 2155 |
| 1137 | Ga0496101_0118636 | 3300048904 | Bacteria | 1998 |
| 1138 | Ga0496101_0467569 | 3300048904 | Bacteria | 995 |
| 1139 | Ga0496101_0539321 | 3300048904 | Bacteria | 922 |
| 1140 | Ga0496101_1003099 | 3300048904 | Bacteria | 657 |
| 1141 | Ga0496102_0002523 | 3300048905 | Bacteria | 15633 |
| 1142 | Ga0496102_0014211 | 3300048905 | Bacteria | 6917 |
| 1143 | Ga0496102_0026145 | 3300048905 | Bacteria | 5203 |
| 1144 | Ga0496102_0047874 | 3300048905 | Bacteria | 3887 |
| 1145 | Ga0496102_0101380 | 3300048905 | Bacteria | 2674 |
| 1146 | Ga0496102_0414857 | 3300048905 | Bacteria | 1265 |
| 1147 | Ga0496102_1195471 | 3300048905 | Bacteria | 680 |
| 1148 | Ga0496102_1898216 | 3300048905 | Bacteria | 512 |
| 1149 | Ga0496103_0014389 | 3300048906 | Bacteria | 4699 |
| 1150 | Ga0496103_0051737 | 3300048906 | Bacteria | 2543 |
| 1151 | Ga0496103_0125082 | 3300048906 | Bacteria | 1639 |
| 1152 | Ga0496104_0011522 | 3300048907 | Bacteria | 7922 |
| 1153 | Ga0496104_0021521 | 3300048907 | Bacteria | 5921 |
| 1154 | Ga0496104_0035075 | 3300048907 | Bacteria | 4682 |
| 1155 | Ga0496104_0059896 | 3300048907 | Bacteria | 3605 |
| 1156 | Ga0496104_0091472 | 3300048907 | Bacteria | 2908 |
| 1157 | Ga0496104_0205045 | 3300048907 | Bacteria | 1883 |
| 1158 | Ga0496104_0340483 | 3300048907 | Bacteria | 1413 |
| 1159 | Ga0496104_0589094 | 3300048907 | Bacteria | 1022 |
| 1160 | Ga0496104_1100843 | 3300048907 | Bacteria | 698 |
| 1161 | Ga0496105_0000093 | 3300048908 | Bacteria | 61223 |
| 1162 | Ga0496105_0011016 | 3300048908 | Bacteria | 7126 |
| 1163 | Ga0496105_0065159 | 3300048908 | Bacteria | 3007 |
| 1164 | Ga0496105_0079322 | 3300048908 | Bacteria | 2711 |
| 1165 | Ga0496105_0160368 | 3300048908 | Bacteria | 1846 |
| 1166 | Ga0496105_0184867 | 3300048908 | Bacteria | 1705 |
| 1167 | Ga0496105_0429277 | 3300048908 | Bacteria | 1045 |
| 1168 | Ga0496106_0037656 | 3300048909 | Bacteria | 3619 |
| 1169 | Ga0496106_0535048 | 3300048909 | Bacteria | 941 |
| 1170 | Ga0496106_0688249 | 3300048909 | Bacteria | 815 |
| 1171 | Ga0496106_0884300 | 3300048909 | Bacteria | 706 |
| 1172 | Ga0496106_1522924 | 3300048909 | Bacteria | 514 |
| 1173 | Ga0496107_0061581 | 3300048910 | Bacteria | 2717 |
| 1174 | Ga0496108_0092806 | 3300048911 | Bacteria | 2567 |
| 1175 | Ga0496108_0115049 | 3300048911 | Bacteria | 2303 |
| 1176 | Ga0496108_0145395 | 3300048911 | Bacteria | 2044 |
| 1177 | Ga0496108_0986043 | 3300048911 | Bacteria | 720 |
| 1178 | Ga0496108_1090210 | 3300048911 | Bacteria | 679 |
| 1179 | Ga0496108_1165399 | 3300048911 | Bacteria | 653 |
| 1180 | Ga0496109_0006477 | 3300048912 | Bacteria | 9858 |
| 1181 | Ga0496109_0110257 | 3300048912 | Bacteria | 2559 |
| 1182 | Ga0496109_0154790 | 3300048912 | Bacteria | 2147 |
| 1183 | Ga0496109_0218292 | 3300048912 | Bacteria | 1793 |
| 1184 | Ga0496109_0599588 | 3300048912 | Bacteria | 1038 |
| 1185 | Ga0496109_0988008 | 3300048912 | Archaea | 779 |
| 1186 | Ga0496109_0997018 | 3300048912 | Bacteria | 775 |
| 1187 | Ga0496110_0019788 | 3300048913 | Bacteria | 5671 |
| 1188 | Ga0496110_0087106 | 3300048913 | Bacteria | 2789 |
| 1189 | Ga0496110_0123611 | 3300048913 | Bacteria | 2333 |
| 1190 | Ga0496110_0257166 | 3300048913 | Bacteria | 1589 |
| 1191 | Ga0496110_0457117 | 3300048913 | Bacteria | 1163 |
| 1192 | Ga0496110_0582361 | 3300048913 | Unclassified | 1016 |
| 1193 | Ga0496110_0828153 | 3300048913 | Bacteria | 830 |
| 1194 | Ga0496110_1092236 | 3300048913 | Bacteria | 706 |
| 1195 | Ga0496110_1113678 | 3300048913 | Unclassified | 698 |
| 1196 | Ga0496111_0012225 | 3300048914 | Bacteria | 5807 |
| 1197 | Ga0496111_0014093 | 3300048914 | Bacteria | 5453 |
| 1198 | Ga0496112_0013357 | 3300048915 | Bacteria | 7580 |
| 1199 | Ga0496112_0035217 | 3300048915 | Unclassified | 4874 |
| 1200 | Ga0496112_0101325 | 3300048915 | Bacteria | 2850 |
| 1201 | Ga0496113_0002034 | 3300048916 | Bacteria | 11613 |
| 1202 | Ga0496113_0227730 | 3300048916 | Bacteria | 1486 |
| 1203 | Ga0496114_0008479 | 3300048917 | Bacteria | 8145 |
| 1204 | Ga0496114_0017914 | 3300048917 | Bacteria | 5724 |
| 1205 | Ga0496114_0106393 | 3300048917 | Bacteria | 2400 |
| 1206 | Ga0496114_0107510 | 3300048917 | Bacteria | 2387 |
| 1207 | Ga0496114_0162541 | 3300048917 | Bacteria | 1942 |
| 1208 | Ga0496114_0298336 | 3300048917 | Bacteria | 1422 |
| 1209 | Ga0496114_0336745 | 3300048917 | Bacteria | 1334 |
| 1210 | Ga0496114_0564554 | 3300048917 | Bacteria | 1005 |
| 1211 | Ga0496114_0575057 | 3300048917 | Bacteria | 994 |
| 1212 | Ga0496115_0258610 | 3300048918 | Bacteria | 1432 |
| 1213 | Ga0496115_1123948 | 3300048918 | Bacteria | 594 |
| 1214 | Ga0496118_0003924 | 3300048921 | Bacteria | 18203 |
| 1215 | Ga0496126_0442804 | 3300048929 | Bacteria | 1047 |
| 1216 | Ga0501314_028898 | 3300049530 | Bacteria | 609 |
| 1217 | Ga0501315_059501 | 3300049531 | Bacteria | 615 |
| 1218 | Ga0501031_0022036 | 3300049568 | Bacteria | 4152 |
| 1219 | Ga0501031_0077430 | 3300049568 | Bacteria | 2166 |
| 1220 | Ga0501031_0422046 | 3300049568 | Bacteria | 862 |
| 1221 | Ga0501031_0786072 | 3300049568 | Bacteria | 610 |
| 1222 | Ga0501031_0811625 | 3300049568 | Bacteria | 600 |
| 1223 | Ga0501033_0069737 | 3300049570 | Bacteria | 2584 |
| 1224 | Ga0501033_1101516 | 3300049570 | Bacteria | 528 |
| 1225 | Ga0501034_0963015 | 3300049571 | Bacteria | 739 |
| 1226 | Ga0501036_0033281 | 3300049572 | Bacteria | 4359 |
| 1227 | Ga0501036_0066082 | 3300049572 | Bacteria | 3060 |
| 1228 | Ga0501036_0087561 | 3300049572 | Bacteria | 2632 |
| 1229 | Ga0501036_0129136 | 3300049572 | Bacteria | 2134 |
| 1230 | Ga0501036_0189321 | 3300049572 | Bacteria | 1731 |
| 1231 | Ga0501037_0096698 | 3300049573 | Bacteria | 2134 |
| 1232 | Ga0501038_0671360 | 3300049574 | Bacteria | 779 |
| 1233 | Ga0501039_0038137 | 3300049575 | Bacteria | 3712 |
| 1234 | Ga0501039_0092526 | 3300049575 | Bacteria | 2357 |
| 1235 | Ga0501039_0586062 | 3300049575 | Bacteria | 874 |
| 1236 | Ga0501040_0025352 | 3300049576 | Bacteria | 3986 |
| 1237 | Ga0501040_0052625 | 3300049576 | Bacteria | 2788 |
| 1238 | Ga0501040_0189872 | 3300049576 | Bacteria | 1457 |
| 1239 | Ga0501040_0880828 | 3300049576 | Bacteria | 648 |
| 1240 | Ga0501040_1093674 | 3300049576 | Bacteria | 578 |
| 1241 | Ga0501041_0017307 | 3300049577 | Bacteria | 4289 |
| 1242 | Ga0501041_0034669 | 3300049577 | Bacteria | 3056 |
| 1243 | Ga0501041_0585753 | 3300049577 | Bacteria | 712 |
| 1244 | Ga0501042_0017993 | 3300049578 | Bacteria | 4888 |
| 1245 | Ga0501042_0366331 | 3300049578 | Bacteria | 1043 |
| 1246 | Ga0501042_0387232 | 3300049578 | Bacteria | 1012 |
| 1247 | Ga0501042_1408528 | 3300049578 | Bacteria | 508 |
| 1248 | Ga0501043_0002433 | 3300049579 | Bacteria | 15753 |
| 1249 | Ga0501043_0446569 | 3300049579 | Bacteria | 972 |
| 1250 | Ga0501046_0248181 | 3300049580 | Bacteria | 1311 |
| 1251 | Ga0501046_0595739 | 3300049580 | Bacteria | 785 |
| 1252 | Ga0501047_0056717 | 3300049581 | Bacteria | 3789 |
| 1253 | Ga0501047_0080871 | 3300049581 | Bacteria | 3124 |
| 1254 | Ga0501048_0021837 | 3300049582 | Bacteria | 4685 |
| 1255 | Ga0501048_0023263 | 3300049582 | Bacteria | 4532 |
| 1256 | Ga0501048_0126426 | 3300049582 | Bacteria | 1807 |
| 1257 | Ga0501048_1221988 | 3300049582 | Bacteria | 540 |
| 1258 | Ga0501067_0017974 | 3300049583 | Bacteria | 3915 |
| 1259 | Ga0501067_0078234 | 3300049583 | Bacteria | 1833 |
| 1260 | Ga0501067_0257350 | 3300049583 | Bacteria | 972 |
| 1261 | Ga0501067_0802052 | 3300049583 | Bacteria | 530 |
| 1262 | Ga0501068_0314003 | 3300049584 | Bacteria | 1004 |
| 1263 | Ga0501069_0036372 | 3300049585 | Bacteria | 2715 |
| 1264 | Ga0501071_0004493 | 3300049587 | Bacteria | 8848 |
| 1265 | Ga0501071_0119000 | 3300049587 | Bacteria | 1957 |
| 1266 | Ga0501071_0131328 | 3300049587 | Bacteria | 1861 |
| 1267 | Ga0501071_0942044 | 3300049587 | Bacteria | 666 |
| 1268 | Ga0501071_1436483 | 3300049587 | Bacteria | 532 |
| 1269 | Ga0501071_1616005 | 3300049587 | Bacteria | 500 |
| 1270 | Ga0501072_0015466 | 3300049588 | Bacteria | 5849 |
| 1271 | Ga0501072_0020892 | 3300049588 | Bacteria | 5075 |
| 1272 | Ga0501072_0021691 | 3300049588 | Bacteria | 4982 |
| 1273 | Ga0501072_0095697 | 3300049588 | Bacteria | 2360 |
| 1274 | Ga0501072_0805640 | 3300049588 | Bacteria | 735 |
| 1275 | Ga0501072_1260303 | 3300049588 | Bacteria | 573 |
| 1276 | Ga0501073_0266650 | 3300049589 | Bacteria | 1182 |
| 1277 | Ga0501073_0867191 | 3300049589 | Bacteria | 622 |
| 1278 | Ga0501074_0094434 | 3300049590 | Bacteria | 2142 |
| 1279 | Ga0501074_0296706 | 3300049590 | Bacteria | 1148 |
| 1280 | Ga0501074_0467167 | 3300049590 | Bacteria | 894 |
| 1281 | Ga0501075_0040980 | 3300049591 | Bacteria | 3470 |
| 1282 | Ga0501075_0063619 | 3300049591 | Bacteria | 2782 |
| 1283 | Ga0501075_0283479 | 3300049591 | Bacteria | 1262 |
| 1284 | Ga0501075_0617104 | 3300049591 | Bacteria | 827 |
| 1285 | Ga0501076_0016244 | 3300049592 | Bacteria | 5640 |
| 1286 | Ga0501076_0546443 | 3300049592 | Bacteria | 955 |
| 1287 | Ga0501076_0564578 | 3300049592 | Bacteria | 938 |
| 1288 | Ga0501077_0199150 | 3300049593 | Bacteria | 1272 |
| 1289 | Ga0501077_0627696 | 3300049593 | Bacteria | 690 |
| 1290 | Ga0501077_0680884 | 3300049593 | Bacteria | 661 |
| 1291 | Ga0501233_131170 | 3300049668 | Bacteria | 685 |
| 1292 | Ga0501079_0011823 | 3300049741 | Bacteria | 6664 |
| 1293 | Ga0501079_0097220 | 3300049741 | Bacteria | 2283 |
| 1294 | Ga0501079_0238445 | 3300049741 | Bacteria | 1421 |
| 1295 | Ga0501079_0409211 | 3300049741 | Bacteria | 1064 |
| 1296 | Ga0501079_0602016 | 3300049741 | Bacteria | 865 |
| 1297 | Ga0501080_0249732 | 3300049742 | Bacteria | 1618 |
| 1298 | Ga0501080_0532856 | 3300049742 | Bacteria | 1047 |
| 1299 | Ga0501080_1769455 | 3300049742 | Bacteria | 520 |
| 1300 | Ga0501081_0042676 | 3300049743 | Bacteria | 3109 |
| 1301 | Ga0501081_0170953 | 3300049743 | Bacteria | 1569 |
| 1302 | Ga0501035_0619261 | 3300049822 | Bacteria | 880 |
| 1303 | Ga0501044_0004942 | 3300049823 | Bacteria | 14911 |
| 1304 | Ga0501045_0047261 | 3300049824 | Bacteria | 3135 |
| 1305 | Ga0501045_0051324 | 3300049824 | Bacteria | 3010 |
| 1306 | Ga0501045_0088902 | 3300049824 | Bacteria | 2282 |
| 1307 | Ga0501045_0976161 | 3300049824 | Bacteria | 621 |
| 1308 | nmdc:mga03683_34547_c1 | 3300050489 | Bacteria | 2046 |
| 1309 | nmdc:mga03683_89783_c1 | 3300050489 | Bacteria | 1338 |
| 1310 | nmdc:mga03n38_441130_c1 | 3300050490 | Bacteria | 723 |
| 1311 | nmdc:mga03n38_58928_c1 | 3300050490 | Bacteria | 1163 |
| 1312 | nmdc:mga03n38_757860_c1 | 3300050490 | Bacteria | 563 |
| 1313 | nmdc:mga03n38_9489_c1 | 3300050490 | Bacteria | 3543 |
| 1314 | nmdc:mga03n38_962247_c1 | 3300050490 | Bacteria | 504 |
| 1315 | nmdc:mga00v17_1029218_c1 | 3300050491 | Bacteria | 518 |
| 1316 | nmdc:mga00v17_120558_c1 | 3300050491 | Bacteria | 1669 |
| 1317 | nmdc:mga00v17_229031_c1 | 3300050491 | Bacteria | 1204 |
| 1318 | nmdc:mga00v17_2601_c1 | 3300050491 | Bacteria | 9255 |
| 1319 | nmdc:mga00v17_340293_c1 | 3300050491 | Bacteria | 975 |
| 1320 | nmdc:mga00v17_390796_c1 | 3300050491 | Bacteria | 904 |
| 1321 | nmdc:mga00v17_465849_c1 | 3300050491 | Bacteria | 820 |
| 1322 | nmdc:mga00v17_665_c1 | 3300050491 | Bacteria | 18923 |
| 1323 | nmdc:mga00v17_85970_c1 | 3300050491 | Bacteria | 1970 |
| 1324 | nmdc:mga0yw44_100143_c1 | 3300050492 | Bacteria | 1845 |
| 1325 | nmdc:mga0yw44_116064_c1 | 3300050492 | Bacteria | 1720 |
| 1326 | nmdc:mga0yw44_136706_c2 | 3300050492 | Bacteria | 1063 |
| 1327 | nmdc:mga0yw44_1398_c1 | 3300050492 | Bacteria | 9570 |
| 1328 | nmdc:mga0yw44_20263_c1 | 3300050492 | Bacteria | 3687 |
| 1329 | nmdc:mga0yw44_23801_c1 | 3300050492 | Bacteria | 3455 |
| 1330 | nmdc:mga0yw44_264923_c1 | 3300050492 | Bacteria | 1146 |
| 1331 | nmdc:mga0yw44_266490_c1 | 3300050492 | Bacteria | 1143 |
| 1332 | nmdc:mga0yw44_266629_c1 | 3300050492 | Bacteria | 1142 |
| 1333 | nmdc:mga0yw44_291750_c1 | 3300050492 | Bacteria | 1092 |
| 1334 | nmdc:mga0yw44_30363_c1 | 3300050492 | Bacteria | 3130 |
| 1335 | nmdc:mga0yw44_350254_c1 | 3300050492 | Bacteria | 994 |
| 1336 | nmdc:mga0yw44_351579_c1 | 3300050492 | Bacteria | 992 |
| 1337 | nmdc:mga0yw44_44_c1 | 3300050492 | Bacteria | 41809 |
| 1338 | nmdc:mga0yw44_5924_c1 | 3300050492 | Bacteria | 5845 |
| 1339 | nmdc:mga0yw44_671996_c1 | 3300050492 | Bacteria | 704 |
| 1340 | nmdc:mga0yw44_78724_c1 | 3300050492 | Bacteria | 1242 |
| 1341 | nmdc:mga0yw44_890002_c1 | 3300050492 | Bacteria | 604 |
| 1342 | nmdc:mga0k408_128180_c1 | 3300050493 | Bacteria | 1505 |
| 1343 | nmdc:mga06z11_243384_c1 | 3300050494 | Bacteria | 758 |
| 1344 | nmdc:mga06z11_433103_c1 | 3300050494 | Bacteria | 793 |
| 1345 | nmdc:mga06z11_5925_c1 | 3300050494 | Bacteria | 4938 |
| 1346 | nmdc:mga06z11_87353_c1 | 3300050494 | Bacteria | 1686 |
| 1347 | nmdc:mga04h51_10254_c1 | 3300050495 | Bacteria | 2568 |
| 1348 | nmdc:mga04h51_162539_c1 | 3300050495 | Bacteria | 860 |
| 1349 | nmdc:mga04h51_240725_c1 | 3300050495 | Bacteria | 722 |
| 1350 | nmdc:mga04h51_305950_c1 | 3300050495 | Bacteria | 649 |
| 1351 | nmdc:mga04h51_380778_c1 | 3300050495 | Bacteria | 588 |
| 1352 | nmdc:mga05p37_1308842_c1 | 3300050507 | Bacteria | 738 |
| 1353 | nmdc:mga05p37_557454_c1 | 3300050507 | Bacteria | 1303 |
| 1354 | nmdc:mga09592_800048_c1 | 3300050508 | Bacteria | 797 |
| 1355 | nmdc:mga08y16_393274_c1 | 3300050511 | Bacteria | 1420 |
| 1356 | nmdc:mga08y16_880295_c1 | 3300050511 | Bacteria | 883 |
| 1357 | nmdc:mga0rr50_1129583_c1 | 3300050513 | Bacteria | 666 |
| 1358 | Ga0500635_0006792 | 3300053080 | Bacteria | 3070 |
| 1359 | Ga0495595_0279429 | 3300053084 | Bacteria | 838 |
| 1360 | Ga0495595_0336813 | 3300053084 | Bacteria | 761 |
| 1361 | Ga0495595_0705211 | 3300053084 | Bacteria | 517 |
| 1362 | Ga0495619_0263881 | 3300053085 | Bacteria | 1193 |
| 1363 | Ga0495619_0773339 | 3300053085 | Bacteria | 650 |
| 1364 | Ga0500644_0375618 | 3300053088 | Bacteria | 617 |
| 1365 | Ga0500646_0026544 | 3300053090 | Bacteria | 1571 |
| 1366 | Ga0500646_0122618 | 3300053090 | Bacteria | 837 |
| 1367 | Ga0500583_0139854 | 3300053092 | Bacteria | 1203 |
| 1368 | Ga0500583_0197939 | 3300053092 | Bacteria | 999 |
| 1369 | Ga0500566_0000532 | 3300053094 | Bacteria | 21366 |
| 1370 | Ga0500566_0120764 | 3300053094 | Bacteria | 1413 |
| 1371 | Ga0500628_210638 | 3300053129 | Bacteria | 563 |
| 1372 | Ga0500655_036960 | 3300053133 | Bacteria | 952 |
| 1373 | Ga0500620_031846 | 3300053155 | Bacteria | 1675 |
| 1374 | Ga0501084_0271980 | 3300054114 | Bacteria | 1430 |
| 1375 | Ga0501084_0326735 | 3300054114 | Bacteria | 1295 |
| 1376 | Ga0501084_1328679 | 3300054114 | Bacteria | 602 |
| 1377 | Ga0587066_108309 | 3300059490 | Bacteria | 641 |
| 1378 | Ga0587077_171293 | 3300059493 | Bacteria | 582 |
| 1379 | Ga0587082_033158 | 3300059504 | Bacteria | 911 |
| 1380 | Ga0587082_037518 | 3300059504 | Bacteria | 874 |
| 1381 | Ga0587083_0019282 | 3300059505 | Bacteria | 1244 |
| 1382 | Ga0587086_020163 | 3300059507 | Bacteria | 903 |
| 1383 | Ga0587088_133956 | 3300059508 | Bacteria | 585 |
| 1384 | Ga0587098_077308 | 3300059604 | Bacteria | 549 |
| 1385 | Ga0587106_136637 | 3300059605 | Bacteria | 534 |
| 1386 | Ga0587101_081851 | 3300059623 | Bacteria | 613 |
| 1387 | Ga0587128_097622 | 3300059630 | Bacteria | 611 |
| 1388 | Ga0587068_037772 | 3300059641 | Bacteria | 863 |
| 1389 | Ga0587068_090856 | 3300059641 | Bacteria | 629 |
| 1390 | Ga0587072_044446 | 3300059643 | Bacteria | 873 |
| 1391 | Ga0587076_189371 | 3300059645 | Bacteria | 523 |
| 1392 | Ga0587079_088058 | 3300059647 | Bacteria | 722 |
| 1393 | Ga0587079_176608 | 3300059647 | Bacteria | 569 |
| 1394 | Ga0587107_022277 | 3300059652 | Bacteria | 895 |
| 1395 | Ga0587110_009122 | 3300059654 | Bacteria | 969 |
| 1396 | Ga0501082_0197947 | 3300060353 | Bacteria | 1748 |
| 1397 | Ga0501082_0862328 | 3300060353 | Bacteria | 792 |
| 1398 | Ga0530510_0008292 | 3300061734 | Bacteria | 7245 |
| 1399 | Ga0530510_0298484 | 3300061734 | Bacteria | 1205 |
| 1400 | Ga0530510_0937047 | 3300061734 | Bacteria | 662 |
| 1401 | Ga0500635_0320462 | |||
| 1402 | JGI24736J21556_1020459 | |||
| 1403 | JGI25151J46595_10020691 | |||
| 1404 | JGI25153J46596_10142022 | |||
| 1405 | Ga0007409J51694_1091639 | |||
| 1406 | Ga0055524_1013072 | |||
| 1407 | Ga0055524_1016559 | |||
| 1408 | Ga0055536_1001953 | |||
| 1409 | Ga0055536_1021661 | |||
| 1410 | Ga0055536_1022461 | |||
| 1411 | Ga0055534_1008037 | |||
| 1412 | Ga0055534_1014588 | |||
| 1413 | Ga0055530_10000578 | |||
| 1414 | Ga0055540_1059529 | |||
| 1415 | Ga0055531_10005972 | |||
| 1416 | Ga0055531_10076138 | |||
| 1417 | Ga0055531_10083302 | |||
| 1418 | Ga0058860_11886216 | |||
| 1419 | Ga0070658_10230542 | |||
| 1420 | Ga0070658_10271818 | |||
| 1421 | Ga0070658_10320468 | |||
| 1422 | Ga0070676_10035996 | |||
| 1423 | Ga0070683_100009342 | |||
| 1424 | Ga0070683_100164501 | |||
| 1425 | Ga0070683_100193432 | |||
| 1426 | Ga0070683_100702525 | |||
| 1427 | Ga0070683_100841158 | |||
| 1428 | Ga0070683_101019396 | |||
| 1429 | Ga0070690_100152737 | |||
| 1430 | Ga0070690_100561832 | |||
| 1431 | Ga0070670_100008384 | |||
| 1432 | Ga0070670_100020647 | |||
| 1433 | Ga0070670_100301931 | |||
| 1434 | Ga0070670_100879245 | |||
| 1435 | Ga0070677_10585781 | |||
| 1436 | Ga0068869_100082842 | |||
| 1437 | Ga0068869_100089544 | |||
| 1438 | Ga0068869_101175118 | |||
| 1439 | Ga0068869_101456232 | |||
| 1440 | Ga0070666_10001853 | |||
| 1441 | Ga0070666_10001858 | |||
| 1442 | Ga0070666_10104933 | |||
| 1443 | Ga0070666_10106699 | |||
| 1444 | Ga0070666_10152584 | |||
| 1445 | Ga0070666_10313345 | |||
| 1446 | Ga0070666_11518868 | |||
| 1447 | Ga0070680_100168007 | |||
| 1448 | Ga0070680_100783916 | |||
| 1449 | Ga0070680_101370827 | |||
| 1450 | Ga0070682_100702611 | |||
| 1451 | Ga0068868_100002892 | |||
| 1452 | Ga0068868_100023407 | |||
| 1453 | Ga0068868_100052388 | |||
| 1454 | Ga0068868_100073533 | |||
| 1455 | Ga0068868_100245090 | |||
| 1456 | Ga0068868_100917469 | |||
| 1457 | Ga0070660_100309699 | |||
| 1458 | Ga0070660_100526478 | |||
| 1459 | Ga0070689_100062330 | |||
| 1460 | Ga0070689_100118587 | |||
| 1461 | Ga0070691_10437858 | |||
| 1462 | Ga0070661_100317167 | |||
| 1463 | Ga0070661_100744294 | |||
| 1464 | Ga0070661_100797306 | |||
| 1465 | Ga0070661_101488612 | |||
| 1466 | Ga0070692_11101637 | |||
| 1467 | Ga0070668_100061913 | |||
| 1468 | Ga0070668_100123105 | |||
| 1469 | Ga0070668_100158266 | |||
| 1470 | Ga0070668_100470118 | |||
| 1471 | Ga0070668_101156304 | |||
| 1472 | Ga0070675_100131501 | |||
| 1473 | Ga0070675_100580587 | |||
| 1474 | Ga0070675_102075178 | |||
| 1475 | Ga0070671_100216956 | |||
| 1476 | Ga0070671_100478445 | |||
| 1477 | Ga0070671_100555740 | |||
| 1478 | Ga0070671_100594802 | |||
| 1479 | Ga0070671_100623307 | |||
| 1480 | Ga0070671_100651630 | |||
| 1481 | Ga0070671_100794062 | |||
| 1482 | Ga0070671_101128638 | |||
| 1483 | Ga0070674_100055299 | |||
| 1484 | Ga0070674_100096952 | |||
| 1485 | Ga0070674_100242595 | |||
| 1486 | Ga0070674_101047912 | |||
| 1487 | Ga0070674_101842572 | |||
| 1488 | Ga0070673_100200402 | |||
| 1489 | Ga0070673_100229682 | |||
| 1490 | Ga0070673_100243952 | |||
| 1491 | Ga0070688_100035680 | |||
| 1492 | Ga0070659_100070335 | |||
| 1493 | Ga0070659_100396649 | |||
| 1494 | Ga0070667_100012108 | |||
| 1495 | Ga0070667_100050487 | |||
| 1496 | Ga0070667_100168848 | |||
| 1497 | Ga0070667_100239742 | |||
| 1498 | Ga0070667_100601514 | |||
| 1499 | Ga0070667_101972865 | |||
| 1500 | Ga0070709_10040805 | |||
| 1501 | Ga0070709_10190549 | |||
| 1502 | Ga0070709_10250424 | |||
| 1503 | Ga0070714_100222825 | |||
| 1504 | Ga0070713_100398392 | |||
| 1505 | Ga0070713_101274783 | |||
| 1506 | Ga0070710_11204827 | |||
| 1507 | Ga0070701_11217311 | |||
| 1508 | Ga0070711_100502744 | |||
| 1509 | Ga0070711_100646771 | |||
| 1510 | Ga0070705_100606260 | |||
| 1511 | Ga0070700_100090819 | |||
| 1512 | Ga0070700_100356404 | |||
| 1513 | Ga0070700_101307374 | |||
| 1514 | Ga0070700_101810937 | |||
| 1515 | Ga0070694_100356639 | |||
| 1516 | Ga0070694_100888618 | |||
| 1517 | Ga0070708_100790466 | |||
| 1518 | Ga0070663_100006966 | |||
| 1519 | Ga0070663_100431874 | |||
| 1520 | Ga0070663_100600003 | |||
| 1521 | Ga0070663_100839526 | |||
| 1522 | Ga0070663_101834212 | |||
| 1523 | Ga0070678_100184141 | |||
| 1524 | Ga0070678_100185081 | |||
| 1525 | Ga0070678_100251181 | |||
| 1526 | Ga0070678_100264027 | |||
| 1527 | Ga0070678_100837154 | |||
| 1528 | Ga0070662_100089159 | |||
| 1529 | Ga0070662_100191719 | |||
| 1530 | Ga0070662_100235573 | |||
| 1531 | Ga0070662_100598881 | |||
| 1532 | Ga0070662_101272128 | |||
| 1533 | Ga0070662_101306613 | |||
| 1534 | Ga0070681_10032389 | |||
| 1535 | Ga0070681_10434936 | |||
| 1536 | Ga0070681_10844164 | |||
| 1537 | Ga0068867_100009183 | |||
| 1538 | Ga0068867_100025867 | |||
| 1539 | Ga0068867_100084237 | |||
| 1540 | Ga0068867_100376064 | |||
| 1541 | Ga0068867_102387584 | |||
| 1542 | Ga0070685_10000451 | |||
| 1543 | Ga0070685_10513131 | |||
| 1544 | Ga0070685_11574634 | |||
| 1545 | Ga0070698_101333024 | |||
| 1546 | Ga0070679_100097653 | |||
| 1547 | Ga0070679_100466649 | |||
| 1548 | Ga0070679_100682259 | |||
| 1549 | Ga0070679_101148126 | |||
| 1550 | Ga0070684_100116954 | |||
| 1551 | Ga0070684_100175239 | |||
| 1552 | Ga0070684_100559071 | |||
| 1553 | Ga0070684_100756026 | |||
| 1554 | Ga0070684_101091014 | |||
| 1555 | Ga0070684_101526321 | |||
| 1556 | Ga0068853_100071363 | |||
| 1557 | Ga0068853_100100623 | |||
| 1558 | Ga0068853_100136744 | |||
| 1559 | Ga0068853_100371171 | |||
| 1560 | Ga0068853_100411923 | |||
| 1561 | Ga0068853_100464408 | |||
| 1562 | Ga0068853_100562116 | |||
| 1563 | Ga0068853_100624342 | |||
| 1564 | Ga0068853_100734184 | |||
| 1565 | Ga0068853_101527667 | |||
| 1566 | Ga0070672_100001795 | |||
| 1567 | Ga0070672_100146908 | |||
| 1568 | Ga0070672_100191976 | |||
| 1569 | Ga0070672_100683935 | |||
| 1570 | Ga0070686_100011927 | |||
| 1571 | Ga0070686_100048036 | |||
| 1572 | Ga0070686_100525036 | |||
| 1573 | Ga0070686_100596289 | |||
| 1574 | Ga0070693_100100982 | |||
| 1575 | Ga0070693_100121565 | |||
| 1576 | Ga0070693_100357862 | |||
| 1577 | Ga0070693_100536104 | |||
| 1578 | Ga0070693_100542601 | |||
| 1579 | Ga0070665_100004571 | |||
| 1580 | Ga0070665_100103330 | |||
| 1581 | Ga0070665_100223338 | |||
| 1582 | Ga0070665_100685398 | |||
| 1583 | Ga0070665_101429234 | |||
| 1584 | Ga0070704_101360420 | |||
| 1585 | Ga0068855_100000432 | |||
| 1586 | Ga0068855_100002034 | |||
| 1587 | Ga0068855_100132552 | |||
| 1588 | Ga0068855_100238567 | |||
| 1589 | Ga0068855_100672786 | |||
| 1590 | Ga0068855_100777737 | |||
| 1591 | Ga0068855_100823119 | |||
| 1592 | Ga0068855_102299715 | |||
| 1593 | Ga0068855_102359364 | |||
| 1594 | Ga0070664_100000726 | |||
| 1595 | Ga0070664_100114705 | |||
| 1596 | Ga0070664_100403208 | |||
| 1597 | Ga0070664_100463468 | |||
| 1598 | Ga0070664_100567162 | |||
| 1599 | Ga0068857_100000096 | |||
| 1600 | Ga0068857_100047219 | |||
| 1601 | Ga0068857_100060204 | |||
| 1602 | Ga0068857_100133139 | |||
| 1603 | Ga0068857_100386761 | |||
| 1604 | Ga0068857_100407995 | |||
| 1605 | Ga0068857_100698433 | |||
| 1606 | Ga0068857_102017329 | |||
| 1607 | Ga0068854_100000554 | |||
| 1608 | Ga0068854_100024664 | |||
| 1609 | Ga0068854_100045641 | |||
| 1610 | Ga0068854_100223761 | |||
| 1611 | Ga0068854_100464268 | |||
| 1612 | Ga0068854_101042823 | |||
| 1613 | Ga0068856_100000179 | |||
| 1614 | Ga0068856_100002175 | |||
| 1615 | Ga0068856_100193004 | |||
| 1616 | Ga0068856_100386850 | |||
| 1617 | Ga0068856_100539649 | |||
| 1618 | Ga0070702_100024290 | |||
| 1619 | Ga0070702_100055642 | |||
| 1620 | Ga0070702_100122007 | |||
| 1621 | Ga0070702_100167315 | |||
| 1622 | Ga0070702_100520411 | |||
| 1623 | Ga0068852_100010460 | |||
| 1624 | Ga0068852_100035832 | |||
| 1625 | Ga0068852_100209869 | |||
| 1626 | Ga0068852_100400190 | |||
| 1627 | Ga0068852_100627068 | |||
| 1628 | Ga0068859_100010599 | |||
| 1629 | Ga0068859_100136484 | |||
| 1630 | Ga0068859_100237623 | |||
| 1631 | Ga0068859_101049795 | |||
| 1632 | Ga0068859_101855626 | |||
| 1633 | Ga0068864_100000129 | |||
| 1634 | Ga0068864_100011149 | |||
| 1635 | Ga0068864_100227870 | |||
| 1636 | Ga0068864_100602769 | |||
| 1637 | Ga0068864_101270974 | |||
| 1638 | Ga0068866_10007138 | |||
| 1639 | Ga0068866_10010050 | |||
| 1640 | Ga0068866_10064147 | |||
| 1641 | Ga0068866_10343585 | |||
| 1642 | Ga0068861_100038831 | |||
| 1643 | Ga0068861_100039875 | |||
| 1644 | Ga0068861_100153483 | |||
| 1645 | Ga0068861_100244554 | |||
| 1646 | Ga0068861_100647643 | |||
| 1647 | Ga0068851_10003554 | |||
| 1648 | Ga0068870_10045752 | |||
| 1649 | Ga0068870_10089992 | |||
| 1650 | Ga0068870_10448127 | |||
| 1651 | Ga0068863_100005116 | |||
| 1652 | Ga0068863_100026366 | |||
| 1653 | Ga0068863_100090500 | |||
| 1654 | Ga0068863_100170884 | |||
| 1655 | Ga0068863_100183012 | |||
| 1656 | Ga0068863_100243488 | |||
| 1657 | Ga0068863_100423207 | |||
| 1658 | Ga0068863_100458082 | |||
| 1659 | Ga0068863_100595675 | |||
| 1660 | Ga0068863_100870858 | |||
| 1661 | Ga0068863_101287007 | |||
| 1662 | Ga0068858_100025071 | |||
| 1663 | Ga0068858_100030716 | |||
| 1664 | Ga0068858_100124922 | |||
| 1665 | Ga0068858_100213797 | |||
| 1666 | Ga0068858_100255257 | |||
| 1667 | Ga0068858_100627282 | |||
| 1668 | Ga0068858_100635556 | |||
| 1669 | Ga0068858_100725982 | |||
| 1670 | Ga0068858_100744839 | |||
| 1671 | Ga0068858_100828650 | |||
| 1672 | Ga0068858_102369603 | |||
| 1673 | Ga0068860_100004438 | |||
| 1674 | Ga0068860_100027327 | |||
| 1675 | Ga0068860_100091037 | |||
| 1676 | Ga0068860_100365661 | |||
| 1677 | Ga0068860_100510384 | |||
| 1678 | Ga0068860_100603674 | |||
| 1679 | Ga0068860_102397800 | |||
| 1680 | Ga0068862_101456482 | |||
| 1681 | Ga0068862_101952538 | |||
| 1682 | Ga0081455_10799957 | |||
| 1683 | Ga0081540_1001046 | |||
| 1684 | Ga0081540_1117627 | |||
| 1685 | Ga0075365_10009641 | |||
| 1686 | Ga0075365_10021278 | |||
| 1687 | Ga0075365_10042348 | |||
| 1688 | Ga0075365_10066208 | |||
| 1689 | Ga0075365_10081217 | |||
| 1690 | Ga0075365_10171080 | |||
| 1691 | Ga0075365_10195685 | |||
| 1692 | Ga0075365_10209985 | |||
| 1693 | Ga0075365_10229439 | |||
| 1694 | Ga0075365_10239001 | |||
| 1695 | Ga0075365_10271012 | |||
| 1696 | Ga0075365_10273148 | |||
| 1697 | Ga0075365_11035369 | |||
| 1698 | Ga0075368_10018412 | |||
| 1699 | Ga0075368_10274749 | |||
| 1700 | Ga0075368_10329156 | |||
| 1701 | Ga0075368_10342364 | |||
| 1702 | Ga0075368_10398090 | |||
| 1703 | Ga0075363_100024237 | |||
| 1704 | Ga0075363_100071908 | |||
| 1705 | Ga0075363_100347545 | |||
| 1706 | Ga0075364_10001125 | |||
| 1707 | Ga0075364_10018799 | |||
| 1708 | Ga0075364_10086675 | |||
| 1709 | Ga0075364_10181730 | |||
| 1710 | Ga0075364_10387297 | |||
| 1711 | Ga0075364_10402584 | |||
| 1712 | Ga0075364_10493870 | |||
| 1713 | Ga0075364_11249850 | |||
| 1714 | Ga0070715_10154698 | |||
| 1715 | Ga0070712_100264735 | |||
| 1716 | Ga0075367_10017493 | |||
| 1717 | Ga0075367_10032975 | |||
| 1718 | Ga0075367_10067400 | |||
| 1719 | Ga0075367_10088617 | |||
| 1720 | Ga0075367_10210472 | |||
| 1721 | Ga0075367_10243957 | |||
| 1722 | Ga0075367_10515075 | |||
| 1723 | Ga0075367_10697495 | |||
| 1724 | Ga0075366_10711803 | |||
| 1725 | Ga0097621_100000196 | |||
| 1726 | Ga0097621_100002114 | |||
| 1727 | Ga0097621_100019556 | |||
| 1728 | Ga0097621_100159978 | |||
| 1729 | Ga0097621_100288304 | |||
| 1730 | Ga0097621_100385197 | |||
| 1731 | Ga0097621_100407750 | |||
| 1732 | Ga0075370_10623732 | |||
| 1733 | Ga0068871_100000049 | |||
| 1734 | Ga0068871_100027217 | |||
| 1735 | Ga0068871_100047305 | |||
| 1736 | Ga0068871_100071763 | |||
| 1737 | Ga0068871_100133563 | |||
| 1738 | Ga0068871_100138395 | |||
| 1739 | Ga0068871_100227044 | |||
| 1740 | Ga0068871_100338812 | |||
| 1741 | Ga0075428_100101055 | |||
| 1742 | Ga0075431_101115607 | |||
| 1743 | Ga0075429_100456305 | |||
| 1744 | Ga0075429_100756886 | |||
| 1745 | Ga0068865_100016213 | |||
| 1746 | Ga0068865_100070890 | |||
| 1747 | Ga0068865_100077435 | |||
| 1748 | Ga0068865_100179459 | |||
| 1749 | Ga0068865_100188845 | |||
| 1750 | Ga0068865_100398524 | |||
| 1751 | Ga0068865_100742490 | |||
| 1752 | Ga0068865_100750310 | |||
| 1753 | Ga0097620_100010599 | |||
| 1754 | Ga0097620_100136488 | |||
| 1755 | Ga0097620_100237623 | |||
| 1756 | Ga0097620_101049746 | |||
| 1757 | Ga0097620_101855547 | |||
| 1758 | Ga0099824_1019323 | |||
| 1759 | Ga0105240_10000906 | |||
| 1760 | Ga0105240_10004993 | |||
| 1761 | Ga0105240_10027081 | |||
| 1762 | Ga0105240_10027316 | |||
| 1763 | Ga0105240_10088014 | |||
| 1764 | Ga0105240_10155563 | |||
| 1765 | Ga0105240_10251728 | |||
| 1766 | Ga0105240_10265229 | |||
| 1767 | Ga0105240_10279530 | |||
| 1768 | Ga0105240_11861069 | |||
| 1769 | Ga0105240_12426867 | |||
| 1770 | Ga0111539_10175933 | |||
| 1771 | Ga0111539_10371110 | |||
| 1772 | Ga0111539_11274521 | |||
| 1773 | Ga0105245_10187338 | |||
| 1774 | Ga0105245_10188072 | |||
| 1775 | Ga0105245_10896004 | |||
| 1776 | Ga0105245_11019902 | |||
| 1777 | Ga0105247_10288387 | |||
| 1778 | Ga0105247_10778532 | |||
| 1779 | Ga0105247_11601429 | |||
| 1780 | Ga0114129_10604548 | |||
| 1781 | Ga0105243_10041324 | |||
| 1782 | Ga0105243_10042566 | |||
| 1783 | Ga0105243_10090932 | |||
| 1784 | Ga0105243_10408280 | |||
| 1785 | Ga0105243_10501008 | |||
| 1786 | Ga0105243_10657632 | |||
| 1787 | Ga0105243_11165715 | |||
| 1788 | Ga0105243_11231758 | |||
| 1789 | Ga0105241_10032759 | |||
| 1790 | Ga0105241_10120160 | |||
| 1791 | Ga0105241_10431342 | |||
| 1792 | Ga0105241_10644028 | |||
| 1793 | Ga0105241_11338911 | |||
| 1794 | Ga0105241_12560117 | |||
| 1795 | Ga0105242_10012056 | |||
| 1796 | Ga0105242_10042305 | |||
| 1797 | Ga0105242_10423519 | |||
| 1798 | Ga0105242_10886616 | |||
| 1799 | Ga0105242_11228100 | |||
| 1800 | Ga0105242_11832603 | |||
| 1801 | Ga0105242_12312340 | |||
| 1802 | Ga0105248_10010283 | |||
| 1803 | Ga0105248_10017949 | |||
| 1804 | Ga0105248_10081498 | |||
| 1805 | Ga0105248_10164087 | |||
| 1806 | Ga0105248_10242008 | |||
| 1807 | Ga0105248_10310979 | |||
| 1808 | Ga0105248_10415691 | |||
| 1809 | Ga0105248_10640126 | |||
| 1810 | Ga0105248_10992361 | |||
| 1811 | Ga0105237_10009430 | |||
| 1812 | Ga0105237_10066651 | |||
| 1813 | Ga0105237_10333521 | |||
| 1814 | Ga0105237_10628663 | |||
| 1815 | Ga0105237_10672051 | |||
| 1816 | Ga0105237_10898148 | |||
| 1817 | Ga0105237_11075995 | |||
| 1818 | Ga0105238_10009376 | |||
| 1819 | Ga0105238_10023690 | |||
| 1820 | Ga0105238_10036707 | |||
| 1821 | Ga0105238_10052956 | |||
| 1822 | Ga0105238_10082010 | |||
| 1823 | Ga0105238_10097773 | |||
| 1824 | Ga0105238_10327534 | |||
| 1825 | Ga0105238_10452257 | |||
| 1826 | Ga0105238_10495788 | |||
| 1827 | Ga0105238_10790803 | |||
| 1828 | Ga0105249_10048096 | |||
| 1829 | Ga0105249_10159404 | |||
| 1830 | Ga0105249_10179568 | |||
| 1831 | Ga0105249_10279928 | |||
| 1832 | Ga0105249_10300706 | |||
| 1833 | Ga0105249_10594681 | |||
| 1834 | Ga0105239_10038937 | |||
| 1835 | Ga0105239_10049542 | |||
| 1836 | Ga0105239_10134538 | |||
| 1837 | Ga0105239_10134956 | |||
| 1838 | Ga0105239_10150239 | |||
| 1839 | Ga0105239_10275935 | |||
| 1840 | Ga0105239_11043199 | |||
| 1841 | Ga0105239_11424567 | |||
| 1842 | Ga0105246_10016866 | |||
| 1843 | Ga0105246_10077748 | |||
| 1844 | Ga0105246_10121355 | |||
| 1845 | Ga0105246_10767720 | |||
| 1846 | Ga0105246_11133405 | |||
| 1847 | Ga0105246_11474086 | |||
| 1848 | Ga0157318_1007034 | |||
| 1849 | Ga0157339_1003561 | |||
| 1850 | Ga0157316_1050929 | |||
| 1851 | Ga0157327_1005852 | |||
| 1852 | Ga0157338_1007600 | |||
| 1853 | Ga0157373_10130661 | |||
| 1854 | Ga0157371_10163129 | |||
| 1855 | Ga0157371_10189802 | |||
| 1856 | Ga0157371_10695988 | |||
| 1857 | Ga0157371_10790493 | |||
| 1858 | Ga0157370_10110028 | |||
| 1859 | Ga0157370_10617216 | |||
| 1860 | Ga0157370_11946286 | |||
| 1861 | Ga0157369_10019968 | |||
| 1862 | Ga0157369_10075339 | |||
| 1863 | Ga0157369_10360373 | |||
| 1864 | Ga0157369_10425283 | |||
| 1865 | Ga0157369_10431777 | |||
| 1866 | Ga0157369_10442977 | |||
| 1867 | Ga0157369_10599162 | |||
| 1868 | Ga0157374_10000062 | |||
| 1869 | Ga0157374_10021722 | |||
| 1870 | Ga0157374_10106725 | |||
| 1871 | Ga0157374_10150309 | |||
| 1872 | Ga0157374_10253738 | |||
| 1873 | Ga0157374_10518609 | |||
| 1874 | Ga0157374_10816210 | |||
| 1875 | Ga0157378_10000009 | |||
| 1876 | Ga0157378_10000366 | |||
| 1877 | Ga0157378_10002258 | |||
| 1878 | Ga0157378_10025295 | |||
| 1879 | Ga0157378_10106770 | |||
| 1880 | Ga0157378_10245045 | |||
| 1881 | Ga0157378_10818152 | |||
| 1882 | Ga0157378_10997973 | |||
| 1883 | Ga0163162_10000028 | |||
| 1884 | Ga0163162_10071763 | |||
| 1885 | Ga0163162_10082672 | |||
| 1886 | Ga0163162_10151115 | |||
| 1887 | Ga0163162_10329599 | |||
| 1888 | Ga0163162_10605705 | |||
| 1889 | Ga0163162_10651778 | |||
| 1890 | Ga0163162_11730171 | |||
| 1891 | Ga0163162_11925388 | |||
| 1892 | Ga0163162_12515910 | |||
| 1893 | Ga0163162_12811305 | |||
| 1894 | Ga0157372_10001184 | |||
| 1895 | Ga0157372_10002204 | |||
| 1896 | Ga0157372_10008186 | |||
| 1897 | Ga0157372_10111977 | |||
| 1898 | Ga0157372_10292790 | |||
| 1899 | Ga0157372_10303986 | |||
| 1900 | Ga0157372_10307674 | |||
| 1901 | Ga0157372_10334834 | |||
| 1902 | Ga0157375_10001583 | |||
| 1903 | Ga0157375_10031568 | |||
| 1904 | Ga0157375_10072749 | |||
| 1905 | Ga0157375_10084786 | |||
| 1906 | Ga0157375_10213455 | |||
| 1907 | Ga0157375_10730150 | |||
| 1908 | Ga0157375_11076585 | |||
| 1909 | Ga0157375_12341202 | |||
| 1910 | Ga0157375_13165977 | |||
| 1911 | Ga0163163_10001955 | |||
| 1912 | Ga0163163_10004520 | |||
| 1913 | Ga0163163_10103355 | |||
| 1914 | Ga0163163_10270330 | |||
| 1915 | Ga0163163_10495605 | |||
| 1916 | Ga0163163_12569231 | |||
| 1917 | Ga0157380_10020607 | |||
| 1918 | Ga0157380_10269114 | |||
| 1919 | Ga0157380_10505670 | |||
| 1920 | Ga0157380_10770206 | |||
| 1921 | Ga0157380_11276160 | |||
| 1922 | Ga0182008_10049225 | |||
| 1923 | Ga0182008_10481120 | |||
| 1924 | Ga0182008_10525419 | |||
| 1925 | Ga0157377_10151536 | |||
| 1926 | Ga0157377_10279058 | |||
| 1927 | Ga0157379_10000319 | |||
| 1928 | Ga0157379_10030697 | |||
| 1929 | Ga0157379_10245833 | |||
| 1930 | Ga0157379_10365956 | |||
| 1931 | Ga0157379_10548003 | |||
| 1932 | Ga0157379_11033142 | |||
| 1933 | Ga0157379_11298238 | |||
| 1934 | Ga0157376_10082837 | |||
| 1935 | Ga0157376_10093047 | |||
| 1936 | Ga0157376_10105381 | |||
| 1937 | Ga0157376_10122466 | |||
| 1938 | Ga0157376_10189556 | |||
| 1939 | Ga0157376_10258581 | |||
| 1940 | Ga0157376_10260700 | |||
| 1941 | Ga0157376_10484450 | |||
| 1942 | Ga0157376_10508205 | |||
| 1943 | Ga0157376_11043313 | |||
| 1944 | Ga0157376_11139105 | |||
| 1945 | Ga0163161_10005516 | |||
| 1946 | Ga0163161_10015892 | |||
| 1947 | Ga0163161_10201622 | |||
| 1948 | Ga0163161_10203088 | |||
| 1949 | Ga0163161_10363611 | |||
| 1950 | Ga0163161_10554401 | |||
| 1951 | Ga0163161_11628128 | |||
| 1952 | Ga0163161_11943241 | |||
| 1953 | Ga0206356_11689876 | |||
| 1954 | Ga0206349_1714749 | |||
| 1955 | Ga0206353_11171569 | |||
| 1956 | Ga0206353_11366746 | |||
| 1957 | Ga0206353_11586967 | |||
| 1958 | Ga0209673_1007174 | |||
| 1959 | Ga0209673_1072312 | |||
| 1960 | Ga0209130_1011708 | |||
| 1961 | Ga0209675_1004813 | |||
| 1962 | Ga0209675_1004817 | |||
| 1963 | Ga0209676_1001568 | |||
| 1964 | Ga0209676_1002588 | |||
| 1965 | Ga0209676_1002747 | |||
| 1966 | Ga0209676_1003093 | |||
| 1967 | Ga0209676_1033031 | |||
| 1968 | Ga0209676_1068054 | |||
| 1969 | Ga0209025_1000454 | |||
| 1970 | Ga0209025_1011745 | |||
| 1971 | Ga0209025_1020449 | |||
| 1972 | Ga0209025_1033207 | |||
| 1973 | Ga0209025_1067527 | |||
| 1974 | Ga0209025_1191523 | |||
| 1975 | Ga0209564_1003082 | |||
| 1976 | Ga0209758_1053082 | |||
| 1977 | Ga0209758_1112180 | |||
| 1978 | Ga0209050_1000865 | |||
| 1979 | Ga0209050_1008800 | |||
| 1980 | Ga0209256_1005269 | |||
| 1981 | Ga0209256_1006382 | |||
| 1982 | Ga0209051_1029660 | |||
| 1983 | Ga0209257_1000154 | |||
| 1984 | Ga0209257_1001025 | |||
| 1985 | Ga0209257_1001296 | |||
| 1986 | Ga0209257_1015047 | |||
| 1987 | Ga0207697_10157211 | |||
| 1988 | Ga0207656_10001724 | |||
| 1989 | Ga0207656_10112803 | |||
| 1990 | Ga0207682_10143516 | |||
| 1991 | Ga0207682_10171017 | |||
| 1992 | Ga0207692_10969175 | |||
| 1993 | Ga0207642_10007476 | |||
| 1994 | Ga0207642_10118473 | |||
| 1995 | Ga0207642_10741856 | |||
| 1996 | Ga0207688_10044138 | |||
| 1997 | Ga0207680_10001162 | |||
| 1998 | Ga0207680_10007152 | |||
| 1999 | Ga0207680_10359870 | |||
| 2000 | Ga0207680_10456999 | |||
| 2001 | Ga0207680_10704104 | |||
| 2002 | Ga0207647_10000024 | |||
| 2003 | Ga0207647_10002046 | |||
| 2004 | Ga0207647_10063045 | |||
| 2005 | Ga0207647_10487124 | |||
| 2006 | Ga0207647_10548242 | |||
| 2007 | Ga0207647_10801934 | |||
| 2008 | Ga0207699_10070829 | |||
| 2009 | Ga0207699_10341074 | |||
| 2010 | Ga0207699_10429108 | |||
| 2011 | Ga0207645_10025001 | |||
| 2012 | Ga0207643_10125350 | |||
| 2013 | Ga0207643_10127157 | |||
| 2014 | Ga0207643_10380027 | |||
| 2015 | Ga0207705_10149766 | |||
| 2016 | Ga0207705_10373572 | |||
| 2017 | Ga0207705_10634513 | |||
| 2018 | Ga0207705_11074411 | |||
| 2019 | Ga0207654_10006477 | |||
| 2020 | Ga0207654_10015692 | |||
| 2021 | Ga0207654_10065026 | |||
| 2022 | Ga0207654_10100463 | |||
| 2023 | Ga0207654_10266358 | |||
| 2024 | Ga0207707_10001452 | |||
| 2025 | Ga0207707_10052277 | |||
| 2026 | Ga0207695_10000040 | |||
| 2027 | Ga0207695_10002176 | |||
| 2028 | Ga0207695_10006210 | |||
| 2029 | Ga0207695_10016274 | |||
| 2030 | Ga0207695_10022021 | |||
| 2031 | Ga0207695_10025623 | |||
| 2032 | Ga0207695_10038774 | |||
| 2033 | Ga0207695_10040956 | |||
| 2034 | Ga0207695_10533362 | |||
| 2035 | Ga0207695_10827735 | |||
| 2036 | Ga0207671_10002984 | |||
| 2037 | Ga0207671_10009442 | |||
| 2038 | Ga0207671_10018841 | |||
| 2039 | Ga0207671_10405775 | |||
| 2040 | Ga0207671_10496425 | |||
| 2041 | Ga0207671_10577850 | |||
| 2042 | Ga0207671_11167927 | |||
| 2043 | Ga0207693_10286913 | |||
| 2044 | Ga0207663_10152669 | |||
| 2045 | Ga0207663_11091975 | |||
| 2046 | Ga0207660_10416195 | |||
| 2047 | Ga0207660_10722308 | |||
| 2048 | Ga0207660_11349006 | |||
| 2049 | Ga0207662_10040240 | |||
| 2050 | Ga0207657_10000326 | |||
| 2051 | Ga0207657_10511310 | |||
| 2052 | Ga0207657_11111319 | |||
| 2053 | Ga0207649_10004643 | |||
| 2054 | Ga0207649_10159208 | |||
| 2055 | Ga0207649_10270891 | |||
| 2056 | Ga0207649_10532696 | |||
| 2057 | Ga0207649_10585098 | |||
| 2058 | Ga0207649_10788992 | |||
| 2059 | Ga0207649_10869496 | |||
| 2060 | Ga0207652_10016784 | |||
| 2061 | Ga0207652_10203273 | |||
| 2062 | Ga0207652_11194063 | |||
| 2063 | Ga0207652_11427174 | |||
| 2064 | Ga0207652_11478752 | |||
| 2065 | Ga0207681_10137587 | |||
| 2066 | Ga0207681_10552603 | |||
| 2067 | Ga0207681_11511191 | |||
| 2068 | Ga0207694_10001319 | |||
| 2069 | Ga0207694_10006000 | |||
| 2070 | Ga0207694_10010865 | |||
| 2071 | Ga0207694_10040794 | |||
| 2072 | Ga0207694_10041105 | |||
| 2073 | Ga0207694_10143818 | |||
| 2074 | Ga0207694_10358811 | |||
| 2075 | Ga0207694_10591577 | |||
| 2076 | Ga0207694_11250158 | |||
| 2077 | Ga0207650_10003597 | |||
| 2078 | Ga0207650_10007026 | |||
| 2079 | Ga0207650_10150236 | |||
| 2080 | Ga0207650_10162989 | |||
| 2081 | Ga0207659_10277557 | |||
| 2082 | Ga0207659_10518814 | |||
| 2083 | Ga0207659_10995151 | |||
| 2084 | Ga0207659_11649400 | |||
| 2085 | Ga0207687_10140730 | |||
| 2086 | Ga0207687_10158132 | |||
| 2087 | Ga0207687_10583760 | |||
| 2088 | Ga0207687_10584936 | |||
| 2089 | Ga0207687_10676723 | |||
| 2090 | Ga0207687_10888147 | |||
| 2091 | Ga0207700_10353069 | |||
| 2092 | Ga0207700_10595647 | |||
| 2093 | Ga0207644_10174600 | |||
| 2094 | Ga0207644_10251177 | |||
| 2095 | Ga0207644_10344765 | |||
| 2096 | Ga0207644_10873267 | |||
| 2097 | Ga0207690_10833288 | |||
| 2098 | Ga0207690_10838427 | |||
| 2099 | Ga0207690_10909924 | |||
| 2100 | Ga0207706_10006512 | |||
| 2101 | Ga0207706_10113646 | |||
| 2102 | Ga0207706_10261519 | |||
| 2103 | Ga0207706_10400407 | |||
| 2104 | Ga0207706_11139690 | |||
| 2105 | Ga0207706_11167617 | |||
| 2106 | Ga0207706_11392604 | |||
| 2107 | Ga0207686_10015548 | |||
| 2108 | Ga0207686_10138086 | |||
| 2109 | Ga0207686_10416366 | |||
| 2110 | Ga0207686_10450316 | |||
| 2111 | Ga0207686_10767744 | |||
| 2112 | Ga0207686_11279916 | |||
| 2113 | Ga0207686_11737595 | |||
| 2114 | Ga0207709_10027510 | |||
| 2115 | Ga0207709_10213470 | |||
| 2116 | Ga0207670_10293221 | |||
| 2117 | Ga0207669_10025336 | |||
| 2118 | Ga0207669_10159282 | |||
| 2119 | Ga0207669_10258036 | |||
| 2120 | Ga0207704_10018725 | |||
| 2121 | Ga0207704_10021380 | |||
| 2122 | Ga0207704_10064222 | |||
| 2123 | Ga0207704_10096787 | |||
| 2124 | Ga0207704_10381941 | |||
| 2125 | Ga0207704_10741225 | |||
| 2126 | Ga0207704_11001374 | |||
| 2127 | Ga0207704_11484772 | |||
| 2128 | Ga0207704_11852943 | |||
| 2129 | Ga0207665_11018767 | |||
| 2130 | Ga0207691_10027848 | |||
| 2131 | Ga0207691_10062400 | |||
| 2132 | Ga0207691_10101776 | |||
| 2133 | Ga0207691_10300986 | |||
| 2134 | Ga0207691_10345714 | |||
| 2135 | Ga0207691_10437193 | |||
| 2136 | Ga0207691_10612968 | |||
| 2137 | Ga0207711_10001544 | |||
| 2138 | Ga0207711_10006123 | |||
| 2139 | Ga0207711_10009684 | |||
| 2140 | Ga0207711_10019526 | |||
| 2141 | Ga0207711_10203021 | |||
| 2142 | Ga0207711_10261515 | |||
| 2143 | Ga0207711_10328735 | |||
| 2144 | Ga0207711_10721443 | |||
| 2145 | Ga0207689_10169299 | |||
| 2146 | Ga0207689_10192430 | |||
| 2147 | Ga0207689_11024129 | |||
| 2148 | Ga0207689_11253393 | |||
| 2149 | Ga0207661_10059158 | |||
| 2150 | Ga0207661_10059225 | |||
| 2151 | Ga0207661_10115744 | |||
| 2152 | Ga0207661_10992832 | |||
| 2153 | Ga0207661_11739692 | |||
| 2154 | Ga0207679_10001856 | |||
| 2155 | Ga0207679_10204991 | |||
| 2156 | Ga0207679_10290784 | |||
| 2157 | Ga0207679_10447035 | |||
| 2158 | Ga0207679_11688830 | |||
| 2159 | Ga0207667_10000465 | |||
| 2160 | Ga0207667_10001399 | |||
| 2161 | Ga0207667_10027253 | |||
| 2162 | Ga0207667_10080008 | |||
| 2163 | Ga0207667_10141308 | |||
| 2164 | Ga0207667_10373465 | |||
| 2165 | Ga0207667_11036637 | |||
| 2166 | Ga0207667_11127458 | |||
| 2167 | Ga0207651_10320214 | |||
| 2168 | Ga0207651_10334158 | |||
| 2169 | Ga0207651_10485762 | |||
| 2170 | Ga0207651_10882676 | |||
| 2171 | Ga0207651_11719631 | |||
| 2172 | Ga0207712_10000275 | |||
| 2173 | Ga0207712_10030485 | |||
| 2174 | Ga0207712_10040634 | |||
| 2175 | Ga0207712_10177825 | |||
| 2176 | Ga0207712_10688910 | |||
| 2177 | Ga0207712_10882859 | |||
| 2178 | Ga0207668_10072961 | |||
| 2179 | Ga0207668_10316378 | |||
| 2180 | Ga0207668_10461821 | |||
| 2181 | Ga0207640_10003205 | |||
| 2182 | Ga0207640_10018145 | |||
| 2183 | Ga0207640_10030688 | |||
| 2184 | Ga0207640_10056429 | |||
| 2185 | Ga0207640_10065293 | |||
| 2186 | Ga0207640_10098411 | |||
| 2187 | Ga0207640_10212413 | |||
| 2188 | Ga0207658_10011118 | |||
| 2189 | Ga0207658_10097209 | |||
| 2190 | Ga0207658_10200064 | |||
| 2191 | Ga0207658_10511296 | |||
| 2192 | Ga0207658_10788387 | |||
| 2193 | Ga0207658_11393045 | |||
| 2194 | Ga0207658_11677120 | |||
| 2195 | Ga0207677_10010569 | |||
| 2196 | Ga0207677_10096166 | |||
| 2197 | Ga0207677_10096831 | |||
| 2198 | Ga0207677_10207950 | |||
| 2199 | Ga0207677_10460226 | |||
| 2200 | Ga0207677_10486879 | |||
| 2201 | Ga0207677_10871921 | |||
| 2202 | Ga0207703_10001612 | |||
| 2203 | Ga0207703_10013731 | |||
| 2204 | Ga0207703_10022458 | |||
| 2205 | Ga0207703_10026541 | |||
| 2206 | Ga0207703_10068511 | |||
| 2207 | Ga0207703_10413352 | |||
| 2208 | Ga0207703_10426585 | |||
| 2209 | Ga0207703_10536610 | |||
| 2210 | Ga0207703_10546625 | |||
| 2211 | Ga0207703_11229443 | |||
| 2212 | Ga0207639_10000116 | |||
| 2213 | Ga0207639_10001494 | |||
| 2214 | Ga0207639_10005911 | |||
| 2215 | Ga0207639_10050029 | |||
| 2216 | Ga0207639_10180619 | |||
| 2217 | Ga0207639_10330641 | |||
| 2218 | Ga0207639_11875370 | |||
| 2219 | Ga0207678_10005905 | |||
| 2220 | Ga0207678_10223153 | |||
| 2221 | Ga0207678_10707280 | |||
| 2222 | Ga0207678_11491716 | |||
| 2223 | Ga0207678_11662131 | |||
| 2224 | Ga0207708_10161011 | |||
| 2225 | Ga0207708_10294154 | |||
| 2226 | Ga0207702_10001051 | |||
| 2227 | Ga0207702_10008697 | |||
| 2228 | Ga0207702_10013885 | |||
| 2229 | Ga0207702_10036300 | |||
| 2230 | Ga0207702_10216397 | |||
| 2231 | Ga0207702_10549727 | |||
| 2232 | Ga0207641_10020771 | |||
| 2233 | Ga0207641_10022745 | |||
| 2234 | Ga0207641_10025422 | |||
| 2235 | Ga0207641_10073518 | |||
| 2236 | Ga0207641_10140241 | |||
| 2237 | Ga0207641_10529347 | |||
| 2238 | Ga0207641_10973412 | |||
| 2239 | Ga0207641_11150095 | |||
| 2240 | Ga0207641_11827313 | |||
| 2241 | Ga0207641_11922758 | |||
| 2242 | Ga0207648_10028264 | |||
| 2243 | Ga0207648_10071363 | |||
| 2244 | Ga0207648_10092387 | |||
| 2245 | Ga0207648_10141728 | |||
| 2246 | Ga0207648_10161034 | |||
| 2247 | Ga0207648_10958181 | |||
| 2248 | Ga0207648_11640543 | |||
| 2249 | Ga0207676_10015306 | |||
| 2250 | Ga0207676_10020158 | |||
| 2251 | Ga0207676_10084369 | |||
| 2252 | Ga0207676_10095677 | |||
| 2253 | Ga0207676_10230810 | |||
| 2254 | Ga0207676_10472482 | |||
| 2255 | Ga0207676_11236738 | |||
| 2256 | Ga0207676_11707682 | |||
| 2257 | Ga0207676_12201449 | |||
| 2258 | Ga0207676_12594716 | |||
| 2259 | Ga0207674_10002111 | |||
| 2260 | Ga0207674_10003692 | |||
| 2261 | Ga0207674_10180643 | |||
| 2262 | Ga0207674_10181195 | |||
| 2263 | Ga0207674_10186230 | |||
| 2264 | Ga0207674_10390820 | |||
| 2265 | Ga0207674_10532582 | |||
| 2266 | Ga0207674_10938633 | |||
| 2267 | Ga0207674_11210336 | |||
| 2268 | Ga0207674_11655389 | |||
| 2269 | Ga0207674_11848943 | |||
| 2270 | Ga0207675_100010284 | |||
| 2271 | Ga0207675_100069455 | |||
| 2272 | Ga0207675_100080251 | |||
| 2273 | Ga0207675_100797267 | |||
| 2274 | Ga0207675_100975801 | |||
| 2275 | Ga0207683_10041514 | |||
| 2276 | Ga0207683_10174299 | |||
| 2277 | Ga0207683_10224289 | |||
| 2278 | Ga0207683_10245372 | |||
| 2279 | Ga0207683_10353144 | |||
| 2280 | Ga0207683_10460767 | |||
| 2281 | Ga0207683_10934410 | |||
| 2282 | Ga0207683_11450479 | |||
| 2283 | Ga0207698_10025790 | |||
| 2284 | Ga0207698_10189561 | |||
| 2285 | Ga0207698_10296992 | |||
| 2286 | Ga0207698_10369316 | |||
| 2287 | Ga0207698_10387578 | |||
| 2288 | Ga0207698_10668990 | |||
| 2289 | Ga0207698_11360110 | |||
| 2290 | Ga0207698_12368509 | |||
| 2291 | Ga0209971_1180016 | |||
| 2292 | Ga0209813_10144077 | |||
| 2293 | Ga0209813_10254670 | |||
| 2294 | Ga0209813_10271466 | |||
| 2295 | Ga0209813_10345713 | |||
| 2296 | Ga0209974_10066110 | |||
| 2297 | Ga0209974_10251929 | |||
| 2298 | Ga0207428_10499733 | |||
| 2299 | Ga0268266_10000008 | |||
| 2300 | Ga0268266_10048529 | |||
| 2301 | Ga0268266_10144893 | |||
| 2302 | Ga0268266_10221390 | |||
| 2303 | Ga0268265_10143946 | |||
| 2304 | Ga0268265_12096315 | |||
| 2305 | Ga0268264_10017059 | |||
| 2306 | Ga0268264_10035419 | |||
| 2307 | Ga0268264_10050247 | |||
| 2308 | Ga0268264_10065648 | |||
| 2309 | Ga0268264_10278908 | |||
| 2310 | Ga0268264_10601297 | |||
| 2311 | Ga0268264_11809743 | |||
| 2312 | Ga0268264_12478561 | |||
| 2313 | Ga0265766_1022650 | |||
| 2314 | Ga0307513_11103177 | |||
| 2315 | Ga0307408_100078352 | |||
| 2316 | Ga0307408_100503230 | |||
| 2317 | Ga0307508_10009148 | |||
| 2318 | Ga0316575_10067027 | |||
| 2319 | Ga0316575_10145067 | |||
| 2320 | Ga0316575_10177475 | |||
| 2321 | Ga0316579_10035148 | |||
| 2322 | Ga0316579_10042354 | |||
| 2323 | Ga0316579_10391337 | |||
| 2324 | Ga0316576_10005896 | |||
| 2325 | Ga0316576_10006214 | |||
| 2326 | Ga0316576_10035004 | |||
| 2327 | Ga0316576_10097808 | |||
| 2328 | Ga0316576_10097962 | |||
| 2329 | Ga0316576_10101454 | |||
| 2330 | Ga0316576_10623041 | |||
| 2331 | Ga0316578_10000785 | |||
| 2332 | Ga0316578_10031889 | |||
| 2333 | Ga0316578_10035472 | |||
| 2334 | Ga0316578_10036064 | |||
| 2335 | Ga0316578_10050639 | |||
| 2336 | Ga0316578_10401498 | |||
| 2337 | Ga0316578_10462580 | |||
| 2338 | Ga0307516_10045126 | |||
| 2339 | Ga0307405_10011566 | |||
| 2340 | Ga0307405_10085176 | |||
| 2341 | Ga0307405_10414640 | |||
| 2342 | Ga0307405_10432868 | |||
| 2343 | Ga0307405_11405812 | |||
| 2344 | Ga0316577_10023857 | |||
| 2345 | Ga0316577_10070727 | |||
| 2346 | Ga0316577_10567628 | |||
| 2347 | Ga0307413_10005154 | |||
| 2348 | Ga0307410_10003872 | |||
| 2349 | Ga0307410_10050867 | |||
| 2350 | Ga0307410_10822939 | |||
| 2351 | Ga0307410_11283329 | |||
| 2352 | Ga0307406_10004191 | |||
| 2353 | Ga0307406_10145381 | |||
| 2354 | Ga0307406_10303100 | |||
| 2355 | Ga0307407_10716221 | |||
| 2356 | Ga0307412_10269682 | |||
| 2357 | Ga0307409_100001007 | |||
| 2358 | Ga0307409_100673996 | |||
| 2359 | Ga0307409_101468556 | |||
| 2360 | Ga0307416_100019061 | |||
| 2361 | Ga0307416_100056399 | |||
| 2362 | Ga0307416_100367485 | |||
| 2363 | Ga0307416_101019506 | |||
| 2364 | Ga0307414_11040822 | |||
| 2365 | Ga0307411_10377180 | |||
| 2366 | Ga0307411_10731470 | |||
| 2367 | Ga0307415_100000190 | |||
| 2368 | Ga0307415_100131400 | |||
| 2369 | Ga0307415_100318770 | |||
| 2370 | Ga0307415_100363344 | |||
| 2371 | Ga0307415_101520076 | |||
| 2372 | Ga0307415_101814762 | |||
| 2373 | Ga0316585_10005493 | |||
| 2374 | Ga0316580_10001392 | |||
| 2375 | Ga0316592_1031132 | |||
| 2376 | Ga0316596_1012403 | |||
| 2377 | Ga0373938_0122376 | |||
| 2378 | Ga0373928_0001559 | |||
| 2379 | Ga0373929_0005769 | |||
| 2380 | Ga0373944_0040699 | |||
| 2381 | Ga0373949_0106882 | |||
| 2382 | Ga0373932_0012957 | |||
| 2383 | Ga0373956_0576659 | |||
| 2384 | Ga0373943_0365343 | |||
| 2385 | Ga0373943_0610319 | |||
| 2386 | Ga0373946_0328855 | |||
| 2387 | Ga0316574_0009298 | |||
| 2388 | Ga0316574_0012164 | |||
| 2389 | Ga0316574_0028980 | |||
| 2390 | Ga0316574_0043707 | |||
| 2391 | Ga0316574_0044640 | |||
| 2392 | Ga0316574_0068255 | |||
| 2393 | Ga0316574_0104517 | |||
| 2394 | Ga0316574_0166127 | |||
| 2395 | Ga0316574_0252697 | |||
| 2396 | Ga0316574_0296427 | |||
| 2397 | Ga0316574_0771780 | |||
| 2398 | Ga0316574_0777003 | |||
| 2399 | Ga0316574_0796423 | |||
| 2400 | Ga0373931_0000006 | |||
| 2401 | Ga0373931_0012253 | |||
| 2402 | Ga0373931_0452825 | |||
| 2403 | Ga0373931_0732471 | |||
| 2404 | Ga0373933_0009250 | |||
| 2405 | Ga0373937_0139768 | |||
| 2406 | Ga0373937_1280912 | |||
| 2407 | Ga0373937_1528419 | |||
| 2408 | Ga0316582_0013632 | |||
| 2409 | Ga0316582_0016194 | |||
| 2410 | Ga0316582_0209094 | |||
| 2411 | Ga0316584_0005439 | |||
| 2412 | Ga0316584_0017406 | |||
| 2413 | Ga0316584_0023461 | |||
| 2414 | Ga0316584_0024065 | |||
| 2415 | Ga0316584_0076261 | |||
| 2416 | Ga0316584_0086520 | |||
| 2417 | Ga0316584_0112103 | |||
| 2418 | Ga0316584_0146323 | |||
| 2419 | Ga0395900_0155816 | |||
| 2420 | Ga0395898_0002525 | |||
| 2421 | Ga0395901_0047958 | |||
| 2422 | Ga0395901_0079626 | |||
| 2423 | Ga0395901_0607616 | |||
| 2424 | Ga0400485_10787 | |||
| 2425 | Ga0400483_017383 | |||
| 2426 | Ga0400483_035347 | |||
| 2427 | Ga0400483_088865 | |||
| 2428 | Ga0400483_136168 | |||
| 2429 | Ga0400483_136484 | |||
| 2430 | Ga0400483_182325 | |||
| 2431 | Ga0400483_190738 | |||
| 2432 | Ga0400483_259065 | |||
| 2433 | Ga0436363_1130565 | |||
| 2434 | Ga0439439_0022419 | |||
| 2435 | Ga0439439_0058660 | |||
| 2436 | Ga0439447_001969 | |||
| 2437 | Ga0439465_0013327 | |||
| 2438 | Ga0451789_0048425 | |||
| 2439 | Ga0451793_0938620 | |||
| 2440 | Ga0451795_0181400 | |||
| 2441 | Ga0451795_0262903 | |||
| 2442 | Ga0451802_0012644 | |||
| 2443 | Ga0451802_1786781 | |||
| 2444 | Ga0451807_1450121 | |||
| 2445 | Ga0451837_0416935 | |||
| 2446 | Ga0451839_0458029 | |||
| 2447 | Ga0451841_0462125 | |||
| 2448 | Ga0451841_0883188 | |||
| 2449 | Ga0451843_0500007 | |||
| 2450 | Ga0451855_1137734 | |||
| 2451 | Ga0451853_1377382 | |||
| 2452 | Ga0451853_2288329 | |||
| 2453 | Ga0439445_0014698 | |||
| 2454 | Ga0439432_007407 | |||
| 2455 | Ga0439449_0017784 | |||
| 2456 | Ga0439449_0057595 | |||
| 2457 | Ga0439452_037293 | |||
| 2458 | Ga0439457_006216 | |||
| 2459 | Ga0439462_0001718 | |||
| 2460 | Ga0439462_0057892 | |||
| 2461 | Ga0439434_0068503 | |||
| 2462 | Ga0439459_0223947 | |||
| 2463 | Ga0451577_0192413 | |||
| 2464 | Ga0453684_0066899 | |||
| 2465 | Ga0466960_0008210 | |||
| 2466 | Ga0451576_2035645 | |||
| 2467 | Ga0466967_0272865 | |||
| 2468 | Ga0466967_0606373 | |||
| 2469 | Ga0495603_0066211 | |||
| 2470 | Ga0495603_0102592 | |||
| 2471 | Ga0495603_0306184 | |||
| 2472 | Ga0495603_0499510 | |||
| 2473 | Ga0495629_0123477 | |||
| 2474 | Ga0495629_0277441 | |||
| 2475 | Ga0495638_0048881 | |||
| 2476 | Ga0495641_0124434 | |||
| 2477 | Ga0495641_0245869 | |||
| 2478 | Ga0495641_0276304 | |||
| 2479 | Ga0495641_0538751 | |||
| 2480 | Ga0495653_0607863 | |||
| 2481 | Ga0495580_0068995 | |||
| 2482 | Ga0495580_0953227 | |||
| 2483 | Ga0495582_0238331 | |||
| 2484 | Ga0495582_0390489 | |||
| 2485 | Ga0495582_0563126 | |||
| 2486 | Ga0495582_0774064 | |||
| 2487 | Ga0495639_0015183 | |||
| 2488 | Ga0495639_0064913 | |||
| 2489 | Ga0495639_0294519 | |||
| 2490 | Ga0495618_0297807 | |||
| 2491 | Ga0495630_0342084 | |||
| 2492 | Ga0495630_0531377 | |||
| 2493 | Ga0495630_0672644 | |||
| 2494 | Ga0495663_0018871 | |||
| 2495 | Ga0495663_0090410 | |||
| 2496 | Ga0495640_0822817 | |||
| 2497 | Ga0495586_0316555 | |||
| 2498 | Ga0495645_0091479 | |||
| 2499 | Ga0495656_0014399 | |||
| 2500 | Ga0495656_0054619 | |||
| 2501 | Ga0495668_0002220 | |||
| 2502 | Ga0495635_0093830 | |||
| 2503 | Ga0495635_0458871 | |||
| 2504 | Ga0495659_0078425 | |||
| 2505 | Ga0495647_0004042 | |||
| 2506 | Ga0495647_0093151 | |||
| 2507 | Ga0495658_0017764 | |||
| 2508 | Ga0495658_0121517 | |||
| 2509 | Ga0495658_0512428 | |||
| 2510 | Ga0495658_0748182 | |||
| 2511 | Ga0495613_0149419 | |||
| 2512 | Ga0495613_0442118 | |||
| 2513 | Ga0495624_0138992 | |||
| 2514 | Ga0495600_0204295 | |||
| 2515 | Ga0495600_0322823 | |||
| 2516 | Ga0495600_0755611 | |||
| 2517 | Ga0495581_0153104 | |||
| 2518 | Ga0495636_0000737 | |||
| 2519 | Ga0495674_0778352 | |||
| 2520 | Ga0495674_1192807 | |||
| 2521 | Ga0495676_0177492 | |||
| 2522 | Ga0495680_0069330 | |||
| 2523 | Ga0495680_0545177 | |||
| 2524 | Ga0495680_0699847 | |||
| 2525 | Ga0495680_0862077 | |||
| 2526 | Ga0495680_1039112 | |||
| 2527 | Ga0495677_0372904 | |||
| 2528 | Ga0495685_123213 | |||
| 2529 | Ga0495684_0404789 | |||
| 2530 | Ga0495615_0123734 | |||
| 2531 | Ga0496100_0017223 | |||
| 2532 | Ga0496100_0112917 | |||
| 2533 | Ga0496100_0454616 | |||
| 2534 | Ga0496100_0945288 | |||
| 2535 | Ga0496101_0022651 | |||
| 2536 | Ga0496101_0101460 | |||
| 2537 | Ga0496101_0118636 | |||
| 2538 | Ga0496101_0467569 | |||
| 2539 | Ga0496101_0539321 | |||
| 2540 | Ga0496101_1003099 | |||
| 2541 | Ga0496102_0002523 | |||
| 2542 | Ga0496102_0014211 | |||
| 2543 | Ga0496102_0026145 | |||
| 2544 | Ga0496102_0047874 | |||
| 2545 | Ga0496102_0101380 | |||
| 2546 | Ga0496102_0414857 | |||
| 2547 | Ga0496102_1195471 | |||
| 2548 | Ga0496102_1898216 | |||
| 2549 | Ga0496103_0014389 | |||
| 2550 | Ga0496103_0051737 | |||
| 2551 | Ga0496103_0125082 | |||
| 2552 | Ga0496104_0011522 | |||
| 2553 | Ga0496104_0021521 | |||
| 2554 | Ga0496104_0035075 | |||
| 2555 | Ga0496104_0059896 | |||
| 2556 | Ga0496104_0091472 | |||
| 2557 | Ga0496104_0205045 | |||
| 2558 | Ga0496104_0340483 | |||
| 2559 | Ga0496104_0589094 | |||
| 2560 | Ga0496104_1100843 | |||
| 2561 | Ga0496105_0000093 | |||
| 2562 | Ga0496105_0011016 | |||
| 2563 | Ga0496105_0065159 | |||
| 2564 | Ga0496105_0079322 | |||
| 2565 | Ga0496105_0160368 | |||
| 2566 | Ga0496105_0184867 | |||
| 2567 | Ga0496105_0429277 | |||
| 2568 | Ga0496106_0037656 | |||
| 2569 | Ga0496106_0535048 | |||
| 2570 | Ga0496106_0688249 | |||
| 2571 | Ga0496106_0884300 | |||
| 2572 | Ga0496106_1522924 | |||
| 2573 | Ga0496107_0061581 | |||
| 2574 | Ga0496108_0092806 | |||
| 2575 | Ga0496108_0115049 | |||
| 2576 | Ga0496108_0145395 | |||
| 2577 | Ga0496108_0986043 | |||
| 2578 | Ga0496108_1090210 | |||
| 2579 | Ga0496108_1165399 | |||
| 2580 | Ga0496109_0006477 | |||
| 2581 | Ga0496109_0110257 | |||
| 2582 | Ga0496109_0154790 | |||
| 2583 | Ga0496109_0218292 | |||
| 2584 | Ga0496109_0599588 | |||
| 2585 | Ga0496109_0988008 | |||
| 2586 | Ga0496109_0997018 | |||
| 2587 | Ga0496110_0019788 | |||
| 2588 | Ga0496110_0087106 | |||
| 2589 | Ga0496110_0123611 | |||
| 2590 | Ga0496110_0257166 | |||
| 2591 | Ga0496110_0457117 | |||
| 2592 | Ga0496110_0582361 | |||
| 2593 | Ga0496110_0828153 | |||
| 2594 | Ga0496110_1092236 | |||
| 2595 | Ga0496110_1113678 | |||
| 2596 | Ga0496111_0012225 | |||
| 2597 | Ga0496111_0014093 | |||
| 2598 | Ga0496112_0013357 | |||
| 2599 | Ga0496112_0035217 | |||
| 2600 | Ga0496112_0101325 | |||
| 2601 | Ga0496113_0002034 | |||
| 2602 | Ga0496113_0227730 | |||
| 2603 | Ga0496114_0008479 | |||
| 2604 | Ga0496114_0017914 | |||
| 2605 | Ga0496114_0106393 | |||
| 2606 | Ga0496114_0107510 | |||
| 2607 | Ga0496114_0162541 | |||
| 2608 | Ga0496114_0298336 | |||
| 2609 | Ga0496114_0336745 | |||
| 2610 | Ga0496114_0564554 | |||
| 2611 | Ga0496114_0575057 | |||
| 2612 | Ga0496115_0258610 | |||
| 2613 | Ga0496115_1123948 | |||
| 2614 | Ga0496118_0003924 | |||
| 2615 | Ga0496126_0442804 | |||
| 2616 | Ga0501314_028898 | |||
| 2617 | Ga0501315_059501 | |||
| 2618 | Ga0501031_0022036 | |||
| 2619 | Ga0501031_0077430 | |||
| 2620 | Ga0501031_0422046 | |||
| 2621 | Ga0501031_0786072 | |||
| 2622 | Ga0501031_0811625 | |||
| 2623 | Ga0501033_0069737 | |||
| 2624 | Ga0501033_1101516 | |||
| 2625 | Ga0501034_0963015 | |||
| 2626 | Ga0501036_0033281 | |||
| 2627 | Ga0501036_0066082 | |||
| 2628 | Ga0501036_0087561 | |||
| 2629 | Ga0501036_0129136 | |||
| 2630 | Ga0501036_0189321 | |||
| 2631 | Ga0501037_0096698 | |||
| 2632 | Ga0501038_0671360 | |||
| 2633 | Ga0501039_0038137 | |||
| 2634 | Ga0501039_0092526 | |||
| 2635 | Ga0501039_0586062 | |||
| 2636 | Ga0501040_0025352 | |||
| 2637 | Ga0501040_0052625 | |||
| 2638 | Ga0501040_0189872 | |||
| 2639 | Ga0501040_0880828 | |||
| 2640 | Ga0501040_1093674 | |||
| 2641 | Ga0501041_0017307 | |||
| 2642 | Ga0501041_0034669 | |||
| 2643 | Ga0501041_0585753 | |||
| 2644 | Ga0501042_0017993 | |||
| 2645 | Ga0501042_0366331 | |||
| 2646 | Ga0501042_0387232 | |||
| 2647 | Ga0501042_1408528 | |||
| 2648 | Ga0501043_0002433 | |||
| 2649 | Ga0501043_0446569 | |||
| 2650 | Ga0501046_0248181 | |||
| 2651 | Ga0501046_0595739 | |||
| 2652 | Ga0501047_0056717 | |||
| 2653 | Ga0501047_0080871 | |||
| 2654 | Ga0501048_0021837 | |||
| 2655 | Ga0501048_0023263 | |||
| 2656 | Ga0501048_0126426 | |||
| 2657 | Ga0501048_1221988 | |||
| 2658 | Ga0501067_0017974 | |||
| 2659 | Ga0501067_0078234 | |||
| 2660 | Ga0501067_0257350 | |||
| 2661 | Ga0501067_0802052 | |||
| 2662 | Ga0501068_0314003 | |||
| 2663 | Ga0501069_0036372 | |||
| 2664 | Ga0501071_0004493 | |||
| 2665 | Ga0501071_0119000 | |||
| 2666 | Ga0501071_0131328 | |||
| 2667 | Ga0501071_0942044 | |||
| 2668 | Ga0501071_1436483 | |||
| 2669 | Ga0501071_1616005 | |||
| 2670 | Ga0501072_0015466 | |||
| 2671 | Ga0501072_0020892 | |||
| 2672 | Ga0501072_0021691 | |||
| 2673 | Ga0501072_0095697 | |||
| 2674 | Ga0501072_0805640 | |||
| 2675 | Ga0501072_1260303 | |||
| 2676 | Ga0501073_0266650 | |||
| 2677 | Ga0501073_0867191 | |||
| 2678 | Ga0501074_0094434 | |||
| 2679 | Ga0501074_0296706 | |||
| 2680 | Ga0501074_0467167 | |||
| 2681 | Ga0501075_0040980 | |||
| 2682 | Ga0501075_0063619 | |||
| 2683 | Ga0501075_0283479 | |||
| 2684 | Ga0501075_0617104 | |||
| 2685 | Ga0501076_0016244 | |||
| 2686 | Ga0501076_0546443 | |||
| 2687 | Ga0501076_0564578 | |||
| 2688 | Ga0501077_0199150 | |||
| 2689 | Ga0501077_0627696 | |||
| 2690 | Ga0501077_0680884 | |||
| 2691 | Ga0501233_131170 | |||
| 2692 | Ga0501079_0011823 | |||
| 2693 | Ga0501079_0097220 | |||
| 2694 | Ga0501079_0238445 | |||
| 2695 | Ga0501079_0409211 | |||
| 2696 | Ga0501079_0602016 | |||
| 2697 | Ga0501080_0249732 | |||
| 2698 | Ga0501080_0532856 | |||
| 2699 | Ga0501080_1769455 | |||
| 2700 | Ga0501081_0042676 | |||
| 2701 | Ga0501081_0170953 | |||
| 2702 | Ga0501035_0619261 | |||
| 2703 | Ga0501044_0004942 | |||
| 2704 | Ga0501045_0047261 | |||
| 2705 | Ga0501045_0051324 | |||
| 2706 | Ga0501045_0088902 | |||
| 2707 | Ga0501045_0976161 | |||
| 2708 | nmdc:mga03683_34547_c1 | |||
| 2709 | nmdc:mga03683_89783_c1 | |||
| 2710 | nmdc:mga03n38_441130_c1 | |||
| 2711 | nmdc:mga03n38_58928_c1 | |||
| 2712 | nmdc:mga03n38_757860_c1 | |||
| 2713 | nmdc:mga03n38_9489_c1 | |||
| 2714 | nmdc:mga03n38_962247_c1 | |||
| 2715 | nmdc:mga00v17_1029218_c1 | |||
| 2716 | nmdc:mga00v17_120558_c1 | |||
| 2717 | nmdc:mga00v17_229031_c1 | |||
| 2718 | nmdc:mga00v17_2601_c1 | |||
| 2719 | nmdc:mga00v17_340293_c1 | |||
| 2720 | nmdc:mga00v17_390796_c1 | |||
| 2721 | nmdc:mga00v17_465849_c1 | |||
| 2722 | nmdc:mga00v17_665_c1 | |||
| 2723 | nmdc:mga00v17_85970_c1 | |||
| 2724 | nmdc:mga0yw44_100143_c1 | |||
| 2725 | nmdc:mga0yw44_116064_c1 | |||
| 2726 | nmdc:mga0yw44_136706_c2 | |||
| 2727 | nmdc:mga0yw44_1398_c1 | |||
| 2728 | nmdc:mga0yw44_20263_c1 | |||
| 2729 | nmdc:mga0yw44_23801_c1 | |||
| 2730 | nmdc:mga0yw44_264923_c1 | |||
| 2731 | nmdc:mga0yw44_266490_c1 | |||
| 2732 | nmdc:mga0yw44_266629_c1 | |||
| 2733 | nmdc:mga0yw44_291750_c1 | |||
| 2734 | nmdc:mga0yw44_30363_c1 | |||
| 2735 | nmdc:mga0yw44_350254_c1 | |||
| 2736 | nmdc:mga0yw44_351579_c1 | |||
| 2737 | nmdc:mga0yw44_44_c1 | |||
| 2738 | nmdc:mga0yw44_5924_c1 | |||
| 2739 | nmdc:mga0yw44_671996_c1 | |||
| 2740 | nmdc:mga0yw44_78724_c1 | |||
| 2741 | nmdc:mga0yw44_890002_c1 | |||
| 2742 | nmdc:mga0k408_128180_c1 | |||
| 2743 | nmdc:mga06z11_243384_c1 | |||
| 2744 | nmdc:mga06z11_433103_c1 | |||
| 2745 | nmdc:mga06z11_5925_c1 | |||
| 2746 | nmdc:mga06z11_87353_c1 | |||
| 2747 | nmdc:mga04h51_10254_c1 | |||
| 2748 | nmdc:mga04h51_162539_c1 | |||
| 2749 | nmdc:mga04h51_240725_c1 | |||
| 2750 | nmdc:mga04h51_305950_c1 | |||
| 2751 | nmdc:mga04h51_380778_c1 | |||
| 2752 | nmdc:mga05p37_1308842_c1 | |||
| 2753 | nmdc:mga05p37_557454_c1 | |||
| 2754 | nmdc:mga09592_800048_c1 | |||
| 2755 | nmdc:mga08y16_393274_c1 | |||
| 2756 | nmdc:mga08y16_880295_c1 | |||
| 2757 | nmdc:mga0rr50_1129583_c1 | |||
| 2758 | Ga0500635_0006792 | |||
| 2759 | Ga0495595_0279429 | |||
| 2760 | Ga0495595_0336813 | |||
| 2761 | Ga0495595_0705211 | |||
| 2762 | Ga0495619_0263881 | |||
| 2763 | Ga0495619_0773339 | |||
| 2764 | Ga0500644_0375618 | |||
| 2765 | Ga0500646_0026544 | |||
| 2766 | Ga0500646_0122618 | |||
| 2767 | Ga0500583_0139854 | |||
| 2768 | Ga0500583_0197939 | |||
| 2769 | Ga0500566_0000532 | |||
| 2770 | Ga0500566_0120764 | |||
| 2771 | Ga0500628_210638 | |||
| 2772 | Ga0500655_036960 | |||
| 2773 | Ga0500620_031846 | |||
| 2774 | Ga0501084_0271980 | |||
| 2775 | Ga0501084_0326735 | |||
| 2776 | Ga0501084_1328679 | |||
| 2777 | Ga0587066_108309 | |||
| 2778 | Ga0587077_171293 | |||
| 2779 | Ga0587082_033158 | |||
| 2780 | Ga0587082_037518 | |||
| 2781 | Ga0587083_0019282 | |||
| 2782 | Ga0587086_020163 | |||
| 2783 | Ga0587088_133956 | |||
| 2784 | Ga0587098_077308 | |||
| 2785 | Ga0587106_136637 | |||
| 2786 | Ga0587101_081851 | |||
| 2787 | Ga0587128_097622 | |||
| 2788 | Ga0587068_037772 | |||
| 2789 | Ga0587068_090856 | |||
| 2790 | Ga0587072_044446 | |||
| 2791 | Ga0587076_189371 | |||
| 2792 | Ga0587079_088058 | |||
| 2793 | Ga0587079_176608 | |||
| 2794 | Ga0587107_022277 | |||
| 2795 | Ga0587110_009122 | |||
| 2796 | Ga0501082_0197947 | |||
| 2797 | Ga0501082_0862328 | |||
| 2798 | Ga0530510_0008292 | |||
| 2799 | Ga0530510_0298484 | |||
| 2800 | Ga0530510_0937047 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1hwu-assembly3.cif.gz_C | structure of pii protein from herbaspirillum seropedicae | 0.9983 | 1 | 112 |
| 3lf0-assembly1.cif.gz_A | crystal structure of the atp bound mycobacterium tuberculosis nitrogen regulatory pii protein | 0.9899 | 2 | 112 |
| 1hwu-assembly3.cif.gz_C | structure of pii protein from herbaspirillum seropedicae | 0.9876 | 1 | 112 |
| 2xzw-assembly2.cif.gz_E | structure of pii from synechococcus elongatus in complex with 2- oxoglutarate at low 2-og concentrations | 0.9835 | 1 | 111 |
| 2eg1-assembly1.cif.gz_A | the crystal structure of pii protein | 0.9829 | 1 | 112 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2o66C00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9735 | 2 | 111 | 3.30.70.120 |
| 4c3kE00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9687 | 1 | 111 | 3.30.70.120 |
| 4c3kE00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.959 | 1 | 111 | 3.30.70.120 |
| 4oznB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9553 | 2 | 112 | 3.30.70.120 |
| 4usiC00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9097 | 2 | 108 | 3.30.70.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y8HQB2-F1-model_v4 | P-II family nitrogen regulator | 0.9768 | 1 | 112 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |
| AF-W0I613-F1-model_v4 | Putative Nitrogen regulatory protein P-II | 0.976 | 1 | 112 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |
| AF-A0A2N3F8I2-F1-model_v4 | Transcriptional regulator | 0.9757 | 1 | 112 |
GO:0005524
GO:0005829 GO:0006808 GO:0009399 GO:0030234 |
| AF-A0A181C720-F1-model_v4 | deleted | 0.9755 | 2 | 112 |
|
| AF-A0A7G9KTM8-F1-model_v4 | deleted | 0.9745 | 2 | 112 |
|