F493631

General Info

Members Datasets Scaffolds Average Seq Length
1396 421 1340 434

Family's Representative Sequence

Representative Sequence 3300046513|Ga0495616_0032459|Ga0495616_0032459_980_2314
Length 427
Sequence MTDAPAPAPFVGPLADKDRIFTNVHGFQDWGIDAAMKRGDWDNTKALLDIGQDAIIEKMKASGLRGRGGAGFPTGMKWSFMPKESKDGRPSFLVINADESEPGSCKDREIIRHDPHKLIEGALVAGFAMRARAAYIYIRGEFIYEAKVLFEAVEQAYAKGFIGKNACGSGYDFDVFVHRGAGAYICGEETAQIESLEGKKGQPRLKPPFPAAVAPTILRRGPEWFAGIGRPGNLGTKLFQISGHVNKPCVVEEAMGIPFRELIDRHCGGIRGGWDNLLAVIPGGSSVPLVPAAQIMDAPMDFDGLKALGSGLGTAAVIVMDKSTDIVRAISRLSYFYKHESCGQCTPCREGTGWMWRVMERLRTGEADLSEIDILQEVTKQVEGHTICALGDAAAWPIQGLIRHFRPEIERRINEAKGGAPMMEAAE

Samples

Sample ID Description Type Environment
1 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
2 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
3 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
4 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
5 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
6 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
7 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
8 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
9 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
10 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
11 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
12 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
13 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
14 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
15 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
16 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
17 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
18 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
19 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
20 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
21 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
22 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
23 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
24 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
25 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
26 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
27 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
28 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
29 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
30 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
31 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
32 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
33 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
34 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
35 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
36 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
37 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
38 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
39 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
40 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
41 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
42 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
43 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
44 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
45 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
46 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
47 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
48 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
49 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
50 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
51 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
52 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
53 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
54 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
55 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
56 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
57 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
58 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
59 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
60 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
61 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
62 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
63 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
64 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
65 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
66 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
67 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
68 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
69 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
70 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
71 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
72 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
73 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
74 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
75 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
76 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
77 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
78 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
79 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
80 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
81 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
82 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
83 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
84 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
85 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
86 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
87 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
88 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
89 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
90 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
91 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
92 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
93 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
94 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
95 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
96 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
97 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
98 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
99 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
100 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
101 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
102 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
103 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
104 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
105 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
106 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
107 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
108 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
109 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
110 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
111 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
112 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
113 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
114 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
115 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
116 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
117 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
118 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
119 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
120 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
121 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
122 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
123 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
124 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
125 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
126 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
127 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
128 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
129 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
130 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
131 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
132 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
133 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
134 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
135 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
136 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
137 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
138 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
139 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
140 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
141 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
142 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
143 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
144 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
145 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
146 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
147 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
148 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
149 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
150 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
151 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
152 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
153 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
154 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
155 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
156 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
157 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
158 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
159 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
160 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
161 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
162 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
163 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
164 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
165 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
166 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
167 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
168 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
169 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
170 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
171 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
172 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
173 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
174 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
175 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
176 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
177 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
178 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
179 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
180 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
181 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
182 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
183 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
184 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
185 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
186 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
187 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
188 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
189 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
190 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
191 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
194 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
195 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
196 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
198 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
199 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
203 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
206 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
207 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
208 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
210 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
211 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
271 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
273 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
277 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
278 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
279 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
280 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
281 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
282 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
283 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
284 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
285 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
286 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
287 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
288 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
289 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
290 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
291 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
292 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
293 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
294 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
295 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
296 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
297 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
298 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
299 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
300 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
301 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
302 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
303 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
304 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
305 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
306 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
307 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
308 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
309 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
310 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
311 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
312 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
313 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
314 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
315 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
316 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
317 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
318 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
319 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
320 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
321 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
322 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
323 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
324 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
325 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
326 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
327 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
328 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
329 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
330 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
331 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
332 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
333 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
334 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
335 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
336 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
337 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
338 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
339 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
340 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
341 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
342 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
343 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
344 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
345 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
346 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
347 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
348 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
349 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
350 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
351 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
352 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
353 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
354 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
355 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
356 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
357 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
358 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
359 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
360 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
361 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
362 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
363 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
364 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
365 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
366 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
367 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
368 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
369 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
370 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
371 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
372 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
373 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
374 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
375 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
376 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
377 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
378 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
379 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
380 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
381 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
382 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
383 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
385 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
386 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
387 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
388 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
389 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
390 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
392 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
393 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
394 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
395 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
396 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
397 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
398 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
399 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
400 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
401 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
402 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
403 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
404 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
405 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
406 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
407 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
408 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
409 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
410 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
411 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
412 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
413 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
414 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
415 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
416 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
417 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
418 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
419 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
420 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
421 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.92
Metatranscriptomes 0.07
Isolates 4.01

Biome Distribution

Category Percentage (%)
Aerial Root 0.36
Bulb 0
Endosphere 8.02
Nodule 0
Rhizoplane 4.3
Rhizosphere 81.09
Stem 0
Stem Tuber 0.07
Unclassified 6.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000108 3300001904 Bacteria 13965
2 JGI24736J21556_1000426 3300001904 Bacteria 7911
3 JGI24736J21556_1001363 3300001904 Bacteria 4458
4 JGI24736J21556_1003865 3300001904 Bacteria 2582
5 JGI24741J21665_1000521 3300001915 Bacteria 11741
6 JGI24741J21665_1004845 3300001915 Bacteria 2911
7 JGI24752J21851_1000192 3300001976 Bacteria 8477
8 JGI24752J21851_1001145 3300001976 Bacteria 3596
9 JGI24740J21852_10002500 3300001979 Bacteria 8309
10 JGI24740J21852_10004864 3300001979 Bacteria 5714
11 JGI24740J21852_10005448 3300001979 Bacteria 5380
12 JGI24740J21852_10006008 3300001979 Bacteria 5078
13 JGI24740J21852_10017845 3300001979 Bacteria 2529
14 JGI24740J21852_10026360 3300001979 Bacteria 1948
15 JGI24739J22299_10003176 3300001989 Bacteria 6271
16 JGI24739J22299_10009782 3300001989 Bacteria 3565
17 JGI24737J22298_10000102 3300001990 Bacteria 25395
18 JGI24737J22298_10001523 3300001990 Bacteria 8257
19 JGI24737J22298_10001746 3300001990 Bacteria 7761
20 JGI24737J22298_10005981 3300001990 Bacteria 4178
21 JGI24737J22298_10013495 3300001990 Bacteria 2658
22 JGI24737J22298_10014855 3300001990 Bacteria 2524
23 JGI24737J22298_10023420 3300001990 Bacteria 1959
24 JGI24743J22301_10003073 3300001991 Bacteria 2599
25 JGI24743J22301_10003317 3300001991 Bacteria 2534
26 JGI24735J21928_10010391 3300002067 Bacteria 2970
27 JGI24735J21928_10038253 3300002067 Bacteria 1405
28 JGI24750J21931_1002313 3300002070 Bacteria 2301
29 JGI24748J21848_1000082 3300002074 Bacteria 28386
30 JGI24738J21930_10000384 3300002075 Bacteria 12294
31 JGI24738J21930_10002936 3300002075 Bacteria 4359
32 JGI24738J21930_10003243 3300002075 Bacteria 4143
33 JGI24749J21850_1000153 3300002076 Bacteria 10997
34 JGI24749J21850_1001046 3300002076 Bacteria 3943
35 JGI24034J26672_10000019 3300002239 Bacteria 125073
36 JGI24751J29686_10000119 3300002459 Bacteria 40044
37 JGI24751J29686_10000527 3300002459 Bacteria 10934
38 JGI25150J39212_1000715 3300002774 Bacteria 11879
39 JGI25150J39212_1001064 3300002774 Bacteria 8348
40 JGI25151J46595_10000436 3300003187 Bacteria 41270
41 JGI25165J46597_1000041 3300003214 Bacteria 272566
42 JGI25165J46597_1000082 3300003214 Bacteria 174736
43 JGI25153J46596_10000002 3300003215 Bacteria 653569
44 JGI25153J46596_10000319 3300003215 Bacteria 35358
45 JGI25160J50197_1003631 3300003354 Bacteria 6854
46 Ga0055525_1000076 3300003759 Bacteria 168820
47 Ga0055542_1000020 3300003762 Bacteria 335745
48 Ga0055529_1000016 3300003763 Bacteria 364775
49 Ga0055526_1005820 3300003771 Bacteria 6934
50 Ga0055537_1005519 3300003773 Bacteria 3380
51 Ga0055536_1008491 3300003781 Bacteria 4405
52 Ga0055534_1011713 3300003784 Bacteria 1767
53 Ga0055530_10000095 3300003791 Bacteria 74707
54 Ga0055530_10001188 3300003791 Bacteria 20133
55 Ga0055540_1001230 3300003792 Bacteria 15764
56 Ga0055531_10001182 3300003794 Bacteria 20057
57 Ga0055531_10003004 3300003794 Bacteria 10952
58 Ga0065165_1005289 3300005262 Bacteria 7354
59 Ga0065704_10009692 3300005289 Bacteria 2245
60 Ga0065704_10070751 3300005289 Bacteria 16714
61 Ga0065715_10008455 3300005293 Bacteria 3296
62 Ga0065707_10082676 3300005295 Bacteria 12843
63 Ga0065707_10088015 3300005295 Bacteria 4812
64 Ga0070658_10000001 3300005327 Bacteria 856789
65 Ga0070658_10000125 3300005327 Bacteria 68211
66 Ga0070658_10000966 3300005327 Bacteria 24638
67 Ga0070658_10004279 3300005327 Bacteria 11665
68 Ga0070658_10037260 3300005327 Bacteria 3919
69 Ga0070658_10065082 3300005327 Bacteria 2975
70 Ga0070658_10172421 3300005327 Bacteria 1818
71 Ga0070658_10191749 3300005327 Bacteria 1722
72 Ga0070658_10231253 3300005327 Bacteria 1565
73 Ga0070658_10238026 3300005327 Bacteria 1542
74 Ga0070676_10095647 3300005328 Bacteria 1827
75 Ga0070676_10139966 3300005328 Bacteria 1539
76 Ga0070683_100001903 3300005329 Bacteria 16330
77 Ga0070683_100005971 3300005329 Bacteria 10195
78 Ga0070683_100099184 3300005329 Bacteria 2742
79 Ga0070690_100001820 3300005330 Bacteria 11305
80 Ga0070670_100000016 3300005331 Bacteria 226440
81 Ga0070670_100000047 3300005331 Bacteria 136625
82 Ga0070670_100001762 3300005331 Bacteria 17610
83 Ga0070670_100009416 3300005331 Bacteria 8338
84 Ga0070670_100047492 3300005331 Bacteria 3694
85 Ga0070670_100141915 3300005331 Bacteria 2077
86 Ga0070677_10000660 3300005333 Bacteria 11497
87 Ga0070677_10005970 3300005333 Bacteria 4038
88 Ga0068869_100099436 3300005334 Bacteria 2198
89 Ga0070666_10000002 3300005335 Bacteria 478684
90 Ga0070666_10000033 3300005335 Bacteria 121625
91 Ga0070666_10004828 3300005335 Bacteria 8240
92 Ga0070666_10040576 3300005335 Bacteria 3106
93 Ga0070666_10043882 3300005335 Bacteria 2994
94 Ga0070666_10045183 3300005335 Bacteria 2952
95 Ga0070666_10077188 3300005335 Bacteria 2273
96 Ga0070680_100004062 3300005336 Bacteria 10956
97 Ga0070680_100005367 3300005336 Bacteria 9700
98 Ga0070680_100011819 3300005336 Bacteria 6772
99 Ga0070680_100014569 3300005336 Bacteria 6149
100 Ga0070680_100070846 3300005336 Bacteria 2864
101 Ga0070682_100049332 3300005337 Bacteria 2624
102 Ga0070682_100180103 3300005337 Bacteria 1475
103 Ga0068868_100000001 3300005338 Bacteria 282170
104 Ga0068868_100040056 3300005338 Bacteria 3644
105 Ga0068868_100046622 3300005338 Bacteria 3393
106 Ga0068868_100087169 3300005338 Bacteria 2510
107 Ga0070660_100000585 3300005339 Bacteria 24415
108 Ga0070660_100003013 3300005339 Bacteria 11603
109 Ga0070660_100005352 3300005339 Bacteria 8882
110 Ga0070660_100011096 3300005339 Bacteria 6390
111 Ga0070660_100012440 3300005339 Bacteria 6076
112 Ga0070660_100024838 3300005339 Bacteria 4450
113 Ga0070660_100061546 3300005339 Bacteria 2914
114 Ga0070660_100139448 3300005339 Bacteria 1944
115 Ga0070660_100202944 3300005339 Bacteria 1608
116 Ga0070689_100008663 3300005340 Bacteria 7178
117 Ga0070689_100131406 3300005340 Bacteria 2008
118 Ga0070661_100000014 3300005344 Bacteria 158652
119 Ga0070661_100000696 3300005344 Bacteria 24644
120 Ga0070661_100008527 3300005344 Bacteria 7090
121 Ga0070661_100023324 3300005344 Bacteria 4434
122 Ga0070661_100076587 3300005344 Bacteria 2465
123 Ga0070661_100083851 3300005344 Bacteria 2355
124 Ga0070661_100105301 3300005344 Bacteria 2102
125 Ga0070661_100208691 3300005344 Bacteria 1494
126 Ga0070692_10002506 3300005345 Bacteria 7149
127 Ga0070692_10013516 3300005345 Bacteria 3808
128 Ga0070668_100000010 3300005347 Bacteria 132833
129 Ga0070668_100000262 3300005347 Bacteria 34868
130 Ga0070668_100010571 3300005347 Bacteria 6865
131 Ga0070668_100014297 3300005347 Bacteria 5931
132 Ga0070668_100141882 3300005347 Bacteria 1937
133 Ga0070669_100000072 3300005353 Bacteria 99184
134 Ga0070669_100000075 3300005353 Bacteria 98073
135 Ga0070669_100000244 3300005353 Bacteria 45046
136 Ga0070669_100000329 3300005353 Bacteria 36963
137 Ga0070669_100009443 3300005353 Bacteria 6947
138 Ga0070669_100009564 3300005353 Bacteria 6903
139 Ga0070669_100019062 3300005353 Bacteria 4904
140 Ga0070669_100070048 3300005353 Bacteria 2592
141 Ga0070669_100083117 3300005353 Bacteria 2387
142 Ga0070675_100105261 3300005354 Bacteria 2381
143 Ga0070671_100000015 3300005355 Bacteria 166132
144 Ga0070671_100002220 3300005355 Bacteria 14991
145 Ga0070671_100002790 3300005355 Bacteria 13569
146 Ga0070671_100004500 3300005355 Bacteria 11034
147 Ga0070671_100005321 3300005355 Bacteria 10271
148 Ga0070671_100034531 3300005355 Bacteria 4186
149 Ga0070671_100044561 3300005355 Bacteria 3686
150 Ga0070671_100075604 3300005355 Bacteria 2814
151 Ga0070671_100135035 3300005355 Bacteria 2080
152 Ga0070671_100187895 3300005355 Bacteria 1751
153 Ga0070674_100001953 3300005356 Bacteria 11251
154 Ga0070674_100002711 3300005356 Bacteria 9798
155 Ga0070673_100000146 3300005364 Bacteria 33612
156 Ga0070673_100001874 3300005364 Bacteria 12589
157 Ga0070673_100044165 3300005364 Bacteria 3449
158 Ga0070659_100000001 3300005366 Bacteria 576390
159 Ga0070659_100000905 3300005366 Bacteria 21696
160 Ga0070659_100012325 3300005366 Bacteria 6336
161 Ga0070659_100024815 3300005366 Bacteria 4599
162 Ga0070659_100025030 3300005366 Bacteria 4580
163 Ga0070659_100034101 3300005366 Bacteria 3958
164 Ga0070659_100040891 3300005366 Bacteria 3624
165 Ga0070659_100051272 3300005366 Bacteria 3244
166 Ga0070659_100060643 3300005366 Bacteria 2988
167 Ga0070659_100061242 3300005366 Bacteria 2974
168 Ga0070659_100090979 3300005366 Bacteria 2445
169 Ga0070659_100103487 3300005366 Bacteria 2293
170 Ga0070659_100114980 3300005366 Bacteria 2174
171 Ga0070659_100134692 3300005366 Bacteria 2008
172 Ga0070667_100000013 3300005367 Bacteria 255674
173 Ga0070667_100000188 3300005367 Bacteria 74225
174 Ga0070667_100002504 3300005367 Bacteria 16032
175 Ga0070667_100010054 3300005367 Bacteria 7837
176 Ga0070667_100010329 3300005367 Bacteria 7712
177 Ga0070667_100010916 3300005367 Bacteria 7513
178 Ga0070667_100014425 3300005367 Bacteria 6528
179 Ga0070667_100014944 3300005367 Bacteria 6413
180 Ga0070667_100015186 3300005367 Bacteria 6362
181 Ga0070667_100015448 3300005367 Bacteria 6313
182 Ga0070667_100017661 3300005367 Bacteria 5911
183 Ga0070667_100023690 3300005367 Bacteria 5096
184 Ga0070667_100026681 3300005367 Bacteria 4805
185 Ga0070714_100020083 3300005435 Bacteria 5451
186 Ga0070714_100059027 3300005435 Bacteria 3289
187 Ga0070713_100012601 3300005436 Bacteria 6210
188 Ga0070713_100188885 3300005436 Bacteria 1855
189 Ga0070663_100002310 3300005455 Bacteria 10702
190 Ga0070663_100007671 3300005455 Bacteria 6585
191 Ga0070663_100014367 3300005455 Bacteria 5081
192 Ga0070663_100081380 3300005455 Bacteria 2380
193 Ga0070663_100149407 3300005455 Bacteria 1790
194 Ga0070678_100004997 3300005456 Bacteria 7600
195 Ga0070662_100000024 3300005457 Bacteria 91042
196 Ga0070662_100001981 3300005457 Bacteria 12566
197 Ga0070662_100002906 3300005457 Bacteria 10644
198 Ga0070662_100004174 3300005457 Bacteria 9102
199 Ga0070662_100064761 3300005457 Bacteria 2677
200 Ga0070662_100083263 3300005457 Bacteria 2387
201 Ga0070681_10091817 3300005458 Bacteria 2986
202 Ga0068867_100004266 3300005459 Bacteria 10057
203 Ga0068867_100091373 3300005459 Bacteria 2311
204 Ga0070685_10000023 3300005466 Bacteria 102548
205 Ga0070679_100000007 3300005530 Bacteria 195373
206 Ga0070679_100120693 3300005530 Bacteria 2606
207 Ga0070679_100136622 3300005530 Bacteria 2432
208 Ga0070679_100202233 3300005530 Bacteria 1952
209 Ga0070684_100060656 3300005535 Bacteria 3309
210 Ga0070684_100074399 3300005535 Bacteria 2994
211 Ga0070684_100089485 3300005535 Bacteria 2736
212 Ga0068853_100000033 3300005539 Bacteria 113700
213 Ga0068853_100005131 3300005539 Bacteria 10238
214 Ga0068853_100027580 3300005539 Bacteria 4771
215 Ga0068853_100056555 3300005539 Bacteria 3383
216 Ga0068853_100101670 3300005539 Bacteria 2542
217 Ga0070672_100022620 3300005543 Bacteria 4622
218 Ga0070686_100000003 3300005544 Bacteria 308397
219 Ga0070686_100000597 3300005544 Bacteria 21352
220 Ga0070686_100083635 3300005544 Bacteria 2119
221 Ga0070696_100033433 3300005546 Bacteria 3533
222 Ga0070665_100000036 3300005548 Bacteria 314603
223 Ga0070665_100000051 3300005548 Bacteria 249317
224 Ga0070665_100000334 3300005548 Bacteria 72297
225 Ga0070665_100002297 3300005548 Bacteria 21236
226 Ga0070665_100009526 3300005548 Bacteria 9824
227 Ga0070665_100009968 3300005548 Bacteria 9610
228 Ga0070665_100010871 3300005548 Bacteria 9206
229 Ga0070665_100015494 3300005548 Bacteria 7659
230 Ga0070665_100066299 3300005548 Bacteria 3622
231 Ga0070665_100124737 3300005548 Bacteria 2577
232 Ga0068855_100006863 3300005563 Bacteria 13811
233 Ga0068855_100012936 3300005563 Bacteria 10067
234 Ga0068855_100028987 3300005563 Bacteria 6621
235 Ga0068855_100031634 3300005563 Bacteria 6318
236 Ga0068855_100055212 3300005563 Bacteria 4666
237 Ga0068855_100078730 3300005563 Bacteria 3823
238 Ga0068855_100159046 3300005563 Bacteria 2565
239 Ga0068855_100169312 3300005563 Bacteria 2474
240 Ga0068855_100204607 3300005563 Bacteria 2221
241 Ga0070664_100000764 3300005564 Bacteria 24811
242 Ga0070664_100015651 3300005564 Bacteria 6206
243 Ga0070664_100038187 3300005564 Bacteria 4041
244 Ga0070664_100042193 3300005564 Bacteria 3851
245 Ga0070664_100046630 3300005564 Bacteria 3660
246 Ga0070664_100070221 3300005564 Bacteria 2999
247 Ga0070664_100093809 3300005564 Bacteria 2601
248 Ga0070664_100107859 3300005564 Bacteria 2428
249 Ga0070664_100147224 3300005564 Bacteria 2077
250 Ga0068857_100010277 3300005577 Bacteria 8134
251 Ga0068857_100012593 3300005577 Bacteria 7369
252 Ga0068857_100021108 3300005577 Bacteria 5730
253 Ga0068857_100042057 3300005577 Bacteria 4053
254 Ga0068857_100043291 3300005577 Bacteria 3994
255 Ga0068857_100108565 3300005577 Bacteria 2493
256 Ga0068854_100007294 3300005578 Bacteria 7063
257 Ga0068854_100008931 3300005578 Bacteria 6453
258 Ga0068854_100010250 3300005578 Bacteria 6075
259 Ga0068854_100017252 3300005578 Bacteria 4829
260 Ga0068854_100062502 3300005578 Bacteria 2700
261 Ga0068854_100094493 3300005578 Bacteria 2230
262 Ga0068854_100099840 3300005578 Bacteria 2174
263 Ga0068854_100116842 3300005578 Bacteria 2019
264 Ga0068854_100220773 3300005578 Bacteria 1499
265 Ga0068854_100235426 3300005578 Bacteria 1455
266 Ga0068856_100000744 3300005614 Bacteria 35290
267 Ga0068856_100009471 3300005614 Bacteria 9458
268 Ga0068856_100016224 3300005614 Bacteria 7206
269 Ga0068856_100021498 3300005614 Bacteria 6271
270 Ga0068856_100037634 3300005614 Bacteria 4747
271 Ga0068856_100124445 3300005614 Bacteria 2581
272 Ga0068856_100370718 3300005614 Bacteria 1451
273 Ga0068852_100000582 3300005616 Bacteria 24092
274 Ga0068852_100005763 3300005616 Bacteria 8890
275 Ga0068852_100008808 3300005616 Bacteria 7465
276 Ga0068852_100009680 3300005616 Bacteria 7161
277 Ga0068852_100030452 3300005616 Bacteria 4442
278 Ga0068852_100031198 3300005616 Bacteria 4394
279 Ga0068852_100070261 3300005616 Bacteria 3071
280 Ga0068852_100156470 3300005616 Bacteria 2124
281 Ga0068859_100000068 3300005617 Bacteria 96701
282 Ga0068859_100000236 3300005617 Bacteria 54634
283 Ga0068859_100081740 3300005617 Bacteria 3273
284 Ga0068859_100393525 3300005617 Bacteria 1481
285 Ga0068864_100000017 3300005618 Bacteria 285607
286 Ga0068864_100000051 3300005618 Bacteria 136621
287 Ga0068864_100000591 3300005618 Bacteria 30902
288 Ga0068864_100002620 3300005618 Bacteria 14855
289 Ga0068864_100003852 3300005618 Bacteria 12361
290 Ga0068864_100010879 3300005618 Bacteria 7521
291 Ga0068864_100012686 3300005618 Bacteria 6967
292 Ga0068864_100024456 3300005618 Bacteria 5082
293 Ga0068864_100046591 3300005618 Bacteria 3720
294 Ga0068864_100057733 3300005618 Bacteria 3353
295 Ga0068864_100263936 3300005618 Bacteria 1602
296 Ga0068861_100000052 3300005719 Bacteria 54577
297 Ga0068861_100016857 3300005719 Bacteria 5176
298 Ga0068863_100000018 3300005841 Bacteria 206948
299 Ga0068863_100000122 3300005841 Bacteria 81534
300 Ga0068863_100000130 3300005841 Bacteria 79433
301 Ga0068863_100000447 3300005841 Bacteria 41934
302 Ga0068863_100001327 3300005841 Bacteria 24641
303 Ga0068863_100001804 3300005841 Bacteria 21250
304 Ga0068863_100006118 3300005841 Bacteria 11804
305 Ga0068863_100007348 3300005841 Bacteria 10785
306 Ga0068863_100007781 3300005841 Bacteria 10478
307 Ga0068863_100008721 3300005841 Bacteria 9908
308 Ga0068863_100010854 3300005841 Bacteria 8833
309 Ga0068863_100012560 3300005841 Bacteria 8172
310 Ga0068863_100030254 3300005841 Bacteria 5171
311 Ga0068858_100001529 3300005842 Bacteria 23762
312 Ga0068858_100017756 3300005842 Bacteria 6663
313 Ga0068858_100024117 3300005842 Bacteria 5669
314 Ga0068858_100038807 3300005842 Bacteria 4417
315 Ga0068858_100042943 3300005842 Bacteria 4192
316 Ga0068858_100083058 3300005842 Bacteria 2978
317 Ga0068858_100161837 3300005842 Bacteria 2107
318 Ga0068860_100000001 3300005843 Bacteria 703043
319 Ga0068860_100000007 3300005843 Bacteria 429329
320 Ga0068860_100000013 3300005843 Bacteria 323055
321 Ga0068860_100006940 3300005843 Bacteria 11351
322 Ga0068860_100022043 3300005843 Bacteria 6166
323 Ga0068860_100063473 3300005843 Bacteria 3508
324 Ga0068860_100223746 3300005843 Bacteria 1827
325 Ga0068862_100000010 3300005844 Bacteria 285607
326 Ga0068862_100000020 3300005844 Bacteria 219516
327 Ga0068862_100000036 3300005844 Bacteria 173453
328 Ga0068862_100000067 3300005844 Bacteria 123668
329 Ga0068862_100000169 3300005844 Bacteria 72633
330 Ga0068862_100007437 3300005844 Bacteria 9080
331 Ga0068862_100008071 3300005844 Bacteria 8716
332 Ga0068862_100027938 3300005844 Bacteria 4751
333 Ga0068862_100028628 3300005844 Bacteria 4692
334 Ga0068862_100038545 3300005844 Bacteria 4053
335 Ga0068862_100078785 3300005844 Bacteria 2855
336 Ga0081455_10002904 3300005937 Bacteria 20117
337 Ga0081455_10019320 3300005937 Bacteria 6449
338 Ga0081455_10028171 3300005937 Bacteria 5135
339 Ga0081539_10006627 3300005985 Bacteria 10992
340 Ga0081539_10027988 3300005985 Bacteria 3554
341 Ga0075368_10000432 3300006042 Bacteria 12392
342 Ga0075363_100008687 3300006048 Bacteria 4742
343 Ga0075363_100041795 3300006048 Bacteria 2419
344 Ga0075364_10015795 3300006051 Bacteria 4686
345 Ga0075364_10028514 3300006051 Bacteria 3574
346 Ga0075432_10024576 3300006058 Bacteria 2065
347 Ga0075362_10000045 3300006177 Bacteria 42952
348 Ga0075362_10005061 3300006177 Bacteria 4791
349 Ga0075362_10072059 3300006177 Bacteria 1580
350 Ga0075367_10002723 3300006178 Bacteria 8167
351 Ga0075367_10010641 3300006178 Bacteria 4839
352 Ga0075369_10001176 3300006186 Bacteria 8853
353 Ga0075366_10000596 3300006195 Bacteria 16937
354 Ga0075366_10023596 3300006195 Bacteria 3584
355 Ga0097621_100041211 3300006237 Bacteria 3716
356 Ga0075370_10000043 3300006353 Bacteria 38612
357 Ga0075370_10018512 3300006353 Bacteria 3780
358 Ga0075370_10024666 3300006353 Bacteria 3323
359 Ga0075370_10029189 3300006353 Bacteria 3070
360 Ga0068871_100017276 3300006358 Bacteria 5455
361 Ga0075430_100050315 3300006846 Bacteria 3514
362 Ga0075431_100052980 3300006847 Bacteria 4184
363 Ga0075433_10037263 3300006852 Bacteria 4194
364 Ga0068865_100019947 3300006881 Bacteria 4344
365 Ga0068865_100078138 3300006881 Bacteria 2367
366 Ga0097620_100000068 3300006931 Bacteria 96701
367 Ga0097620_100000236 3300006931 Bacteria 54634
368 Ga0097620_100000812 3300006931 Bacteria 31775
369 Ga0097620_100081728 3300006931 Bacteria 3273
370 Ga0097620_100393538 3300006931 Bacteria 1481
371 Ga0105251_10000568 3300009011 Bacteria 34626
372 Ga0105251_10002301 3300009011 Bacteria 15138
373 Ga0105251_10026234 3300009011 Bacteria 2969
374 Ga0105250_10016009 3300009092 Bacteria 3061
375 Ga0105240_10009325 3300009093 Bacteria 13913
376 Ga0105240_10020826 3300009093 Bacteria 8734
377 Ga0105240_10093813 3300009093 Bacteria 3663
378 Ga0105240_10142379 3300009093 Bacteria 2865
379 Ga0111539_10174053 3300009094 Bacteria 2514
380 Ga0105245_10000250 3300009098 Bacteria 51190
381 Ga0105245_10037482 3300009098 Bacteria 4311
382 Ga0105245_10106548 3300009098 Bacteria 2601
383 Ga0105247_10000801 3300009101 Bacteria 24058
384 Ga0105247_10011972 3300009101 Bacteria 5211
385 Ga0105247_10046047 3300009101 Bacteria 2677
386 Ga0105247_10092950 3300009101 Bacteria 1917
387 Ga0105243_10000116 3300009148 Bacteria 92035
388 Ga0105243_10189947 3300009148 Bacteria 1793
389 Ga0105241_10058312 3300009174 Bacteria 2965
390 Ga0105248_10000059 3300009177 Bacteria 137176
391 Ga0105248_10000071 3300009177 Bacteria 118281
392 Ga0105248_10000096 3300009177 Bacteria 97519
393 Ga0105248_10000128 3300009177 Bacteria 87735
394 Ga0105248_10001063 3300009177 Bacteria 30382
395 Ga0105248_10001208 3300009177 Bacteria 28863
396 Ga0105248_10008735 3300009177 Bacteria 11130
397 Ga0105248_10009113 3300009177 Bacteria 10917
398 Ga0105248_10009138 3300009177 Bacteria 10899
399 Ga0105248_10107564 3300009177 Bacteria 3145
400 Ga0105237_10003515 3300009545 Bacteria 18584
401 Ga0105237_10045486 3300009545 Bacteria 4417
402 Ga0105237_10116527 3300009545 Bacteria 2665
403 Ga0105238_10015374 3300009551 Bacteria 7748
404 Ga0105238_10062956 3300009551 Bacteria 3710
405 Ga0105238_10082242 3300009551 Bacteria 3210
406 Ga0105249_10000105 3300009553 Bacteria 117181
407 Ga0105249_10000114 3300009553 Bacteria 108599
408 Ga0105249_10000173 3300009553 Bacteria 75519
409 Ga0105249_10117034 3300009553 Bacteria 2527
410 Ga0105249_10178415 3300009553 Bacteria 2065
411 Ga0105239_10000037 3300010375 Bacteria 206779
412 Ga0105246_10000060 3300011119 Bacteria 44347
413 Ga0157326_1000993 3300012513 Bacteria 3206
414 Ga0157373_10062526 3300013100 Bacteria 2637
415 Ga0157371_10000030 3300013102 Bacteria 241585
416 Ga0157371_10007471 3300013102 Bacteria 8845
417 Ga0157371_10012723 3300013102 Bacteria 6415
418 Ga0157371_10045108 3300013102 Bacteria 3138
419 Ga0157371_10166038 3300013102 Bacteria 1577
420 Ga0157370_10001103 3300013104 Bacteria 33826
421 Ga0157370_10011492 3300013104 Bacteria 9251
422 Ga0157370_10017186 3300013104 Bacteria 7302
423 Ga0157369_10001177 3300013105 Bacteria 32602
424 Ga0157369_10050738 3300013105 Bacteria 4491
425 Ga0157369_10087163 3300013105 Bacteria 3334
426 Ga0157369_10117111 3300013105 Bacteria 2828
427 Ga0157374_10187622 3300013296 Bacteria 2022
428 Ga0157378_10030218 3300013297 Bacteria 4787
429 Ga0163162_10021409 3300013306 Bacteria 6368
430 Ga0163162_10052450 3300013306 Bacteria 4096
431 Ga0163162_10189514 3300013306 Bacteria 2184
432 Ga0157372_10066650 3300013307 Bacteria 4045
433 Ga0157372_10118345 3300013307 Bacteria 3040
434 Ga0157372_10201865 3300013307 Bacteria 2303
435 Ga0157375_10025773 3300013308 Bacteria 5470
436 Ga0157375_10087316 3300013308 Bacteria 3171
437 Ga0163163_10000573 3300014325 Bacteria 32374
438 Ga0163163_10001821 3300014325 Bacteria 18002
439 Ga0163163_10061252 3300014325 Bacteria 3728
440 Ga0157380_10000238 3300014326 Bacteria 33156
441 Ga0157380_10000495 3300014326 Bacteria 24048
442 Ga0157380_10032802 3300014326 Bacteria 3996
443 Ga0157380_10167833 3300014326 Bacteria 1914
444 Ga0157379_10045190 3300014968 Bacteria 3932
445 Ga0157379_10057793 3300014968 Bacteria 3467
446 Ga0157376_10217148 3300014969 Bacteria 1769
447 Ga0183363_1005 3300015690 Bacteria 403020
448 Ga0163161_10000067 3300017792 Bacteria 106359
449 Ga0163161_10004433 3300017792 Bacteria 9784
450 Ga0163161_10036370 3300017792 Bacteria 3526
451 Ga0206354_10970312 3300020081 Bacteria 3424
452 Ga0213873_10000025 3300021358 Bacteria 86171
453 Ga0213876_10000004 3300021384 Bacteria 943822
454 Ga0213876_10000234 3300021384 Bacteria 54188
455 Ga0213876_10014515 3300021384 Bacteria 4174
456 Ga0213875_10000135 3300021388 Bacteria 82147
457 Ga0209147_101545 3300025229 Bacteria 7942
458 Ga0209563_100019 3300025230 Bacteria 697828
459 Ga0207427_100919 3300025231 Bacteria 12623
460 Ga0207425_1000026 3300025245 Bacteria 301303
461 Ga0209026_1000813 3300025250 Bacteria 16748
462 Ga0209148_1000017 3300025254 Bacteria 787064
463 Ga0209129_1000302 3300025258 Bacteria 44955
464 Ga0209233_1000041 3300025261 Bacteria 515463
465 Ga0209233_1000104 3300025261 Bacteria 272675
466 Ga0209565_1000010 3300025263 Bacteria 687724
467 Ga0209565_1000064 3300025263 Bacteria 180732
468 Ga0209455_1000005 3300025272 Bacteria 1416756
469 Ga0209673_1001168 3300025273 Bacteria 28518
470 Ga0209673_1010268 3300025273 Bacteria 3960
471 Ga0209130_1000167 3300025284 Bacteria 95517
472 Ga0209675_1000025 3300025291 Bacteria 294102
473 Ga0209676_1000198 3300025292 Bacteria 134708
474 Ga0209676_1000362 3300025292 Bacteria 85770
475 Ga0209676_1002334 3300025292 Bacteria 13714
476 Ga0209676_1003950 3300025292 Bacteria 8575
477 Ga0209025_1000077 3300025294 Bacteria 271958
478 Ga0209025_1001838 3300025294 Bacteria 24941
479 Ga0209564_1001724 3300025295 Bacteria 20518
480 Ga0209758_1000001 3300025297 Bacteria 1981790
481 Ga0209758_1000004 3300025297 Bacteria 1375322
482 Ga0209758_1008092 3300025297 Bacteria 6931
483 Ga0209050_1000001 3300025298 Bacteria 3563507
484 Ga0209050_1000010 3300025298 Bacteria 980454
485 Ga0209050_1000849 3300025298 Bacteria 41596
486 Ga0209256_1000034 3300025299 Bacteria 388475
487 Ga0207426_1000239 3300025302 Bacteria 123307
488 Ga0207426_1022527 3300025302 Bacteria 2161
489 Ga0209051_1000270 3300025303 Bacteria 86574
490 Ga0209257_1000009 3300025304 Bacteria 1205047
491 Ga0209257_1000229 3300025304 Bacteria 133121
492 Ga0209257_1000596 3300025304 Bacteria 59951
493 Ga0209257_1004248 3300025304 Bacteria 11309
494 Ga0207697_10000222 3300025315 Bacteria 30741
495 Ga0207697_10002010 3300025315 Bacteria 10770
496 Ga0207697_10004976 3300025315 Bacteria 6260
497 Ga0207656_10000453 3300025321 Bacteria 13722
498 Ga0207656_10074041 3300025321 Bacteria 1519
499 Ga0207696_1022674 3300025711 Bacteria 1991
500 Ga0207713_1001495 3300025735 Bacteria 18469
501 Ga0207713_1004474 3300025735 Bacteria 9055
502 Ga0207713_1005997 3300025735 Bacteria 7490
503 Ga0207682_10000808 3300025893 Bacteria 14483
504 Ga0207682_10004803 3300025893 Bacteria 5601
505 Ga0207642_10063146 3300025899 Bacteria 1731
506 Ga0207710_10001065 3300025900 Bacteria 14160
507 Ga0207688_10007700 3300025901 Bacteria 5866
508 Ga0207688_10050871 3300025901 Bacteria 2320
509 Ga0207688_10098729 3300025901 Bacteria 1684
510 Ga0207680_10000004 3300025903 Bacteria 827324
511 Ga0207680_10000952 3300025903 Bacteria 13645
512 Ga0207680_10007339 3300025903 Bacteria 5365
513 Ga0207680_10011762 3300025903 Bacteria 4434
514 Ga0207680_10026035 3300025903 Bacteria 3236
515 Ga0207680_10126875 3300025903 Bacteria 1676
516 Ga0207647_10004657 3300025904 Bacteria 10165
517 Ga0207647_10006289 3300025904 Bacteria 8646
518 Ga0207647_10007166 3300025904 Bacteria 8085
519 Ga0207647_10007308 3300025904 Bacteria 7993
520 Ga0207647_10009134 3300025904 Bacteria 7053
521 Ga0207647_10011520 3300025904 Bacteria 6198
522 Ga0207645_10046366 3300025907 Bacteria 2777
523 Ga0207705_10000002 3300025909 Bacteria 2046852
524 Ga0207705_10000004 3300025909 Bacteria 705756
525 Ga0207705_10000062 3300025909 Bacteria 149432
526 Ga0207705_10000412 3300025909 Bacteria 37600
527 Ga0207705_10000722 3300025909 Bacteria 27211
528 Ga0207705_10003954 3300025909 Bacteria 11269
529 Ga0207705_10021135 3300025909 Bacteria 4642
530 Ga0207705_10041408 3300025909 Bacteria 3305
531 Ga0207705_10044414 3300025909 Bacteria 3194
532 Ga0207705_10047892 3300025909 Bacteria 3074
533 Ga0207705_10070440 3300025909 Bacteria 2534
534 Ga0207705_10081940 3300025909 Bacteria 2352
535 Ga0207705_10127991 3300025909 Bacteria 1888
536 Ga0207705_10135774 3300025909 Bacteria 1834
537 Ga0207654_10001841 3300025911 Bacteria 10996
538 Ga0207654_10003761 3300025911 Bacteria 7649
539 Ga0207707_10019248 3300025912 Bacteria 5958
540 Ga0207707_10028804 3300025912 Bacteria 4853
541 Ga0207707_10165128 3300025912 Bacteria 1935
542 Ga0207695_10001017 3300025913 Bacteria 49429
543 Ga0207695_10002670 3300025913 Bacteria 26052
544 Ga0207695_10008542 3300025913 Bacteria 12800
545 Ga0207695_10017051 3300025913 Bacteria 8469
546 Ga0207695_10051120 3300025913 Bacteria 4342
547 Ga0207695_10096423 3300025913 Bacteria 2959
548 Ga0207695_10119227 3300025913 Bacteria 2609
549 Ga0207695_10134570 3300025913 Bacteria 2426
550 Ga0207671_10010082 3300025914 Bacteria 7833
551 Ga0207671_10020867 3300025914 Bacteria 4982
552 Ga0207671_10022427 3300025914 Bacteria 4775
553 Ga0207660_10000049 3300025917 Bacteria 59933
554 Ga0207660_10000986 3300025917 Bacteria 18882
555 Ga0207660_10005696 3300025917 Bacteria 8084
556 Ga0207660_10008421 3300025917 Bacteria 6671
557 Ga0207660_10023677 3300025917 Bacteria 4150
558 Ga0207660_10029019 3300025917 Bacteria 3790
559 Ga0207660_10083809 3300025917 Bacteria 2348
560 Ga0207657_10002115 3300025919 Bacteria 21475
561 Ga0207657_10004147 3300025919 Bacteria 15362
562 Ga0207657_10004231 3300025919 Bacteria 15210
563 Ga0207657_10004974 3300025919 Bacteria 13986
564 Ga0207657_10011635 3300025919 Bacteria 8725
565 Ga0207657_10012965 3300025919 Bacteria 8196
566 Ga0207657_10013383 3300025919 Bacteria 8050
567 Ga0207657_10026856 3300025919 Bacteria 5281
568 Ga0207657_10038931 3300025919 Bacteria 4228
569 Ga0207657_10042510 3300025919 Bacteria 4009
570 Ga0207657_10043778 3300025919 Bacteria 3940
571 Ga0207657_10060983 3300025919 Bacteria 3236
572 Ga0207657_10064175 3300025919 Bacteria 3136
573 Ga0207657_10153290 3300025919 Bacteria 1875
574 Ga0207657_10180604 3300025919 Bacteria 1706
575 Ga0207649_10000248 3300025920 Bacteria 43782
576 Ga0207649_10000298 3300025920 Bacteria 38460
577 Ga0207649_10000351 3300025920 Bacteria 34859
578 Ga0207649_10000613 3300025920 Bacteria 24131
579 Ga0207649_10038078 3300025920 Bacteria 2910
580 Ga0207649_10050218 3300025920 Bacteria 2579
581 Ga0207652_10000001 3300025921 Bacteria 1006643
582 Ga0207652_10000002 3300025921 Bacteria 878035
583 Ga0207652_10001278 3300025921 Bacteria 22417
584 Ga0207652_10021854 3300025921 Bacteria 5284
585 Ga0207652_10094380 3300025921 Bacteria 2634
586 Ga0207652_10145870 3300025921 Bacteria 2118
587 Ga0207681_10000002 3300025923 Bacteria 985597
588 Ga0207681_10000061 3300025923 Bacteria 102257
589 Ga0207681_10000079 3300025923 Bacteria 87683
590 Ga0207681_10000448 3300025923 Bacteria 28899
591 Ga0207681_10000547 3300025923 Bacteria 25925
592 Ga0207681_10003943 3300025923 Bacteria 9203
593 Ga0207681_10005423 3300025923 Bacteria 7832
594 Ga0207681_10009776 3300025923 Bacteria 5867
595 Ga0207681_10047181 3300025923 Bacteria 2900
596 Ga0207681_10088162 3300025923 Bacteria 2209
597 Ga0207681_10123421 3300025923 Bacteria 1903
598 Ga0207694_10006428 3300025924 Bacteria 8954
599 Ga0207694_10033709 3300025924 Bacteria 3923
600 Ga0207694_10036865 3300025924 Bacteria 3753
601 Ga0207694_10041008 3300025924 Bacteria 3567
602 Ga0207694_10089732 3300025924 Bacteria 2425
603 Ga0207650_10000038 3300025925 Bacteria 206081
604 Ga0207650_10000057 3300025925 Bacteria 156913
605 Ga0207650_10001564 3300025925 Bacteria 16366
606 Ga0207650_10008743 3300025925 Bacteria 6918
607 Ga0207650_10016417 3300025925 Bacteria 5174
608 Ga0207650_10020163 3300025925 Bacteria 4698
609 Ga0207650_10042759 3300025925 Bacteria 3324
610 Ga0207650_10106303 3300025925 Bacteria 2167
611 Ga0207659_10007604 3300025926 Bacteria 6679
612 Ga0207659_10018329 3300025926 Bacteria 4588
613 Ga0207659_10073841 3300025926 Bacteria 2498
614 Ga0207659_10101431 3300025926 Bacteria 2170
615 Ga0207687_10000184 3300025927 Bacteria 41508
616 Ga0207687_10009473 3300025927 Bacteria 6368
617 Ga0207664_10006221 3300025929 Bacteria 8198
618 Ga0207664_10061228 3300025929 Bacteria 3002
619 Ga0207644_10000002 3300025931 Bacteria 942221
620 Ga0207644_10000003 3300025931 Bacteria 585905
621 Ga0207644_10000235 3300025931 Bacteria 38139
622 Ga0207644_10000293 3300025931 Bacteria 32998
623 Ga0207644_10000602 3300025931 Bacteria 22923
624 Ga0207644_10001259 3300025931 Bacteria 16288
625 Ga0207644_10004811 3300025931 Bacteria 8795
626 Ga0207644_10008124 3300025931 Bacteria 6873
627 Ga0207644_10008440 3300025931 Bacteria 6742
628 Ga0207644_10025000 3300025931 Bacteria 4103
629 Ga0207644_10029403 3300025931 Bacteria 3812
630 Ga0207644_10056322 3300025931 Bacteria 2837
631 Ga0207644_10073806 3300025931 Bacteria 2502
632 Ga0207644_10085469 3300025931 Bacteria 2340
633 Ga0207690_10000032 3300025932 Bacteria 152479
634 Ga0207690_10000051 3300025932 Bacteria 107367
635 Ga0207690_10007071 3300025932 Bacteria 6663
636 Ga0207690_10008596 3300025932 Bacteria 6058
637 Ga0207690_10010321 3300025932 Bacteria 5544
638 Ga0207690_10064350 3300025932 Bacteria 2504
639 Ga0207690_10178168 3300025932 Bacteria 1598
640 Ga0207706_10000032 3300025933 Bacteria 142723
641 Ga0207706_10000194 3300025933 Bacteria 67452
642 Ga0207706_10018546 3300025933 Bacteria 6260
643 Ga0207706_10029322 3300025933 Bacteria 4913
644 Ga0207706_10032968 3300025933 Bacteria 4609
645 Ga0207706_10047401 3300025933 Bacteria 3802
646 Ga0207706_10047789 3300025933 Bacteria 3786
647 Ga0207706_10061592 3300025933 Bacteria 3304
648 Ga0207706_10063492 3300025933 Bacteria 3251
649 Ga0207706_10131631 3300025933 Bacteria 2200
650 Ga0207706_10140473 3300025933 Bacteria 2125
651 Ga0207706_10142946 3300025933 Bacteria 2105
652 Ga0207686_10152925 3300025934 Bacteria 1608
653 Ga0207709_10000031 3300025935 Bacteria 329046
654 Ga0207670_10020172 3300025936 Bacteria 4089
655 Ga0207670_10065428 3300025936 Bacteria 2495
656 Ga0207670_10135088 3300025936 Bacteria 1812
657 Ga0207669_10000242 3300025937 Bacteria 24773
658 Ga0207669_10039534 3300025937 Bacteria 2727
659 Ga0207669_10086252 3300025937 Bacteria 2029
660 Ga0207704_10025003 3300025938 Bacteria 3251
661 Ga0207691_10011704 3300025940 Bacteria 8424
662 Ga0207691_10019348 3300025940 Bacteria 6442
663 Ga0207691_10024770 3300025940 Bacteria 5642
664 Ga0207691_10056900 3300025940 Bacteria 3561
665 Ga0207691_10074263 3300025940 Bacteria 3067
666 Ga0207691_10123270 3300025940 Bacteria 2294
667 Ga0207711_10000031 3300025941 Bacteria 203323
668 Ga0207711_10000046 3300025941 Bacteria 153238
669 Ga0207711_10000254 3300025941 Bacteria 57648
670 Ga0207711_10000476 3300025941 Bacteria 41373
671 Ga0207711_10001111 3300025941 Bacteria 25714
672 Ga0207711_10003731 3300025941 Bacteria 13137
673 Ga0207711_10004041 3300025941 Bacteria 12593
674 Ga0207711_10004129 3300025941 Bacteria 12441
675 Ga0207711_10005173 3300025941 Bacteria 11053
676 Ga0207711_10005858 3300025941 Bacteria 10377
677 Ga0207711_10013274 3300025941 Bacteria 6846
678 Ga0207711_10015656 3300025941 Bacteria 6290
679 Ga0207711_10016349 3300025941 Bacteria 6167
680 Ga0207711_10019396 3300025941 Bacteria 5663
681 Ga0207711_10019811 3300025941 Bacteria 5607
682 Ga0207689_10000094 3300025942 Bacteria 71733
683 Ga0207689_10215251 3300025942 Bacteria 1587
684 Ga0207661_10005798 3300025944 Bacteria 8708
685 Ga0207661_10008817 3300025944 Bacteria 7215
686 Ga0207661_10124402 3300025944 Bacteria 2200
687 Ga0207661_10226631 3300025944 Bacteria 1653
688 Ga0207679_10000466 3300025945 Bacteria 28495
689 Ga0207679_10002201 3300025945 Bacteria 12048
690 Ga0207679_10059975 3300025945 Bacteria 2825
691 Ga0207679_10066731 3300025945 Bacteria 2697
692 Ga0207679_10080635 3300025945 Bacteria 2485
693 Ga0207679_10109890 3300025945 Bacteria 2174
694 Ga0207667_10000004 3300025949 Bacteria 737718
695 Ga0207667_10008339 3300025949 Bacteria 12323
696 Ga0207667_10021603 3300025949 Bacteria 7131
697 Ga0207667_10022820 3300025949 Bacteria 6902
698 Ga0207667_10033932 3300025949 Bacteria 5482
699 Ga0207667_10034011 3300025949 Bacteria 5476
700 Ga0207667_10040609 3300025949 Bacteria 4954
701 Ga0207667_10040979 3300025949 Bacteria 4929
702 Ga0207667_10044832 3300025949 Bacteria 4685
703 Ga0207667_10059242 3300025949 Bacteria 4011
704 Ga0207667_10069695 3300025949 Bacteria 3660
705 Ga0207667_10110302 3300025949 Bacteria 2838
706 Ga0207667_10116974 3300025949 Bacteria 2747
707 Ga0207667_10125432 3300025949 Bacteria 2644
708 Ga0207667_10156384 3300025949 Bacteria 2345
709 Ga0207667_10186977 3300025949 Bacteria 2126
710 Ga0207667_10194990 3300025949 Bacteria 2078
711 Ga0207651_10000404 3300025960 Bacteria 18252
712 Ga0207651_10002467 3300025960 Bacteria 8824
713 Ga0207651_10009540 3300025960 Bacteria 5322
714 Ga0207651_10030614 3300025960 Bacteria 3429
715 Ga0207651_10032970 3300025960 Bacteria 3334
716 Ga0207651_10039102 3300025960 Bacteria 3125
717 Ga0207651_10067526 3300025960 Bacteria 2517
718 Ga0207712_10000001 3300025961 Bacteria 750309
719 Ga0207712_10000015 3300025961 Bacteria 346689
720 Ga0207712_10002737 3300025961 Bacteria 11266
721 Ga0207712_10005214 3300025961 Bacteria 8223
722 Ga0207668_10000020 3300025972 Bacteria 140737
723 Ga0207668_10000060 3300025972 Bacteria 89732
724 Ga0207668_10000155 3300025972 Bacteria 47429
725 Ga0207668_10000305 3300025972 Bacteria 32148
726 Ga0207668_10006027 3300025972 Bacteria 7146
727 Ga0207668_10036801 3300025972 Bacteria 3270
728 Ga0207640_10001085 3300025981 Bacteria 15058
729 Ga0207640_10004706 3300025981 Bacteria 7412
730 Ga0207640_10005109 3300025981 Bacteria 7135
731 Ga0207640_10006471 3300025981 Bacteria 6430
732 Ga0207640_10010409 3300025981 Bacteria 5241
733 Ga0207640_10026460 3300025981 Bacteria 3523
734 Ga0207640_10035054 3300025981 Bacteria 3137
735 Ga0207640_10077088 3300025981 Bacteria 2265
736 Ga0207640_10193605 3300025981 Bacteria 1534
737 Ga0207658_10000068 3300025986 Bacteria 113745
738 Ga0207658_10000145 3300025986 Bacteria 74256
739 Ga0207658_10002100 3300025986 Bacteria 14811
740 Ga0207658_10002200 3300025986 Bacteria 14476
741 Ga0207658_10003431 3300025986 Bacteria 11220
742 Ga0207658_10005378 3300025986 Bacteria 8791
743 Ga0207658_10009238 3300025986 Bacteria 6685
744 Ga0207658_10009590 3300025986 Bacteria 6569
745 Ga0207658_10011898 3300025986 Bacteria 5932
746 Ga0207658_10015373 3300025986 Bacteria 5250
747 Ga0207658_10018442 3300025986 Bacteria 4818
748 Ga0207658_10019169 3300025986 Bacteria 4730
749 Ga0207658_10024468 3300025986 Bacteria 4226
750 Ga0207658_10055464 3300025986 Bacteria 2936
751 Ga0207658_10078251 3300025986 Bacteria 2526
752 Ga0207677_10000013 3300026023 Bacteria 186519
753 Ga0207677_10016073 3300026023 Bacteria 4422
754 Ga0207677_10021800 3300026023 Bacteria 3923
755 Ga0207677_10024073 3300026023 Bacteria 3776
756 Ga0207677_10051929 3300026023 Bacteria 2782
757 Ga0207677_10161744 3300026023 Bacteria 1740
758 Ga0207703_10000749 3300026035 Bacteria 32046
759 Ga0207703_10000782 3300026035 Bacteria 31303
760 Ga0207703_10001417 3300026035 Bacteria 21851
761 Ga0207703_10005610 3300026035 Bacteria 10075
762 Ga0207703_10006776 3300026035 Bacteria 9135
763 Ga0207703_10010097 3300026035 Bacteria 7399
764 Ga0207703_10011862 3300026035 Bacteria 6785
765 Ga0207703_10047440 3300026035 Bacteria 3463
766 Ga0207639_10000410 3300026041 Bacteria 29670
767 Ga0207639_10001534 3300026041 Bacteria 15510
768 Ga0207639_10002085 3300026041 Bacteria 13453
769 Ga0207639_10041154 3300026041 Bacteria 3455
770 Ga0207639_10047650 3300026041 Bacteria 3240
771 Ga0207639_10065980 3300026041 Bacteria 2811
772 Ga0207639_10071303 3300026041 Bacteria 2717
773 Ga0207639_10073643 3300026041 Bacteria 2678
774 Ga0207678_10005620 3300026067 Bacteria 11213
775 Ga0207678_10014829 3300026067 Bacteria 6856
776 Ga0207678_10034597 3300026067 Bacteria 4400
777 Ga0207678_10070293 3300026067 Bacteria 3002
778 Ga0207678_10098815 3300026067 Bacteria 2493
779 Ga0207678_10153613 3300026067 Bacteria 1965
780 Ga0207678_10177912 3300026067 Bacteria 1817
781 Ga0207702_10001312 3300026078 Bacteria 24920
782 Ga0207702_10007346 3300026078 Bacteria 9412
783 Ga0207702_10008337 3300026078 Bacteria 8750
784 Ga0207702_10022992 3300026078 Bacteria 5171
785 Ga0207702_10026718 3300026078 Bacteria 4793
786 Ga0207702_10047236 3300026078 Bacteria 3627
787 Ga0207702_10071014 3300026078 Bacteria 2996
788 Ga0207702_10073798 3300026078 Bacteria 2943
789 Ga0207702_10089035 3300026078 Bacteria 2698
790 Ga0207702_10100179 3300026078 Bacteria 2555
791 Ga0207702_10280017 3300026078 Bacteria 1576
792 Ga0207641_10000001 3300026088 Bacteria 1180841
793 Ga0207641_10000002 3300026088 Bacteria 981004
794 Ga0207641_10000035 3300026088 Bacteria 214358
795 Ga0207641_10000074 3300026088 Bacteria 145908
796 Ga0207641_10000288 3300026088 Bacteria 63229
797 Ga0207641_10000534 3300026088 Bacteria 42657
798 Ga0207641_10000657 3300026088 Bacteria 37717
799 Ga0207641_10002010 3300026088 Bacteria 19383
800 Ga0207641_10003413 3300026088 Bacteria 14074
801 Ga0207641_10004716 3300026088 Bacteria 11757
802 Ga0207641_10013361 3300026088 Bacteria 6733
803 Ga0207641_10016475 3300026088 Bacteria 6052
804 Ga0207641_10031019 3300026088 Bacteria 4431
805 Ga0207641_10045478 3300026088 Bacteria 3696
806 Ga0207648_10028512 3300026089 Bacteria 4949
807 Ga0207648_10041080 3300026089 Bacteria 4062
808 Ga0207648_10041280 3300026089 Bacteria 4052
809 Ga0207648_10050131 3300026089 Bacteria 3651
810 Ga0207648_10229113 3300026089 Bacteria 1653
811 Ga0207676_10000005 3300026095 Bacteria 698744
812 Ga0207676_10000034 3300026095 Bacteria 206058
813 Ga0207676_10000635 3300026095 Bacteria 28333
814 Ga0207676_10001250 3300026095 Bacteria 18918
815 Ga0207676_10001911 3300026095 Bacteria 15217
816 Ga0207676_10009084 3300026095 Bacteria 7077
817 Ga0207676_10015241 3300026095 Bacteria 5543
818 Ga0207676_10027753 3300026095 Bacteria 4220
819 Ga0207676_10036672 3300026095 Bacteria 3732
820 Ga0207674_10000345 3300026116 Bacteria 59803
821 Ga0207674_10001571 3300026116 Bacteria 29407
822 Ga0207674_10006314 3300026116 Bacteria 13968
823 Ga0207674_10007097 3300026116 Bacteria 13089
824 Ga0207674_10012272 3300026116 Bacteria 9583
825 Ga0207674_10013213 3300026116 Bacteria 9182
826 Ga0207674_10016212 3300026116 Bacteria 8161
827 Ga0207674_10024062 3300026116 Bacteria 6514
828 Ga0207674_10044498 3300026116 Bacteria 4572
829 Ga0207674_10068710 3300026116 Bacteria 3565
830 Ga0207674_10084315 3300026116 Bacteria 3176
831 Ga0207675_100000035 3300026118 Bacteria 95190
832 Ga0207675_100000679 3300026118 Bacteria 33420
833 Ga0207675_100108643 3300026118 Bacteria 2616
834 Ga0207683_10014018 3300026121 Bacteria 6834
835 Ga0207683_10017542 3300026121 Bacteria 6102
836 Ga0207698_10000193 3300026142 Bacteria 38052
837 Ga0207698_10001539 3300026142 Bacteria 13438
838 Ga0207698_10003445 3300026142 Bacteria 9525
839 Ga0207698_10019103 3300026142 Bacteria 4683
840 Ga0207698_10019413 3300026142 Bacteria 4653
841 Ga0207698_10021481 3300026142 Bacteria 4465
842 Ga0207698_10030136 3300026142 Bacteria 3897
843 Ga0207698_10090961 3300026142 Bacteria 2497
844 Ga0207698_10146373 3300026142 Bacteria 2044
845 Ga0207698_10176858 3300026142 Bacteria 1886
846 Ga0209813_10000053 3300027866 Bacteria 47000
847 Ga0209813_10000101 3300027866 Bacteria 31896
848 Ga0209974_10016584 3300027876 Bacteria 2446
849 Ga0209974_10035657 3300027876 Bacteria 1652
850 Ga0207428_10135232 3300027907 Bacteria 1885
851 Ga0268266_10000002 3300028379 Bacteria 3059047
852 Ga0268266_10000042 3300028379 Bacteria 316826
853 Ga0268266_10000133 3300028379 Bacteria 143210
854 Ga0268266_10000471 3300028379 Bacteria 58314
855 Ga0268266_10000518 3300028379 Bacteria 54434
856 Ga0268266_10001119 3300028379 Bacteria 33470
857 Ga0268266_10004895 3300028379 Bacteria 12705
858 Ga0268266_10007465 3300028379 Bacteria 9860
859 Ga0268266_10014556 3300028379 Bacteria 6759
860 Ga0268266_10014590 3300028379 Bacteria 6751
861 Ga0268266_10050327 3300028379 Bacteria 3574
862 Ga0268266_10060485 3300028379 Bacteria 3266
863 Ga0268265_10000003 3300028380 Bacteria 949201
864 Ga0268265_10000021 3300028380 Bacteria 272292
865 Ga0268265_10000052 3300028380 Bacteria 174254
866 Ga0268265_10000190 3300028380 Bacteria 72600
867 Ga0268265_10000497 3300028380 Bacteria 40721
868 Ga0268265_10001936 3300028380 Bacteria 16421
869 Ga0268265_10009185 3300028380 Bacteria 6681
870 Ga0268265_10049838 3300028380 Bacteria 3151
871 Ga0268265_10057140 3300028380 Bacteria 2972
872 Ga0268265_10106244 3300028380 Bacteria 2280
873 Ga0268265_10145874 3300028380 Bacteria 1988
874 Ga0268264_10000006 3300028381 Bacteria 827324
875 Ga0268264_10000010 3300028381 Bacteria 596543
876 Ga0268264_10000039 3300028381 Bacteria 376641
877 Ga0268264_10000077 3300028381 Bacteria 252597
878 Ga0268264_10000395 3300028381 Bacteria 62904
879 Ga0268264_10002869 3300028381 Bacteria 15002
880 Ga0268264_10003049 3300028381 Bacteria 14517
881 Ga0268264_10008769 3300028381 Bacteria 8389
882 Ga0268264_10030190 3300028381 Bacteria 4444
883 Ga0268264_10125457 3300028381 Bacteria 2268
884 Ga0268264_10252785 3300028381 Bacteria 1638
885 Ga0307517_10042424 3300028786 Bacteria 4879
886 Ga0265331_10010745 3300031250 Bacteria 5042
887 Ga0307408_100022473 3300031548 Bacteria 4286
888 Ga0307408_100026447 3300031548 Bacteria 3986
889 Ga0307408_100029746 3300031548 Bacteria 3787
890 Ga0307408_100039543 3300031548 Bacteria 3335
891 Ga0307408_100054861 3300031548 Bacteria 2883
892 Ga0307508_10025276 3300031616 Bacteria 5385
893 Ga0307405_10000513 3300031731 Bacteria 14592
894 Ga0307405_10002170 3300031731 Bacteria 8571
895 Ga0307405_10055012 3300031731 Bacteria 2488
896 Ga0307413_10006516 3300031824 Bacteria 5343
897 Ga0307413_10008583 3300031824 Bacteria 4837
898 Ga0307413_10010486 3300031824 Bacteria 4498
899 Ga0307413_10024309 3300031824 Bacteria 3301
900 Ga0307413_10026001 3300031824 Bacteria 3220
901 Ga0307413_10044725 3300031824 Bacteria 2619
902 Ga0307413_10049522 3300031824 Bacteria 2518
903 Ga0307413_10060419 3300031824 Bacteria 2333
904 Ga0307413_10076418 3300031824 Bacteria 2128
905 Ga0307413_10091445 3300031824 Bacteria 1982
906 Ga0307413_10162095 3300031824 Bacteria 1572
907 Ga0307413_10185824 3300031824 Bacteria 1487
908 Ga0307410_10001447 3300031852 Bacteria 10712
909 Ga0307410_10013550 3300031852 Bacteria 4761
910 Ga0307410_10015447 3300031852 Bacteria 4529
911 Ga0307410_10016353 3300031852 Bacteria 4424
912 Ga0307410_10022994 3300031852 Bacteria 3865
913 Ga0307410_10026204 3300031852 Bacteria 3667
914 Ga0307410_10033588 3300031852 Bacteria 3313
915 Ga0307410_10079469 3300031852 Bacteria 2298
916 Ga0307410_10082237 3300031852 Bacteria 2265
917 Ga0307406_10009112 3300031901 Bacteria 5555
918 Ga0307406_10011820 3300031901 Bacteria 4959
919 Ga0307406_10029678 3300031901 Bacteria 3313
920 Ga0307406_10075630 3300031901 Bacteria 2222
921 Ga0307407_10002499 3300031903 Bacteria 7221
922 Ga0307407_10006203 3300031903 Bacteria 5283
923 Ga0307407_10024640 3300031903 Bacteria 3158
924 Ga0307407_10039731 3300031903 Bacteria 2618
925 Ga0307407_10048941 3300031903 Bacteria 2409
926 Ga0307412_10001044 3300031911 Bacteria 15823
927 Ga0307412_10002460 3300031911 Bacteria 10300
928 Ga0307412_10016615 3300031911 Bacteria 4389
929 Ga0307412_10041680 3300031911 Bacteria 2977
930 Ga0307412_10088807 3300031911 Bacteria 2157
931 Ga0307412_10100081 3300031911 Bacteria 2048
932 Ga0307412_10123010 3300031911 Bacteria 1871
933 Ga0307412_10130554 3300031911 Bacteria 1824
934 Ga0307409_100007774 3300031995 Bacteria 6447
935 Ga0307409_100014611 3300031995 Bacteria 5116
936 Ga0307409_100016234 3300031995 Bacteria 4919
937 Ga0307409_100028691 3300031995 Bacteria 3969
938 Ga0307409_100060421 3300031995 Bacteria 2955
939 Ga0307409_100139814 3300031995 Bacteria 2084
940 Ga0307409_100156493 3300031995 Bacteria 1986
941 Ga0307409_100194771 3300031995 Bacteria 1807
942 Ga0307409_100211166 3300031995 Bacteria 1744
943 Ga0307409_100245034 3300031995 Bacteria 1634
944 Ga0307409_100266369 3300031995 Bacteria 1576
945 Ga0307416_100018305 3300032002 Bacteria 4931
946 Ga0307416_100024489 3300032002 Bacteria 4407
947 Ga0307416_100037974 3300032002 Bacteria 3711
948 Ga0307416_100046355 3300032002 Bacteria 3430
949 Ga0307416_100062508 3300032002 Bacteria 3045
950 Ga0307416_100066937 3300032002 Bacteria 2960
951 Ga0307414_10000144 3300032004 Bacteria 48442
952 Ga0307414_10000696 3300032004 Bacteria 17248
953 Ga0307414_10001388 3300032004 Bacteria 12548
954 Ga0307414_10007509 3300032004 Bacteria 6126
955 Ga0307414_10042492 3300032004 Bacteria 3089
956 Ga0307414_10045286 3300032004 Bacteria 3012
957 Ga0307414_10053424 3300032004 Bacteria 2817
958 Ga0307414_10057484 3300032004 Bacteria 2734
959 Ga0307414_10065753 3300032004 Bacteria 2588
960 Ga0307414_10067903 3300032004 Bacteria 2556
961 Ga0307414_10095468 3300032004 Bacteria 2222
962 Ga0307414_10104996 3300032004 Bacteria 2135
963 Ga0307414_10137489 3300032004 Bacteria 1907
964 Ga0307414_10198107 3300032004 Bacteria 1631
965 Ga0307411_10001019 3300032005 Bacteria 10822
966 Ga0307411_10010141 3300032005 Bacteria 5004
967 Ga0307411_10011253 3300032005 Bacteria 4817
968 Ga0307411_10030652 3300032005 Bacteria 3299
969 Ga0307411_10053001 3300032005 Bacteria 2655
970 Ga0307411_10116783 3300032005 Bacteria 1921
971 Ga0307415_100006146 3300032126 Bacteria 6443
972 Ga0307415_100015744 3300032126 Bacteria 4489
973 Ga0307415_100031406 3300032126 Bacteria 3421
974 Ga0307415_100034485 3300032126 Bacteria 3296
975 Ga0307415_100035995 3300032126 Bacteria 3239
976 Ga0307415_100231788 3300032126 Bacteria 1487
977 Ga0316583_10001679 3300032133 Bacteria 7508
978 Ga0307510_10009032 3300033180 Bacteria 11869
979 Ga0307510_10118929 3300033180 Bacteria 2354
980 Ga0373930_0012330 3300034816 Bacteria 1558
981 Ga0373954_0014927 3300035118 Bacteria 3467
982 Ga0373956_0052172 3300035119 Bacteria 1839
983 Ga0373955_0008899 3300035172 Bacteria 4681
984 Ga0373931_0009005 3300035691 Bacteria 4759
985 Ga0373931_0026766 3300035691 Bacteria 2939
986 Ga0373933_0010147 3300035724 Bacteria 5157
987 Ga0373947_0044027 3300035725 Bacteria 2667
988 Ga0373937_0002661 3300036401 Bacteria 14891
989 Ga0316582_0007879 3300036647 Bacteria 5691
990 Ga0316584_0078473 3300036712 Bacteria 2473
991 Ga0373925_0116526 3300037068 Bacteria 2069
992 Ga0395899_0000885 3300037312 Bacteria 28458
993 Ga0395899_0000911 3300037312 Bacteria 27806
994 Ga0395899_0002729 3300037312 Bacteria 14234
995 Ga0395899_0002824 3300037312 Bacteria 13993
996 Ga0395899_0007534 3300037312 Bacteria 8410
997 Ga0395899_0013558 3300037312 Bacteria 6230
998 Ga0395899_0015775 3300037312 Bacteria 5761
999 Ga0395899_0050069 3300037312 Bacteria 3102
1000 Ga0395899_0056270 3300037312 Bacteria 2907
1001 Ga0395899_0064532 3300037312 Bacteria 2692
1002 Ga0395899_0088951 3300037312 Bacteria 2240
1003 Ga0395899_0120497 3300037312 Bacteria 1879
1004 Ga0395899_0121383 3300037312 Bacteria 1871
1005 Ga0395900_0000031 3300037418 Bacteria 262393
1006 Ga0395900_0000667 3300037418 Bacteria 45770
1007 Ga0395900_0006624 3300037418 Bacteria 12053
1008 Ga0395900_0008073 3300037418 Bacteria 10835
1009 Ga0395900_0008821 3300037418 Bacteria 10357
1010 Ga0395900_0018968 3300037418 Bacteria 7016
1011 Ga0395900_0019626 3300037418 Bacteria 6892
1012 Ga0395900_0020751 3300037418 Bacteria 6715
1013 Ga0395900_0023644 3300037418 Bacteria 6286
1014 Ga0395900_0030043 3300037418 Bacteria 5577
1015 Ga0395900_0054396 3300037418 Bacteria 4122
1016 Ga0395900_0058500 3300037418 Bacteria 3968
1017 Ga0395900_0060079 3300037418 Bacteria 3912
1018 Ga0395900_0104607 3300037418 Bacteria 2908
1019 Ga0395900_0105956 3300037418 Bacteria 2888
1020 Ga0395900_0133393 3300037418 Bacteria 2544
1021 Ga0395900_0145729 3300037418 Bacteria 2421
1022 Ga0395900_0157307 3300037418 Bacteria 2320
1023 Ga0395900_0162662 3300037418 Bacteria 2276
1024 Ga0395900_0191614 3300037418 Bacteria 2073
1025 Ga0395900_0233096 3300037418 Bacteria 1850
1026 Ga0395900_0359317 3300037418 Bacteria 1428
1027 Ga0395900_0408689 3300037418 Bacteria 1320
1028 Ga0395898_0001423 3300037466 Bacteria 34055
1029 Ga0395898_0006934 3300037466 Bacteria 12042
1030 Ga0395898_0007436 3300037466 Bacteria 11624
1031 Ga0395898_0025383 3300037466 Bacteria 5972
1032 Ga0395898_0063274 3300037466 Bacteria 3590
1033 Ga0395898_0069463 3300037466 Bacteria 3408
1034 Ga0395898_0074670 3300037466 Bacteria 3275
1035 Ga0395898_0102746 3300037466 Bacteria 2743
1036 Ga0395898_0161725 3300037466 Bacteria 2141
1037 Ga0395898_0185383 3300037466 Bacteria 1988
1038 Ga0395898_0252319 3300037466 Bacteria 1682
1039 Ga0395905_0000193 3300037471 Bacteria 96667
1040 Ga0395905_0000458 3300037471 Bacteria 57029
1041 Ga0395905_0000546 3300037471 Bacteria 51378
1042 Ga0395905_0001063 3300037471 Bacteria 34650
1043 Ga0395905_0003104 3300037471 Bacteria 17940
1044 Ga0395905_0004408 3300037471 Bacteria 14640
1045 Ga0395905_0004878 3300037471 Bacteria 13825
1046 Ga0395905_0007856 3300037471 Bacteria 10566
1047 Ga0395905_0008684 3300037471 Bacteria 10005
1048 Ga0395905_0018797 3300037471 Bacteria 6554
1049 Ga0395905_0020585 3300037471 Bacteria 6246
1050 Ga0395905_0048859 3300037471 Bacteria 3963
1051 Ga0395905_0059018 3300037471 Bacteria 3587
1052 Ga0395905_0064849 3300037471 Bacteria 3419
1053 Ga0395905_0070857 3300037471 Bacteria 3267
1054 Ga0395905_0080260 3300037471 Bacteria 3057
1055 Ga0395905_0082712 3300037471 Bacteria 3008
1056 Ga0395905_0083807 3300037471 Bacteria 2986
1057 Ga0395905_0091506 3300037471 Bacteria 2852
1058 Ga0395905_0095211 3300037471 Bacteria 2794
1059 Ga0395905_0096687 3300037471 Bacteria 2772
1060 Ga0395905_0101887 3300037471 Bacteria 2695
1061 Ga0395905_0103197 3300037471 Bacteria 2677
1062 Ga0395905_0104697 3300037471 Bacteria 2656
1063 Ga0395905_0130160 3300037471 Bacteria 2367
1064 Ga0395905_0138896 3300037471 Bacteria 2286
1065 Ga0395905_0180007 3300037471 Bacteria 1984
1066 Ga0395905_0182158 3300037471 Bacteria 1972
1067 Ga0395905_0222956 3300037471 Bacteria 1764
1068 Ga0395905_0232532 3300037471 Bacteria 1724
1069 Ga0395905_0352345 3300037471 Bacteria 1364
1070 Ga0395905_0391071 3300037471 Bacteria 1285
1071 Ga0436364_0351684 3300037853 Bacteria 5477
1072 Ga0436364_0868202 3300037853 Bacteria 1457
1073 Ga0436364_0986946 3300037853 Bacteria 208509
1074 Ga0395901_0000035 3300038443 Bacteria 223888
1075 Ga0395901_0000329 3300038443 Bacteria 58460
1076 Ga0395901_0000447 3300038443 Bacteria 47979
1077 Ga0395901_0000681 3300038443 Bacteria 39074
1078 Ga0395901_0002236 3300038443 Bacteria 19743
1079 Ga0395901_0006446 3300038443 Bacteria 11891
1080 Ga0395901_0006751 3300038443 Bacteria 11588
1081 Ga0395901_0011421 3300038443 Bacteria 8996
1082 Ga0395901_0030266 3300038443 Bacteria 5577
1083 Ga0395901_0041623 3300038443 Bacteria 4762
1084 Ga0395901_0047555 3300038443 Bacteria 4454
1085 Ga0395901_0060749 3300038443 Bacteria 3933
1086 Ga0395901_0108836 3300038443 Bacteria 2909
1087 Ga0395901_0131677 3300038443 Bacteria 2628
1088 Ga0395901_0134678 3300038443 Bacteria 2596
1089 Ga0395901_0188606 3300038443 Bacteria 2162
1090 Ga0395901_0296631 3300038443 Bacteria 1676
1091 Ga0395901_0301219 3300038443 Bacteria 1662
1092 Ga0395901_0339351 3300038443 Bacteria 1552
1093 Ga0237819_01972 3300038705 Bacteria 4621
1094 Ga0436365_0304676 3300039437 Bacteria 2215
1095 Ga0436365_0401005 3300039437 Bacteria 54951
1096 Ga0436365_1229825 3300039437 Bacteria 2091
1097 Ga0436365_1881943 3300039437 Bacteria 6674
1098 Ga0436360_0901768 3300039438 Bacteria 1499
1099 Ga0436361_0281517 3300039447 Bacteria 2155
1100 Ga0436361_0359771 3300039447 Bacteria 1918
1101 Ga0436363_0898552 3300039450 Bacteria 1466
1102 Ga0436362_1061615 3300039453 Bacteria 22504
1103 Ga0439465_0006644 3300041413 Bacteria 3673
1104 Ga0439465_0008077 3300041413 Bacteria 3327
1105 Ga0439445_0007539 3300042004 Bacteria 2527
1106 Ga0439445_0010981 3300042004 Bacteria 2151
1107 Ga0450907_001444 3300042146 Bacteria 5141
1108 Ga0439458_0001118 3300042157 Bacteria 6813
1109 Ga0439458_0009956 3300042157 Bacteria 2117
1110 Ga0466969_0003922 3300044656 Bacteria 7899
1111 Ga0466966_0000003 3300044684 Bacteria 233677
1112 Ga0466966_0000732 3300044684 Bacteria 20858
1113 Ga0466966_0037542 3300044684 Bacteria 3123
1114 Ga0466961_0011805 3300044693 Bacteria 5583
1115 Ga0466961_0041104 3300044693 Bacteria 2964
1116 Ga0466961_0105051 3300044693 Bacteria 1778
1117 Ga0466961_0146928 3300044693 Bacteria 1474
1118 Ga0466961_0182124 3300044693 Bacteria 1304
1119 Ga0466963_0002990 3300044694 Bacteria 9560
1120 Ga0466963_0017280 3300044694 Bacteria 4495
1121 Ga0466963_0039115 3300044694 Bacteria 3105
1122 Ga0466963_0043353 3300044694 Bacteria 2957
1123 Ga0466963_0082029 3300044694 Bacteria 2185
1124 Ga0466963_0137194 3300044694 Bacteria 1693
1125 Ga0466971_0000835 3300044719 Bacteria 12510
1126 Ga0466968_0029949 3300044735 Bacteria 2253
1127 Ga0466968_0039389 3300044735 Bacteria 1989
1128 Ga0466970_0003735 3300044765 Bacteria 7443
1129 Ga0466970_0035274 3300044765 Bacteria 2650
1130 Ga0466957_0002580 3300044842 Bacteria 9753
1131 Ga0466957_0004623 3300044842 Bacteria 7690
1132 Ga0466957_0045646 3300044842 Bacteria 2658
1133 Ga0466959_0001663 3300045049 Bacteria 13771
1134 Ga0466959_0117435 3300045049 Bacteria 1894
1135 Ga0466958_0000245 3300045836 Bacteria 20911
1136 Ga0466958_0018446 3300045836 Bacteria 4049
1137 Ga0466958_0156392 3300045836 Bacteria 1439
1138 Ga0466967_0006643 3300045976 Bacteria 8221
1139 Ga0466967_0022023 3300045976 Bacteria 5190
1140 Ga0466967_0201151 3300045976 Bacteria 1887
1141 Ga0466967_0249478 3300045976 Bacteria 1695
1142 Ga0466967_0253032 3300045976 Bacteria 1683
1143 Ga0466967_0276158 3300045976 Bacteria 1611
1144 Ga0495627_001619 3300046453 Bacteria 12583
1145 Ga0495638_0000018 3300046460 Bacteria 389696
1146 Ga0495638_0004781 3300046460 Bacteria 10216
1147 Ga0495650_0004591 3300046471 Bacteria 9387
1148 Ga0495583_0000426 3300046506 Bacteria 63627
1149 Ga0495583_0010186 3300046506 Bacteria 5516
1150 Ga0495610_0000042 3300046512 Bacteria 158665
1151 Ga0495616_0032459 3300046513 Bacteria 2727
1152 Ga0495620_0092765 3300046515 Bacteria 1210
1153 Ga0495632_0000049 3300046519 Bacteria 134597
1154 Ga0495637_0003069 3300046520 Bacteria 8917
1155 Ga0495643_0000061 3300046522 Bacteria 185933
1156 Ga0495643_0009493 3300046522 Bacteria 6043
1157 Ga0495643_0025298 3300046522 Bacteria 3360
1158 Ga0495643_0043999 3300046522 Bacteria 2427
1159 Ga0495648_0000018 3300046524 Bacteria 282490
1160 Ga0495648_0000439 3300046524 Bacteria 45123
1161 Ga0495663_0000009 3300046525 Bacteria 256308
1162 Ga0495642_0068619 3300046528 Bacteria 1480
1163 Ga0495598_0001030 3300046537 Bacteria 5343
1164 Ga0495598_0005097 3300046537 Bacteria 2891
1165 Ga0495621_0000301 3300046539 Bacteria 11902
1166 Ga0495621_0000483 3300046539 Bacteria 9802
1167 Ga0495621_0000995 3300046539 Bacteria 7260
1168 Ga0495633_0000862 3300046558 Bacteria 26407
1169 Ga0495633_0002648 3300046558 Bacteria 12461
1170 Ga0495668_0000001 3300046616 Bacteria 1013420
1171 Ga0495668_0000007 3300046616 Bacteria 552902
1172 Ga0495625_0000362 3300046660 Bacteria 69497
1173 Ga0495625_0000583 3300046660 Bacteria 53056
1174 Ga0495625_0076150 3300046660 Bacteria 2346
1175 Ga0495669_0011145 3300046684 Bacteria 3810
1176 Ga0495669_0048701 3300046684 Bacteria 1896
1177 Ga0495671_0000011 3300046692 Bacteria 365582
1178 Ga0495671_0000036 3300046692 Bacteria 181192
1179 Ga0495600_0128811 3300046809 Bacteria 1645
1180 Ga0495687_000224 3300047443 Bacteria 79719
1181 Ga0495687_004697 3300047443 Bacteria 9085
1182 Ga0495673_0000013 3300047469 Bacteria 612902
1183 Ga0495673_0060404 3300047469 Bacteria 1626
1184 Ga0495681_0000006 3300047470 Bacteria 221565
1185 Ga0495686_0000120 3300047472 Bacteria 164638
1186 Ga0495686_0008764 3300047472 Bacteria 7373
1187 Ga0496100_0008703 3300048903 Bacteria 5671
1188 Ga0496101_0092061 3300048904 Bacteria 2257
1189 Ga0496102_0000043 3300048905 Bacteria 189201
1190 Ga0496102_0000704 3300048905 Bacteria 33120
1191 Ga0496102_0004690 3300048905 Bacteria 11564
1192 Ga0496102_0014028 3300048905 Bacteria 6958
1193 Ga0496103_0000086 3300048906 Bacteria 104765
1194 Ga0496103_0011230 3300048906 Bacteria 5304
1195 Ga0496103_0025039 3300048906 Bacteria 3604
1196 Ga0496103_0170545 3300048906 Bacteria 1397
1197 Ga0496104_0000345 3300048907 Bacteria 41448
1198 Ga0496105_0000372 3300048908 Bacteria 29640
1199 Ga0496105_0012699 3300048908 Bacteria 6670
1200 Ga0496106_0002579 3300048909 Bacteria 13494
1201 Ga0496106_0047931 3300048909 Bacteria 3217
1202 Ga0496106_0072157 3300048909 Bacteria 2640
1203 Ga0496107_0005607 3300048910 Bacteria 8598
1204 Ga0496107_0007167 3300048910 Bacteria 7683
1205 Ga0496107_0048046 3300048910 Bacteria 3073
1206 Ga0496107_0111244 3300048910 Bacteria 2013
1207 Ga0496108_0002842 3300048911 Bacteria 13904
1208 Ga0496108_0004161 3300048911 Bacteria 11641
1209 Ga0496108_0014571 3300048911 Bacteria 6417
1210 Ga0496108_0024312 3300048911 Bacteria 4986
1211 Ga0496108_0077670 3300048911 Bacteria 2809
1212 Ga0496109_0002390 3300048912 Bacteria 15690
1213 Ga0496109_0006017 3300048912 Bacteria 10190
1214 Ga0496109_0016069 3300048912 Bacteria 6540
1215 Ga0496109_0066955 3300048912 Bacteria 3289
1216 Ga0496110_0001980 3300048913 Bacteria 15237
1217 Ga0496110_0004761 3300048913 Bacteria 10570
1218 Ga0496110_0005147 3300048913 Bacteria 10219
1219 Ga0496110_0019463 3300048913 Bacteria 5714
1220 Ga0496110_0046648 3300048913 Bacteria 3791
1221 Ga0496110_0164207 3300048913 Bacteria 2013
1222 Ga0496111_0007943 3300048914 Bacteria 6996
1223 Ga0496111_0058187 3300048914 Bacteria 2798
1224 Ga0496111_0075507 3300048914 Bacteria 2456
1225 Ga0496112_0004311 3300048915 Bacteria 12022
1226 Ga0496112_0011382 3300048915 Bacteria 8122
1227 Ga0496112_0024319 3300048915 Bacteria 5798
1228 Ga0496112_0065060 3300048915 Bacteria 3598
1229 Ga0496112_0070443 3300048915 Bacteria 3456
1230 Ga0496112_0088605 3300048915 Bacteria 3062
1231 Ga0496112_0127901 3300048915 Bacteria 2511
1232 Ga0496113_0025789 3300048916 Bacteria 4195
1233 Ga0496113_0029425 3300048916 Bacteria 3966
1234 Ga0496113_0029700 3300048916 Bacteria 3951
1235 Ga0496113_0034457 3300048916 Bacteria 3694
1236 Ga0496113_0058205 3300048916 Bacteria 2907
1237 Ga0496113_0091954 3300048916 Bacteria 2339
1238 Ga0496113_0155503 3300048916 Bacteria 1805
1239 Ga0496114_0000130 3300048917 Bacteria 54437
1240 Ga0496114_0001341 3300048917 Bacteria 18657
1241 Ga0496114_0056260 3300048917 Bacteria 3282
1242 Ga0496114_0169511 3300048917 Bacteria 1902
1243 Ga0496115_0000571 3300048918 Bacteria 28486
1244 Ga0496115_0003486 3300048918 Bacteria 11310
1245 Ga0496116_0000039 3300048919 Bacteria 349134
1246 Ga0496116_0039118 3300048919 Bacteria 3282
1247 Ga0496116_0050677 3300048919 Bacteria 2764
1248 Ga0496117_0000104 3300048920 Bacteria 189201
1249 Ga0496117_0000462 3300048920 Bacteria 67853
1250 Ga0496117_0010593 3300048920 Bacteria 8378
1251 Ga0496117_0023303 3300048920 Bacteria 4939
1252 Ga0496118_0000080 3300048921 Bacteria 189201
1253 Ga0496118_0000125 3300048921 Bacteria 136422
1254 Ga0496118_0003058 3300048921 Bacteria 21506
1255 Ga0496118_0021467 3300048921 Bacteria 5680
1256 Ga0496118_0044167 3300048921 Bacteria 3492
1257 Ga0496119_0000526 3300048922 Bacteria 52112
1258 Ga0496120_0000628 3300048923 Bacteria 52686
1259 Ga0496121_0000237 3300048924 Bacteria 118615
1260 Ga0496121_0000243 3300048924 Bacteria 116698
1261 Ga0496121_0006027 3300048924 Bacteria 15284
1262 Ga0496121_0019995 3300048924 Bacteria 6661
1263 Ga0496121_0049913 3300048924 Bacteria 3541
1264 Ga0496121_0056545 3300048924 Bacteria 3258
1265 Ga0496122_0000532 3300048925 Bacteria 79032
1266 Ga0496122_0009301 3300048925 Bacteria 10387
1267 Ga0496123_0000210 3300048926 Bacteria 118956
1268 Ga0496123_0001181 3300048926 Bacteria 38475
1269 Ga0496123_0002576 3300048926 Bacteria 22062
1270 Ga0496123_0080985 3300048926 Bacteria 1975
1271 Ga0496123_0130932 3300048926 Bacteria 1390
1272 Ga0496124_0000082 3300048927 Bacteria 208248
1273 Ga0496124_0000093 3300048927 Bacteria 189201
1274 Ga0496124_0005897 3300048927 Bacteria 13556
1275 Ga0496124_0022133 3300048927 Bacteria 5834
1276 Ga0496124_0139055 3300048927 Bacteria 1918
1277 Ga0496125_0000828 3300048928 Bacteria 49920
1278 Ga0496125_0012514 3300048928 Bacteria 8416
1279 Ga0496125_0018078 3300048928 Bacteria 6701
1280 Ga0496125_0091026 3300048928 Bacteria 2287
1281 Ga0496125_0123489 3300048928 Bacteria 1840
1282 Ga0496126_0000028 3300048929 Bacteria 394082
1283 Ga0496126_0000041 3300048929 Bacteria 340389
1284 Ga0496126_0001775 3300048929 Bacteria 31900
1285 Ga0496126_0021420 3300048929 Bacteria 6314
1286 Ga0496126_0056776 3300048929 Bacteria 3538
1287 Ga0501033_0012413 3300049570 Bacteria 6502
1288 Ga0501033_0019380 3300049570 Bacteria 5144
1289 Ga0501224_000012 3300049664 Bacteria 92585
1290 Ga0501257_000176 3300049686 Bacteria 12989
1291 Ga0501225_0000019 3300049705 Bacteria 59374
1292 Ga0501079_0144059 3300049741 Bacteria 1857
1293 Ga0501268_004138 3300049765 Bacteria 2029
1294 Ga0501282_000252 3300049778 Bacteria 6473
1295 Ga0501044_0026898 3300049823 Bacteria 6088
1296 Ga0501044_0082505 3300049823 Bacteria 3253
1297 Ga0501226_000384 3300049853 Bacteria 6389
1298 nmdc:mga03683_196_c1 3300050489 Bacteria 19906
1299 nmdc:mga03683_40013_c1 3300050489 Bacteria 1921
1300 nmdc:mga03683_6_c1 3300050489 Bacteria 141493
1301 nmdc:mga03n38_14038_c1 3300050490 Bacteria 3061
1302 nmdc:mga00v17_13923_c1 3300050491 Bacteria 4476
1303 nmdc:mga00v17_3708_c1 3300050491 Bacteria 7896
1304 nmdc:mga0k408_6_c1 3300050493 Bacteria 200443
1305 nmdc:mga06z11_338_c1 3300050494 Bacteria 17799
1306 nmdc:mga04h51_155_c1 3300050495 Bacteria 19454
1307 nmdc:mga04h51_24_c1 3300050495 Bacteria 59995
1308 nmdc:mga07m45_148383_c1 3300050496 Bacteria 1359
1309 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
1310 nmdc:mga07m45_49217_c1 3300050496 Bacteria 2372
1311 nmdc:mga07m45_4_c1 3300050496 Bacteria 409607
1312 nmdc:mga0qj67_24448_c1 3300050509 Bacteria 4656
1313 nmdc:mga0a205_4433_c1 3300050515 Bacteria 12603
1314 nmdc:mga0sz30_2058_c1 3300050516 Bacteria 7187
1315 nmdc:mga0sz30_2624_c1 3300050516 Bacteria 6401
1316 nmdc:mga0sz30_44_c1 3300050516 Bacteria 44851
1317 Ga0500610_0000597 3300053079 Bacteria 11055
1318 Ga0500643_000004 3300053087 Bacteria 857484
1319 Ga0500643_003093 3300053087 Bacteria 8170
1320 Ga0500643_005254 3300053087 Bacteria 5622
1321 Ga0500555_002039 3300053103 Bacteria 5952
1322 Ga0500556_0000040 3300053104 Bacteria 137489
1323 Ga0500592_007223 3300053116 Bacteria 1768
1324 Ga0500618_002450 3300053125 Bacteria 6980
1325 Ga0500642_0000003 3300053130 Bacteria 544899
1326 Ga0500652_000573 3300053131 Bacteria 12839
1327 Ga0500658_0000219 3300053134 Bacteria 27328
1328 Ga0500559_0021762 3300053136 Bacteria 2719
1329 Ga0500568_0004441 3300053139 Bacteria 7496
1330 Ga0500573_0001876 3300053140 Bacteria 10257
1331 Ga0500616_0000128 3300053153 Bacteria 134307
1332 Ga0500624_000001 3300053157 Bacteria 284974
1333 Ga0500625_000003 3300053729 Bacteria 268493
1334 Ga0500645_000009 3300053730 Bacteria 206177
1335 Ga0500645_003206 3300053730 Bacteria 6777
1336 Ga0501082_0006880 3300060353 Bacteria 9836
1337 Ga0466962_0004260 3300061719 Bacteria 6853
1338 Ga0466962_0007496 3300061719 Bacteria 5235
1339 Ga0466962_0030974 3300061719 Bacteria 2561
1340 Ga0466962_0038168 3300061719 Bacteria 2300

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050496 nmdc:mga07m45_148383_c1 nmdc:mga07m45_148383_c1_234_1343 366
2 3300048929 Ga0496126_0021420 Ga0496126_0021420_45_1163 367
3 3300037418 Ga0395900_0233096 Ga0395900_0233096_15_1121 368
4 3300037466 Ga0395898_0252319 Ga0395898_0252319_15_1121 368
5 3300037471 Ga0395905_0103197 Ga0395905_0103197_1549_2655 368
6 3300037471 Ga0395905_0104697 Ga0395905_0104697_1537_2643 368
7 3300037471 Ga0395905_0352345 Ga0395905_0352345_222_1328 368
8 3300038443 Ga0395901_0296631 Ga0395901_0296631_21_1127 368
9 3300046515 Ga0495620_0092765 Ga0495620_0092765_20_1126 368
10 3300048903 Ga0496100_0008703 Ga0496100_0008703_10_1116 368
11 3300048914 Ga0496111_0007943 Ga0496111_0007943_20_1126 368
12 3300048926 Ga0496123_0130932 Ga0496123_0130932_256_1371 368
13 3300037418 Ga0395900_0408689 Ga0395900_0408689_184_1305 373
14 3300037471 Ga0395905_0391071 Ga0395905_0391071_20_1141 373
15 3300044693 Ga0466961_0182124 Ga0466961_0182124_10_1131 373
16 3300026078 Ga0207702_10047236 Ga0207702_100472363 396
17 3300037068 Ga0373925_0116526 Ga0373925_0116526_32_1237 401
18 3300037471 Ga0395905_0180007 Ga0395905_0180007_755_1960 401
19 3300044694 Ga0466963_0137194 Ga0466963_0137194_478_1683 401
20 3300048928 Ga0496125_0091026 Ga0496125_0091026_10_1239 406
21 3300005937 Ga0081455_10028171 Ga0081455_100281715 409
22 3300038705 Ga0237819_01972 Ga0237819_01972_956_2251 417
23 3300046513 Ga0495616_0032459 Ga0495616_0032459_980_2314 418
24 3300053131 Ga0500652_000573 Ga0500652_000573_3451_4731 422
25 3300049741 Ga0501079_0144059 Ga0501079_0144059_246_1526 423
26 3300005937 Ga0081455_10019320 Ga0081455_100193204 424
27 3300005985 Ga0081539_10006627 Ga0081539_100066277 424
28 3300006353 Ga0075370_10024666 Ga0075370_100246662 424
29 3300039447 Ga0436361_0281517 Ga0436361_0281517_107_1390 424
30 3300050489 nmdc:mga03683_40013_c1 nmdc:mga03683_40013_c1_237_1520 424
31 3300050496 nmdc:mga07m45_49217_c1 nmdc:mga07m45_49217_c1_138_1421 424
32 3300050516 nmdc:mga0sz30_2624_c1 nmdc:mga0sz30_2624_c1_3815_5098 424
33 iso_pu_bacteria 2643221560 2643823326 424
34 iso_pu_bacteria 2643221563 2643835672 424
35 iso_pu_bacteria 2643221608 2644056598 424
36 iso_pu_bacteria 2818991438 2819550576 424
37 iso_pu_bacteria 2852653556 2852655230 424
38 3300053136 Ga0500559_0021762 Ga0500559_0021762_243_1523 425
39 iso_pu_bacteria 2821443989 2821447834 425
40 iso_pu_bacteria 2844533157 2844536476 425
41 iso_pu_bacteria 2852680915 2852681200 425
42 iso_pu_bacteria 2895880812 2895886309 425
43 3300032133 Ga0316583_10001679 Ga0316583_100016793 426
44 3300036647 Ga0316582_0007879 Ga0316582_0007879_1939_3228 426
45 3300036712 Ga0316584_0078473 Ga0316584_0078473_688_1977 426
46 3300060353 Ga0501082_0006880 Ga0501082_0006880_8452_9738 426
47 iso_pu_bacteria 2582581305 2585261910 426
48 iso_pu_bacteria 2643221588 2643949422 426
49 iso_pu_bacteria 2738541275 2738709333 426
50 iso_pu_bacteria 2738541301 2738847758 426
51 iso_pu_bacteria 2738541304 2738863487 426
52 iso_pu_bacteria 2738543022 2739296005 426
53 iso_pu_bacteria 2738543033 2739357683 426
54 iso_pu_bacteria 2739367664 2739651671 426
55 iso_pu_bacteria 2739367865 2740030145 426
56 iso_pu_bacteria 2848297114 2848299101 426
57 iso_pu_bacteria 2882806704 2882807673 426
58 iso_pu_bacteria 2896253425 2896255105 426
59 iso_pu_bacteria 2928100450 2928102876 426
60 iso_pu_bacteria 2928959182 2928959442 426
61 iso_pu_bacteria 2946787523 2946788884 426
62 iso_pu_bacteria 3000865235 3000866182 426
63 3300005347 Ga0070668_100141882 Ga0070668_1001418822 427
64 3300006353 Ga0075370_10000043 Ga0075370_1000004315 427
65 3300025972 Ga0207668_10036801 Ga0207668_100368015 427
66 3300039438 Ga0436360_0901768 Ga0436360_0901768_187_1479 427
67 3300049823 Ga0501044_0082505 Ga0501044_0082505_528_1814 427
68 3300050496 nmdc:mga07m45_3_c1 nmdc:mga07m45_3_c1_236829_238112 427
69 iso_pu_bacteria 2599185354 2600201028 427
70 iso_pu_bacteria 2599185359 2600224868 427
71 iso_pu_bacteria 2643221541 2643730900 427
72 iso_pu_bacteria 2643221605 2644040215 427
73 iso_pu_bacteria 2643221606 2644044447 427
74 iso_pu_bacteria 2643221622 2644126540 427
75 iso_pu_bacteria 2643221671 2644391629 427
76 iso_pu_bacteria 2751185897 2753765320 427
77 iso_pu_bacteria 2879163058 2879165691 427
78 iso_pu_bacteria 2896184354 2896184960 427
79 iso_pu_bacteria 2919138771 2919139660 427
80 iso_pu_bacteria 2928027323 2928028948 427
81 iso_pu_bacteria 2984555340 2984557820 427
82 iso_pu_bacteria 2984564862 2984567814 427
83 iso_pu_bacteria 2990265787 2990266342 427
84 iso_pu_bacteria 2993356040 2993358865 427
85 iso_pu_bacteria 2993693658 2993695865 427
86 iso_pu_bacteria 8054302542 8054307351 427
87 3300002459 JGI24751J29686_10000527 JGI24751J29686_100005273 428
88 3300003784 Ga0055534_1011713 Ga0055534_10117131 428
89 3300003791 Ga0055530_10000095 Ga0055530_1000009552 428
90 3300003794 Ga0055531_10003004 Ga0055531_100030042 428
91 3300005327 Ga0070658_10000125 Ga0070658_1000012562 428
92 3300005327 Ga0070658_10172421 Ga0070658_101724212 428
93 3300005353 Ga0070669_100000329 Ga0070669_10000032920 428
94 3300005563 Ga0068855_100028987 Ga0068855_1000289873 428
95 3300005578 Ga0068854_100008931 Ga0068854_1000089314 428
96 3300005614 Ga0068856_100016224 Ga0068856_1000162243 428
97 3300005616 Ga0068852_100000582 Ga0068852_10000058222 428
98 3300005617 Ga0068859_100393525 Ga0068859_1003935251 428
99 3300005618 Ga0068864_100024456 Ga0068864_1000244562 428
100 3300005719 Ga0068861_100000052 Ga0068861_10000005229 428
101 3300005841 Ga0068863_100001327 Ga0068863_10000132726 428
102 3300005842 Ga0068858_100083058 Ga0068858_1000830582 428
103 3300005844 Ga0068862_100008071 Ga0068862_10000807110 428
104 3300006048 Ga0075363_100008687 Ga0075363_1000086873 428
105 3300006051 Ga0075364_10015795 Ga0075364_100157955 428
106 3300006058 Ga0075432_10024576 Ga0075432_100245762 428
107 3300006177 Ga0075362_10000045 Ga0075362_1000004531 428
108 3300006177 Ga0075362_10005061 Ga0075362_100050613 428
109 3300006178 Ga0075367_10002723 Ga0075367_100027236 428
110 3300006186 Ga0075369_10001176 Ga0075369_1000117610 428
111 3300006195 Ga0075366_10000596 Ga0075366_1000059613 428
112 3300006195 Ga0075366_10023596 Ga0075366_100235964 428
113 3300006931 Ga0097620_100000812 Ga0097620_10000081210 428
114 3300006931 Ga0097620_100393538 Ga0097620_1003935381 428
115 3300009093 Ga0105240_10020826 Ga0105240_100208262 428
116 3300009177 Ga0105248_10009138 Ga0105248_1000913812 428
117 3300009551 Ga0105238_10082242 Ga0105238_100822425 428
118 3300025291 Ga0209675_1000025 Ga0209675_1000025110 428
119 3300025292 Ga0209676_1000198 Ga0209676_100019868 428
120 3300025292 Ga0209676_1000362 Ga0209676_100036252 428
121 3300025292 Ga0209676_1002334 Ga0209676_10023349 428
122 3300025298 Ga0209050_1000849 Ga0209050_100084910 428
123 3300025304 Ga0209257_1000229 Ga0209257_1000229123 428
124 3300025304 Ga0209257_1000596 Ga0209257_10005966 428
125 3300025909 Ga0207705_10000004 Ga0207705_10000004659 428
126 3300025913 Ga0207695_10017051 Ga0207695_1001705111 428
127 3300025923 Ga0207681_10000448 Ga0207681_1000044820 428
128 3300025924 Ga0207694_10033709 Ga0207694_100337091 428
129 3300025931 Ga0207644_10000003 Ga0207644_10000003134 428
130 3300025941 Ga0207711_10005173 Ga0207711_100051733 428
131 3300025941 Ga0207711_10016349 Ga0207711_100163492 428
132 3300025949 Ga0207667_10022820 Ga0207667_100228205 428
133 3300025972 Ga0207668_10006027 Ga0207668_100060275 428
134 3300025981 Ga0207640_10006471 Ga0207640_100064714 428
135 3300026078 Ga0207702_10073798 Ga0207702_100737982 428
136 3300026088 Ga0207641_10000035 Ga0207641_1000003583 428
137 3300026095 Ga0207676_10015241 Ga0207676_100152416 428
138 3300026118 Ga0207675_100000035 Ga0207675_10000003546 428
139 3300026142 Ga0207698_10000193 Ga0207698_1000019331 428
140 3300027866 Ga0209813_10000053 Ga0209813_1000005314 428
141 3300027907 Ga0207428_10135232 Ga0207428_101352321 428
142 3300031250 Ga0265331_10010745 Ga0265331_100107453 428
143 3300031616 Ga0307508_10025276 Ga0307508_100252768 428
144 3300032004 Ga0307414_10001388 Ga0307414_100013884 428
145 3300035691 Ga0373931_0026766 Ga0373931_0026766_654_1940 428
146 3300046506 Ga0495583_0000426 Ga0495583_0000426_16206_17501 428
147 3300046522 Ga0495643_0025298 Ga0495643_0025298_1402_2694 428
148 3300046616 Ga0495668_0000001 Ga0495668_0000001_458471_459760 428
149 3300046660 Ga0495625_0000362 Ga0495625_0000362_62156_63445 428
150 3300047469 Ga0495673_0060404 Ga0495673_0060404_173_1468 428
151 3300048908 Ga0496105_0012699 Ga0496105_0012699_3223_4509 428
152 3300048910 Ga0496107_0005607 Ga0496107_0005607_1806_3107 428
153 3300048915 Ga0496112_0127901 Ga0496112_0127901_142_1443 428
154 3300048916 Ga0496113_0091954 Ga0496113_0091954_310_1611 428
155 3300048919 Ga0496116_0000039 Ga0496116_0000039_216330_217631 428
156 3300048921 Ga0496118_0044167 Ga0496118_0044167_428_1720 428
157 3300048924 Ga0496121_0056545 Ga0496121_0056545_1785_3086 428
158 3300048926 Ga0496123_0002576 Ga0496123_0002576_15116_16417 428
159 3300048928 Ga0496125_0012514 Ga0496125_0012514_2866_4167 428
160 3300048929 Ga0496126_0000041 Ga0496126_0000041_124269_125570 428
161 3300048929 Ga0496126_0056776 Ga0496126_0056776_36_1322 428
162 3300049570 Ga0501033_0019380 Ga0501033_0019380_975_2264 428
163 3300049823 Ga0501044_0026898 Ga0501044_0026898_3302_4588 428
164 3300050489 nmdc:mga03683_196_c1 nmdc:mga03683_196_c1_182_1468 428
165 3300050489 nmdc:mga03683_6_c1 nmdc:mga03683_6_c1_36197_37483 428
166 3300050490 nmdc:mga03n38_14038_c1 nmdc:mga03n38_14038_c1_55_1341 428
167 3300050491 nmdc:mga00v17_13923_c1 nmdc:mga00v17_13923_c1_1755_3041 428
168 3300050491 nmdc:mga00v17_3708_c1 nmdc:mga00v17_3708_c1_5828_7114 428
169 3300050493 nmdc:mga0k408_6_c1 nmdc:mga0k408_6_c1_162964_164250 428
170 3300050494 nmdc:mga06z11_338_c1 nmdc:mga06z11_338_c1_11954_13240 428
171 3300050495 nmdc:mga04h51_24_c1 nmdc:mga04h51_24_c1_10573_11859 428
172 3300050496 nmdc:mga07m45_4_c1 nmdc:mga07m45_4_c1_201682_202968 428
173 3300050516 nmdc:mga0sz30_2058_c1 nmdc:mga0sz30_2058_c1_2399_3685 428
174 3300050516 nmdc:mga0sz30_44_c1 nmdc:mga0sz30_44_c1_14816_16102 428
175 3300053087 Ga0500643_000004 Ga0500643_000004_771622_772914 428
176 3300053103 Ga0500555_002039 Ga0500555_002039_1459_2754 428
177 3300053116 Ga0500592_007223 Ga0500592_007223_156_1445 428
178 3300053139 Ga0500568_0004441 Ga0500568_0004441_4540_5829 428
179 iso_pu_bacteria 2842775625 2842776894 428
180 iso_pu_bacteria 2885429604 2885431412 428
181 3300002774 JGI25150J39212_1000715 JGI25150J39212_10007156 429
182 3300002774 JGI25150J39212_1001064 JGI25150J39212_10010646 429
183 3300003187 JGI25151J46595_10000436 JGI25151J46595_1000043640 429
184 3300003215 JGI25153J46596_10000319 JGI25153J46596_100003196 429
185 3300003354 JGI25160J50197_1003631 JGI25160J50197_10036312 429
186 3300003771 Ga0055526_1005820 Ga0055526_10058208 429
187 3300003781 Ga0055536_1008491 Ga0055536_10084914 429
188 3300003792 Ga0055540_1001230 Ga0055540_100123013 429
189 3300005367 Ga0070667_100000188 Ga0070667_10000018815 429
190 3300005457 Ga0070662_100083263 Ga0070662_1000832631 429
191 3300005578 Ga0068854_100099840 Ga0068854_1000998402 429
192 3300005841 Ga0068863_100007348 Ga0068863_10000734812 429
193 3300005843 Ga0068860_100000013 Ga0068860_100000013331 429
194 3300021388 Ga0213875_10000135 Ga0213875_100001358 429
195 3300025245 Ga0207425_1000026 Ga0207425_100002678 429
196 3300025258 Ga0209129_1000302 Ga0209129_100030222 429
197 3300025263 Ga0209565_1000064 Ga0209565_1000064182 429
198 3300025273 Ga0209673_1010268 Ga0209673_10102682 429
199 3300025284 Ga0209130_1000167 Ga0209130_100016751 429
200 3300025292 Ga0209676_1003950 Ga0209676_10039502 429
201 3300025294 Ga0209025_1000077 Ga0209025_100007759 429
202 3300025294 Ga0209025_1001838 Ga0209025_10018382 429
203 3300025295 Ga0209564_1001724 Ga0209564_10017248 429
204 3300025297 Ga0209758_1000004 Ga0209758_10000041020 429
205 3300025297 Ga0209758_1008092 Ga0209758_100809211 429
206 3300025298 Ga0209050_1000001 Ga0209050_10000013018 429
207 3300025302 Ga0207426_1000239 Ga0207426_100023989 429
208 3300025302 Ga0207426_1022527 Ga0207426_10225272 429
209 3300025303 Ga0209051_1000270 Ga0209051_100027032 429
210 3300025919 Ga0207657_10153290 Ga0207657_101532902 429
211 3300025986 Ga0207658_10000145 Ga0207658_1000014564 429
212 3300026041 Ga0207639_10047650 Ga0207639_100476506 429
213 3300026088 Ga0207641_10002010 Ga0207641_100020106 429
214 3300027876 Ga0209974_10035657 Ga0209974_100356571 429
215 3300028381 Ga0268264_10000039 Ga0268264_10000039326 429
216 3300031911 Ga0307412_10088807 Ga0307412_100888072 429
217 3300032004 Ga0307414_10053424 Ga0307414_100534243 429
218 3300033180 Ga0307510_10118929 Ga0307510_101189293 429
219 3300037853 Ga0436364_0986946 Ga0436364_0986946_198826_200124 429
220 3300039447 Ga0436361_0359771 Ga0436361_0359771_602_1900 429
221 3300042146 Ga0450907_001444 Ga0450907_001444_850_2148 429
222 3300049570 Ga0501033_0012413 Ga0501033_0012413_1873_3165 429
223 3300049686 Ga0501257_000176 Ga0501257_000176_6985_8280 429
224 3300049778 Ga0501282_000252 Ga0501282_000252_957_2249 429
225 3300053157 Ga0500624_000001 Ga0500624_000001_98935_100230 429
226 3300053729 Ga0500625_000003 Ga0500625_000003_1287_2576 429
227 3300001904 JGI24736J21556_1000426 JGI24736J21556_10004263 430
228 3300001976 JGI24752J21851_1000192 JGI24752J21851_10001922 430
229 3300001976 JGI24752J21851_1001145 JGI24752J21851_10011455 430
230 3300002067 JGI24735J21928_10038253 JGI24735J21928_100382532 430
231 3300002070 JGI24750J21931_1002313 JGI24750J21931_10023133 430
232 3300002074 JGI24748J21848_1000082 JGI24748J21848_100008229 430
233 3300002075 JGI24738J21930_10002936 JGI24738J21930_100029365 430
234 3300002076 JGI24749J21850_1001046 JGI24749J21850_10010462 430
235 3300002239 JGI24034J26672_10000019 JGI24034J26672_1000001995 430
236 3300003214 JGI25165J46597_1000041 JGI25165J46597_1000041266 430
237 3300005289 Ga0065704_10009692 Ga0065704_100096923 430
238 3300005289 Ga0065704_10070751 Ga0065704_100707513 430
239 3300005327 Ga0070658_10000001 Ga0070658_10000001767 430
240 3300005327 Ga0070658_10065082 Ga0070658_100650823 430
241 3300005329 Ga0070683_100099184 Ga0070683_1000991843 430
242 3300005330 Ga0070690_100001820 Ga0070690_10000182013 430
243 3300005331 Ga0070670_100000016 Ga0070670_1000000165 430
244 3300005333 Ga0070677_10000660 Ga0070677_100006602 430
245 3300005335 Ga0070666_10000002 Ga0070666_10000002316 430
246 3300005336 Ga0070680_100005367 Ga0070680_10000536710 430
247 3300005338 Ga0068868_100000001 Ga0068868_10000000134 430
248 3300005339 Ga0070660_100003013 Ga0070660_1000030132 430
249 3300005340 Ga0070689_100008663 Ga0070689_1000086636 430
250 3300005344 Ga0070661_100000014 Ga0070661_10000001410 430
251 3300005345 Ga0070692_10002506 Ga0070692_100025063 430
252 3300005347 Ga0070668_100000262 Ga0070668_1000002627 430
253 3300005353 Ga0070669_100000244 Ga0070669_10000024417 430
254 3300005353 Ga0070669_100009564 Ga0070669_1000095645 430
255 3300005355 Ga0070671_100044561 Ga0070671_1000445615 430
256 3300005366 Ga0070659_100000001 Ga0070659_100000001324 430
257 3300005366 Ga0070659_100051272 Ga0070659_1000512725 430
258 3300005366 Ga0070659_100114980 Ga0070659_1001149801 430
259 3300005367 Ga0070667_100002504 Ga0070667_10000250414 430
260 3300005367 Ga0070667_100015448 Ga0070667_1000154483 430
261 3300005367 Ga0070667_100023690 Ga0070667_1000236905 430
262 3300005466 Ga0070685_10000023 Ga0070685_1000002393 430
263 3300005530 Ga0070679_100000007 Ga0070679_10000000741 430
264 3300005530 Ga0070679_100136622 Ga0070679_1001366221 430
265 3300005535 Ga0070684_100089485 Ga0070684_1000894853 430
266 3300005539 Ga0068853_100056555 Ga0068853_1000565553 430
267 3300005544 Ga0070686_100000003 Ga0070686_10000000352 430
268 3300005548 Ga0070665_100000036 Ga0070665_10000003620 430
269 3300005548 Ga0070665_100000334 Ga0070665_10000033410 430
270 3300005548 Ga0070665_100009526 Ga0070665_10000952610 430
271 3300005548 Ga0070665_100066299 Ga0070665_1000662992 430
272 3300005563 Ga0068855_100012936 Ga0068855_1000129367 430
273 3300005614 Ga0068856_100037634 Ga0068856_1000376343 430
274 3300005617 Ga0068859_100081740 Ga0068859_1000817403 430
275 3300005618 Ga0068864_100000017 Ga0068864_100000017284 430
276 3300005618 Ga0068864_100010879 Ga0068864_1000108793 430
277 3300005719 Ga0068861_100016857 Ga0068861_1000168576 430
278 3300005841 Ga0068863_100000018 Ga0068863_100000018206 430
279 3300005841 Ga0068863_100000122 Ga0068863_10000012250 430
280 3300005841 Ga0068863_100000447 Ga0068863_10000044735 430
281 3300005841 Ga0068863_100001804 Ga0068863_1000018043 430
282 3300005842 Ga0068858_100001529 Ga0068858_1000015293 430
283 3300005842 Ga0068858_100042943 Ga0068858_1000429433 430
284 3300005843 Ga0068860_100000001 Ga0068860_100000001318 430
285 3300005843 Ga0068860_100000007 Ga0068860_10000000729 430
286 3300005844 Ga0068862_100000010 Ga0068862_10000001026 430
287 3300005844 Ga0068862_100000020 Ga0068862_1000000207 430
288 3300005844 Ga0068862_100000067 Ga0068862_10000006797 430
289 3300005844 Ga0068862_100027938 Ga0068862_1000279384 430
290 3300005937 Ga0081455_10002904 Ga0081455_100029044 430
291 3300006177 Ga0075362_10072059 Ga0075362_100720592 430
292 3300006931 Ga0097620_100081728 Ga0097620_1000817283 430
293 3300009011 Ga0105251_10000568 Ga0105251_1000056820 430
294 3300009011 Ga0105251_10026234 Ga0105251_100262342 430
295 3300009098 Ga0105245_10000250 Ga0105245_1000025028 430
296 3300009101 Ga0105247_10011972 Ga0105247_100119725 430
297 3300009101 Ga0105247_10046047 Ga0105247_100460472 430
298 3300009101 Ga0105247_10092950 Ga0105247_100929502 430
299 3300009177 Ga0105248_10000128 Ga0105248_1000012828 430
300 3300009553 Ga0105249_10000105 Ga0105249_10000105102 430
301 3300009553 Ga0105249_10000114 Ga0105249_1000011467 430
302 3300009553 Ga0105249_10000173 Ga0105249_1000017337 430
303 3300009553 Ga0105249_10117034 Ga0105249_101170343 430
304 3300013306 Ga0163162_10021409 Ga0163162_100214096 430
305 3300017792 Ga0163161_10000067 Ga0163161_100000679 430
306 3300020081 Ga0206354_10970312 Ga0206354_109703122 430
307 3300021358 Ga0213873_10000025 Ga0213873_1000002541 430
308 3300021384 Ga0213876_10000004 Ga0213876_1000000457 430
309 3300021384 Ga0213876_10000234 Ga0213876_1000023415 430
310 3300021384 Ga0213876_10014515 Ga0213876_100145153 430
311 3300025261 Ga0209233_1000104 Ga0209233_1000104270 430
312 3300025735 Ga0207713_1001495 Ga0207713_100149513 430
313 3300025735 Ga0207713_1005997 Ga0207713_10059972 430
314 3300025893 Ga0207682_10000808 Ga0207682_1000080816 430
315 3300025900 Ga0207710_10001065 Ga0207710_1000106510 430
316 3300025901 Ga0207688_10098729 Ga0207688_100987291 430
317 3300025903 Ga0207680_10000004 Ga0207680_10000004545 430
318 3300025904 Ga0207647_10009134 Ga0207647_100091342 430
319 3300025909 Ga0207705_10000002 Ga0207705_100000021114 430
320 3300025911 Ga0207654_10003761 Ga0207654_100037614 430
321 3300025912 Ga0207707_10019248 Ga0207707_100192485 430
322 3300025913 Ga0207695_10096423 Ga0207695_100964233 430
323 3300025914 Ga0207671_10020867 Ga0207671_100208675 430
324 3300025917 Ga0207660_10000986 Ga0207660_1000098625 430
325 3300025919 Ga0207657_10004974 Ga0207657_1000497415 430
326 3300025919 Ga0207657_10011635 Ga0207657_100116354 430
327 3300025920 Ga0207649_10000613 Ga0207649_1000061318 430
328 3300025921 Ga0207652_10000001 Ga0207652_10000001626 430
329 3300025921 Ga0207652_10000002 Ga0207652_10000002101 430
330 3300025921 Ga0207652_10094380 Ga0207652_100943802 430
331 3300025923 Ga0207681_10000079 Ga0207681_1000007974 430
332 3300025923 Ga0207681_10000547 Ga0207681_1000054710 430
333 3300025924 Ga0207694_10089732 Ga0207694_100897322 430
334 3300025925 Ga0207650_10000057 Ga0207650_100000576 430
335 3300025927 Ga0207687_10000184 Ga0207687_1000018417 430
336 3300025931 Ga0207644_10000602 Ga0207644_1000060216 430
337 3300025932 Ga0207690_10000051 Ga0207690_1000005162 430
338 3300025933 Ga0207706_10142946 Ga0207706_101429462 430
339 3300025936 Ga0207670_10020172 Ga0207670_100201723 430
340 3300025941 Ga0207711_10000031 Ga0207711_1000003127 430
341 3300025941 Ga0207711_10015656 Ga0207711_100156563 430
342 3300025941 Ga0207711_10019811 Ga0207711_100198112 430
343 3300025949 Ga0207667_10008339 Ga0207667_100083398 430
344 3300025949 Ga0207667_10033932 Ga0207667_100339327 430
345 3300025961 Ga0207712_10000001 Ga0207712_10000001419 430
346 3300025961 Ga0207712_10000015 Ga0207712_10000015102 430
347 3300025961 Ga0207712_10002737 Ga0207712_1000273710 430
348 3300025972 Ga0207668_10000305 Ga0207668_1000030536 430
349 3300025986 Ga0207658_10002100 Ga0207658_100021008 430
350 3300025986 Ga0207658_10003431 Ga0207658_100034316 430
351 3300025986 Ga0207658_10009238 Ga0207658_100092383 430
352 3300026023 Ga0207677_10000013 Ga0207677_10000013165 430
353 3300026035 Ga0207703_10000749 Ga0207703_1000074928 430
354 3300026035 Ga0207703_10001417 Ga0207703_100014173 430
355 3300026078 Ga0207702_10026718 Ga0207702_100267185 430
356 3300026088 Ga0207641_10000001 Ga0207641_1000000136 430
357 3300026088 Ga0207641_10000002 Ga0207641_10000002458 430
358 3300026088 Ga0207641_10000657 Ga0207641_100006573 430
359 3300026095 Ga0207676_10000005 Ga0207676_10000005349 430
360 3300026095 Ga0207676_10001911 Ga0207676_1000191110 430
361 3300028379 Ga0268266_10000042 Ga0268266_10000042318 430
362 3300028379 Ga0268266_10000518 Ga0268266_100005189 430
363 3300028379 Ga0268266_10001119 Ga0268266_1000111922 430
364 3300028379 Ga0268266_10004895 Ga0268266_1000489511 430
365 3300028379 Ga0268266_10007465 Ga0268266_100074652 430
366 3300028379 Ga0268266_10060485 Ga0268266_100604853 430
367 3300028380 Ga0268265_10000003 Ga0268265_10000003531 430
368 3300028380 Ga0268265_10000021 Ga0268265_10000021135 430
369 3300028380 Ga0268265_10000190 Ga0268265_1000019039 430
370 3300028380 Ga0268265_10049838 Ga0268265_100498382 430
371 3300028380 Ga0268265_10106244 Ga0268265_101062442 430
372 3300028381 Ga0268264_10000006 Ga0268264_10000006545 430
373 3300028381 Ga0268264_10000077 Ga0268264_10000077211 430
374 3300028381 Ga0268264_10003049 Ga0268264_100030492 430
375 3300028381 Ga0268264_10030190 Ga0268264_100301903 430
376 3300031731 Ga0307405_10000513 Ga0307405_1000051310 430
377 3300031824 Ga0307413_10162095 Ga0307413_101620952 430
378 3300031911 Ga0307412_10016615 Ga0307412_100166154 430
379 3300031911 Ga0307412_10041680 Ga0307412_100416802 430
380 3300032002 Ga0307416_100046355 Ga0307416_1000463552 430
381 3300032004 Ga0307414_10104996 Ga0307414_101049964 430
382 3300039437 Ga0436365_0401005 Ga0436365_0401005_3870_5162 430
383 3300039437 Ga0436365_1229825 Ga0436365_1229825_435_1727 430
384 3300039437 Ga0436365_1881943 Ga0436365_1881943_1178_2470 430
385 3300039453 Ga0436362_1061615 Ga0436362_1061615_10177_11469 430
386 3300044735 Ga0466968_0039389 Ga0466968_0039389_548_1846 430
387 3300046460 Ga0495638_0000018 Ga0495638_0000018_280690_281988 430
388 3300046460 Ga0495638_0004781 Ga0495638_0004781_7718_9019 430
389 3300046520 Ga0495637_0003069 Ga0495637_0003069_7027_8325 430
390 3300046524 Ga0495648_0000018 Ga0495648_0000018_503_1801 430
391 3300046692 Ga0495671_0000011 Ga0495671_0000011_343160_344458 430
392 3300047469 Ga0495673_0000013 Ga0495673_0000013_611224_612522 430
393 3300048905 Ga0496102_0000704 Ga0496102_0000704_24527_25819 430
394 3300048905 Ga0496102_0014028 Ga0496102_0014028_3675_4970 430
395 3300048906 Ga0496103_0011230 Ga0496103_0011230_2021_3316 430
396 3300048907 Ga0496104_0000345 Ga0496104_0000345_31402_32694 430
397 3300048908 Ga0496105_0000372 Ga0496105_0000372_4498_5790 430
398 3300048919 Ga0496116_0039118 Ga0496116_0039118_1501_2793 430
399 3300048920 Ga0496117_0000462 Ga0496117_0000462_3176_4468 430
400 3300048921 Ga0496118_0003058 Ga0496118_0003058_19248_20540 430
401 3300048922 Ga0496119_0000526 Ga0496119_0000526_19267_20559 430
402 3300048923 Ga0496120_0000628 Ga0496120_0000628_32724_34016 430
403 3300048924 Ga0496121_0000243 Ga0496121_0000243_107542_108834 430
404 3300048924 Ga0496121_0006027 Ga0496121_0006027_314_1606 430
405 3300048925 Ga0496122_0000532 Ga0496122_0000532_25961_27253 430
406 3300048926 Ga0496123_0001181 Ga0496123_0001181_19389_20681 430
407 3300048927 Ga0496124_0005897 Ga0496124_0005897_8478_9770 430
408 3300048928 Ga0496125_0000828 Ga0496125_0000828_17227_18519 430
409 3300048929 Ga0496126_0000028 Ga0496126_0000028_290454_291746 430
410 3300053153 Ga0500616_0000128 Ga0500616_0000128_43466_44758 430
411 3300001915 JGI24741J21665_1000521 JGI24741J21665_100052114 431
412 3300001979 JGI24740J21852_10005448 JGI24740J21852_100054487 431
413 3300001979 JGI24740J21852_10026360 JGI24740J21852_100263602 431
414 3300001990 JGI24737J22298_10001523 JGI24737J22298_100015237 431
415 3300001990 JGI24737J22298_10005981 JGI24737J22298_100059813 431
416 3300002076 JGI24749J21850_1000153 JGI24749J21850_10001538 431
417 3300002459 JGI24751J29686_10000119 JGI24751J29686_1000011918 431
418 3300003214 JGI25165J46597_1000082 JGI25165J46597_100008297 431
419 3300003215 JGI25153J46596_10000002 JGI25153J46596_10000002481 431
420 3300003759 Ga0055525_1000076 Ga0055525_100007621 431
421 3300003762 Ga0055542_1000020 Ga0055542_100002096 431
422 3300003763 Ga0055529_1000016 Ga0055529_1000016251 431
423 3300003773 Ga0055537_1005519 Ga0055537_10055196 431
424 3300003791 Ga0055530_10001188 Ga0055530_1000118820 431
425 3300003794 Ga0055531_10001182 Ga0055531_100011827 431
426 3300005262 Ga0065165_1005289 Ga0065165_10052897 431
427 3300005295 Ga0065707_10082676 Ga0065707_100826766 431
428 3300005295 Ga0065707_10088015 Ga0065707_100880154 431
429 3300005327 Ga0070658_10004279 Ga0070658_100042795 431
430 3300005331 Ga0070670_100000047 Ga0070670_10000004757 431
431 3300005339 Ga0070660_100012440 Ga0070660_1000124408 431
432 3300005344 Ga0070661_100008527 Ga0070661_1000085277 431
433 3300005347 Ga0070668_100014297 Ga0070668_1000142976 431
434 3300005353 Ga0070669_100000072 Ga0070669_10000007229 431
435 3300005355 Ga0070671_100002790 Ga0070671_10000279014 431
436 3300005356 Ga0070674_100001953 Ga0070674_1000019535 431
437 3300005356 Ga0070674_100002711 Ga0070674_1000027116 431
438 3300005366 Ga0070659_100012325 Ga0070659_1000123258 431
439 3300005367 Ga0070667_100026681 Ga0070667_1000266814 431
440 3300005456 Ga0070678_100004997 Ga0070678_1000049977 431
441 3300005459 Ga0068867_100091373 Ga0068867_1000913732 431
442 3300005544 Ga0070686_100000597 Ga0070686_1000005974 431
443 3300005548 Ga0070665_100000051 Ga0070665_100000051179 431
444 3300005548 Ga0070665_100002297 Ga0070665_1000022975 431
445 3300005548 Ga0070665_100015494 Ga0070665_1000154949 431
446 3300005578 Ga0068854_100094493 Ga0068854_1000944933 431
447 3300005614 Ga0068856_100021498 Ga0068856_1000214983 431
448 3300005618 Ga0068864_100000051 Ga0068864_10000005157 431
449 3300005618 Ga0068864_100003852 Ga0068864_1000038526 431
450 3300005841 Ga0068863_100012560 Ga0068863_1000125609 431
451 3300005843 Ga0068860_100022043 Ga0068860_1000220433 431
452 3300005844 Ga0068862_100000036 Ga0068862_10000003697 431
453 3300006051 Ga0075364_10028514 Ga0075364_100285143 431
454 3300006353 Ga0075370_10029189 Ga0075370_100291894 431
455 3300009011 Ga0105251_10002301 Ga0105251_100023014 431
456 3300009148 Ga0105243_10000116 Ga0105243_100001169 431
457 3300009177 Ga0105248_10001208 Ga0105248_1000120827 431
458 3300009177 Ga0105248_10009113 Ga0105248_100091135 431
459 3300009545 Ga0105237_10003515 Ga0105237_1000351513 431
460 3300010375 Ga0105239_10000037 Ga0105239_10000037173 431
461 3300011119 Ga0105246_10000060 Ga0105246_1000006019 431
462 3300013100 Ga0157373_10062526 Ga0157373_100625262 431
463 3300013102 Ga0157371_10000030 Ga0157371_10000030162 431
464 3300013306 Ga0163162_10189514 Ga0163162_101895141 431
465 3300013307 Ga0157372_10118345 Ga0157372_101183453 431
466 3300014325 Ga0163163_10061252 Ga0163163_100612523 431
467 3300014326 Ga0157380_10000238 Ga0157380_1000023814 431
468 3300014326 Ga0157380_10000495 Ga0157380_100004954 431
469 3300014326 Ga0157380_10167833 Ga0157380_101678333 431
470 3300015690 Ga0183363_1005 Ga0183363_1005104 431
471 3300017792 Ga0163161_10036370 Ga0163161_100363702 431
472 3300025230 Ga0209563_100019 Ga0209563_100019526 431
473 3300025231 Ga0207427_100919 Ga0207427_1009199 431
474 3300025250 Ga0209026_1000813 Ga0209026_10008136 431
475 3300025254 Ga0209148_1000017 Ga0209148_1000017497 431
476 3300025261 Ga0209233_1000041 Ga0209233_100004196 431
477 3300025263 Ga0209565_1000010 Ga0209565_1000010326 431
478 3300025272 Ga0209455_1000005 Ga0209455_1000005497 431
479 3300025273 Ga0209673_1001168 Ga0209673_100116827 431
480 3300025297 Ga0209758_1000001 Ga0209758_10000011278 431
481 3300025298 Ga0209050_1000010 Ga0209050_1000010630 431
482 3300025299 Ga0209256_1000034 Ga0209256_1000034182 431
483 3300025304 Ga0209257_1000009 Ga0209257_1000009486 431
484 3300025304 Ga0209257_1004248 Ga0209257_100424816 431
485 3300025321 Ga0207656_10000453 Ga0207656_1000045316 431
486 3300025735 Ga0207713_1004474 Ga0207713_10044748 431
487 3300025909 Ga0207705_10000412 Ga0207705_1000041227 431
488 3300025909 Ga0207705_10047892 Ga0207705_100478924 431
489 3300025911 Ga0207654_10001841 Ga0207654_100018418 431
490 3300025912 Ga0207707_10165128 Ga0207707_101651283 431
491 3300025913 Ga0207695_10001017 Ga0207695_1000101725 431
492 3300025913 Ga0207695_10134570 Ga0207695_101345702 431
493 3300025914 Ga0207671_10010082 Ga0207671_1001008210 431
494 3300025914 Ga0207671_10022427 Ga0207671_100224274 431
495 3300025919 Ga0207657_10002115 Ga0207657_1000211520 431
496 3300025920 Ga0207649_10000351 Ga0207649_1000035121 431
497 3300025923 Ga0207681_10000061 Ga0207681_1000006167 431
498 3300025923 Ga0207681_10005423 Ga0207681_100054233 431
499 3300025924 Ga0207694_10036865 Ga0207694_100368655 431
500 3300025925 Ga0207650_10000038 Ga0207650_1000003840 431
501 3300025931 Ga0207644_10000293 Ga0207644_100002933 431
502 3300025933 Ga0207706_10032968 Ga0207706_100329684 431
503 3300025935 Ga0207709_10000031 Ga0207709_1000003122 431
504 3300025937 Ga0207669_10000242 Ga0207669_1000024222 431
505 3300025941 Ga0207711_10000254 Ga0207711_100002542 431
506 3300025949 Ga0207667_10000004 Ga0207667_10000004306 431
507 3300025981 Ga0207640_10001085 Ga0207640_100010855 431
508 3300025981 Ga0207640_10035054 Ga0207640_100350542 431
509 3300025986 Ga0207658_10018442 Ga0207658_100184424 431
510 3300026035 Ga0207703_10000782 Ga0207703_100007823 431
511 3300026041 Ga0207639_10041154 Ga0207639_100411545 431
512 3300026067 Ga0207678_10070293 Ga0207678_100702933 431
513 3300026078 Ga0207702_10007346 Ga0207702_1000734611 431
514 3300026078 Ga0207702_10008337 Ga0207702_100083377 431
515 3300026088 Ga0207641_10000288 Ga0207641_1000028837 431
516 3300026088 Ga0207641_10003413 Ga0207641_1000341311 431
517 3300026089 Ga0207648_10028512 Ga0207648_100285123 431
518 3300026095 Ga0207676_10000034 Ga0207676_10000034143 431
519 3300026095 Ga0207676_10000635 Ga0207676_100006355 431
520 3300026116 Ga0207674_10068710 Ga0207674_100687103 431
521 3300026121 Ga0207683_10014018 Ga0207683_100140186 431
522 3300026142 Ga0207698_10019413 Ga0207698_100194134 431
523 3300027876 Ga0209974_10016584 Ga0209974_100165843 431
524 3300028379 Ga0268266_10000002 Ga0268266_100000022610 431
525 3300028379 Ga0268266_10000471 Ga0268266_1000047141 431
526 3300028380 Ga0268265_10000052 Ga0268265_1000005291 431
527 3300028380 Ga0268265_10145874 Ga0268265_101458742 431
528 3300028381 Ga0268264_10002869 Ga0268264_100028698 431
529 3300028786 Ga0307517_10042424 Ga0307517_100424244 431
530 3300033180 Ga0307510_10009032 Ga0307510_100090325 431
531 3300037312 Ga0395899_0007534 Ga0395899_0007534_5414_6718 431
532 3300037418 Ga0395900_0133393 Ga0395900_0133393_28_1332 431
533 3300041413 Ga0439465_0006644 Ga0439465_0006644_933_2237 431
534 3300041413 Ga0439465_0008077 Ga0439465_0008077_1663_2967 431
535 3300042004 Ga0439445_0007539 Ga0439445_0007539_1108_2412 431
536 3300046471 Ga0495650_0004591 Ga0495650_0004591_1873_3177 431
537 3300046506 Ga0495583_0010186 Ga0495583_0010186_2428_3732 431
538 3300046522 Ga0495643_0009493 Ga0495643_0009493_1062_2366 431
539 3300046522 Ga0495643_0043999 Ga0495643_0043999_624_1928 431
540 3300046524 Ga0495648_0000439 Ga0495648_0000439_42533_43837 431
541 3300046616 Ga0495668_0000007 Ga0495668_0000007_269140_270444 431
542 3300046660 Ga0495625_0000583 Ga0495625_0000583_43816_45120 431
543 3300046660 Ga0495625_0076150 Ga0495625_0076150_268_1572 431
544 3300046809 Ga0495600_0128811 Ga0495600_0128811_259_1563 431
545 3300047443 Ga0495687_000224 Ga0495687_000224_26789_28093 431
546 3300047443 Ga0495687_004697 Ga0495687_004697_6254_7558 431
547 3300047472 Ga0495686_0000120 Ga0495686_0000120_4534_5838 431
548 3300048905 Ga0496102_0004690 Ga0496102_0004690_5731_7035 431
549 3300048906 Ga0496103_0025039 Ga0496103_0025039_418_1728 431
550 3300048913 Ga0496110_0164207 Ga0496110_0164207_578_1882 431
551 3300048917 Ga0496114_0056260 Ga0496114_0056260_320_1624 431
552 3300048918 Ga0496115_0003486 Ga0496115_0003486_4556_5860 431
553 3300048919 Ga0496116_0050677 Ga0496116_0050677_1419_2723 431
554 3300048920 Ga0496117_0010593 Ga0496117_0010593_4537_5841 431
555 3300048920 Ga0496117_0023303 Ga0496117_0023303_3306_4616 431
556 3300048921 Ga0496118_0000125 Ga0496118_0000125_130573_131877 431
557 3300048921 Ga0496118_0021467 Ga0496118_0021467_2709_4019 431
558 3300048924 Ga0496121_0000237 Ga0496121_0000237_116967_118271 431
559 3300048924 Ga0496121_0019995 Ga0496121_0019995_4514_5818 431
560 3300048924 Ga0496121_0049913 Ga0496121_0049913_571_1881 431
561 3300048926 Ga0496123_0080985 Ga0496123_0080985_388_1692 431
562 3300048927 Ga0496124_0000082 Ga0496124_0000082_4531_5835 431
563 3300048927 Ga0496124_0022133 Ga0496124_0022133_449_1753 431
564 3300048927 Ga0496124_0139055 Ga0496124_0139055_589_1899 431
565 3300048928 Ga0496125_0018078 Ga0496125_0018078_4710_6014 431
566 3300048928 Ga0496125_0123489 Ga0496125_0123489_407_1717 431
567 3300048929 Ga0496126_0001775 Ga0496126_0001775_638_1942 431
568 3300053079 Ga0500610_0000597 Ga0500610_0000597_9686_10990 431
569 3300053087 Ga0500643_005254 Ga0500643_005254_2626_3933 431
570 3300053125 Ga0500618_002450 Ga0500618_002450_1895_3190 431
571 3300053140 Ga0500573_0001876 Ga0500573_0001876_5427_6731 431
572 3300053730 Ga0500645_000009 Ga0500645_000009_173249_174553 431
573 iso_pu_bacteria 2885427238 2885428478 431
574 iso_pu_bacteria 2896429255 2896430536 431
575 3300001989 JGI24739J22299_10009782 JGI24739J22299_100097825 432
576 3300005339 Ga0070660_100005352 Ga0070660_1000053528 432
577 3300005355 Ga0070671_100135035 Ga0070671_1001350352 432
578 3300005366 Ga0070659_100040891 Ga0070659_1000408914 432
579 3300006353 Ga0075370_10018512 Ga0075370_100185125 432
580 3300009545 Ga0105237_10116527 Ga0105237_101165272 432
581 3300025904 Ga0207647_10004657 Ga0207647_100046574 432
582 3300025931 Ga0207644_10008440 Ga0207644_100084404 432
583 3300025932 Ga0207690_10064350 Ga0207690_100643503 432
584 3300025933 Ga0207706_10047789 Ga0207706_100477894 432
585 3300025949 Ga0207667_10110302 Ga0207667_101103023 432
586 3300026078 Ga0207702_10071014 Ga0207702_100710145 432
587 3300026142 Ga0207698_10003445 Ga0207698_100034457 432
588 3300037471 Ga0395905_0091506 Ga0395905_0091506_1462_2769 432
589 3300042157 Ga0439458_0001118 Ga0439458_0001118_3847_5154 432
590 3300061719 Ga0466962_0007496 Ga0466962_0007496_3890_5197 432
591 iso_pu_bacteria 2775507255 2778123680 432
592 iso_pu_bacteria 2830075706 2830078855 432
593 iso_pu_bacteria 8057101203 8057104443 432
594 3300001904 JGI24736J21556_1001363 JGI24736J21556_10013632 433
595 3300001990 JGI24737J22298_10023420 JGI24737J22298_100234202 433
596 3300005331 Ga0070670_100001762 Ga0070670_10000176214 433
597 3300005344 Ga0070661_100208691 Ga0070661_1002086912 433
598 3300005564 Ga0070664_100042193 Ga0070664_1000421933 433
599 3300005577 Ga0068857_100021108 Ga0068857_1000211084 433
600 3300005614 Ga0068856_100009471 Ga0068856_1000094717 433
601 3300005617 Ga0068859_100000236 Ga0068859_1000002364 433
602 3300006931 Ga0097620_100000236 Ga0097620_1000002364 433
603 3300009101 Ga0105247_10000801 Ga0105247_100008019 433
604 3300009174 Ga0105241_10058312 Ga0105241_100583122 433
605 3300025904 Ga0207647_10007308 Ga0207647_100073083 433
606 3300025913 Ga0207695_10051120 Ga0207695_100511202 433
607 3300025919 Ga0207657_10026856 Ga0207657_100268563 433
608 3300025933 Ga0207706_10140473 Ga0207706_101404732 433
609 3300025949 Ga0207667_10040609 Ga0207667_100406094 433
610 3300025961 Ga0207712_10005214 Ga0207712_100052144 433
611 3300025981 Ga0207640_10005109 Ga0207640_100051091 433
612 3300026041 Ga0207639_10001534 Ga0207639_1000153413 433
613 3300026067 Ga0207678_10014829 Ga0207678_100148296 433
614 3300026116 Ga0207674_10084315 Ga0207674_100843152 433
615 3300026142 Ga0207698_10176858 Ga0207698_101768582 433
616 3300031548 Ga0307408_100026447 Ga0307408_1000264472 433
617 3300031852 Ga0307410_10033588 Ga0307410_100335883 433
618 3300032002 Ga0307416_100062508 Ga0307416_1000625083 433
619 3300048905 Ga0496102_0000043 Ga0496102_0000043_72650_74005 433
620 3300048906 Ga0496103_0000086 Ga0496103_0000086_36568_37923 433
621 3300048920 Ga0496117_0000104 Ga0496117_0000104_72650_74005 433
622 3300048921 Ga0496118_0000080 Ga0496118_0000080_115197_116552 433
623 3300048927 Ga0496124_0000093 Ga0496124_0000093_115197_116552 433
624 iso_pu_bacteria 2808606401 2809062099 433
625 iso_pu_bacteria 2808606404 2809078063 433
626 iso_pu_bacteria 2808606405 2809082229 433
627 iso_pu_bacteria 2880518877 2880519716 433
628 3300005539 Ga0068853_100005131 Ga0068853_1000051319 434
629 3300006042 Ga0075368_10000432 Ga0075368_1000043211 434
630 3300006048 Ga0075363_100041795 Ga0075363_1000417952 434
631 3300006178 Ga0075367_10010641 Ga0075367_100106412 434
632 3300006846 Ga0075430_100050315 Ga0075430_1000503154 434
633 3300025321 Ga0207656_10074041 Ga0207656_100740412 434
634 3300026041 Ga0207639_10002085 Ga0207639_100020857 434
635 3300027866 Ga0209813_10000101 Ga0209813_100001012 434
636 3300031548 Ga0307408_100054861 Ga0307408_1000548615 434
637 3300031911 Ga0307412_10001044 Ga0307412_1000104413 434
638 3300032004 Ga0307414_10000144 Ga0307414_1000014433 434
639 3300032004 Ga0307414_10095468 Ga0307414_100954682 434
640 3300039450 Ga0436363_0898552 Ga0436363_0898552_29_1357 434
641 3300048925 Ga0496122_0009301 Ga0496122_0009301_7162_8511 434
642 3300048926 Ga0496123_0000210 Ga0496123_0000210_7180_8529 434
643 3300050495 nmdc:mga04h51_155_c1 nmdc:mga04h51_155_c1_214_1569 434
644 3300050509 nmdc:mga0qj67_24448_c1 nmdc:mga0qj67_24448_c1_2712_4019 434
645 3300053104 Ga0500556_0000040 Ga0500556_0000040_127056_128405 434
646 3300053130 Ga0500642_0000003 Ga0500642_0000003_256182_257537 434
647 3300053730 Ga0500645_003206 Ga0500645_003206_1333_2688 434
648 iso_pu_bacteria 2512564014 2512645814 434
649 3300005293 Ga0065715_10008455 Ga0065715_100084552 435
650 3300005331 Ga0070670_100141915 Ga0070670_1001419153 435
651 3300005333 Ga0070677_10005970 Ga0070677_100059703 435
652 3300005335 Ga0070666_10000033 Ga0070666_1000003328 435
653 3300005347 Ga0070668_100000010 Ga0070668_10000001036 435
654 3300005353 Ga0070669_100000075 Ga0070669_1000000755 435
655 3300005353 Ga0070669_100009443 Ga0070669_1000094435 435
656 3300005355 Ga0070671_100000015 Ga0070671_10000001588 435
657 3300005355 Ga0070671_100187895 Ga0070671_1001878952 435
658 3300005366 Ga0070659_100024815 Ga0070659_1000248154 435
659 3300005367 Ga0070667_100000013 Ga0070667_100000013103 435
660 3300005564 Ga0070664_100107859 Ga0070664_1001078593 435
661 3300005577 Ga0068857_100042057 Ga0068857_1000420572 435
662 3300005618 Ga0068864_100012686 Ga0068864_1000126868 435
663 3300005841 Ga0068863_100000130 Ga0068863_10000013044 435
664 3300005841 Ga0068863_100007781 Ga0068863_10000778113 435
665 3300005842 Ga0068858_100038807 Ga0068858_1000388072 435
666 3300005844 Ga0068862_100000169 Ga0068862_10000016957 435
667 3300005844 Ga0068862_100078785 Ga0068862_1000787853 435
668 3300006847 Ga0075431_100052980 Ga0075431_1000529802 435
669 3300014326 Ga0157380_10032802 Ga0157380_100328024 435
670 3300017792 Ga0163161_10004433 Ga0163161_100044338 435
671 3300025229 Ga0209147_101545 Ga0209147_1015452 435
672 3300025315 Ga0207697_10000222 Ga0207697_1000022227 435
673 3300025315 Ga0207697_10002010 Ga0207697_100020102 435
674 3300025893 Ga0207682_10004803 Ga0207682_100048033 435
675 3300025903 Ga0207680_10000952 Ga0207680_100009529 435
676 3300025923 Ga0207681_10000002 Ga0207681_1000000287 435
677 3300025923 Ga0207681_10003943 Ga0207681_100039432 435
678 3300025923 Ga0207681_10009776 Ga0207681_100097767 435
679 3300025925 Ga0207650_10001564 Ga0207650_100015643 435
680 3300025925 Ga0207650_10020163 Ga0207650_100201633 435
681 3300025926 Ga0207659_10007604 Ga0207659_100076046 435
682 3300025931 Ga0207644_10000002 Ga0207644_1000000287 435
683 3300025933 Ga0207706_10018546 Ga0207706_100185463 435
684 3300025937 Ga0207669_10039534 Ga0207669_100395343 435
685 3300025940 Ga0207691_10074263 Ga0207691_100742631 435
686 3300025960 Ga0207651_10009540 Ga0207651_100095406 435
687 3300025972 Ga0207668_10000020 Ga0207668_1000002036 435
688 3300025972 Ga0207668_10000155 Ga0207668_1000015541 435
689 3300025986 Ga0207658_10000068 Ga0207658_10000068104 435
690 3300025986 Ga0207658_10005378 Ga0207658_100053788 435
691 3300026088 Ga0207641_10000074 Ga0207641_10000074108 435
692 3300026088 Ga0207641_10004716 Ga0207641_100047162 435
693 3300026089 Ga0207648_10041280 Ga0207648_100412804 435
694 3300026095 Ga0207676_10009084 Ga0207676_100090842 435
695 3300026118 Ga0207675_100000679 Ga0207675_1000006793 435
696 3300026118 Ga0207675_100108643 Ga0207675_1001086433 435
697 3300028380 Ga0268265_10000497 Ga0268265_1000049713 435
698 3300028381 Ga0268264_10000010 Ga0268264_10000010305 435
699 3300028381 Ga0268264_10008769 Ga0268264_100087692 435
700 3300031548 Ga0307408_100022473 Ga0307408_1000224733 435
701 3300031824 Ga0307413_10008583 Ga0307413_100085834 435
702 3300031824 Ga0307413_10026001 Ga0307413_100260013 435
703 3300031824 Ga0307413_10076418 Ga0307413_100764182 435
704 3300031824 Ga0307413_10091445 Ga0307413_100914453 435
705 3300031852 Ga0307410_10026204 Ga0307410_100262042 435
706 3300031852 Ga0307410_10079469 Ga0307410_100794692 435
707 3300031852 Ga0307410_10082237 Ga0307410_100822373 435
708 3300031901 Ga0307406_10009112 Ga0307406_100091123 435
709 3300031903 Ga0307407_10024640 Ga0307407_100246403 435
710 3300031903 Ga0307407_10039731 Ga0307407_100397311 435
711 3300031903 Ga0307407_10048941 Ga0307407_100489412 435
712 3300031911 Ga0307412_10002460 Ga0307412_100024602 435
713 3300031911 Ga0307412_10123010 Ga0307412_101230102 435
714 3300031911 Ga0307412_10130554 Ga0307412_101305542 435
715 3300031995 Ga0307409_100194771 Ga0307409_1001947712 435
716 3300031995 Ga0307409_100211166 Ga0307409_1002111663 435
717 3300031995 Ga0307409_100245034 Ga0307409_1002450342 435
718 3300032002 Ga0307416_100024489 Ga0307416_1000244893 435
719 3300032004 Ga0307414_10000696 Ga0307414_1000069617 435
720 3300032004 Ga0307414_10042492 Ga0307414_100424924 435
721 3300032004 Ga0307414_10067903 Ga0307414_100679032 435
722 3300032004 Ga0307414_10137489 Ga0307414_101374892 435
723 3300032004 Ga0307414_10198107 Ga0307414_101981071 435
724 3300032005 Ga0307411_10030652 Ga0307411_100306521 435
725 3300032005 Ga0307411_10053001 Ga0307411_100530012 435
726 3300032126 Ga0307415_100031406 Ga0307415_1000314063 435
727 3300037418 Ga0395900_0006624 Ga0395900_0006624_2396_3703 435
728 3300037471 Ga0395905_0000458 Ga0395905_0000458_23891_25198 435
729 3300042004 Ga0439445_0010981 Ga0439445_0010981_473_1780 435
730 3300046453 Ga0495627_001619 Ga0495627_001619_4377_5720 435
731 3300046512 Ga0495610_0000042 Ga0495610_0000042_133015_134358 435
732 3300046519 Ga0495632_0000049 Ga0495632_0000049_7058_8401 435
733 3300046522 Ga0495643_0000061 Ga0495643_0000061_13640_14983 435
734 3300046525 Ga0495663_0000009 Ga0495663_0000009_62698_64041 435
735 3300046528 Ga0495642_0068619 Ga0495642_0068619_89_1396 435
736 3300046539 Ga0495621_0000995 Ga0495621_0000995_2756_4063 435
737 3300046558 Ga0495633_0000862 Ga0495633_0000862_6132_7475 435
738 3300046692 Ga0495671_0000036 Ga0495671_0000036_13640_14983 435
739 3300047470 Ga0495681_0000006 Ga0495681_0000006_58940_60283 435
740 3300047472 Ga0495686_0008764 Ga0495686_0008764_4264_5607 435
741 3300048917 Ga0496114_0001341 Ga0496114_0001341_4068_5375 435
742 3300049664 Ga0501224_000012 Ga0501224_000012_27026_28339 435
743 3300049705 Ga0501225_0000019 Ga0501225_0000019_26970_28283 435
744 3300049765 Ga0501268_004138 Ga0501268_004138_481_1788 435
745 3300049853 Ga0501226_000384 Ga0501226_000384_4806_6119 435
746 3300053087 Ga0500643_003093 Ga0500643_003093_3600_4952 435
747 iso_pu_bacteria 2919709256 2919710023 435
748 3300001904 JGI24736J21556_1003865 JGI24736J21556_10038654 436
749 3300001979 JGI24740J21852_10006008 JGI24740J21852_100060083 436
750 3300001979 JGI24740J21852_10017845 JGI24740J21852_100178452 436
751 3300001989 JGI24739J22299_10003176 JGI24739J22299_100031763 436
752 3300001990 JGI24737J22298_10000102 JGI24737J22298_100001029 436
753 3300001990 JGI24737J22298_10001746 JGI24737J22298_100017464 436
754 3300001991 JGI24743J22301_10003073 JGI24743J22301_100030733 436
755 3300001991 JGI24743J22301_10003317 JGI24743J22301_100033174 436
756 3300002075 JGI24738J21930_10000384 JGI24738J21930_100003844 436
757 3300002075 JGI24738J21930_10003243 JGI24738J21930_100032433 436
758 3300005327 Ga0070658_10000966 Ga0070658_100009666 436
759 3300005327 Ga0070658_10191749 Ga0070658_101917492 436
760 3300005327 Ga0070658_10231253 Ga0070658_102312532 436
761 3300005328 Ga0070676_10095647 Ga0070676_100956473 436
762 3300005328 Ga0070676_10139966 Ga0070676_101399661 436
763 3300005329 Ga0070683_100005971 Ga0070683_1000059714 436
764 3300005331 Ga0070670_100047492 Ga0070670_1000474923 436
765 3300005334 Ga0068869_100099436 Ga0068869_1000994362 436
766 3300005335 Ga0070666_10004828 Ga0070666_100048286 436
767 3300005335 Ga0070666_10040576 Ga0070666_100405764 436
768 3300005335 Ga0070666_10043882 Ga0070666_100438824 436
769 3300005335 Ga0070666_10045183 Ga0070666_100451833 436
770 3300005335 Ga0070666_10077188 Ga0070666_100771882 436
771 3300005338 Ga0068868_100040056 Ga0068868_1000400564 436
772 3300005338 Ga0068868_100087169 Ga0068868_1000871693 436
773 3300005339 Ga0070660_100000585 Ga0070660_1000005856 436
774 3300005339 Ga0070660_100011096 Ga0070660_1000110968 436
775 3300005339 Ga0070660_100024838 Ga0070660_1000248385 436
776 3300005339 Ga0070660_100139448 Ga0070660_1001394482 436
777 3300005339 Ga0070660_100202944 Ga0070660_1002029442 436
778 3300005340 Ga0070689_100131406 Ga0070689_1001314063 436
779 3300005344 Ga0070661_100000696 Ga0070661_1000006966 436
780 3300005344 Ga0070661_100023324 Ga0070661_1000233244 436
781 3300005344 Ga0070661_100076587 Ga0070661_1000765874 436
782 3300005344 Ga0070661_100083851 Ga0070661_1000838512 436
783 3300005345 Ga0070692_10013516 Ga0070692_100135164 436
784 3300005347 Ga0070668_100010571 Ga0070668_1000105714 436
785 3300005353 Ga0070669_100019062 Ga0070669_1000190625 436
786 3300005353 Ga0070669_100070048 Ga0070669_1000700483 436
787 3300005353 Ga0070669_100083117 Ga0070669_1000831173 436
788 3300005354 Ga0070675_100105261 Ga0070675_1001052612 436
789 3300005355 Ga0070671_100002220 Ga0070671_10000222013 436
790 3300005355 Ga0070671_100004500 Ga0070671_10000450012 436
791 3300005355 Ga0070671_100005321 Ga0070671_1000053217 436
792 3300005355 Ga0070671_100034531 Ga0070671_1000345313 436
793 3300005355 Ga0070671_100075604 Ga0070671_1000756043 436
794 3300005364 Ga0070673_100000146 Ga0070673_1000001464 436
795 3300005364 Ga0070673_100001874 Ga0070673_1000018746 436
796 3300005364 Ga0070673_100044165 Ga0070673_1000441655 436
797 3300005366 Ga0070659_100000905 Ga0070659_10000090510 436
798 3300005366 Ga0070659_100025030 Ga0070659_1000250302 436
799 3300005366 Ga0070659_100060643 Ga0070659_1000606435 436
800 3300005366 Ga0070659_100061242 Ga0070659_1000612424 436
801 3300005366 Ga0070659_100134692 Ga0070659_1001346922 436
802 3300005367 Ga0070667_100010054 Ga0070667_1000100544 436
803 3300005367 Ga0070667_100010329 Ga0070667_1000103294 436
804 3300005367 Ga0070667_100010916 Ga0070667_1000109168 436
805 3300005367 Ga0070667_100014425 Ga0070667_1000144254 436
806 3300005367 Ga0070667_100014944 Ga0070667_1000149448 436
807 3300005367 Ga0070667_100015186 Ga0070667_1000151865 436
808 3300005367 Ga0070667_100017661 Ga0070667_1000176617 436
809 3300005435 Ga0070714_100020083 Ga0070714_1000200836 436
810 3300005436 Ga0070713_100012601 Ga0070713_1000126015 436
811 3300005436 Ga0070713_100188885 Ga0070713_1001888851 436
812 3300005455 Ga0070663_100002310 Ga0070663_10000231010 436
813 3300005455 Ga0070663_100081380 Ga0070663_1000813803 436
814 3300005457 Ga0070662_100000024 Ga0070662_10000002472 436
815 3300005457 Ga0070662_100001981 Ga0070662_10000198110 436
816 3300005457 Ga0070662_100002906 Ga0070662_1000029065 436
817 3300005457 Ga0070662_100064761 Ga0070662_1000647614 436
818 3300005459 Ga0068867_100004266 Ga0068867_1000042665 436
819 3300005530 Ga0070679_100202233 Ga0070679_1002022332 436
820 3300005535 Ga0070684_100074399 Ga0070684_1000743994 436
821 3300005539 Ga0068853_100000033 Ga0068853_10000003325 436
822 3300005539 Ga0068853_100027580 Ga0068853_1000275805 436
823 3300005543 Ga0070672_100022620 Ga0070672_1000226203 436
824 3300005548 Ga0070665_100009968 Ga0070665_10000996813 436
825 3300005548 Ga0070665_100010871 Ga0070665_1000108715 436
826 3300005548 Ga0070665_100124737 Ga0070665_1001247375 436
827 3300005563 Ga0068855_100006863 Ga0068855_10000686317 436
828 3300005563 Ga0068855_100078730 Ga0068855_1000787303 436
829 3300005564 Ga0070664_100000764 Ga0070664_10000076423 436
830 3300005564 Ga0070664_100015651 Ga0070664_1000156512 436
831 3300005564 Ga0070664_100038187 Ga0070664_1000381873 436
832 3300005564 Ga0070664_100147224 Ga0070664_1001472244 436
833 3300005577 Ga0068857_100010277 Ga0068857_1000102775 436
834 3300005577 Ga0068857_100012593 Ga0068857_1000125933 436
835 3300005577 Ga0068857_100043291 Ga0068857_1000432912 436
836 3300005578 Ga0068854_100017252 Ga0068854_1000172523 436
837 3300005578 Ga0068854_100062502 Ga0068854_1000625024 436
838 3300005578 Ga0068854_100116842 Ga0068854_1001168422 436
839 3300005578 Ga0068854_100220773 Ga0068854_1002207732 436
840 3300005578 Ga0068854_100235426 Ga0068854_1002354262 436
841 3300005614 Ga0068856_100000744 Ga0068856_10000074428 436
842 3300005616 Ga0068852_100005763 Ga0068852_1000057637 436
843 3300005616 Ga0068852_100030452 Ga0068852_1000304526 436
844 3300005616 Ga0068852_100031198 Ga0068852_1000311983 436
845 3300005617 Ga0068859_100000068 Ga0068859_10000006812 436
846 3300005618 Ga0068864_100000591 Ga0068864_10000059110 436
847 3300005618 Ga0068864_100002620 Ga0068864_1000026207 436
848 3300005618 Ga0068864_100046591 Ga0068864_1000465915 436
849 3300005618 Ga0068864_100057733 Ga0068864_1000577334 436
850 3300005618 Ga0068864_100263936 Ga0068864_1002639361 436
851 3300005841 Ga0068863_100006118 Ga0068863_10000611816 436
852 3300005841 Ga0068863_100008721 Ga0068863_10000872112 436
853 3300005841 Ga0068863_100010854 Ga0068863_10001085413 436
854 3300005841 Ga0068863_100030254 Ga0068863_1000302545 436
855 3300005842 Ga0068858_100017756 Ga0068858_1000177566 436
856 3300005842 Ga0068858_100024117 Ga0068858_1000241173 436
857 3300005842 Ga0068858_100161837 Ga0068858_1001618372 436
858 3300005843 Ga0068860_100006940 Ga0068860_1000069405 436
859 3300005843 Ga0068860_100063473 Ga0068860_1000634734 436
860 3300005843 Ga0068860_100223746 Ga0068860_1002237464 436
861 3300005844 Ga0068862_100007437 Ga0068862_1000074377 436
862 3300005844 Ga0068862_100028628 Ga0068862_1000286286 436
863 3300005844 Ga0068862_100038545 Ga0068862_1000385455 436
864 3300005985 Ga0081539_10027988 Ga0081539_100279883 436
865 3300006237 Ga0097621_100041211 Ga0097621_1000412115 436
866 3300006358 Ga0068871_100017276 Ga0068871_1000172765 436
867 3300006852 Ga0075433_10037263 Ga0075433_100372636 436
868 3300006881 Ga0068865_100019947 Ga0068865_1000199475 436
869 3300006881 Ga0068865_100078138 Ga0068865_1000781384 436
870 3300006931 Ga0097620_100000068 Ga0097620_10000006812 436
871 3300009092 Ga0105250_10016009 Ga0105250_100160096 436
872 3300009098 Ga0105245_10037482 Ga0105245_100374823 436
873 3300009098 Ga0105245_10106548 Ga0105245_101065484 436
874 3300009148 Ga0105243_10189947 Ga0105243_101899471 436
875 3300009177 Ga0105248_10000059 Ga0105248_1000005952 436
876 3300009177 Ga0105248_10000071 Ga0105248_10000071115 436
877 3300009177 Ga0105248_10000096 Ga0105248_1000009631 436
878 3300009177 Ga0105248_10001063 Ga0105248_1000106312 436
879 3300009177 Ga0105248_10008735 Ga0105248_1000873511 436
880 3300009177 Ga0105248_10107564 Ga0105248_101075646 436
881 3300009545 Ga0105237_10045486 Ga0105237_100454864 436
882 3300009551 Ga0105238_10015374 Ga0105238_100153748 436
883 3300009551 Ga0105238_10062956 Ga0105238_100629564 436
884 3300009553 Ga0105249_10178415 Ga0105249_101784152 436
885 3300012513 Ga0157326_1000993 Ga0157326_10009932 436
886 3300013102 Ga0157371_10007471 Ga0157371_100074717 436
887 3300013102 Ga0157371_10012723 Ga0157371_100127234 436
888 3300013102 Ga0157371_10166038 Ga0157371_101660381 436
889 3300013104 Ga0157370_10017186 Ga0157370_100171864 436
890 3300013105 Ga0157369_10050738 Ga0157369_100507386 436
891 3300013296 Ga0157374_10187622 Ga0157374_101876221 436
892 3300013297 Ga0157378_10030218 Ga0157378_100302181 436
893 3300013306 Ga0163162_10052450 Ga0163162_100524504 436
894 3300013307 Ga0157372_10066650 Ga0157372_100666503 436
895 3300013308 Ga0157375_10025773 Ga0157375_100257737 436
896 3300013308 Ga0157375_10087316 Ga0157375_100873167 436
897 3300014325 Ga0163163_10000573 Ga0163163_1000057336 436
898 3300014325 Ga0163163_10001821 Ga0163163_1000182117 436
899 3300014968 Ga0157379_10045190 Ga0157379_100451904 436
900 3300014968 Ga0157379_10057793 Ga0157379_100577934 436
901 3300014969 Ga0157376_10217148 Ga0157376_102171482 436
902 3300025315 Ga0207697_10004976 Ga0207697_100049765 436
903 3300025711 Ga0207696_1022674 Ga0207696_10226744 436
904 3300025899 Ga0207642_10063146 Ga0207642_100631463 436
905 3300025901 Ga0207688_10007700 Ga0207688_100077006 436
906 3300025901 Ga0207688_10050871 Ga0207688_100508714 436
907 3300025903 Ga0207680_10007339 Ga0207680_100073393 436
908 3300025903 Ga0207680_10026035 Ga0207680_100260354 436
909 3300025903 Ga0207680_10126875 Ga0207680_101268753 436
910 3300025904 Ga0207647_10006289 Ga0207647_100062895 436
911 3300025904 Ga0207647_10011520 Ga0207647_100115204 436
912 3300025907 Ga0207645_10046366 Ga0207645_100463664 436
913 3300025909 Ga0207705_10000062 Ga0207705_1000006270 436
914 3300025909 Ga0207705_10081940 Ga0207705_100819402 436
915 3300025909 Ga0207705_10127991 Ga0207705_101279913 436
916 3300025909 Ga0207705_10135774 Ga0207705_101357742 436
917 3300025919 Ga0207657_10004231 Ga0207657_100042314 436
918 3300025919 Ga0207657_10012965 Ga0207657_1001296510 436
919 3300025919 Ga0207657_10042510 Ga0207657_100425105 436
920 3300025919 Ga0207657_10064175 Ga0207657_100641755 436
921 3300025920 Ga0207649_10000248 Ga0207649_1000024811 436
922 3300025920 Ga0207649_10038078 Ga0207649_100380781 436
923 3300025921 Ga0207652_10145870 Ga0207652_101458702 436
924 3300025923 Ga0207681_10047181 Ga0207681_100471813 436
925 3300025923 Ga0207681_10088162 Ga0207681_100881623 436
926 3300025923 Ga0207681_10123421 Ga0207681_101234212 436
927 3300025924 Ga0207694_10006428 Ga0207694_100064289 436
928 3300025924 Ga0207694_10041008 Ga0207694_100410084 436
929 3300025925 Ga0207650_10008743 Ga0207650_100087433 436
930 3300025925 Ga0207650_10016417 Ga0207650_100164173 436
931 3300025925 Ga0207650_10042759 Ga0207650_100427593 436
932 3300025925 Ga0207650_10106303 Ga0207650_101063032 436
933 3300025926 Ga0207659_10018329 Ga0207659_100183295 436
934 3300025926 Ga0207659_10073841 Ga0207659_100738413 436
935 3300025926 Ga0207659_10101431 Ga0207659_101014311 436
936 3300025927 Ga0207687_10009473 Ga0207687_100094737 436
937 3300025929 Ga0207664_10006221 Ga0207664_100062216 436
938 3300025931 Ga0207644_10000235 Ga0207644_1000023518 436
939 3300025931 Ga0207644_10001259 Ga0207644_1000125912 436
940 3300025931 Ga0207644_10004811 Ga0207644_100048119 436
941 3300025931 Ga0207644_10008124 Ga0207644_100081244 436
942 3300025931 Ga0207644_10025000 Ga0207644_100250002 436
943 3300025931 Ga0207644_10029403 Ga0207644_100294035 436
944 3300025931 Ga0207644_10056322 Ga0207644_100563222 436
945 3300025931 Ga0207644_10073806 Ga0207644_100738063 436
946 3300025931 Ga0207644_10085469 Ga0207644_100854692 436
947 3300025932 Ga0207690_10000032 Ga0207690_1000003217 436
948 3300025932 Ga0207690_10008596 Ga0207690_100085961 436
949 3300025932 Ga0207690_10178168 Ga0207690_101781682 436
950 3300025933 Ga0207706_10000032 Ga0207706_10000032143 436
951 3300025933 Ga0207706_10000194 Ga0207706_1000019469 436
952 3300025933 Ga0207706_10029322 Ga0207706_100293225 436
953 3300025933 Ga0207706_10047401 Ga0207706_100474016 436
954 3300025933 Ga0207706_10061592 Ga0207706_100615925 436
955 3300025933 Ga0207706_10131631 Ga0207706_101316314 436
956 3300025936 Ga0207670_10065428 Ga0207670_100654281 436
957 3300025936 Ga0207670_10135088 Ga0207670_101350883 436
958 3300025937 Ga0207669_10086252 Ga0207669_100862524 436
959 3300025938 Ga0207704_10025003 Ga0207704_100250033 436
960 3300025940 Ga0207691_10011704 Ga0207691_1001170410 436
961 3300025940 Ga0207691_10019348 Ga0207691_100193484 436
962 3300025940 Ga0207691_10024770 Ga0207691_100247707 436
963 3300025940 Ga0207691_10056900 Ga0207691_100569007 436
964 3300025941 Ga0207711_10000046 Ga0207711_1000004688 436
965 3300025941 Ga0207711_10000476 Ga0207711_1000047640 436
966 3300025941 Ga0207711_10001111 Ga0207711_100011118 436
967 3300025941 Ga0207711_10003731 Ga0207711_1000373116 436
968 3300025941 Ga0207711_10004041 Ga0207711_100040414 436
969 3300025941 Ga0207711_10004129 Ga0207711_100041297 436
970 3300025941 Ga0207711_10005858 Ga0207711_100058589 436
971 3300025941 Ga0207711_10013274 Ga0207711_100132744 436
972 3300025942 Ga0207689_10000094 Ga0207689_1000009411 436
973 3300025942 Ga0207689_10215251 Ga0207689_102152511 436
974 3300025944 Ga0207661_10005798 Ga0207661_1000579812 436
975 3300025945 Ga0207679_10000466 Ga0207679_1000046625 436
976 3300025945 Ga0207679_10002201 Ga0207679_100022014 436
977 3300025945 Ga0207679_10059975 Ga0207679_100599753 436
978 3300025945 Ga0207679_10066731 Ga0207679_100667312 436
979 3300025949 Ga0207667_10021603 Ga0207667_100216034 436
980 3300025949 Ga0207667_10044832 Ga0207667_100448323 436
981 3300025949 Ga0207667_10116974 Ga0207667_101169745 436
982 3300025960 Ga0207651_10000404 Ga0207651_100004041 436
983 3300025960 Ga0207651_10002467 Ga0207651_100024679 436
984 3300025960 Ga0207651_10030614 Ga0207651_100306142 436
985 3300025960 Ga0207651_10032970 Ga0207651_100329703 436
986 3300025960 Ga0207651_10039102 Ga0207651_100391024 436
987 3300025960 Ga0207651_10067526 Ga0207651_100675263 436
988 3300025972 Ga0207668_10000060 Ga0207668_1000006058 436
989 3300025981 Ga0207640_10004706 Ga0207640_100047065 436
990 3300025981 Ga0207640_10026460 Ga0207640_100264603 436
991 3300025986 Ga0207658_10002200 Ga0207658_1000220010 436
992 3300025986 Ga0207658_10009590 Ga0207658_100095904 436
993 3300025986 Ga0207658_10011898 Ga0207658_100118986 436
994 3300025986 Ga0207658_10015373 Ga0207658_100153735 436
995 3300025986 Ga0207658_10019169 Ga0207658_100191694 436
996 3300025986 Ga0207658_10024468 Ga0207658_100244682 436
997 3300025986 Ga0207658_10055464 Ga0207658_100554644 436
998 3300025986 Ga0207658_10078251 Ga0207658_100782516 436
999 3300026023 Ga0207677_10024073 Ga0207677_100240734 436
1000 3300026023 Ga0207677_10051929 Ga0207677_100519294 436
1001 3300026023 Ga0207677_10161744 Ga0207677_101617442 436
1002 3300026035 Ga0207703_10005610 Ga0207703_100056108 436
1003 3300026035 Ga0207703_10006776 Ga0207703_100067767 436
1004 3300026035 Ga0207703_10011862 Ga0207703_100118623 436
1005 3300026035 Ga0207703_10047440 Ga0207703_100474404 436
1006 3300026041 Ga0207639_10000410 Ga0207639_1000041025 436
1007 3300026067 Ga0207678_10034597 Ga0207678_100345973 436
1008 3300026067 Ga0207678_10153613 Ga0207678_101536133 436
1009 3300026067 Ga0207678_10177912 Ga0207678_101779122 436
1010 3300026078 Ga0207702_10001312 Ga0207702_1000131211 436
1011 3300026088 Ga0207641_10000534 Ga0207641_1000053412 436
1012 3300026088 Ga0207641_10013361 Ga0207641_100133618 436
1013 3300026088 Ga0207641_10016475 Ga0207641_100164756 436
1014 3300026088 Ga0207641_10031019 Ga0207641_100310194 436
1015 3300026088 Ga0207641_10045478 Ga0207641_100454784 436
1016 3300026089 Ga0207648_10050131 Ga0207648_100501314 436
1017 3300026089 Ga0207648_10229113 Ga0207648_102291132 436
1018 3300026095 Ga0207676_10001250 Ga0207676_1000125023 436
1019 3300026095 Ga0207676_10027753 Ga0207676_100277534 436
1020 3300026095 Ga0207676_10036672 Ga0207676_100366726 436
1021 3300026116 Ga0207674_10000345 Ga0207674_1000034521 436
1022 3300026116 Ga0207674_10001571 Ga0207674_1000157121 436
1023 3300026116 Ga0207674_10007097 Ga0207674_1000709712 436
1024 3300026116 Ga0207674_10012272 Ga0207674_1001227213 436
1025 3300026116 Ga0207674_10016212 Ga0207674_100162124 436
1026 3300026121 Ga0207683_10017542 Ga0207683_100175424 436
1027 3300026142 Ga0207698_10001539 Ga0207698_100015399 436
1028 3300026142 Ga0207698_10019103 Ga0207698_100191035 436
1029 3300026142 Ga0207698_10090961 Ga0207698_100909613 436
1030 3300028379 Ga0268266_10000133 Ga0268266_10000133138 436
1031 3300028379 Ga0268266_10014556 Ga0268266_100145569 436
1032 3300028379 Ga0268266_10014590 Ga0268266_100145906 436
1033 3300028379 Ga0268266_10050327 Ga0268266_100503274 436
1034 3300028380 Ga0268265_10001936 Ga0268265_1000193616 436
1035 3300028380 Ga0268265_10009185 Ga0268265_1000918510 436
1036 3300028380 Ga0268265_10057140 Ga0268265_100571404 436
1037 3300028381 Ga0268264_10000395 Ga0268264_1000039556 436
1038 3300028381 Ga0268264_10125457 Ga0268264_101254574 436
1039 3300028381 Ga0268264_10252785 Ga0268264_102527851 436
1040 3300031548 Ga0307408_100029746 Ga0307408_1000297463 436
1041 3300031548 Ga0307408_100039543 Ga0307408_1000395435 436
1042 3300031731 Ga0307405_10002170 Ga0307405_100021709 436
1043 3300031731 Ga0307405_10055012 Ga0307405_100550124 436
1044 3300031824 Ga0307413_10006516 Ga0307413_100065163 436
1045 3300031824 Ga0307413_10010486 Ga0307413_100104866 436
1046 3300031824 Ga0307413_10024309 Ga0307413_100243094 436
1047 3300031824 Ga0307413_10044725 Ga0307413_100447253 436
1048 3300031824 Ga0307413_10049522 Ga0307413_100495223 436
1049 3300031824 Ga0307413_10060419 Ga0307413_100604192 436
1050 3300031824 Ga0307413_10185824 Ga0307413_101858242 436
1051 3300031852 Ga0307410_10001447 Ga0307410_100014473 436
1052 3300031852 Ga0307410_10013550 Ga0307410_100135504 436
1053 3300031852 Ga0307410_10015447 Ga0307410_100154475 436
1054 3300031852 Ga0307410_10016353 Ga0307410_100163535 436
1055 3300031852 Ga0307410_10022994 Ga0307410_100229941 436
1056 3300031901 Ga0307406_10011820 Ga0307406_100118203 436
1057 3300031901 Ga0307406_10029678 Ga0307406_100296781 436
1058 3300031901 Ga0307406_10075630 Ga0307406_100756301 436
1059 3300031903 Ga0307407_10002499 Ga0307407_100024993 436
1060 3300031903 Ga0307407_10006203 Ga0307407_100062035 436
1061 3300031911 Ga0307412_10100081 Ga0307412_101000812 436
1062 3300031995 Ga0307409_100007774 Ga0307409_1000077744 436
1063 3300031995 Ga0307409_100014611 Ga0307409_1000146114 436
1064 3300031995 Ga0307409_100016234 Ga0307409_1000162344 436
1065 3300031995 Ga0307409_100028691 Ga0307409_1000286915 436
1066 3300031995 Ga0307409_100060421 Ga0307409_1000604213 436
1067 3300031995 Ga0307409_100139814 Ga0307409_1001398143 436
1068 3300031995 Ga0307409_100156493 Ga0307409_1001564932 436
1069 3300031995 Ga0307409_100266369 Ga0307409_1002663692 436
1070 3300032002 Ga0307416_100018305 Ga0307416_1000183056 436
1071 3300032002 Ga0307416_100037974 Ga0307416_1000379742 436
1072 3300032002 Ga0307416_100066937 Ga0307416_1000669374 436
1073 3300032004 Ga0307414_10007509 Ga0307414_100075097 436
1074 3300032004 Ga0307414_10045286 Ga0307414_100452864 436
1075 3300032004 Ga0307414_10057484 Ga0307414_100574843 436
1076 3300032004 Ga0307414_10065753 Ga0307414_100657532 436
1077 3300032005 Ga0307411_10001019 Ga0307411_1000101911 436
1078 3300032005 Ga0307411_10010141 Ga0307411_100101415 436
1079 3300032005 Ga0307411_10011253 Ga0307411_100112533 436
1080 3300032005 Ga0307411_10116783 Ga0307411_101167833 436
1081 3300032126 Ga0307415_100006146 Ga0307415_1000061463 436
1082 3300032126 Ga0307415_100015744 Ga0307415_1000157444 436
1083 3300032126 Ga0307415_100034485 Ga0307415_1000344855 436
1084 3300032126 Ga0307415_100035995 Ga0307415_1000359954 436
1085 3300032126 Ga0307415_100231788 Ga0307415_1002317882 436
1086 3300034816 Ga0373930_0012330 Ga0373930_0012330_185_1495 436
1087 3300035118 Ga0373954_0014927 Ga0373954_0014927_1476_2786 436
1088 3300035119 Ga0373956_0052172 Ga0373956_0052172_404_1714 436
1089 3300035172 Ga0373955_0008899 Ga0373955_0008899_2380_3690 436
1090 3300035691 Ga0373931_0009005 Ga0373931_0009005_3295_4605 436
1091 3300035724 Ga0373933_0010147 Ga0373933_0010147_919_2229 436
1092 3300036401 Ga0373937_0002661 Ga0373937_0002661_12254_13564 436
1093 3300037312 Ga0395899_0000911 Ga0395899_0000911_2596_3906 436
1094 3300037312 Ga0395899_0013558 Ga0395899_0013558_326_1636 436
1095 3300037312 Ga0395899_0056270 Ga0395899_0056270_1168_2478 436
1096 3300037312 Ga0395899_0064532 Ga0395899_0064532_772_2082 436
1097 3300037312 Ga0395899_0120497 Ga0395899_0120497_155_1465 436
1098 3300037418 Ga0395900_0018968 Ga0395900_0018968_1094_2404 436
1099 3300037418 Ga0395900_0023644 Ga0395900_0023644_3748_5058 436
1100 3300037418 Ga0395900_0054396 Ga0395900_0054396_109_1419 436
1101 3300037418 Ga0395900_0058500 Ga0395900_0058500_2238_3548 436
1102 3300037418 Ga0395900_0105956 Ga0395900_0105956_701_2011 436
1103 3300037418 Ga0395900_0145729 Ga0395900_0145729_155_1465 436
1104 3300037418 Ga0395900_0162662 Ga0395900_0162662_653_1963 436
1105 3300037418 Ga0395900_0191614 Ga0395900_0191614_547_1857 436
1106 3300037418 Ga0395900_0359317 Ga0395900_0359317_108_1418 436
1107 3300037466 Ga0395898_0006934 Ga0395898_0006934_6242_7552 436
1108 3300037466 Ga0395898_0025383 Ga0395898_0025383_2867_4177 436
1109 3300037466 Ga0395898_0074670 Ga0395898_0074670_1017_2327 436
1110 3300037466 Ga0395898_0102746 Ga0395898_0102746_356_1666 436
1111 3300037466 Ga0395898_0185383 Ga0395898_0185383_58_1368 436
1112 3300037471 Ga0395905_0000193 Ga0395905_0000193_18400_19710 436
1113 3300037471 Ga0395905_0001063 Ga0395905_0001063_20175_21485 436
1114 3300037471 Ga0395905_0003104 Ga0395905_0003104_1846_3156 436
1115 3300037471 Ga0395905_0004408 Ga0395905_0004408_2565_3875 436
1116 3300037471 Ga0395905_0004878 Ga0395905_0004878_4367_5677 436
1117 3300037471 Ga0395905_0008684 Ga0395905_0008684_4064_5374 436
1118 3300037471 Ga0395905_0018797 Ga0395905_0018797_2341_3651 436
1119 3300037471 Ga0395905_0020585 Ga0395905_0020585_2799_4109 436
1120 3300037471 Ga0395905_0048859 Ga0395905_0048859_1098_2408 436
1121 3300037471 Ga0395905_0059018 Ga0395905_0059018_1908_3218 436
1122 3300037471 Ga0395905_0064849 Ga0395905_0064849_525_1835 436
1123 3300037471 Ga0395905_0070857 Ga0395905_0070857_135_1445 436
1124 3300037471 Ga0395905_0080260 Ga0395905_0080260_393_1703 436
1125 3300037471 Ga0395905_0082712 Ga0395905_0082712_260_1570 436
1126 3300037471 Ga0395905_0083807 Ga0395905_0083807_1549_2859 436
1127 3300037471 Ga0395905_0096687 Ga0395905_0096687_309_1619 436
1128 3300037471 Ga0395905_0101887 Ga0395905_0101887_145_1455 436
1129 3300037471 Ga0395905_0130160 Ga0395905_0130160_585_1895 436
1130 3300037471 Ga0395905_0138896 Ga0395905_0138896_771_2081 436
1131 3300037853 Ga0436364_0351684 Ga0436364_0351684_1554_2864 436
1132 3300037853 Ga0436364_0868202 Ga0436364_0868202_126_1442 436
1133 3300038443 Ga0395901_0000681 Ga0395901_0000681_24488_25798 436
1134 3300038443 Ga0395901_0006446 Ga0395901_0006446_2005_3315 436
1135 3300038443 Ga0395901_0006751 Ga0395901_0006751_7274_8584 436
1136 3300038443 Ga0395901_0030266 Ga0395901_0030266_98_1408 436
1137 3300038443 Ga0395901_0041623 Ga0395901_0041623_1419_2729 436
1138 3300038443 Ga0395901_0108836 Ga0395901_0108836_1415_2725 436
1139 3300038443 Ga0395901_0131677 Ga0395901_0131677_154_1464 436
1140 3300038443 Ga0395901_0134678 Ga0395901_0134678_368_1678 436
1141 3300038443 Ga0395901_0339351 Ga0395901_0339351_40_1350 436
1142 3300039437 Ga0436365_0304676 Ga0436365_0304676_789_2099 436
1143 3300042157 Ga0439458_0009956 Ga0439458_0009956_165_1475 436
1144 3300044684 Ga0466966_0037542 Ga0466966_0037542_24_1334 436
1145 3300044693 Ga0466961_0041104 Ga0466961_0041104_232_1542 436
1146 3300044735 Ga0466968_0029949 Ga0466968_0029949_348_1658 436
1147 3300044765 Ga0466970_0035274 Ga0466970_0035274_1036_2346 436
1148 3300044842 Ga0466957_0045646 Ga0466957_0045646_1046_2356 436
1149 3300045976 Ga0466967_0006643 Ga0466967_0006643_2161_3471 436
1150 3300045976 Ga0466967_0249478 Ga0466967_0249478_260_1570 436
1151 3300046537 Ga0495598_0001030 Ga0495598_0001030_1966_3276 436
1152 3300046537 Ga0495598_0005097 Ga0495598_0005097_128_1438 436
1153 3300046539 Ga0495621_0000301 Ga0495621_0000301_8574_9884 436
1154 3300046539 Ga0495621_0000483 Ga0495621_0000483_2096_3406 436
1155 3300046558 Ga0495633_0002648 Ga0495633_0002648_9226_10536 436
1156 3300046684 Ga0495669_0011145 Ga0495669_0011145_711_2021 436
1157 3300046684 Ga0495669_0048701 Ga0495669_0048701_443_1753 436
1158 3300048904 Ga0496101_0092061 Ga0496101_0092061_781_2091 436
1159 3300048906 Ga0496103_0170545 Ga0496103_0170545_51_1361 436
1160 3300048909 Ga0496106_0002579 Ga0496106_0002579_3168_4478 436
1161 3300048909 Ga0496106_0047931 Ga0496106_0047931_687_1997 436
1162 3300048910 Ga0496107_0007167 Ga0496107_0007167_3279_4589 436
1163 3300048910 Ga0496107_0111244 Ga0496107_0111244_281_1591 436
1164 3300048911 Ga0496108_0002842 Ga0496108_0002842_7325_8635 436
1165 3300048911 Ga0496108_0004161 Ga0496108_0004161_8922_10232 436
1166 3300048911 Ga0496108_0014571 Ga0496108_0014571_2714_4024 436
1167 3300048911 Ga0496108_0077670 Ga0496108_0077670_1115_2425 436
1168 3300048912 Ga0496109_0002390 Ga0496109_0002390_14078_15388 436
1169 3300048912 Ga0496109_0006017 Ga0496109_0006017_4053_5363 436
1170 3300048912 Ga0496109_0016069 Ga0496109_0016069_5171_6481 436
1171 3300048912 Ga0496109_0066955 Ga0496109_0066955_968_2278 436
1172 3300048913 Ga0496110_0001980 Ga0496110_0001980_5913_7223 436
1173 3300048913 Ga0496110_0004761 Ga0496110_0004761_6262_7572 436
1174 3300048913 Ga0496110_0005147 Ga0496110_0005147_7422_8732 436
1175 3300048913 Ga0496110_0046648 Ga0496110_0046648_1099_2409 436
1176 3300048914 Ga0496111_0058187 Ga0496111_0058187_214_1524 436
1177 3300048914 Ga0496111_0075507 Ga0496111_0075507_1056_2366 436
1178 3300048915 Ga0496112_0011382 Ga0496112_0011382_5530_6840 436
1179 3300048915 Ga0496112_0024319 Ga0496112_0024319_3767_5077 436
1180 3300048915 Ga0496112_0065060 Ga0496112_0065060_1271_2581 436
1181 3300048915 Ga0496112_0070443 Ga0496112_0070443_1240_2550 436
1182 3300048915 Ga0496112_0088605 Ga0496112_0088605_211_1521 436
1183 3300048916 Ga0496113_0025789 Ga0496113_0025789_2592_3902 436
1184 3300048916 Ga0496113_0029425 Ga0496113_0029425_1165_2475 436
1185 3300048916 Ga0496113_0034457 Ga0496113_0034457_1431_2741 436
1186 3300048916 Ga0496113_0155503 Ga0496113_0155503_140_1450 436
1187 3300048917 Ga0496114_0169511 Ga0496114_0169511_535_1845 436
1188 3300048918 Ga0496115_0000571 Ga0496115_0000571_12511_13821 436
1189 3300050515 nmdc:mga0a205_4433_c1 nmdc:mga0a205_4433_c1_5716_7056 436
1190 3300053134 Ga0500658_0000219 Ga0500658_0000219_3483_4793 436
1191 3300001904 JGI24736J21556_1000108 JGI24736J21556_10001082 441
1192 3300001915 JGI24741J21665_1004845 JGI24741J21665_10048455 441
1193 3300001979 JGI24740J21852_10002500 JGI24740J21852_1000250011 441
1194 3300001979 JGI24740J21852_10004864 JGI24740J21852_100048645 441
1195 3300001990 JGI24737J22298_10013495 JGI24737J22298_100134956 441
1196 3300001990 JGI24737J22298_10014855 JGI24737J22298_100148551 441
1197 3300002067 JGI24735J21928_10010391 JGI24735J21928_100103915 441
1198 3300005327 Ga0070658_10037260 Ga0070658_100372604 441
1199 3300005327 Ga0070658_10238026 Ga0070658_102380262 441
1200 3300005329 Ga0070683_100001903 Ga0070683_10000190316 441
1201 3300005331 Ga0070670_100009416 Ga0070670_1000094166 441
1202 3300005336 Ga0070680_100004062 Ga0070680_1000040629 441
1203 3300005336 Ga0070680_100011819 Ga0070680_1000118198 441
1204 3300005336 Ga0070680_100014569 Ga0070680_1000145697 441
1205 3300005336 Ga0070680_100070846 Ga0070680_1000708461 441
1206 3300005337 Ga0070682_100049332 Ga0070682_1000493324 441
1207 3300005337 Ga0070682_100180103 Ga0070682_1001801031 441
1208 3300005338 Ga0068868_100046622 Ga0068868_1000466224 441
1209 3300005339 Ga0070660_100061546 Ga0070660_1000615464 441
1210 3300005344 Ga0070661_100105301 Ga0070661_1001053011 441
1211 3300005366 Ga0070659_100034101 Ga0070659_1000341013 441
1212 3300005366 Ga0070659_100090979 Ga0070659_1000909793 441
1213 3300005366 Ga0070659_100103487 Ga0070659_1001034873 441
1214 3300005435 Ga0070714_100059027 Ga0070714_1000590273 441
1215 3300005455 Ga0070663_100007671 Ga0070663_1000076715 441
1216 3300005455 Ga0070663_100014367 Ga0070663_1000143672 441
1217 3300005455 Ga0070663_100149407 Ga0070663_1001494072 441
1218 3300005457 Ga0070662_100004174 Ga0070662_1000041748 441
1219 3300005458 Ga0070681_10091817 Ga0070681_100918174 441
1220 3300005530 Ga0070679_100120693 Ga0070679_1001206932 441
1221 3300005535 Ga0070684_100060656 Ga0070684_1000606563 441
1222 3300005539 Ga0068853_100101670 Ga0068853_1001016701 441
1223 3300005544 Ga0070686_100083635 Ga0070686_1000836353 441
1224 3300005546 Ga0070696_100033433 Ga0070696_1000334335 441
1225 3300005563 Ga0068855_100031634 Ga0068855_1000316349 441
1226 3300005563 Ga0068855_100055212 Ga0068855_1000552124 441
1227 3300005563 Ga0068855_100159046 Ga0068855_1001590464 441
1228 3300005563 Ga0068855_100169312 Ga0068855_1001693124 441
1229 3300005563 Ga0068855_100204607 Ga0068855_1002046072 441
1230 3300005564 Ga0070664_100046630 Ga0070664_1000466305 441
1231 3300005564 Ga0070664_100070221 Ga0070664_1000702215 441
1232 3300005564 Ga0070664_100093809 Ga0070664_1000938092 441
1233 3300005577 Ga0068857_100108565 Ga0068857_1001085654 441
1234 3300005578 Ga0068854_100007294 Ga0068854_1000072945 441
1235 3300005578 Ga0068854_100010250 Ga0068854_10001025010 441
1236 3300005614 Ga0068856_100124445 Ga0068856_1001244452 441
1237 3300005614 Ga0068856_100370718 Ga0068856_1003707181 441
1238 3300005616 Ga0068852_100008808 Ga0068852_1000088082 441
1239 3300005616 Ga0068852_100009680 Ga0068852_1000096807 441
1240 3300005616 Ga0068852_100070261 Ga0068852_1000702613 441
1241 3300005616 Ga0068852_100156470 Ga0068852_1001564704 441
1242 3300009093 Ga0105240_10009325 Ga0105240_1000932515 441
1243 3300009093 Ga0105240_10093813 Ga0105240_100938135 441
1244 3300009093 Ga0105240_10142379 Ga0105240_101423793 441
1245 3300009094 Ga0111539_10174053 Ga0111539_101740532 441
1246 3300013102 Ga0157371_10045108 Ga0157371_100451084 441
1247 3300013104 Ga0157370_10001103 Ga0157370_1000110324 441
1248 3300013104 Ga0157370_10011492 Ga0157370_1001149210 441
1249 3300013105 Ga0157369_10001177 Ga0157369_1000117729 441
1250 3300013105 Ga0157369_10087163 Ga0157369_100871632 441
1251 3300013105 Ga0157369_10117111 Ga0157369_101171113 441
1252 3300013307 Ga0157372_10201865 Ga0157372_102018653 441
1253 3300025903 Ga0207680_10011762 Ga0207680_100117624 441
1254 3300025904 Ga0207647_10007166 Ga0207647_100071665 441
1255 3300025909 Ga0207705_10000722 Ga0207705_1000072216 441
1256 3300025909 Ga0207705_10003954 Ga0207705_100039546 441
1257 3300025909 Ga0207705_10021135 Ga0207705_100211353 441
1258 3300025909 Ga0207705_10041408 Ga0207705_100414082 441
1259 3300025909 Ga0207705_10044414 Ga0207705_100444141 441
1260 3300025909 Ga0207705_10070440 Ga0207705_100704403 441
1261 3300025912 Ga0207707_10028804 Ga0207707_100288044 441
1262 3300025913 Ga0207695_10002670 Ga0207695_1000267019 441
1263 3300025913 Ga0207695_10008542 Ga0207695_1000854214 441
1264 3300025913 Ga0207695_10119227 Ga0207695_101192273 441
1265 3300025917 Ga0207660_10000049 Ga0207660_1000004970 441
1266 3300025917 Ga0207660_10005696 Ga0207660_100056965 441
1267 3300025917 Ga0207660_10008421 Ga0207660_100084218 441
1268 3300025917 Ga0207660_10023677 Ga0207660_100236776 441
1269 3300025917 Ga0207660_10029019 Ga0207660_100290193 441
1270 3300025917 Ga0207660_10083809 Ga0207660_100838092 441
1271 3300025919 Ga0207657_10004147 Ga0207657_1000414716 441
1272 3300025919 Ga0207657_10013383 Ga0207657_100133834 441
1273 3300025919 Ga0207657_10038931 Ga0207657_100389315 441
1274 3300025919 Ga0207657_10043778 Ga0207657_100437784 441
1275 3300025919 Ga0207657_10060983 Ga0207657_100609833 441
1276 3300025919 Ga0207657_10180604 Ga0207657_101806041 441
1277 3300025920 Ga0207649_10000298 Ga0207649_1000029830 441
1278 3300025920 Ga0207649_10050218 Ga0207649_100502183 441
1279 3300025921 Ga0207652_10001278 Ga0207652_100012784 441
1280 3300025921 Ga0207652_10021854 Ga0207652_100218546 441
1281 3300025929 Ga0207664_10061228 Ga0207664_100612285 441
1282 3300025932 Ga0207690_10007071 Ga0207690_100070718 441
1283 3300025932 Ga0207690_10010321 Ga0207690_100103213 441
1284 3300025933 Ga0207706_10063492 Ga0207706_100634923 441
1285 3300025934 Ga0207686_10152925 Ga0207686_101529251 441
1286 3300025940 Ga0207691_10123270 Ga0207691_101232703 441
1287 3300025941 Ga0207711_10019396 Ga0207711_100193967 441
1288 3300025944 Ga0207661_10008817 Ga0207661_100088175 441
1289 3300025944 Ga0207661_10124402 Ga0207661_101244024 441
1290 3300025944 Ga0207661_10226631 Ga0207661_102266311 441
1291 3300025945 Ga0207679_10080635 Ga0207679_100806354 441
1292 3300025945 Ga0207679_10109890 Ga0207679_101098903 441
1293 3300025949 Ga0207667_10034011 Ga0207667_100340114 441
1294 3300025949 Ga0207667_10040979 Ga0207667_100409795 441
1295 3300025949 Ga0207667_10059242 Ga0207667_100592424 441
1296 3300025949 Ga0207667_10069695 Ga0207667_100696951 441
1297 3300025949 Ga0207667_10125432 Ga0207667_101254322 441
1298 3300025949 Ga0207667_10156384 Ga0207667_101563844 441
1299 3300025949 Ga0207667_10186977 Ga0207667_101869774 441
1300 3300025949 Ga0207667_10194990 Ga0207667_101949902 441
1301 3300025981 Ga0207640_10010409 Ga0207640_100104094 441
1302 3300025981 Ga0207640_10077088 Ga0207640_100770882 441
1303 3300025981 Ga0207640_10193605 Ga0207640_101936052 441
1304 3300026023 Ga0207677_10016073 Ga0207677_100160733 441
1305 3300026023 Ga0207677_10021800 Ga0207677_100218004 441
1306 3300026035 Ga0207703_10010097 Ga0207703_100100975 441
1307 3300026041 Ga0207639_10065980 Ga0207639_100659805 441
1308 3300026041 Ga0207639_10071303 Ga0207639_100713034 441
1309 3300026041 Ga0207639_10073643 Ga0207639_100736433 441
1310 3300026067 Ga0207678_10005620 Ga0207678_100056206 441
1311 3300026067 Ga0207678_10098815 Ga0207678_100988152 441
1312 3300026078 Ga0207702_10022992 Ga0207702_100229926 441
1313 3300026078 Ga0207702_10089035 Ga0207702_100890352 441
1314 3300026078 Ga0207702_10100179 Ga0207702_101001792 441
1315 3300026078 Ga0207702_10280017 Ga0207702_102800172 441
1316 3300026089 Ga0207648_10041080 Ga0207648_100410802 441
1317 3300026116 Ga0207674_10006314 Ga0207674_100063147 441
1318 3300026116 Ga0207674_10013213 Ga0207674_100132137 441
1319 3300026116 Ga0207674_10024062 Ga0207674_100240626 441
1320 3300026116 Ga0207674_10044498 Ga0207674_100444984 441
1321 3300026142 Ga0207698_10021481 Ga0207698_100214815 441
1322 3300026142 Ga0207698_10030136 Ga0207698_100301366 441
1323 3300026142 Ga0207698_10146373 Ga0207698_101463732 441
1324 3300035725 Ga0373947_0044027 Ga0373947_0044027_1210_2535 441
1325 3300037312 Ga0395899_0000885 Ga0395899_0000885_21799_23124 441
1326 3300037312 Ga0395899_0002729 Ga0395899_0002729_6007_7332 441
1327 3300037312 Ga0395899_0002824 Ga0395899_0002824_4434_5759 441
1328 3300037312 Ga0395899_0015775 Ga0395899_0015775_1983_3308 441
1329 3300037312 Ga0395899_0050069 Ga0395899_0050069_566_1891 441
1330 3300037312 Ga0395899_0088951 Ga0395899_0088951_578_1903 441
1331 3300037312 Ga0395899_0121383 Ga0395899_0121383_122_1447 441
1332 3300037418 Ga0395900_0000031 Ga0395900_0000031_234447_235772 441
1333 3300037418 Ga0395900_0000667 Ga0395900_0000667_31194_32519 441
1334 3300037418 Ga0395900_0008073 Ga0395900_0008073_4772_6097 441
1335 3300037418 Ga0395900_0008821 Ga0395900_0008821_8372_9697 441
1336 3300037418 Ga0395900_0019626 Ga0395900_0019626_3445_4770 441
1337 3300037418 Ga0395900_0020751 Ga0395900_0020751_1880_3205 441
1338 3300037418 Ga0395900_0030043 Ga0395900_0030043_3846_5171 441
1339 3300037418 Ga0395900_0060079 Ga0395900_0060079_746_2071 441
1340 3300037418 Ga0395900_0104607 Ga0395900_0104607_517_1842 441
1341 3300037418 Ga0395900_0157307 Ga0395900_0157307_851_2176 441
1342 3300037466 Ga0395898_0001423 Ga0395898_0001423_4213_5538 441
1343 3300037466 Ga0395898_0007436 Ga0395898_0007436_4328_5653 441
1344 3300037466 Ga0395898_0063274 Ga0395898_0063274_1415_2740 441
1345 3300037466 Ga0395898_0069463 Ga0395898_0069463_689_2014 441
1346 3300037466 Ga0395898_0161725 Ga0395898_0161725_64_1389 441
1347 3300037471 Ga0395905_0000546 Ga0395905_0000546_14402_15727 441
1348 3300037471 Ga0395905_0007856 Ga0395905_0007856_6007_7332 441
1349 3300037471 Ga0395905_0095211 Ga0395905_0095211_1078_2403 441
1350 3300037471 Ga0395905_0182158 Ga0395905_0182158_582_1907 441
1351 3300037471 Ga0395905_0222956 Ga0395905_0222956_221_1546 441
1352 3300037471 Ga0395905_0232532 Ga0395905_0232532_313_1638 441
1353 3300038443 Ga0395901_0000035 Ga0395901_0000035_50140_51465 441
1354 3300038443 Ga0395901_0000329 Ga0395901_0000329_5604_6929 441
1355 3300038443 Ga0395901_0000447 Ga0395901_0000447_32111_33436 441
1356 3300038443 Ga0395901_0002236 Ga0395901_0002236_12888_14213 441
1357 3300038443 Ga0395901_0011421 Ga0395901_0011421_6100_7425 441
1358 3300038443 Ga0395901_0047555 Ga0395901_0047555_794_2119 441
1359 3300038443 Ga0395901_0060749 Ga0395901_0060749_2442_3767 441
1360 3300038443 Ga0395901_0188606 Ga0395901_0188606_768_2093 441
1361 3300038443 Ga0395901_0301219 Ga0395901_0301219_209_1534 441
1362 3300044656 Ga0466969_0003922 Ga0466969_0003922_1337_2662 441
1363 3300044684 Ga0466966_0000003 Ga0466966_0000003_228221_229546 441
1364 3300044684 Ga0466966_0000732 Ga0466966_0000732_12686_14011 441
1365 3300044693 Ga0466961_0011805 Ga0466961_0011805_1435_2760 441
1366 3300044693 Ga0466961_0105051 Ga0466961_0105051_231_1556 441
1367 3300044693 Ga0466961_0146928 Ga0466961_0146928_32_1357 441
1368 3300044694 Ga0466963_0002990 Ga0466963_0002990_4118_5443 441
1369 3300044694 Ga0466963_0017280 Ga0466963_0017280_800_2125 441
1370 3300044694 Ga0466963_0039115 Ga0466963_0039115_338_1663 441
1371 3300044694 Ga0466963_0043353 Ga0466963_0043353_1098_2423 441
1372 3300044694 Ga0466963_0082029 Ga0466963_0082029_677_2002 441
1373 3300044719 Ga0466971_0000835 Ga0466971_0000835_5218_6543 441
1374 3300044765 Ga0466970_0003735 Ga0466970_0003735_5272_6597 441
1375 3300044842 Ga0466957_0002580 Ga0466957_0002580_3809_5134 441
1376 3300044842 Ga0466957_0004623 Ga0466957_0004623_1953_3278 441
1377 3300045049 Ga0466959_0001663 Ga0466959_0001663_6553_7878 441
1378 3300045049 Ga0466959_0117435 Ga0466959_0117435_375_1700 441
1379 3300045836 Ga0466958_0000245 Ga0466958_0000245_9517_10842 441
1380 3300045836 Ga0466958_0018446 Ga0466958_0018446_1834_3159 441
1381 3300045836 Ga0466958_0156392 Ga0466958_0156392_78_1403 441
1382 3300045976 Ga0466967_0022023 Ga0466967_0022023_1338_2663 441
1383 3300045976 Ga0466967_0201151 Ga0466967_0201151_116_1441 441
1384 3300045976 Ga0466967_0253032 Ga0466967_0253032_153_1478 441
1385 3300045976 Ga0466967_0276158 Ga0466967_0276158_59_1384 441
1386 3300048909 Ga0496106_0072157 Ga0496106_0072157_943_2268 441
1387 3300048910 Ga0496107_0048046 Ga0496107_0048046_1263_2588 441
1388 3300048911 Ga0496108_0024312 Ga0496108_0024312_2687_4012 441
1389 3300048913 Ga0496110_0019463 Ga0496110_0019463_465_1790 441
1390 3300048915 Ga0496112_0004311 Ga0496112_0004311_8569_9894 441
1391 3300048916 Ga0496113_0029700 Ga0496113_0029700_2084_3409 441
1392 3300048916 Ga0496113_0058205 Ga0496113_0058205_1264_2589 441
1393 3300048917 Ga0496114_0000130 Ga0496114_0000130_6505_7830 441
1394 3300061719 Ga0466962_0004260 Ga0466962_0004260_5385_6710 441
1395 3300061719 Ga0466962_0030974 Ga0466962_0030974_1018_2343 441
1396 3300061719 Ga0466962_0038168 Ga0466962_0038168_362_1687 441

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10589

NADH_4Fe-4S

NADH-ubiquinone oxidoreductase-F iron-sulfur binding region

328

412

0.97

PF01512

Complex1_51K

Respiratory-chain NADH dehydrogenase 51 Kd subunit

59

218

0.96

PF10531

SLBB

SLBB domain

238

290

0.87

PF22461

SLBB_2

SLBB domain

237

327

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zkg-assembly1.cif.gz_1 complex i with nadh, closed 0.938 7 435
7v2c-assembly1.cif.gz_A active state complex i from q10 dataset 0.9348 1 435
8e73-assembly1.cif.gz_V1 vigna radiata supercomplex i+iii2 (full bridge) 0.9346 3 437
7ard-assembly1.cif.gz_F cryo-em structure of polytomella complex-i (complete composition) 0.9344 3 433
8b9z-assembly1.cif.gz_F drosophila melanogaster complex i in the active state (dm1) 0.9341 1 434
ID Description Score Start End Superfamily
af_A1ZAW7_585_680_1.20.1440.230 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);NADH-ubiquinone oxidoreductase 51kDa subunit, iron-sulphur binding domain 0.9601 340 434 1.20.1440.230
af_P9WIV7_242_335_3.10.20.600 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.9545 238 339 3.10.20.600
6g72F03 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.9479 239 339 3.10.20.600
af_P9WIV7_242_335_3.10.20.600 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.9447 238 339 3.10.20.600
af_A1ZAW7_585_680_1.20.1440.230 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);NADH-ubiquinone oxidoreductase 51kDa subunit, iron-sulphur binding domain 0.9408 340 434 1.20.1440.230
ID Description Score Start End GO Terms
AF-A0A287I0E1-F1-model_v4 deleted 0.9821 207 440
AF-A0A2P5NSX2-F1-model_v4 NADH-quinone oxidoreductase subunit NuoF 0.9806 202 430 GO:0008137
GO:0010181
GO:0046872
GO:0051539
AF-A0A287I047-F1-model_v4 deleted 0.9794 204 440
AF-A0A257NMP5-F1-model_v4 NADH-quinone oxidoreductase subunit F 0.9751 7 174 GO:0046872
GO:0051539
AF-A0A520J9Q5-F1-model_v4 NADH-quinone oxidoreductase subunit F (EC 1.6.5.11) 0.9738 7 145 GO:0016491
GO:0046872
GO:0051539

Feature Viewer

pLDDT pTM Quality
86.37 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map