F493617
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1395 | 465 | 2790 | 212 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100279750|Ga0070714_1002797501 |
| Length | 244 |
| Sequence | VHVVLDALIGLDLHACVHVDILRTVAHDIPWNMIIAIDGPAASGKGTIAKQVAAIYGLPHLDTGLIYRAVARAVLDAGYPPDNVEKAIDAAIALDPRGFDESALKAPAITEAASVVAAIPEVRQALMNYQRAFATKPPGAVLDGRDIGTVIAPGADVKIFVVATPEVRAARRTAEMRARGEAADEREVLADLLRRDERDSRRTAAPLKAAPDAHLLDTTHLGIDAAFRAAVDIIEAVRTGRKRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 4 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 6 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 8 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 9 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 10 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 11 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 12 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 13 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 14 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 15 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 16 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 17 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 18 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 19 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 20 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 21 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 22 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 23 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 24 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 25 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 26 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 69 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 84 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 86 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 87 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 88 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 90 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 91 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 92 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 93 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 94 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 95 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 96 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 97 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 98 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 99 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 100 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 101 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 102 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 103 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 105 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 106 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 107 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 108 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 112 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 113 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 114 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 115 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 116 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 118 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 119 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 120 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 121 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 122 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 123 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 124 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 125 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 126 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 127 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 129 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 130 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 145 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 163 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 164 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 242 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 246 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 247 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 248 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 250 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 251 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 252 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 253 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 254 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 255 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 256 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 257 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 258 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 259 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 260 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 261 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 262 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 263 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 264 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 265 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 266 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 267 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 268 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 269 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 270 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 271 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 272 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 273 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 274 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 276 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 277 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 279 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 280 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 281 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 282 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 283 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 284 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 285 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 286 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 287 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 288 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 289 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 290 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 292 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 293 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 294 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 295 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 296 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 297 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 298 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 299 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 300 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 301 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 302 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 303 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 304 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 305 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 306 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 307 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 308 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 309 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 310 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 311 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 312 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 313 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 314 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 315 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 316 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 317 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 318 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 319 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 320 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 321 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 322 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 323 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 324 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 325 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 326 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 397 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 398 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 399 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 400 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 401 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 402 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 403 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 404 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 405 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 406 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 407 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 408 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 409 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 410 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 411 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 412 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 413 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 414 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 433 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 434 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 435 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 436 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 437 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 438 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 439 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 440 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 449 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 454 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 455 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 456 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 457 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 458 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 459 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 460 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 461 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 462 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 464 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.71 |
| Metatranscriptomes | 0.29 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.37 |
| Nodule | 0 |
| Rhizoplane | 7.38 |
| Rhizosphere | 88.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070714_100279750 | 3300005435 | Bacteria | 1550 |
| 2 | SwRhRL2b_contig_1529358 | 2162886007 | Bacteria | 996 |
| 3 | 2214745211 | 2209111006 | Bacteria | 14800 |
| 4 | ARcpr5oldR_c000059 | 3300000041 | Bacteria | 20360 |
| 5 | ARSoilYngRDRAFT_c00001 | 3300000042 | Bacteria | 59233 |
| 6 | ARcpr5yngRDRAFT_c000001 | 3300000043 | Bacteria | 58937 |
| 7 | ARSoilOldRDRAFT_c000066 | 3300000044 | Bacteria | 20359 |
| 8 | ARCol0oldRDRAFT_c00439 | 3300000045 | Bacteria | 3971 |
| 9 | ARCol0yngRDRAFT_1000014 | 3300000652 | Bacteria | 35008 |
| 10 | JGI24746J21847_1002433 | 3300001977 | Bacteria | 2965 |
| 11 | JGI24740J21852_10020451 | 3300001979 | Bacteria | 2308 |
| 12 | JGI24739J22299_10010837 | 3300001989 | Bacteria | 3375 |
| 13 | JGI24737J22298_10008285 | 3300001990 | Bacteria | 3486 |
| 14 | JGI24735J21928_10011548 | 3300002067 | Bacteria | 2797 |
| 15 | JGI24750J21931_1000154 | 3300002070 | Bacteria | 11402 |
| 16 | JGI24745J21846_1000047 | 3300002073 | Bacteria | 8297 |
| 17 | JGI24748J21848_1000162 | 3300002074 | Bacteria | 9733 |
| 18 | JGI24738J21930_10000005 | 3300002075 | Bacteria | 42207 |
| 19 | JGI24749J21850_1000444 | 3300002076 | Bacteria | 6172 |
| 20 | JGI24749J21850_1003765 | 3300002076 | Bacteria | 2119 |
| 21 | JGI24033J26618_1000407 | 3300002155 | Bacteria | 4353 |
| 22 | JGI24034J26672_10000819 | 3300002239 | Bacteria | 4027 |
| 23 | JGI24742J22300_10000203 | 3300002244 | Bacteria | 8766 |
| 24 | JGI24751J29686_10011942 | 3300002459 | Bacteria | 1791 |
| 25 | JGI25406J46586_10041430 | 3300003203 | Bacteria | 1621 |
| 26 | JGI25405J52794_10024670 | 3300003911 | Bacteria | 1229 |
| 27 | Ga0065704_10072903 | 3300005289 | Bacteria | 7838 |
| 28 | Ga0065715_10003668 | 3300005293 | Bacteria | 5170 |
| 29 | Ga0065715_10102699 | 3300005293 | Bacteria | 3090 |
| 30 | Ga0070658_10703830 | 3300005327 | Bacteria | 877 |
| 31 | Ga0070676_10000087 | 3300005328 | Bacteria | 31855 |
| 32 | Ga0070683_100000098 | 3300005329 | Bacteria | 57301 |
| 33 | Ga0070683_100070578 | 3300005329 | Bacteria | 3258 |
| 34 | Ga0070683_101141842 | 3300005329 | Bacteria | 748 |
| 35 | Ga0070690_100004710 | 3300005330 | Bacteria | 7603 |
| 36 | Ga0070690_100036430 | 3300005330 | Bacteria | 3091 |
| 37 | Ga0070690_100064871 | 3300005330 | Bacteria | 2360 |
| 38 | Ga0070690_100209982 | 3300005330 | Bacteria | 1359 |
| 39 | Ga0070690_100298987 | 3300005330 | Bacteria | 1154 |
| 40 | Ga0070670_100062990 | 3300005331 | Bacteria | 3183 |
| 41 | Ga0070670_100083177 | 3300005331 | Bacteria | 2750 |
| 42 | Ga0070670_100133407 | 3300005331 | Bacteria | 2145 |
| 43 | Ga0070670_100165242 | 3300005331 | Bacteria | 1919 |
| 44 | Ga0070677_10000087 | 3300005333 | Bacteria | 29691 |
| 45 | Ga0070677_10005921 | 3300005333 | Bacteria | 4051 |
| 46 | Ga0068869_100007030 | 3300005334 | Bacteria | 7167 |
| 47 | Ga0068869_100168436 | 3300005334 | Bacteria | 1710 |
| 48 | Ga0068869_100195559 | 3300005334 | Bacteria | 1592 |
| 49 | Ga0070666_10006074 | 3300005335 | Bacteria | 7421 |
| 50 | Ga0070666_10139159 | 3300005335 | Bacteria | 1690 |
| 51 | Ga0070666_10166879 | 3300005335 | Bacteria | 1540 |
| 52 | Ga0070666_10213027 | 3300005335 | Bacteria | 1361 |
| 53 | Ga0070680_100129126 | 3300005336 | Bacteria | 2113 |
| 54 | Ga0070680_100715864 | 3300005336 | Bacteria | 861 |
| 55 | Ga0070680_100807244 | 3300005336 | Bacteria | 808 |
| 56 | Ga0070682_100003963 | 3300005337 | Bacteria | 8220 |
| 57 | Ga0070682_100229025 | 3300005337 | Bacteria | 1327 |
| 58 | Ga0070682_100363791 | 3300005337 | Bacteria | 1082 |
| 59 | Ga0068868_100020059 | 3300005338 | Bacteria | 5016 |
| 60 | Ga0068868_100281521 | 3300005338 | Bacteria | 1408 |
| 61 | Ga0070660_100008367 | 3300005339 | Bacteria | 7233 |
| 62 | Ga0070660_100063999 | 3300005339 | Bacteria | 2861 |
| 63 | Ga0070689_100002716 | 3300005340 | Bacteria | 11589 |
| 64 | Ga0070689_100023410 | 3300005340 | Bacteria | 4623 |
| 65 | Ga0070689_100041942 | 3300005340 | Bacteria | 3513 |
| 66 | Ga0070689_100153285 | 3300005340 | Bacteria | 1859 |
| 67 | Ga0070689_100212072 | 3300005340 | Bacteria | 1585 |
| 68 | Ga0070689_100232835 | 3300005340 | Bacteria | 1515 |
| 69 | Ga0070691_10006879 | 3300005341 | Bacteria | 5202 |
| 70 | Ga0070687_100027779 | 3300005343 | Bacteria | 2737 |
| 71 | Ga0070687_100050664 | 3300005343 | Bacteria | 2145 |
| 72 | Ga0070661_100000153 | 3300005344 | Bacteria | 56652 |
| 73 | Ga0070661_100032632 | 3300005344 | Bacteria | 3768 |
| 74 | Ga0070661_100046668 | 3300005344 | Bacteria | 3169 |
| 75 | Ga0070692_10028938 | 3300005345 | Bacteria | 2758 |
| 76 | Ga0070668_100054761 | 3300005347 | Bacteria | 3077 |
| 77 | Ga0070668_100235655 | 3300005347 | Bacteria | 1515 |
| 78 | Ga0070668_100310033 | 3300005347 | Bacteria | 1326 |
| 79 | Ga0070669_100018867 | 3300005353 | Bacteria | 4930 |
| 80 | Ga0070669_100134784 | 3300005353 | Bacteria | 1898 |
| 81 | Ga0070669_100496769 | 3300005353 | Bacteria | 1011 |
| 82 | Ga0070675_100010385 | 3300005354 | Bacteria | 7272 |
| 83 | Ga0070675_100058672 | 3300005354 | Bacteria | 3174 |
| 84 | Ga0070675_100319369 | 3300005354 | Bacteria | 1372 |
| 85 | Ga0070675_100638054 | 3300005354 | Bacteria | 967 |
| 86 | Ga0070671_100000087 | 3300005355 | Bacteria | 59534 |
| 87 | Ga0070671_100011988 | 3300005355 | Bacteria | 6973 |
| 88 | Ga0070671_100087488 | 3300005355 | Bacteria | 2607 |
| 89 | Ga0070671_100275396 | 3300005355 | Bacteria | 1430 |
| 90 | Ga0070674_100003304 | 3300005356 | Bacteria | 9027 |
| 91 | Ga0070674_100018767 | 3300005356 | Bacteria | 4381 |
| 92 | Ga0070674_100036515 | 3300005356 | Bacteria | 3299 |
| 93 | Ga0070673_100005718 | 3300005364 | Bacteria | 7996 |
| 94 | Ga0070673_100039017 | 3300005364 | Bacteria | 3631 |
| 95 | Ga0070673_100147552 | 3300005364 | Bacteria | 1989 |
| 96 | Ga0070673_100182500 | 3300005364 | Bacteria | 1797 |
| 97 | Ga0070688_100048957 | 3300005365 | Bacteria | 2628 |
| 98 | Ga0070688_100079522 | 3300005365 | Bacteria | 2118 |
| 99 | Ga0070688_100154850 | 3300005365 | Bacteria | 1569 |
| 100 | Ga0070688_100155055 | 3300005365 | Bacteria | 1568 |
| 101 | Ga0070688_100373345 | 3300005365 | Bacteria | 1049 |
| 102 | Ga0070659_100009167 | 3300005366 | Bacteria | 7258 |
| 103 | Ga0070659_100152918 | 3300005366 | Bacteria | 1883 |
| 104 | Ga0070659_100164242 | 3300005366 | Bacteria | 1816 |
| 105 | Ga0070659_100322980 | 3300005366 | Bacteria | 1290 |
| 106 | Ga0070659_100531013 | 3300005366 | Bacteria | 1005 |
| 107 | Ga0070667_100027461 | 3300005367 | Bacteria | 4735 |
| 108 | Ga0070667_100042852 | 3300005367 | Bacteria | 3797 |
| 109 | Ga0070667_100193919 | 3300005367 | Bacteria | 1801 |
| 110 | Ga0070667_100792549 | 3300005367 | Bacteria | 879 |
| 111 | Ga0070703_10034267 | 3300005406 | Bacteria | 1549 |
| 112 | Ga0070709_10001851 | 3300005434 | Bacteria | 11474 |
| 113 | Ga0070709_10014055 | 3300005434 | Bacteria | 4518 |
| 114 | Ga0070709_10343819 | 3300005434 | Bacteria | 1100 |
| 115 | Ga0070714_100049571 | 3300005435 | Bacteria | 3574 |
| 116 | Ga0070714_100066424 | 3300005435 | Bacteria | 3108 |
| 117 | Ga0070714_100209348 | 3300005435 | Bacteria | 1787 |
| 118 | Ga0070713_100001450 | 3300005436 | Bacteria | 15134 |
| 119 | Ga0070713_100022950 | 3300005436 | Bacteria | 4831 |
| 120 | Ga0070713_100083011 | 3300005436 | Bacteria | 2738 |
| 121 | Ga0070713_100120596 | 3300005436 | Bacteria | 2299 |
| 122 | Ga0070713_100140940 | 3300005436 | Bacteria | 2135 |
| 123 | Ga0070713_100201076 | 3300005436 | Bacteria | 1799 |
| 124 | Ga0070713_100249189 | 3300005436 | Bacteria | 1619 |
| 125 | Ga0070713_100538581 | 3300005436 | Bacteria | 1105 |
| 126 | Ga0070713_100766477 | 3300005436 | Bacteria | 924 |
| 127 | Ga0070710_10003954 | 3300005437 | Bacteria | 7023 |
| 128 | Ga0070701_10001447 | 3300005438 | Bacteria | 8796 |
| 129 | Ga0070701_10014027 | 3300005438 | Bacteria | 3664 |
| 130 | Ga0070701_10052667 | 3300005438 | Bacteria | 2115 |
| 131 | Ga0070701_10072974 | 3300005438 | Bacteria | 1839 |
| 132 | Ga0070711_100033186 | 3300005439 | Bacteria | 3436 |
| 133 | Ga0070711_100042334 | 3300005439 | Bacteria | 3078 |
| 134 | Ga0070711_100081215 | 3300005439 | Bacteria | 2310 |
| 135 | Ga0070711_100111727 | 3300005439 | Bacteria | 2006 |
| 136 | Ga0070705_100014389 | 3300005440 | Bacteria | 4068 |
| 137 | Ga0070705_100219093 | 3300005440 | Bacteria | 1317 |
| 138 | Ga0070700_100010178 | 3300005441 | Bacteria | 5185 |
| 139 | Ga0070700_100011271 | 3300005441 | Bacteria | 4949 |
| 140 | Ga0070694_100034125 | 3300005444 | Bacteria | 3353 |
| 141 | Ga0070694_100316720 | 3300005444 | Bacteria | 1199 |
| 142 | Ga0070694_100440471 | 3300005444 | Bacteria | 1027 |
| 143 | Ga0070694_100511649 | 3300005444 | Bacteria | 957 |
| 144 | Ga0070708_100162550 | 3300005445 | Bacteria | 2081 |
| 145 | Ga0070663_100015960 | 3300005455 | Bacteria | 4863 |
| 146 | Ga0070663_100048158 | 3300005455 | Bacteria | 3021 |
| 147 | Ga0070663_100085275 | 3300005455 | Bacteria | 2330 |
| 148 | Ga0070663_100127767 | 3300005455 | Bacteria | 1927 |
| 149 | Ga0070663_100785481 | 3300005455 | Bacteria | 815 |
| 150 | Ga0070678_100000090 | 3300005456 | Bacteria | 34718 |
| 151 | Ga0070678_100040261 | 3300005456 | Bacteria | 3305 |
| 152 | Ga0070678_100088267 | 3300005456 | Bacteria | 2370 |
| 153 | Ga0070678_100162412 | 3300005456 | Bacteria | 1811 |
| 154 | Ga0070678_100232850 | 3300005456 | Bacteria | 1536 |
| 155 | Ga0070662_100042407 | 3300005457 | Bacteria | 3250 |
| 156 | Ga0070662_100050569 | 3300005457 | Bacteria | 2998 |
| 157 | Ga0070662_100105908 | 3300005457 | Bacteria | 2135 |
| 158 | Ga0070662_100192539 | 3300005457 | Bacteria | 1614 |
| 159 | Ga0070681_10032354 | 3300005458 | Bacteria | 5248 |
| 160 | Ga0070681_10200388 | 3300005458 | Bacteria | 1914 |
| 161 | Ga0070681_10247460 | 3300005458 | Bacteria | 1696 |
| 162 | Ga0070681_10564977 | 3300005458 | Bacteria | 1051 |
| 163 | Ga0070681_11009290 | 3300005458 | Bacteria | 752 |
| 164 | Ga0068867_100008100 | 3300005459 | Bacteria | 7427 |
| 165 | Ga0068867_100252836 | 3300005459 | Bacteria | 1434 |
| 166 | Ga0068867_100414460 | 3300005459 | Bacteria | 1139 |
| 167 | Ga0070685_10003606 | 3300005466 | Bacteria | 7854 |
| 168 | Ga0070685_10004710 | 3300005466 | Bacteria | 6903 |
| 169 | Ga0070685_10028131 | 3300005466 | Bacteria | 3113 |
| 170 | Ga0070685_10061747 | 3300005466 | Bacteria | 2195 |
| 171 | Ga0070706_100141717 | 3300005467 | Bacteria | 2244 |
| 172 | Ga0070699_100369093 | 3300005518 | Bacteria | 1294 |
| 173 | Ga0070679_100057812 | 3300005530 | Bacteria | 3865 |
| 174 | Ga0070679_100158506 | 3300005530 | Bacteria | 2237 |
| 175 | Ga0070679_100178646 | 3300005530 | Bacteria | 2095 |
| 176 | Ga0070679_100197288 | 3300005530 | Bacteria | 1980 |
| 177 | Ga0070679_100252262 | 3300005530 | Bacteria | 1720 |
| 178 | Ga0070679_100332067 | 3300005530 | Bacteria | 1469 |
| 179 | Ga0070684_100007412 | 3300005535 | Bacteria | 8526 |
| 180 | Ga0070684_100010741 | 3300005535 | Bacteria | 7269 |
| 181 | Ga0070697_100129350 | 3300005536 | Bacteria | 2117 |
| 182 | Ga0068853_100011425 | 3300005539 | Bacteria | 7214 |
| 183 | Ga0068853_100218038 | 3300005539 | Bacteria | 1741 |
| 184 | Ga0068853_100238329 | 3300005539 | Bacteria | 1666 |
| 185 | Ga0068853_100329417 | 3300005539 | Bacteria | 1417 |
| 186 | Ga0070672_100003453 | 3300005543 | Bacteria | 10240 |
| 187 | Ga0070672_100023218 | 3300005543 | Bacteria | 4569 |
| 188 | Ga0070672_100377437 | 3300005543 | Bacteria | 1212 |
| 189 | Ga0070686_100001736 | 3300005544 | Bacteria | 12183 |
| 190 | Ga0070686_100012700 | 3300005544 | Bacteria | 4805 |
| 191 | Ga0070686_100014361 | 3300005544 | Bacteria | 4565 |
| 192 | Ga0070686_100039869 | 3300005544 | Bacteria | 2929 |
| 193 | Ga0070686_100173841 | 3300005544 | Bacteria | 1525 |
| 194 | Ga0070695_100117562 | 3300005545 | Bacteria | 1814 |
| 195 | Ga0070695_100132327 | 3300005545 | Bacteria | 1720 |
| 196 | Ga0070695_100442081 | 3300005545 | Bacteria | 995 |
| 197 | Ga0070695_100628178 | 3300005545 | Bacteria | 846 |
| 198 | Ga0070696_100037459 | 3300005546 | Bacteria | 3346 |
| 199 | Ga0070696_100150142 | 3300005546 | Bacteria | 1710 |
| 200 | Ga0070696_100349612 | 3300005546 | Bacteria | 1144 |
| 201 | Ga0070693_100020625 | 3300005547 | Bacteria | 3479 |
| 202 | Ga0070693_100078790 | 3300005547 | Bacteria | 1959 |
| 203 | Ga0070665_100025741 | 3300005548 | Bacteria | 5927 |
| 204 | Ga0070665_100083333 | 3300005548 | Bacteria | 3202 |
| 205 | Ga0070665_100257373 | 3300005548 | Bacteria | 1747 |
| 206 | Ga0070665_101067113 | 3300005548 | Bacteria | 819 |
| 207 | Ga0070704_100013532 | 3300005549 | Bacteria | 5064 |
| 208 | Ga0070704_100184961 | 3300005549 | Bacteria | 1670 |
| 209 | Ga0070704_100220936 | 3300005549 | Bacteria | 1540 |
| 210 | Ga0070704_100430988 | 3300005549 | Bacteria | 1131 |
| 211 | Ga0068855_100029468 | 3300005563 | Bacteria | 6561 |
| 212 | Ga0068855_100589779 | 3300005563 | Bacteria | 1200 |
| 213 | Ga0068855_100719578 | 3300005563 | Bacteria | 1067 |
| 214 | Ga0070664_100003492 | 3300005564 | Bacteria | 12699 |
| 215 | Ga0070664_100029633 | 3300005564 | Bacteria | 4564 |
| 216 | Ga0068857_100001853 | 3300005577 | Bacteria | 17029 |
| 217 | Ga0068854_100051068 | 3300005578 | Bacteria | 2961 |
| 218 | Ga0068854_100324849 | 3300005578 | Bacteria | 1252 |
| 219 | Ga0068854_100909408 | 3300005578 | Bacteria | 774 |
| 220 | Ga0068856_100000429 | 3300005614 | Bacteria | 46191 |
| 221 | Ga0068856_100077570 | 3300005614 | Bacteria | 3292 |
| 222 | Ga0068856_100174255 | 3300005614 | Bacteria | 2164 |
| 223 | Ga0068856_100360392 | 3300005614 | Bacteria | 1473 |
| 224 | Ga0068856_100578360 | 3300005614 | Bacteria | 1144 |
| 225 | Ga0068856_100998077 | 3300005614 | Bacteria | 855 |
| 226 | Ga0070702_100000021 | 3300005615 | Bacteria | 44632 |
| 227 | Ga0070702_100012355 | 3300005615 | Bacteria | 4275 |
| 228 | Ga0070702_100232408 | 3300005615 | Bacteria | 1240 |
| 229 | Ga0068852_100079650 | 3300005616 | Bacteria | 2902 |
| 230 | Ga0068859_100045661 | 3300005617 | Bacteria | 4401 |
| 231 | Ga0068859_100187867 | 3300005617 | Bacteria | 2150 |
| 232 | Ga0068864_100051399 | 3300005618 | Bacteria | 3550 |
| 233 | Ga0068864_100074171 | 3300005618 | Bacteria | 2968 |
| 234 | Ga0068864_100113244 | 3300005618 | Bacteria | 2418 |
| 235 | Ga0068864_100581797 | 3300005618 | Bacteria | 1085 |
| 236 | Ga0068866_10000919 | 3300005718 | Bacteria | 12924 |
| 237 | Ga0068866_10018320 | 3300005718 | Bacteria | 3164 |
| 238 | Ga0068866_10077263 | 3300005718 | Bacteria | 1778 |
| 239 | Ga0068866_10207964 | 3300005718 | Bacteria | 1173 |
| 240 | Ga0068861_100002149 | 3300005719 | Bacteria | 12765 |
| 241 | Ga0068861_100067791 | 3300005719 | Bacteria | 2755 |
| 242 | Ga0068861_100131007 | 3300005719 | Bacteria | 2036 |
| 243 | Ga0068861_100196432 | 3300005719 | Bacteria | 1690 |
| 244 | Ga0068861_100228759 | 3300005719 | Bacteria | 1576 |
| 245 | Ga0068861_100783057 | 3300005719 | Bacteria | 894 |
| 246 | Ga0068851_10359784 | 3300005834 | Bacteria | 848 |
| 247 | Ga0068870_10000588 | 3300005840 | Bacteria | 13807 |
| 248 | Ga0068870_10014308 | 3300005840 | Bacteria | 3746 |
| 249 | Ga0068863_100001459 | 3300005841 | Bacteria | 23446 |
| 250 | Ga0068863_100045935 | 3300005841 | Bacteria | 4145 |
| 251 | Ga0068863_100244222 | 3300005841 | Bacteria | 1733 |
| 252 | Ga0068858_100116038 | 3300005842 | Bacteria | 2502 |
| 253 | Ga0068858_100302872 | 3300005842 | Bacteria | 1525 |
| 254 | Ga0068858_100334154 | 3300005842 | Bacteria | 1449 |
| 255 | Ga0068858_100615929 | 3300005842 | Bacteria | 1054 |
| 256 | Ga0068860_100016194 | 3300005843 | Bacteria | 7272 |
| 257 | Ga0068860_100020090 | 3300005843 | Bacteria | 6471 |
| 258 | Ga0068860_100036305 | 3300005843 | Bacteria | 4723 |
| 259 | Ga0068862_100036033 | 3300005844 | Bacteria | 4191 |
| 260 | Ga0068862_100250035 | 3300005844 | Bacteria | 1615 |
| 261 | Ga0081455_10000002 | 3300005937 | Bacteria | 460472 |
| 262 | Ga0081455_10003269 | 3300005937 | Bacteria | 18754 |
| 263 | Ga0081455_10003886 | 3300005937 | Bacteria | 17015 |
| 264 | Ga0081455_10022547 | 3300005937 | Bacteria | 5884 |
| 265 | Ga0081455_10120655 | 3300005937 | Bacteria | 2066 |
| 266 | Ga0081455_10139546 | 3300005937 | Bacteria | 1884 |
| 267 | Ga0081455_10194436 | 3300005937 | Bacteria | 1525 |
| 268 | Ga0081540_1010355 | 3300005983 | Bacteria | 6324 |
| 269 | Ga0081540_1031460 | 3300005983 | Bacteria | 2916 |
| 270 | Ga0081539_10002901 | 3300005985 | Bacteria | 22688 |
| 271 | Ga0070717_10001529 | 3300006028 | Bacteria | 16025 |
| 272 | Ga0070717_10008327 | 3300006028 | Bacteria | 7743 |
| 273 | Ga0070717_10233626 | 3300006028 | Bacteria | 1619 |
| 274 | Ga0070717_10250189 | 3300006028 | Bacteria | 1565 |
| 275 | Ga0075365_10001671 | 3300006038 | Bacteria | 10246 |
| 276 | Ga0075365_10026637 | 3300006038 | Bacteria | 3672 |
| 277 | Ga0075365_10095029 | 3300006038 | Bacteria | 2035 |
| 278 | Ga0075365_10160523 | 3300006038 | Bacteria | 1566 |
| 279 | Ga0075368_10028171 | 3300006042 | Bacteria | 2169 |
| 280 | Ga0075363_100001378 | 3300006048 | Bacteria | 9157 |
| 281 | Ga0075363_100012518 | 3300006048 | Bacteria | 4093 |
| 282 | Ga0075363_100034923 | 3300006048 | Bacteria | 2627 |
| 283 | Ga0075364_10005413 | 3300006051 | Bacteria | 7413 |
| 284 | Ga0075364_10041419 | 3300006051 | Bacteria | 2991 |
| 285 | Ga0075364_10470023 | 3300006051 | Bacteria | 859 |
| 286 | Ga0070715_10000379 | 3300006163 | Bacteria | 11125 |
| 287 | Ga0070715_10058215 | 3300006163 | Bacteria | 1686 |
| 288 | Ga0070715_10069483 | 3300006163 | Bacteria | 1569 |
| 289 | Ga0070715_10078723 | 3300006163 | Bacteria | 1491 |
| 290 | Ga0070716_100041362 | 3300006173 | Bacteria | 2567 |
| 291 | Ga0070716_100577985 | 3300006173 | Bacteria | 842 |
| 292 | Ga0070712_100010590 | 3300006175 | Bacteria | 5823 |
| 293 | Ga0070712_100171040 | 3300006175 | Bacteria | 1686 |
| 294 | Ga0070712_100297739 | 3300006175 | Bacteria | 1305 |
| 295 | Ga0075362_10010849 | 3300006177 | Bacteria | 3573 |
| 296 | Ga0075362_10012472 | 3300006177 | Bacteria | 3378 |
| 297 | Ga0075362_10209336 | 3300006177 | Bacteria | 951 |
| 298 | Ga0075367_10001203 | 3300006178 | Bacteria | 10851 |
| 299 | Ga0075367_10053037 | 3300006178 | Bacteria | 2402 |
| 300 | Ga0075367_10127068 | 3300006178 | Bacteria | 1574 |
| 301 | Ga0075369_10005459 | 3300006186 | Bacteria | 4753 |
| 302 | Ga0075427_10000093 | 3300006194 | Bacteria | 7279 |
| 303 | Ga0075366_10006427 | 3300006195 | Bacteria | 6440 |
| 304 | Ga0075366_10031698 | 3300006195 | Bacteria | 3112 |
| 305 | Ga0097621_100000012 | 3300006237 | Bacteria | 105108 |
| 306 | Ga0097621_100032038 | 3300006237 | Bacteria | 4176 |
| 307 | Ga0097621_100323904 | 3300006237 | Bacteria | 1365 |
| 308 | Ga0097621_100354308 | 3300006237 | Bacteria | 1306 |
| 309 | Ga0075370_10262301 | 3300006353 | Bacteria | 1025 |
| 310 | Ga0068871_100000138 | 3300006358 | Bacteria | 46912 |
| 311 | Ga0068871_100008692 | 3300006358 | Bacteria | 7306 |
| 312 | Ga0068871_100087680 | 3300006358 | Bacteria | 2588 |
| 313 | Ga0068871_100298467 | 3300006358 | Bacteria | 1413 |
| 314 | Ga0075428_100036127 | 3300006844 | Bacteria | 5444 |
| 315 | Ga0075428_100087699 | 3300006844 | Bacteria | 3394 |
| 316 | Ga0075428_100161541 | 3300006844 | Bacteria | 2432 |
| 317 | Ga0075428_100185144 | 3300006844 | Bacteria | 2253 |
| 318 | Ga0075428_100233494 | 3300006844 | Bacteria | 1985 |
| 319 | Ga0075428_100609429 | 3300006844 | Bacteria | 1166 |
| 320 | Ga0075430_100000014 | 3300006846 | Bacteria | 90404 |
| 321 | Ga0075430_100003974 | 3300006846 | Bacteria | 12467 |
| 322 | Ga0075430_100009563 | 3300006846 | Bacteria | 8190 |
| 323 | Ga0075430_100411982 | 3300006846 | Bacteria | 1116 |
| 324 | Ga0075431_100005449 | 3300006847 | Bacteria | 12571 |
| 325 | Ga0075431_100140324 | 3300006847 | Bacteria | 2491 |
| 326 | Ga0075431_100163948 | 3300006847 | Bacteria | 2285 |
| 327 | Ga0075433_10000100 | 3300006852 | Bacteria | 41448 |
| 328 | Ga0075433_10038428 | 3300006852 | Bacteria | 4134 |
| 329 | Ga0075433_10095241 | 3300006852 | Bacteria | 2634 |
| 330 | Ga0075434_100018712 | 3300006871 | Bacteria | 6693 |
| 331 | Ga0075434_100038552 | 3300006871 | Bacteria | 4732 |
| 332 | Ga0075434_100045780 | 3300006871 | Bacteria | 4340 |
| 333 | Ga0075434_100061573 | 3300006871 | Bacteria | 3734 |
| 334 | Ga0075434_100075803 | 3300006871 | Bacteria | 3358 |
| 335 | Ga0075434_100457505 | 3300006871 | Bacteria | 1297 |
| 336 | Ga0075434_100830966 | 3300006871 | Bacteria | 940 |
| 337 | Ga0075429_100004155 | 3300006880 | Bacteria | 12386 |
| 338 | Ga0068865_100015586 | 3300006881 | Bacteria | 4849 |
| 339 | Ga0068865_100104993 | 3300006881 | Bacteria | 2075 |
| 340 | Ga0068865_100182872 | 3300006881 | Bacteria | 1615 |
| 341 | Ga0075436_100111964 | 3300006914 | Bacteria | 1906 |
| 342 | Ga0075436_100120146 | 3300006914 | Bacteria | 1838 |
| 343 | Ga0075436_100135614 | 3300006914 | Bacteria | 1728 |
| 344 | Ga0075436_100400398 | 3300006914 | Bacteria | 995 |
| 345 | Ga0075436_100525802 | 3300006914 | Bacteria | 867 |
| 346 | Ga0097620_100045654 | 3300006931 | Bacteria | 4401 |
| 347 | Ga0097620_100187848 | 3300006931 | Bacteria | 2150 |
| 348 | Ga0075435_100061289 | 3300007076 | Bacteria | 3052 |
| 349 | Ga0075435_100067947 | 3300007076 | Bacteria | 2902 |
| 350 | Ga0075435_100105192 | 3300007076 | Bacteria | 2342 |
| 351 | Ga0075435_100267411 | 3300007076 | Bacteria | 1458 |
| 352 | Ga0075435_100309827 | 3300007076 | Bacteria | 1351 |
| 353 | Ga0075435_100392122 | 3300007076 | Bacteria | 1193 |
| 354 | Ga0075435_100477353 | 3300007076 | Bacteria | 1077 |
| 355 | Ga0099795_10004915 | 3300007788 | Bacteria | 3501 |
| 356 | Ga0105251_10027453 | 3300009011 | Bacteria | 2886 |
| 357 | Ga0105250_10038833 | 3300009092 | Bacteria | 1909 |
| 358 | Ga0105250_10048561 | 3300009092 | Bacteria | 1702 |
| 359 | Ga0105240_10020624 | 3300009093 | Bacteria | 8786 |
| 360 | Ga0105240_10054015 | 3300009093 | Bacteria | 5037 |
| 361 | Ga0105240_10538318 | 3300009093 | Bacteria | 1294 |
| 362 | Ga0111539_10010658 | 3300009094 | Bacteria | 11577 |
| 363 | Ga0111539_10031589 | 3300009094 | Bacteria | 6433 |
| 364 | Ga0111539_10046646 | 3300009094 | Bacteria | 5182 |
| 365 | Ga0111539_10107930 | 3300009094 | Bacteria | 3266 |
| 366 | Ga0111539_10187325 | 3300009094 | Bacteria | 2416 |
| 367 | Ga0111539_10207051 | 3300009094 | Bacteria | 2286 |
| 368 | Ga0111539_10290381 | 3300009094 | Bacteria | 1903 |
| 369 | Ga0111539_10394916 | 3300009094 | Bacteria | 1611 |
| 370 | Ga0111539_10421369 | 3300009094 | Bacteria | 1555 |
| 371 | Ga0111539_10725552 | 3300009094 | Bacteria | 1157 |
| 372 | Ga0105245_10001132 | 3300009098 | Bacteria | 24118 |
| 373 | Ga0105245_10028479 | 3300009098 | Bacteria | 4929 |
| 374 | Ga0105245_10313858 | 3300009098 | Bacteria | 1542 |
| 375 | Ga0105247_10011973 | 3300009101 | Bacteria | 5211 |
| 376 | Ga0105247_10057718 | 3300009101 | Bacteria | 2400 |
| 377 | Ga0105247_10089867 | 3300009101 | Bacteria | 1948 |
| 378 | Ga0105247_10098594 | 3300009101 | Bacteria | 1865 |
| 379 | Ga0114129_10002014 | 3300009147 | Bacteria | 27856 |
| 380 | Ga0114129_10011877 | 3300009147 | Bacteria | 12386 |
| 381 | Ga0114129_10019370 | 3300009147 | Bacteria | 9691 |
| 382 | Ga0114129_10053795 | 3300009147 | Bacteria | 5646 |
| 383 | Ga0114129_10078363 | 3300009147 | Bacteria | 4596 |
| 384 | Ga0114129_10262075 | 3300009147 | Bacteria | 2316 |
| 385 | Ga0114129_10321372 | 3300009147 | Bacteria | 2057 |
| 386 | Ga0114129_10554657 | 3300009147 | Bacteria | 1494 |
| 387 | Ga0105243_10021892 | 3300009148 | Bacteria | 4854 |
| 388 | Ga0105243_10062102 | 3300009148 | Bacteria | 2990 |
| 389 | Ga0105243_10216178 | 3300009148 | Bacteria | 1691 |
| 390 | Ga0105243_10436681 | 3300009148 | Bacteria | 1225 |
| 391 | Ga0105241_10009988 | 3300009174 | Bacteria | 6972 |
| 392 | Ga0105241_10157156 | 3300009174 | Bacteria | 1866 |
| 393 | Ga0105242_10000623 | 3300009176 | Bacteria | 27811 |
| 394 | Ga0105242_10063821 | 3300009176 | Bacteria | 3034 |
| 395 | Ga0105242_10089675 | 3300009176 | Bacteria | 2585 |
| 396 | Ga0105242_10099801 | 3300009176 | Bacteria | 2458 |
| 397 | Ga0105242_10543833 | 3300009176 | Bacteria | 1112 |
| 398 | Ga0105248_10037821 | 3300009177 | Bacteria | 5400 |
| 399 | Ga0105248_10080147 | 3300009177 | Bacteria | 3669 |
| 400 | Ga0105248_10169653 | 3300009177 | Bacteria | 2459 |
| 401 | Ga0105248_10180002 | 3300009177 | Bacteria | 2382 |
| 402 | Ga0105248_10229032 | 3300009177 | Bacteria | 2092 |
| 403 | Ga0105248_10508627 | 3300009177 | Bacteria | 1358 |
| 404 | Ga0105237_10052924 | 3300009545 | Bacteria | 4073 |
| 405 | Ga0105237_10103835 | 3300009545 | Bacteria | 2834 |
| 406 | Ga0105237_10195426 | 3300009545 | Bacteria | 2023 |
| 407 | Ga0105237_10477616 | 3300009545 | Bacteria | 1253 |
| 408 | Ga0105237_10488024 | 3300009545 | Bacteria | 1238 |
| 409 | Ga0105238_10006101 | 3300009551 | Bacteria | 11953 |
| 410 | Ga0105238_10068460 | 3300009551 | Bacteria | 3551 |
| 411 | Ga0105238_10083410 | 3300009551 | Bacteria | 3185 |
| 412 | Ga0105249_10026638 | 3300009553 | Bacteria | 5212 |
| 413 | Ga0105249_10084761 | 3300009553 | Bacteria | 2951 |
| 414 | Ga0105249_10168270 | 3300009553 | Bacteria | 2124 |
| 415 | Ga0105249_10172880 | 3300009553 | Bacteria | 2096 |
| 416 | Ga0105249_10173692 | 3300009553 | Bacteria | 2091 |
| 417 | Ga0105249_10228917 | 3300009553 | Bacteria | 1833 |
| 418 | Ga0105249_11639760 | 3300009553 | Bacteria | 716 |
| 419 | Ga0099796_10005106 | 3300010159 | Bacteria | 3247 |
| 420 | Ga0105239_10029848 | 3300010375 | Bacteria | 5996 |
| 421 | Ga0105239_10038880 | 3300010375 | Bacteria | 5212 |
| 422 | Ga0105239_10048338 | 3300010375 | Bacteria | 4665 |
| 423 | Ga0105239_10720401 | 3300010375 | Bacteria | 1141 |
| 424 | Ga0105246_10001183 | 3300011119 | Bacteria | 15175 |
| 425 | Ga0105246_10572213 | 3300011119 | Bacteria | 972 |
| 426 | Ga0105246_10938328 | 3300011119 | Bacteria | 779 |
| 427 | Ga0157373_10012880 | 3300013100 | Bacteria | 6140 |
| 428 | Ga0157373_10246400 | 3300013100 | Bacteria | 1263 |
| 429 | Ga0157373_10295000 | 3300013100 | Bacteria | 1150 |
| 430 | Ga0157371_10057659 | 3300013102 | Bacteria | 2754 |
| 431 | Ga0157371_10135387 | 3300013102 | Bacteria | 1754 |
| 432 | Ga0157371_10595984 | 3300013102 | Bacteria | 822 |
| 433 | Ga0157370_10108378 | 3300013104 | Bacteria | 2597 |
| 434 | Ga0157370_10776615 | 3300013104 | Bacteria | 872 |
| 435 | Ga0157369_10193404 | 3300013105 | Bacteria | 2137 |
| 436 | Ga0157369_10423619 | 3300013105 | Bacteria | 1380 |
| 437 | Ga0157374_10001601 | 3300013296 | Bacteria | 18992 |
| 438 | Ga0157374_10124095 | 3300013296 | Bacteria | 2495 |
| 439 | Ga0157374_10128465 | 3300013296 | Bacteria | 2451 |
| 440 | Ga0157374_10422485 | 3300013296 | Bacteria | 1332 |
| 441 | Ga0157374_10958114 | 3300013296 | Bacteria | 874 |
| 442 | Ga0157378_10002020 | 3300013297 | Bacteria | 18147 |
| 443 | Ga0157378_10133677 | 3300013297 | Bacteria | 2298 |
| 444 | Ga0163162_10032396 | 3300013306 | Bacteria | 5191 |
| 445 | Ga0163162_10114861 | 3300013306 | Bacteria | 2792 |
| 446 | Ga0163162_10206623 | 3300013306 | Bacteria | 2093 |
| 447 | Ga0163162_10208911 | 3300013306 | Bacteria | 2082 |
| 448 | Ga0163162_10348941 | 3300013306 | Bacteria | 1613 |
| 449 | Ga0157372_10288614 | 3300013307 | Bacteria | 1908 |
| 450 | Ga0157375_10029102 | 3300013308 | Bacteria | 5190 |
| 451 | Ga0157375_10044806 | 3300013308 | Bacteria | 4302 |
| 452 | Ga0157375_10367402 | 3300013308 | Bacteria | 1605 |
| 453 | Ga0157375_10782202 | 3300013308 | Bacteria | 1104 |
| 454 | Ga0157375_10851229 | 3300013308 | Bacteria | 1058 |
| 455 | Ga0157375_11170870 | 3300013308 | Bacteria | 901 |
| 456 | Ga0163163_10049673 | 3300014325 | Bacteria | 4128 |
| 457 | Ga0163163_10127282 | 3300014325 | Bacteria | 2585 |
| 458 | Ga0163163_10157490 | 3300014325 | Bacteria | 2316 |
| 459 | Ga0163163_10180826 | 3300014325 | Bacteria | 2156 |
| 460 | Ga0163163_10341401 | 3300014325 | Bacteria | 1553 |
| 461 | Ga0157380_10104618 | 3300014326 | Bacteria | 2365 |
| 462 | Ga0157380_10182785 | 3300014326 | Bacteria | 1844 |
| 463 | Ga0157380_10196047 | 3300014326 | Bacteria | 1787 |
| 464 | Ga0157377_10000196 | 3300014745 | Bacteria | 33816 |
| 465 | Ga0157377_10179011 | 3300014745 | Bacteria | 1332 |
| 466 | Ga0157379_10021402 | 3300014968 | Bacteria | 5724 |
| 467 | Ga0157379_10049072 | 3300014968 | Bacteria | 3768 |
| 468 | Ga0157379_10151547 | 3300014968 | Bacteria | 2091 |
| 469 | Ga0157379_10161364 | 3300014968 | Bacteria | 2023 |
| 470 | Ga0157379_10677320 | 3300014968 | Bacteria | 967 |
| 471 | Ga0157379_11012124 | 3300014968 | Bacteria | 792 |
| 472 | Ga0157376_10000168 | 3300014969 | Bacteria | 45352 |
| 473 | Ga0157376_10145651 | 3300014969 | Bacteria | 2130 |
| 474 | Ga0157376_10162625 | 3300014969 | Bacteria | 2025 |
| 475 | Ga0157376_10249994 | 3300014969 | Bacteria | 1655 |
| 476 | Ga0163161_10000511 | 3300017792 | Bacteria | 31657 |
| 477 | Ga0163161_10067114 | 3300017792 | Bacteria | 2620 |
| 478 | Ga0163161_10102191 | 3300017792 | Bacteria | 2135 |
| 479 | Ga0213874_10077144 | 3300021377 | Bacteria | 1073 |
| 480 | Ga0213876_10067575 | 3300021384 | Bacteria | 1888 |
| 481 | Ga0213876_10177992 | 3300021384 | Bacteria | 1131 |
| 482 | Ga0207666_1000296 | 3300025271 | Bacteria | 7022 |
| 483 | Ga0207673_1000056 | 3300025290 | Bacteria | 9521 |
| 484 | Ga0207697_10006861 | 3300025315 | Bacteria | 5109 |
| 485 | Ga0207697_10204838 | 3300025315 | Bacteria | 868 |
| 486 | Ga0207713_1063657 | 3300025735 | Bacteria | 1392 |
| 487 | Ga0207682_10000064 | 3300025893 | Bacteria | 46752 |
| 488 | Ga0207682_10001593 | 3300025893 | Bacteria | 10438 |
| 489 | Ga0207692_10026576 | 3300025898 | Bacteria | 2716 |
| 490 | Ga0207692_10135720 | 3300025898 | Bacteria | 1394 |
| 491 | Ga0207692_10155744 | 3300025898 | Bacteria | 1312 |
| 492 | Ga0207642_10006630 | 3300025899 | Bacteria | 3862 |
| 493 | Ga0207642_10029164 | 3300025899 | Bacteria | 2282 |
| 494 | Ga0207710_10007378 | 3300025900 | Bacteria | 4658 |
| 495 | Ga0207710_10012495 | 3300025900 | Bacteria | 3573 |
| 496 | Ga0207688_10000117 | 3300025901 | Bacteria | 32379 |
| 497 | Ga0207688_10000195 | 3300025901 | Bacteria | 26893 |
| 498 | Ga0207688_10356869 | 3300025901 | Bacteria | 901 |
| 499 | Ga0207680_10126150 | 3300025903 | Bacteria | 1681 |
| 500 | Ga0207680_10127971 | 3300025903 | Bacteria | 1670 |
| 501 | Ga0207680_10162594 | 3300025903 | Bacteria | 1498 |
| 502 | Ga0207680_10164890 | 3300025903 | Bacteria | 1488 |
| 503 | Ga0207680_10691915 | 3300025903 | Bacteria | 731 |
| 504 | Ga0207647_10032286 | 3300025904 | Bacteria | 3366 |
| 505 | Ga0207647_10112320 | 3300025904 | Bacteria | 1610 |
| 506 | Ga0207685_10022403 | 3300025905 | Bacteria | 2135 |
| 507 | Ga0207685_10044028 | 3300025905 | Bacteria | 1685 |
| 508 | Ga0207685_10076764 | 3300025905 | Bacteria | 1370 |
| 509 | Ga0207699_10101144 | 3300025906 | Bacteria | 1829 |
| 510 | Ga0207699_10220282 | 3300025906 | Bacteria | 1295 |
| 511 | Ga0207699_10236930 | 3300025906 | Bacteria | 1252 |
| 512 | Ga0207699_10462537 | 3300025906 | Bacteria | 911 |
| 513 | Ga0207699_10489897 | 3300025906 | Bacteria | 886 |
| 514 | Ga0207645_10000040 | 3300025907 | Bacteria | 87876 |
| 515 | Ga0207643_10000072 | 3300025908 | Bacteria | 65857 |
| 516 | Ga0207643_10000291 | 3300025908 | Bacteria | 34985 |
| 517 | Ga0207705_10551007 | 3300025909 | Bacteria | 896 |
| 518 | Ga0207684_10084148 | 3300025910 | Bacteria | 2709 |
| 519 | Ga0207654_10010446 | 3300025911 | Bacteria | 4728 |
| 520 | Ga0207654_10045184 | 3300025911 | Bacteria | 2506 |
| 521 | Ga0207654_10202484 | 3300025911 | Bacteria | 1308 |
| 522 | Ga0207654_10239909 | 3300025911 | Bacteria | 1211 |
| 523 | Ga0207654_10358344 | 3300025911 | Bacteria | 1006 |
| 524 | Ga0207707_10003512 | 3300025912 | Bacteria | 13877 |
| 525 | Ga0207707_10281862 | 3300025912 | Bacteria | 1439 |
| 526 | Ga0207695_10432255 | 3300025913 | Bacteria | 1200 |
| 527 | Ga0207671_10026718 | 3300025914 | Bacteria | 4322 |
| 528 | Ga0207671_10324099 | 3300025914 | Bacteria | 1219 |
| 529 | Ga0207693_10004617 | 3300025915 | Bacteria | 11623 |
| 530 | Ga0207693_10005019 | 3300025915 | Bacteria | 11108 |
| 531 | Ga0207693_10007075 | 3300025915 | Bacteria | 9262 |
| 532 | Ga0207693_10021399 | 3300025915 | Bacteria | 5140 |
| 533 | Ga0207693_10059962 | 3300025915 | Bacteria | 2981 |
| 534 | Ga0207693_10111959 | 3300025915 | Bacteria | 2141 |
| 535 | Ga0207693_10122397 | 3300025915 | Bacteria | 2043 |
| 536 | Ga0207693_10122592 | 3300025915 | Bacteria | 2042 |
| 537 | Ga0207693_10137568 | 3300025915 | Bacteria | 1921 |
| 538 | Ga0207663_10102395 | 3300025916 | Bacteria | 1926 |
| 539 | Ga0207663_10129151 | 3300025916 | Bacteria | 1743 |
| 540 | Ga0207663_10529915 | 3300025916 | Bacteria | 918 |
| 541 | Ga0207660_10003460 | 3300025917 | Bacteria | 10295 |
| 542 | Ga0207660_10032727 | 3300025917 | Bacteria | 3590 |
| 543 | Ga0207660_10206010 | 3300025917 | Bacteria | 1538 |
| 544 | Ga0207660_10461750 | 3300025917 | Bacteria | 1028 |
| 545 | Ga0207662_10010243 | 3300025918 | Bacteria | 5171 |
| 546 | Ga0207662_10065808 | 3300025918 | Bacteria | 2183 |
| 547 | Ga0207662_10261625 | 3300025918 | Bacteria | 1139 |
| 548 | Ga0207657_10051887 | 3300025919 | Bacteria | 3563 |
| 549 | Ga0207657_10075361 | 3300025919 | Bacteria | 2847 |
| 550 | Ga0207657_10079987 | 3300025919 | Bacteria | 2748 |
| 551 | Ga0207657_10125762 | 3300025919 | Bacteria | 2106 |
| 552 | Ga0207657_10159561 | 3300025919 | Bacteria | 1832 |
| 553 | Ga0207649_10000086 | 3300025920 | Bacteria | 79546 |
| 554 | Ga0207652_10004335 | 3300025921 | Bacteria | 11560 |
| 555 | Ga0207652_10148105 | 3300025921 | Bacteria | 2101 |
| 556 | Ga0207652_10231094 | 3300025921 | Bacteria | 1667 |
| 557 | Ga0207652_10384661 | 3300025921 | Bacteria | 1266 |
| 558 | Ga0207646_10048472 | 3300025922 | Bacteria | 3808 |
| 559 | Ga0207646_10995330 | 3300025922 | Bacteria | 741 |
| 560 | Ga0207681_10000451 | 3300025923 | Bacteria | 28809 |
| 561 | Ga0207694_10103727 | 3300025924 | Bacteria | 2255 |
| 562 | Ga0207694_10297751 | 3300025924 | Bacteria | 1328 |
| 563 | Ga0207694_10531258 | 3300025924 | Bacteria | 986 |
| 564 | Ga0207650_10000972 | 3300025925 | Bacteria | 21558 |
| 565 | Ga0207650_10008027 | 3300025925 | Bacteria | 7194 |
| 566 | Ga0207650_10046577 | 3300025925 | Bacteria | 3193 |
| 567 | Ga0207650_10201795 | 3300025925 | Bacteria | 1593 |
| 568 | Ga0207659_10000478 | 3300025926 | Bacteria | 24069 |
| 569 | Ga0207659_10027849 | 3300025926 | Bacteria | 3832 |
| 570 | Ga0207659_10053244 | 3300025926 | Bacteria | 2886 |
| 571 | Ga0207659_10060168 | 3300025926 | Bacteria | 2733 |
| 572 | Ga0207659_10176572 | 3300025926 | Bacteria | 1689 |
| 573 | Ga0207659_10210254 | 3300025926 | Bacteria | 1559 |
| 574 | Ga0207687_10000144 | 3300025927 | Bacteria | 47356 |
| 575 | Ga0207687_10005852 | 3300025927 | Bacteria | 8133 |
| 576 | Ga0207687_10007800 | 3300025927 | Bacteria | 7021 |
| 577 | Ga0207687_10017010 | 3300025927 | Bacteria | 4781 |
| 578 | Ga0207687_10595119 | 3300025927 | Bacteria | 932 |
| 579 | Ga0207700_10007883 | 3300025928 | Bacteria | 6551 |
| 580 | Ga0207700_10010360 | 3300025928 | Bacteria | 5877 |
| 581 | Ga0207700_10103349 | 3300025928 | Bacteria | 2278 |
| 582 | Ga0207700_10209693 | 3300025928 | Bacteria | 1646 |
| 583 | Ga0207700_10238468 | 3300025928 | Bacteria | 1549 |
| 584 | Ga0207700_10246473 | 3300025928 | Bacteria | 1525 |
| 585 | Ga0207700_10333255 | 3300025928 | Bacteria | 1317 |
| 586 | Ga0207664_10052117 | 3300025929 | Bacteria | 3235 |
| 587 | Ga0207664_10311302 | 3300025929 | Bacteria | 1387 |
| 588 | Ga0207664_10558659 | 3300025929 | Bacteria | 1027 |
| 589 | Ga0207644_10001694 | 3300025931 | Bacteria | 14217 |
| 590 | Ga0207644_10007672 | 3300025931 | Bacteria | 7037 |
| 591 | Ga0207644_10010699 | 3300025931 | Bacteria | 6050 |
| 592 | Ga0207644_10028186 | 3300025931 | Bacteria | 3885 |
| 593 | Ga0207690_10000086 | 3300025932 | Bacteria | 77995 |
| 594 | Ga0207690_10071142 | 3300025932 | Bacteria | 2398 |
| 595 | Ga0207690_10093526 | 3300025932 | Bacteria | 2131 |
| 596 | Ga0207690_10204089 | 3300025932 | Bacteria | 1503 |
| 597 | Ga0207690_10441232 | 3300025932 | Bacteria | 1045 |
| 598 | Ga0207706_10013203 | 3300025933 | Bacteria | 7515 |
| 599 | Ga0207706_10039372 | 3300025933 | Bacteria | 4190 |
| 600 | Ga0207706_10186999 | 3300025933 | Bacteria | 1819 |
| 601 | Ga0207686_10000287 | 3300025934 | Bacteria | 37285 |
| 602 | Ga0207686_10026795 | 3300025934 | Bacteria | 3367 |
| 603 | Ga0207686_10129282 | 3300025934 | Bacteria | 1730 |
| 604 | Ga0207686_10196937 | 3300025934 | Bacteria | 1440 |
| 605 | Ga0207709_10000431 | 3300025935 | Bacteria | 40052 |
| 606 | Ga0207709_10044459 | 3300025935 | Bacteria | 2684 |
| 607 | Ga0207709_10425584 | 3300025935 | Bacteria | 1021 |
| 608 | Ga0207670_10010207 | 3300025936 | Bacteria | 5400 |
| 609 | Ga0207670_10011186 | 3300025936 | Bacteria | 5199 |
| 610 | Ga0207670_10061434 | 3300025936 | Bacteria | 2564 |
| 611 | Ga0207670_10100941 | 3300025936 | Bacteria | 2061 |
| 612 | Ga0207670_10165734 | 3300025936 | Bacteria | 1653 |
| 613 | Ga0207670_10300161 | 3300025936 | Bacteria | 1257 |
| 614 | Ga0207669_10000050 | 3300025937 | Bacteria | 60155 |
| 615 | Ga0207669_10022824 | 3300025937 | Bacteria | 3330 |
| 616 | Ga0207669_10171196 | 3300025937 | Bacteria | 1546 |
| 617 | Ga0207669_10402567 | 3300025937 | Bacteria | 1072 |
| 618 | Ga0207704_10000774 | 3300025938 | Bacteria | 14048 |
| 619 | Ga0207704_10006265 | 3300025938 | Bacteria | 5533 |
| 620 | Ga0207704_10014495 | 3300025938 | Bacteria | 3981 |
| 621 | Ga0207704_10225989 | 3300025938 | Bacteria | 1388 |
| 622 | Ga0207704_10464271 | 3300025938 | Bacteria | 1013 |
| 623 | Ga0207665_10001033 | 3300025939 | Bacteria | 18741 |
| 624 | Ga0207665_10016224 | 3300025939 | Bacteria | 4891 |
| 625 | Ga0207665_10109746 | 3300025939 | Bacteria | 1937 |
| 626 | Ga0207665_10545867 | 3300025939 | Bacteria | 900 |
| 627 | Ga0207691_10002007 | 3300025940 | Bacteria | 19920 |
| 628 | Ga0207691_10019090 | 3300025940 | Bacteria | 6493 |
| 629 | Ga0207691_10020643 | 3300025940 | Bacteria | 6228 |
| 630 | Ga0207711_10011783 | 3300025941 | Bacteria | 7263 |
| 631 | Ga0207711_10036115 | 3300025941 | Bacteria | 4192 |
| 632 | Ga0207711_10036907 | 3300025941 | Bacteria | 4147 |
| 633 | Ga0207711_10041690 | 3300025941 | Bacteria | 3910 |
| 634 | Ga0207689_10000115 | 3300025942 | Bacteria | 66254 |
| 635 | Ga0207689_10002877 | 3300025942 | Bacteria | 15867 |
| 636 | Ga0207689_10109931 | 3300025942 | Bacteria | 2265 |
| 637 | Ga0207661_10000094 | 3300025944 | Bacteria | 56621 |
| 638 | Ga0207661_10091112 | 3300025944 | Bacteria | 2540 |
| 639 | Ga0207679_10000025 | 3300025945 | Bacteria | 203699 |
| 640 | Ga0207679_10015384 | 3300025945 | Bacteria | 5055 |
| 641 | Ga0207679_10340404 | 3300025945 | Bacteria | 1304 |
| 642 | Ga0207679_10695165 | 3300025945 | Bacteria | 922 |
| 643 | Ga0207679_10738468 | 3300025945 | Bacteria | 895 |
| 644 | Ga0207667_10047924 | 3300025949 | Bacteria | 4520 |
| 645 | Ga0207667_10957064 | 3300025949 | Bacteria | 845 |
| 646 | Ga0207651_10000081 | 3300025960 | Bacteria | 42817 |
| 647 | Ga0207651_10082069 | 3300025960 | Bacteria | 2326 |
| 648 | Ga0207712_10000315 | 3300025961 | Bacteria | 44324 |
| 649 | Ga0207712_10017744 | 3300025961 | Bacteria | 4627 |
| 650 | Ga0207712_10097480 | 3300025961 | Bacteria | 2178 |
| 651 | Ga0207668_10000098 | 3300025972 | Bacteria | 62195 |
| 652 | Ga0207668_10240575 | 3300025972 | Bacteria | 1464 |
| 653 | Ga0207640_10000104 | 3300025981 | Bacteria | 65093 |
| 654 | Ga0207640_10067074 | 3300025981 | Bacteria | 2399 |
| 655 | Ga0207640_10224233 | 3300025981 | Bacteria | 1441 |
| 656 | Ga0207640_10287503 | 3300025981 | Bacteria | 1295 |
| 657 | Ga0207658_10022108 | 3300025986 | Bacteria | 4424 |
| 658 | Ga0207658_10043430 | 3300025986 | Bacteria | 3267 |
| 659 | Ga0207658_10119607 | 3300025986 | Bacteria | 2097 |
| 660 | Ga0207658_10264654 | 3300025986 | Bacteria | 1467 |
| 661 | Ga0207677_10034106 | 3300026023 | Bacteria | 3292 |
| 662 | Ga0207677_10137379 | 3300026023 | Bacteria | 1866 |
| 663 | Ga0207677_10240490 | 3300026023 | Bacteria | 1464 |
| 664 | Ga0207703_10046816 | 3300026035 | Bacteria | 3485 |
| 665 | Ga0207703_10088275 | 3300026035 | Bacteria | 2602 |
| 666 | Ga0207703_10483725 | 3300026035 | Bacteria | 1160 |
| 667 | Ga0207639_10000954 | 3300026041 | Bacteria | 19615 |
| 668 | Ga0207639_10112920 | 3300026041 | Bacteria | 2218 |
| 669 | Ga0207639_10194149 | 3300026041 | Bacteria | 1736 |
| 670 | Ga0207639_10281884 | 3300026041 | Bacteria | 1462 |
| 671 | Ga0207639_10313196 | 3300026041 | Bacteria | 1391 |
| 672 | Ga0207678_10001162 | 3300026067 | Bacteria | 24108 |
| 673 | Ga0207678_10008097 | 3300026067 | Bacteria | 9269 |
| 674 | Ga0207678_10009832 | 3300026067 | Bacteria | 8406 |
| 675 | Ga0207678_10145462 | 3300026067 | Bacteria | 2023 |
| 676 | Ga0207678_10380604 | 3300026067 | Bacteria | 1220 |
| 677 | Ga0207708_10001029 | 3300026075 | Bacteria | 20873 |
| 678 | Ga0207708_10019521 | 3300026075 | Bacteria | 5111 |
| 679 | Ga0207708_10131875 | 3300026075 | Bacteria | 1954 |
| 680 | Ga0207708_10252786 | 3300026075 | Bacteria | 1421 |
| 681 | Ga0207708_10338657 | 3300026075 | Bacteria | 1231 |
| 682 | Ga0207702_10002785 | 3300026078 | Bacteria | 16385 |
| 683 | Ga0207702_10272978 | 3300026078 | Bacteria | 1596 |
| 684 | Ga0207702_10277859 | 3300026078 | Bacteria | 1582 |
| 685 | Ga0207702_10278883 | 3300026078 | Bacteria | 1579 |
| 686 | Ga0207702_10919652 | 3300026078 | Bacteria | 867 |
| 687 | Ga0207641_10000364 | 3300026088 | Bacteria | 53999 |
| 688 | Ga0207641_10029516 | 3300026088 | Bacteria | 4536 |
| 689 | Ga0207641_10036719 | 3300026088 | Bacteria | 4090 |
| 690 | Ga0207648_10017434 | 3300026089 | Bacteria | 6534 |
| 691 | Ga0207648_10023601 | 3300026089 | Bacteria | 5507 |
| 692 | Ga0207648_10027119 | 3300026089 | Bacteria | 5088 |
| 693 | Ga0207648_10213726 | 3300026089 | Bacteria | 1713 |
| 694 | Ga0207648_10267297 | 3300026089 | Bacteria | 1527 |
| 695 | Ga0207648_10408896 | 3300026089 | Bacteria | 1231 |
| 696 | Ga0207676_10003923 | 3300026095 | Bacteria | 10503 |
| 697 | Ga0207676_10004707 | 3300026095 | Bacteria | 9666 |
| 698 | Ga0207676_10006878 | 3300026095 | Bacteria | 8058 |
| 699 | Ga0207676_10246146 | 3300026095 | Bacteria | 1607 |
| 700 | Ga0207676_10652954 | 3300026095 | Bacteria | 1015 |
| 701 | Ga0207674_10019868 | 3300026116 | Bacteria | 7270 |
| 702 | Ga0207674_10240199 | 3300026116 | Bacteria | 1758 |
| 703 | Ga0207674_10713633 | 3300026116 | Bacteria | 968 |
| 704 | Ga0207675_100002392 | 3300026118 | Bacteria | 18578 |
| 705 | Ga0207675_100083025 | 3300026118 | Bacteria | 3005 |
| 706 | Ga0207675_100142583 | 3300026118 | Bacteria | 2277 |
| 707 | Ga0207675_100268304 | 3300026118 | Bacteria | 1656 |
| 708 | Ga0207683_10000001 | 3300026121 | Bacteria | 352047 |
| 709 | Ga0207683_10000918 | 3300026121 | Bacteria | 27095 |
| 710 | Ga0207683_10004123 | 3300026121 | Bacteria | 12568 |
| 711 | Ga0207683_10033169 | 3300026121 | Bacteria | 4484 |
| 712 | Ga0207683_10082865 | 3300026121 | Bacteria | 2850 |
| 713 | Ga0207698_10011125 | 3300026142 | Bacteria | 5817 |
| 714 | Ga0207698_10731019 | 3300026142 | Bacteria | 987 |
| 715 | Ga0209967_1004004 | 3300027364 | Bacteria | 1946 |
| 716 | Ga0209984_1003477 | 3300027424 | Bacteria | 1807 |
| 717 | Ga0209970_1007141 | 3300027614 | Bacteria | 1831 |
| 718 | Ga0209983_1003280 | 3300027665 | Bacteria | 3473 |
| 719 | Ga0209971_1003510 | 3300027682 | Bacteria | 3709 |
| 720 | Ga0209966_1001211 | 3300027695 | Bacteria | 4595 |
| 721 | Ga0209998_10012805 | 3300027717 | Bacteria | 1743 |
| 722 | Ga0209998_10015130 | 3300027717 | Bacteria | 1613 |
| 723 | Ga0209974_10045558 | 3300027876 | Bacteria | 1465 |
| 724 | Ga0209974_10047488 | 3300027876 | Bacteria | 1438 |
| 725 | Ga0207428_10000146 | 3300027907 | Bacteria | 95417 |
| 726 | Ga0207428_10000221 | 3300027907 | Bacteria | 79234 |
| 727 | Ga0207428_10000524 | 3300027907 | Bacteria | 45818 |
| 728 | Ga0268266_10036070 | 3300028379 | Bacteria | 4207 |
| 729 | Ga0268266_10064002 | 3300028379 | Bacteria | 3176 |
| 730 | Ga0268266_10093484 | 3300028379 | Bacteria | 2638 |
| 731 | Ga0268266_10213454 | 3300028379 | Bacteria | 1771 |
| 732 | Ga0268265_10000350 | 3300028380 | Bacteria | 49940 |
| 733 | Ga0268265_10205052 | 3300028380 | Bacteria | 1713 |
| 734 | Ga0268265_10836915 | 3300028380 | Bacteria | 899 |
| 735 | Ga0268264_10021698 | 3300028381 | Bacteria | 5243 |
| 736 | Ga0268264_10136895 | 3300028381 | Bacteria | 2178 |
| 737 | Ga0268264_10793015 | 3300028381 | Bacteria | 946 |
| 738 | Ga0265337_1006088 | 3300028556 | Bacteria | 4698 |
| 739 | Ga0265318_10016381 | 3300028577 | Bacteria | 3062 |
| 740 | Ga0265338_10008028 | 3300028800 | Bacteria | 12916 |
| 741 | Ga0265760_10044756 | 3300031090 | Bacteria | 1325 |
| 742 | Ga0265760_10046630 | 3300031090 | Bacteria | 1300 |
| 743 | Ga0265760_10058917 | 3300031090 | Bacteria | 1165 |
| 744 | Ga0265760_10064269 | 3300031090 | Bacteria | 1119 |
| 745 | Ga0265330_10100356 | 3300031235 | Bacteria | 1239 |
| 746 | Ga0265332_10011248 | 3300031238 | Bacteria | 3979 |
| 747 | Ga0265332_10017669 | 3300031238 | Bacteria | 3147 |
| 748 | Ga0265325_10015013 | 3300031241 | Bacteria | 4365 |
| 749 | Ga0265340_10031418 | 3300031247 | Bacteria | 2655 |
| 750 | Ga0265339_10000096 | 3300031249 | Bacteria | 74964 |
| 751 | Ga0265339_10021879 | 3300031249 | Bacteria | 3711 |
| 752 | Ga0265316_10051989 | 3300031344 | Bacteria | 3216 |
| 753 | Ga0307408_101063056 | 3300031548 | Bacteria | 749 |
| 754 | Ga0265313_10000024 | 3300031595 | Bacteria | 138587 |
| 755 | Ga0316575_10055211 | 3300031665 | Bacteria | 1582 |
| 756 | Ga0265314_10283896 | 3300031711 | Bacteria | 935 |
| 757 | Ga0265342_10000230 | 3300031712 | Bacteria | 62706 |
| 758 | Ga0265342_10059320 | 3300031712 | Bacteria | 2260 |
| 759 | Ga0316578_10066629 | 3300031728 | Bacteria | 2127 |
| 760 | Ga0307406_11020210 | 3300031901 | Bacteria | 711 |
| 761 | Ga0373930_0001414 | 3300034816 | Bacteria | 3560 |
| 762 | Ga0373930_0004022 | 3300034816 | Bacteria | 2369 |
| 763 | Ga0373948_0003227 | 3300034817 | Bacteria | 2489 |
| 764 | Ga0373948_0032879 | 3300034817 | Bacteria | 1053 |
| 765 | Ga0373950_0000233 | 3300034818 | Bacteria | 7281 |
| 766 | Ga0373958_0000271 | 3300034819 | Bacteria | 6111 |
| 767 | Ga0373958_0004321 | 3300034819 | Bacteria | 2099 |
| 768 | Ga0373959_0002070 | 3300034820 | Bacteria | 3199 |
| 769 | Ga0373938_0014635 | 3300034957 | Bacteria | 1509 |
| 770 | Ga0373938_0019336 | 3300034957 | Bacteria | 1361 |
| 771 | Ga0373938_0020613 | 3300034957 | Bacteria | 1329 |
| 772 | Ga0373926_0006063 | 3300035083 | Bacteria | 4000 |
| 773 | Ga0373928_0012174 | 3300035084 | Bacteria | 1712 |
| 774 | Ga0373929_0000054 | 3300035085 | Bacteria | 20951 |
| 775 | Ga0373934_0032784 | 3300035086 | Bacteria | 2038 |
| 776 | Ga0373934_0033349 | 3300035086 | Bacteria | 2021 |
| 777 | Ga0373940_0000308 | 3300035088 | Bacteria | 7071 |
| 778 | Ga0373940_0001216 | 3300035088 | Bacteria | 4544 |
| 779 | Ga0373940_0018543 | 3300035088 | Bacteria | 1748 |
| 780 | Ga0373940_0051906 | 3300035088 | Bacteria | 1154 |
| 781 | Ga0373944_0005528 | 3300035089 | Bacteria | 3330 |
| 782 | Ga0373944_0009262 | 3300035089 | Bacteria | 2668 |
| 783 | Ga0373944_0063225 | 3300035089 | Bacteria | 1191 |
| 784 | Ga0373951_0006408 | 3300035091 | Bacteria | 2692 |
| 785 | Ga0373951_0018048 | 3300035091 | Bacteria | 1601 |
| 786 | Ga0373952_0001176 | 3300035092 | Bacteria | 4777 |
| 787 | Ga0373952_0004129 | 3300035092 | Bacteria | 2624 |
| 788 | Ga0373923_0007797 | 3300035111 | Bacteria | 3782 |
| 789 | Ga0373923_0009424 | 3300035111 | Bacteria | 3522 |
| 790 | Ga0373932_0000513 | 3300035112 | Bacteria | 11912 |
| 791 | Ga0373932_0004289 | 3300035112 | Bacteria | 3384 |
| 792 | Ga0373932_0004716 | 3300035112 | Bacteria | 3217 |
| 793 | Ga0373936_0008189 | 3300035113 | Bacteria | 3929 |
| 794 | Ga0373936_0060285 | 3300035113 | Bacteria | 1548 |
| 795 | Ga0373936_0078942 | 3300035113 | Bacteria | 1367 |
| 796 | Ga0373936_0269599 | 3300035113 | Bacteria | 763 |
| 797 | Ga0373939_0000835 | 3300035114 | Bacteria | 7629 |
| 798 | Ga0373939_0002022 | 3300035114 | Bacteria | 4843 |
| 799 | Ga0373939_0002422 | 3300035114 | Bacteria | 4395 |
| 800 | Ga0373939_0056971 | 3300035114 | Bacteria | 1232 |
| 801 | Ga0373941_0000446 | 3300035115 | Bacteria | 8210 |
| 802 | Ga0373941_0001331 | 3300035115 | Bacteria | 5199 |
| 803 | Ga0373941_0018235 | 3300035115 | Bacteria | 1936 |
| 804 | Ga0373945_0002888 | 3300035116 | Bacteria | 5396 |
| 805 | Ga0373945_0026173 | 3300035116 | Bacteria | 2031 |
| 806 | Ga0373953_0006422 | 3300035117 | Bacteria | 3871 |
| 807 | Ga0373953_0022517 | 3300035117 | Bacteria | 2377 |
| 808 | Ga0373953_0027003 | 3300035117 | Bacteria | 2203 |
| 809 | Ga0373953_0053410 | 3300035117 | Bacteria | 1638 |
| 810 | Ga0373954_0005543 | 3300035118 | Bacteria | 5465 |
| 811 | Ga0373954_0019638 | 3300035118 | Bacteria | 3050 |
| 812 | Ga0373954_0097191 | 3300035118 | Bacteria | 1419 |
| 813 | Ga0373954_0150530 | 3300035118 | Bacteria | 1137 |
| 814 | Ga0373956_0001402 | 3300035119 | Bacteria | 9970 |
| 815 | Ga0373956_0058468 | 3300035119 | Bacteria | 1743 |
| 816 | Ga0373956_0134111 | 3300035119 | Bacteria | 1161 |
| 817 | Ga0373957_0001296 | 3300035120 | Bacteria | 6707 |
| 818 | Ga0373957_0024719 | 3300035120 | Bacteria | 2159 |
| 819 | Ga0373957_0169052 | 3300035120 | Bacteria | 903 |
| 820 | Ga0373960_0001375 | 3300035121 | Bacteria | 5368 |
| 821 | Ga0373960_0010662 | 3300035121 | Bacteria | 2249 |
| 822 | Ga0373943_0000604 | 3300035170 | Bacteria | 15625 |
| 823 | Ga0373943_0039468 | 3300035170 | Bacteria | 2274 |
| 824 | Ga0373943_0047410 | 3300035170 | Bacteria | 2100 |
| 825 | Ga0373943_0057544 | 3300035170 | Bacteria | 1932 |
| 826 | Ga0373943_0062098 | 3300035170 | Bacteria | 1869 |
| 827 | Ga0373943_0080638 | 3300035170 | Bacteria | 1668 |
| 828 | Ga0373946_0003645 | 3300035171 | Bacteria | 5455 |
| 829 | Ga0373946_0026555 | 3300035171 | Bacteria | 2285 |
| 830 | Ga0373946_0029375 | 3300035171 | Bacteria | 2188 |
| 831 | Ga0373946_0087903 | 3300035171 | Bacteria | 1372 |
| 832 | Ga0373946_0114705 | 3300035171 | Bacteria | 1223 |
| 833 | Ga0373955_0001931 | 3300035172 | Bacteria | 8945 |
| 834 | Ga0373955_0069643 | 3300035172 | Bacteria | 1963 |
| 835 | Ga0373955_0233880 | 3300035172 | Bacteria | 1100 |
| 836 | Ga0373955_0277221 | 3300035172 | Bacteria | 1008 |
| 837 | Ga0373942_0001024 | 3300035207 | Bacteria | 7615 |
| 838 | Ga0373942_0002937 | 3300035207 | Bacteria | 4040 |
| 839 | Ga0373942_0086196 | 3300035207 | Bacteria | 940 |
| 840 | Ga0373961_0000356 | 3300035241 | Bacteria | 19781 |
| 841 | Ga0373961_0014739 | 3300035241 | Bacteria | 1989 |
| 842 | Ga0373962_0016277 | 3300035242 | Bacteria | 1916 |
| 843 | Ga0373962_0017415 | 3300035242 | Bacteria | 1862 |
| 844 | Ga0373924_0005132 | 3300035410 | Bacteria | 4621 |
| 845 | Ga0373931_0000593 | 3300035691 | Bacteria | 14946 |
| 846 | Ga0373931_0007758 | 3300035691 | Bacteria | 5068 |
| 847 | Ga0373931_0022947 | 3300035691 | Bacteria | 3145 |
| 848 | Ga0373931_0030252 | 3300035691 | Bacteria | 2786 |
| 849 | Ga0373931_0145219 | 3300035691 | Bacteria | 1378 |
| 850 | Ga0373935_0001442 | 3300035692 | Bacteria | 13189 |
| 851 | Ga0373935_0012660 | 3300035692 | Bacteria | 5076 |
| 852 | Ga0373935_0097321 | 3300035692 | Bacteria | 1935 |
| 853 | Ga0373935_0114225 | 3300035692 | Bacteria | 1796 |
| 854 | Ga0373935_0143522 | 3300035692 | Bacteria | 1614 |
| 855 | Ga0373935_0375206 | 3300035692 | Bacteria | 1018 |
| 856 | Ga0373935_0508065 | 3300035692 | Bacteria | 875 |
| 857 | Ga0373927_0002603 | 3300035695 | Bacteria | 13149 |
| 858 | Ga0373927_0007920 | 3300035695 | Bacteria | 7176 |
| 859 | Ga0373927_0008533 | 3300035695 | Bacteria | 6893 |
| 860 | Ga0373927_0008946 | 3300035695 | Bacteria | 6725 |
| 861 | Ga0373927_0041540 | 3300035695 | Bacteria | 2982 |
| 862 | Ga0373927_0085335 | 3300035695 | Bacteria | 2049 |
| 863 | Ga0373927_0221080 | 3300035695 | Bacteria | 1244 |
| 864 | Ga0373927_0449996 | 3300035695 | Bacteria | 850 |
| 865 | Ga0373933_0001968 | 3300035724 | Bacteria | 11834 |
| 866 | Ga0373933_0064420 | 3300035724 | Bacteria | 2217 |
| 867 | Ga0373933_0085482 | 3300035724 | Bacteria | 1940 |
| 868 | Ga0373933_0108034 | 3300035724 | Bacteria | 1733 |
| 869 | Ga0373933_0254034 | 3300035724 | Bacteria | 1132 |
| 870 | Ga0373933_0439949 | 3300035724 | Bacteria | 852 |
| 871 | Ga0373947_0000168 | 3300035725 | Bacteria | 35315 |
| 872 | Ga0373947_0009446 | 3300035725 | Bacteria | 5600 |
| 873 | Ga0373947_0011068 | 3300035725 | Bacteria | 5178 |
| 874 | Ga0373947_0088433 | 3300035725 | Bacteria | 1928 |
| 875 | Ga0373947_0166258 | 3300035725 | Bacteria | 1429 |
| 876 | Ga0373947_0230637 | 3300035725 | Bacteria | 1219 |
| 877 | Ga0373947_0378566 | 3300035725 | Bacteria | 953 |
| 878 | Ga0373947_0469169 | 3300035725 | Bacteria | 853 |
| 879 | Ga0373937_0000814 | 3300036401 | Bacteria | 26684 |
| 880 | Ga0373937_0001859 | 3300036401 | Bacteria | 17748 |
| 881 | Ga0373937_0002452 | 3300036401 | Bacteria | 15416 |
| 882 | Ga0373937_0033958 | 3300036401 | Bacteria | 4637 |
| 883 | Ga0373937_0117315 | 3300036401 | Bacteria | 2479 |
| 884 | Ga0373937_0120795 | 3300036401 | Bacteria | 2441 |
| 885 | Ga0373937_0148066 | 3300036401 | Bacteria | 2198 |
| 886 | Ga0373937_0289058 | 3300036401 | Bacteria | 1549 |
| 887 | Ga0316584_0005534 | 3300036712 | Bacteria | 8489 |
| 888 | Ga0316584_0120026 | 3300036712 | Bacteria | 1965 |
| 889 | Ga0373925_0013667 | 3300037068 | Bacteria | 5879 |
| 890 | Ga0373925_0017035 | 3300037068 | Bacteria | 5260 |
| 891 | Ga0373925_0044216 | 3300037068 | Bacteria | 3307 |
| 892 | Ga0373925_0075111 | 3300037068 | Bacteria | 2560 |
| 893 | Ga0373925_0251594 | 3300037068 | Bacteria | 1417 |
| 894 | Ga0373925_0486544 | 3300037068 | Bacteria | 1012 |
| 895 | Ga0395899_0008835 | 3300037312 | Bacteria | 7756 |
| 896 | Ga0395899_0204640 | 3300037312 | Bacteria | 1374 |
| 897 | Ga0395899_0249719 | 3300037312 | Bacteria | 1218 |
| 898 | Ga0395899_0538303 | 3300037312 | Bacteria | 752 |
| 899 | Ga0395900_0000709 | 3300037418 | Bacteria | 44342 |
| 900 | Ga0395900_0103524 | 3300037418 | Bacteria | 2924 |
| 901 | Ga0395900_0164184 | 3300037418 | Bacteria | 2264 |
| 902 | Ga0395900_1010770 | 3300037418 | Bacteria | 751 |
| 903 | Ga0395898_0023683 | 3300037466 | Bacteria | 6198 |
| 904 | Ga0395898_0072915 | 3300037466 | Bacteria | 3316 |
| 905 | Ga0395898_0083680 | 3300037466 | Bacteria | 3075 |
| 906 | Ga0395898_0508850 | 3300037466 | Bacteria | 1145 |
| 907 | Ga0395905_0120346 | 3300037471 | Bacteria | 2468 |
| 908 | Ga0436364_0671098 | 3300037853 | Bacteria | 1085 |
| 909 | Ga0436364_1035362 | 3300037853 | Bacteria | 2326 |
| 910 | Ga0395901_0011960 | 3300038443 | Bacteria | 8800 |
| 911 | Ga0395901_0207765 | 3300038443 | Bacteria | 2050 |
| 912 | Ga0395901_0635086 | 3300038443 | Bacteria | 1073 |
| 913 | Ga0395901_1117792 | 3300038443 | Bacteria | 758 |
| 914 | Ga0436365_0909129 | 3300039437 | Bacteria | 1965 |
| 915 | Ga0436360_0063464 | 3300039438 | Bacteria | 1240 |
| 916 | Ga0436360_0067730 | 3300039438 | Bacteria | 940 |
| 917 | Ga0436361_0174670 | 3300039447 | Bacteria | 866 |
| 918 | Ga0436361_0329200 | 3300039447 | Bacteria | 2074 |
| 919 | Ga0436361_0825759 | 3300039447 | Bacteria | 3160 |
| 920 | Ga0436363_0431026 | 3300039450 | Bacteria | 1086 |
| 921 | Ga0436363_0450495 | 3300039450 | Bacteria | 3991 |
| 922 | Ga0436363_0738257 | 3300039450 | Bacteria | 1823 |
| 923 | Ga0451793_1911136 | 3300041452 | Bacteria | 1506 |
| 924 | Ga0439445_0129412 | 3300042004 | Bacteria | 728 |
| 925 | Ga0439450_006590 | 3300042008 | Bacteria | 2096 |
| 926 | Ga0439455_0004874 | 3300042012 | Bacteria | 2690 |
| 927 | Ga0439464_0038648 | 3300042439 | Bacteria | 1355 |
| 928 | Ga0439460_0008770 | 3300042461 | Bacteria | 2557 |
| 929 | Ga0451577_0026107 | 3300042876 | Bacteria | 5292 |
| 930 | Ga0439440_0007658 | 3300042993 | Bacteria | 2200 |
| 931 | Ga0466963_0033242 | 3300044694 | Bacteria | 3346 |
| 932 | Ga0453684_0049507 | 3300044712 | Bacteria | 5541 |
| 933 | Ga0466957_0061173 | 3300044842 | Bacteria | 2310 |
| 934 | Ga0451576_0225795 | 3300045051 | Bacteria | 1955 |
| 935 | Ga0466958_0085752 | 3300045836 | Bacteria | 1943 |
| 936 | Ga0466967_0001077 | 3300045976 | Bacteria | 15096 |
| 937 | Ga0495592_0011257 | 3300046454 | Bacteria | 6764 |
| 938 | Ga0495592_0016998 | 3300046454 | Bacteria | 5523 |
| 939 | Ga0495592_0060432 | 3300046454 | Bacteria | 2787 |
| 940 | Ga0495592_0095181 | 3300046454 | Bacteria | 2130 |
| 941 | Ga0495592_0118079 | 3300046454 | Bacteria | 1869 |
| 942 | Ga0495592_0134747 | 3300046454 | Bacteria | 1724 |
| 943 | Ga0495592_0202512 | 3300046454 | Bacteria | 1338 |
| 944 | Ga0495591_020020 | 3300046458 | Bacteria | 2223 |
| 945 | Ga0495629_0000230 | 3300046459 | Bacteria | 49922 |
| 946 | Ga0495629_0001246 | 3300046459 | Bacteria | 19991 |
| 947 | Ga0495629_0062243 | 3300046459 | Bacteria | 2607 |
| 948 | Ga0495629_0086466 | 3300046459 | Bacteria | 2187 |
| 949 | Ga0495629_0113085 | 3300046459 | Bacteria | 1892 |
| 950 | Ga0495629_0206469 | 3300046459 | Bacteria | 1357 |
| 951 | Ga0495629_0249472 | 3300046459 | Bacteria | 1221 |
| 952 | Ga0495641_0021558 | 3300046461 | Bacteria | 3240 |
| 953 | Ga0495641_0027803 | 3300046461 | Bacteria | 2744 |
| 954 | Ga0495641_0124457 | 3300046461 | Bacteria | 1150 |
| 955 | Ga0495641_0217734 | 3300046461 | Bacteria | 856 |
| 956 | Ga0495651_0000514 | 3300046462 | Bacteria | 30081 |
| 957 | Ga0495651_0015536 | 3300046462 | Bacteria | 5890 |
| 958 | Ga0495651_0038788 | 3300046462 | Bacteria | 3709 |
| 959 | Ga0495651_0163357 | 3300046462 | Bacteria | 1593 |
| 960 | Ga0495653_0000928 | 3300046463 | Bacteria | 22666 |
| 961 | Ga0495653_0017250 | 3300046463 | Bacteria | 5872 |
| 962 | Ga0495653_0019183 | 3300046463 | Bacteria | 5548 |
| 963 | Ga0495650_0024137 | 3300046471 | Bacteria | 2877 |
| 964 | Ga0495580_0021820 | 3300046472 | Bacteria | 4722 |
| 965 | Ga0495580_0022796 | 3300046472 | Bacteria | 4603 |
| 966 | Ga0495580_0107751 | 3300046472 | Bacteria | 1935 |
| 967 | Ga0495580_0113425 | 3300046472 | Bacteria | 1883 |
| 968 | Ga0495580_0182045 | 3300046472 | Bacteria | 1451 |
| 969 | Ga0495582_0013255 | 3300046473 | Bacteria | 4537 |
| 970 | Ga0495582_0028396 | 3300046473 | Bacteria | 3070 |
| 971 | Ga0495582_0241590 | 3300046473 | Bacteria | 1035 |
| 972 | Ga0495582_0284537 | 3300046473 | Bacteria | 950 |
| 973 | Ga0495605_0034824 | 3300046474 | Bacteria | 2548 |
| 974 | Ga0495639_0237218 | 3300046475 | Bacteria | 899 |
| 975 | Ga0495662_0008984 | 3300046476 | Bacteria | 4907 |
| 976 | Ga0495662_0122940 | 3300046476 | Bacteria | 1274 |
| 977 | Ga0495662_0131930 | 3300046476 | Bacteria | 1228 |
| 978 | Ga0495662_0231796 | 3300046476 | Bacteria | 910 |
| 979 | Ga0495664_0012425 | 3300046477 | Bacteria | 4823 |
| 980 | Ga0495664_0021800 | 3300046477 | Bacteria | 3702 |
| 981 | Ga0495664_0025369 | 3300046477 | Bacteria | 3450 |
| 982 | Ga0495664_0037733 | 3300046477 | Bacteria | 2852 |
| 983 | Ga0495664_0085136 | 3300046477 | Bacteria | 1898 |
| 984 | Ga0495664_0089763 | 3300046477 | Bacteria | 1847 |
| 985 | Ga0495664_0143878 | 3300046477 | Bacteria | 1446 |
| 986 | Ga0495584_0038768 | 3300046491 | Bacteria | 2408 |
| 987 | Ga0495584_0087774 | 3300046491 | Bacteria | 1568 |
| 988 | Ga0495585_0012824 | 3300046492 | Bacteria | 4929 |
| 989 | Ga0495585_0171157 | 3300046492 | Bacteria | 1122 |
| 990 | Ga0495594_0080692 | 3300046499 | Bacteria | 1816 |
| 991 | Ga0495607_0028730 | 3300046501 | Bacteria | 3427 |
| 992 | Ga0495608_0000211 | 3300046511 | Bacteria | 41989 |
| 993 | Ga0495608_0013911 | 3300046511 | Bacteria | 5584 |
| 994 | Ga0495608_0017291 | 3300046511 | Bacteria | 4989 |
| 995 | Ga0495608_0028242 | 3300046511 | Bacteria | 3813 |
| 996 | Ga0495616_0116940 | 3300046513 | Bacteria | 1234 |
| 997 | Ga0495618_0004258 | 3300046514 | Bacteria | 8827 |
| 998 | Ga0495618_0007886 | 3300046514 | Bacteria | 6444 |
| 999 | Ga0495618_0061862 | 3300046514 | Bacteria | 2375 |
| 1000 | Ga0495618_0087832 | 3300046514 | Bacteria | 1988 |
| 1001 | Ga0495628_0001017 | 3300046516 | Bacteria | 25597 |
| 1002 | Ga0495628_0058738 | 3300046516 | Bacteria | 3021 |
| 1003 | Ga0495628_0060309 | 3300046516 | Bacteria | 2976 |
| 1004 | Ga0495628_0242728 | 3300046516 | Bacteria | 1347 |
| 1005 | Ga0495628_0581616 | 3300046516 | Bacteria | 801 |
| 1006 | Ga0495630_0030857 | 3300046517 | Bacteria | 3989 |
| 1007 | Ga0495630_0033639 | 3300046517 | Bacteria | 3823 |
| 1008 | Ga0495630_0047187 | 3300046517 | Bacteria | 3221 |
| 1009 | Ga0495630_0310397 | 3300046517 | Bacteria | 1205 |
| 1010 | Ga0495630_0429917 | 3300046517 | Bacteria | 1012 |
| 1011 | Ga0495637_0017568 | 3300046520 | Bacteria | 3331 |
| 1012 | Ga0495643_0152182 | 3300046522 | Bacteria | 1145 |
| 1013 | Ga0495644_0000207 | 3300046523 | Bacteria | 27708 |
| 1014 | Ga0495663_0108428 | 3300046525 | Bacteria | 921 |
| 1015 | Ga0495666_0008778 | 3300046526 | Bacteria | 5064 |
| 1016 | Ga0495666_0057605 | 3300046526 | Bacteria | 1860 |
| 1017 | Ga0495652_0009353 | 3300046529 | Bacteria | 8906 |
| 1018 | Ga0495652_0010381 | 3300046529 | Bacteria | 8440 |
| 1019 | Ga0495652_0049242 | 3300046529 | Bacteria | 3608 |
| 1020 | Ga0495652_0053555 | 3300046529 | Bacteria | 3438 |
| 1021 | Ga0495652_0181217 | 3300046529 | Bacteria | 1616 |
| 1022 | Ga0495652_0399323 | 3300046529 | Bacteria | 974 |
| 1023 | Ga0495665_0005144 | 3300046531 | Bacteria | 7053 |
| 1024 | Ga0495665_0029177 | 3300046531 | Bacteria | 2956 |
| 1025 | Ga0495640_0002965 | 3300046533 | Bacteria | 13663 |
| 1026 | Ga0495640_0025900 | 3300046533 | Bacteria | 4247 |
| 1027 | Ga0495640_0058225 | 3300046533 | Bacteria | 2635 |
| 1028 | Ga0495640_0088902 | 3300046533 | Bacteria | 2041 |
| 1029 | Ga0495640_0153154 | 3300046533 | Bacteria | 1480 |
| 1030 | Ga0495587_0003782 | 3300046536 | Bacteria | 10043 |
| 1031 | Ga0495587_0012005 | 3300046536 | Bacteria | 5471 |
| 1032 | Ga0495587_0012054 | 3300046536 | Bacteria | 5460 |
| 1033 | Ga0495587_0038988 | 3300046536 | Bacteria | 2846 |
| 1034 | Ga0495598_0102915 | 3300046537 | Bacteria | 947 |
| 1035 | Ga0495609_0024001 | 3300046538 | Bacteria | 2799 |
| 1036 | Ga0495609_0025772 | 3300046538 | Bacteria | 2694 |
| 1037 | Ga0495621_0053497 | 3300046539 | Bacteria | 1449 |
| 1038 | Ga0495645_0005364 | 3300046543 | Bacteria | 8790 |
| 1039 | Ga0495645_0025415 | 3300046543 | Bacteria | 4297 |
| 1040 | Ga0495645_0035601 | 3300046543 | Bacteria | 3628 |
| 1041 | Ga0495645_0061742 | 3300046543 | Bacteria | 2715 |
| 1042 | Ga0495645_0526320 | 3300046543 | Bacteria | 736 |
| 1043 | Ga0495622_0032721 | 3300046557 | Bacteria | 2427 |
| 1044 | Ga0495633_0007791 | 3300046558 | Bacteria | 6120 |
| 1045 | Ga0495633_0320059 | 3300046558 | Bacteria | 704 |
| 1046 | Ga0495667_0004263 | 3300046559 | Bacteria | 9640 |
| 1047 | Ga0495667_0019341 | 3300046559 | Bacteria | 4595 |
| 1048 | Ga0495667_0030062 | 3300046559 | Bacteria | 3653 |
| 1049 | Ga0495667_0039123 | 3300046559 | Bacteria | 3155 |
| 1050 | Ga0495667_0068781 | 3300046559 | Bacteria | 2312 |
| 1051 | Ga0495667_0113311 | 3300046559 | Bacteria | 1752 |
| 1052 | Ga0495667_0453675 | 3300046559 | Bacteria | 805 |
| 1053 | Ga0495656_0000115 | 3300046615 | Bacteria | 31179 |
| 1054 | Ga0495656_0168039 | 3300046615 | Bacteria | 1070 |
| 1055 | Ga0495668_0192854 | 3300046616 | Bacteria | 1116 |
| 1056 | Ga0495634_0016926 | 3300046642 | Bacteria | 5207 |
| 1057 | Ga0495634_0030683 | 3300046642 | Bacteria | 3709 |
| 1058 | Ga0495634_0043090 | 3300046642 | Bacteria | 3059 |
| 1059 | Ga0495634_0098548 | 3300046642 | Bacteria | 1891 |
| 1060 | Ga0495634_0136460 | 3300046642 | Bacteria | 1560 |
| 1061 | Ga0495634_0218727 | 3300046642 | Bacteria | 1177 |
| 1062 | Ga0495611_0000905 | 3300046648 | Bacteria | 16099 |
| 1063 | Ga0495611_0141749 | 3300046648 | Bacteria | 1122 |
| 1064 | Ga0495635_0011378 | 3300046663 | Bacteria | 6240 |
| 1065 | Ga0495635_0023649 | 3300046663 | Bacteria | 4280 |
| 1066 | Ga0495635_0024578 | 3300046663 | Bacteria | 4199 |
| 1067 | Ga0495635_0026118 | 3300046663 | Bacteria | 4066 |
| 1068 | Ga0495635_0118612 | 3300046663 | Bacteria | 1805 |
| 1069 | Ga0495635_0361528 | 3300046663 | Bacteria | 967 |
| 1070 | Ga0495635_0470423 | 3300046663 | Bacteria | 829 |
| 1071 | Ga0495659_0000545 | 3300046664 | Bacteria | 13925 |
| 1072 | Ga0495659_0012800 | 3300046664 | Bacteria | 2724 |
| 1073 | Ga0495659_0214901 | 3300046664 | Bacteria | 792 |
| 1074 | Ga0495588_0030812 | 3300046674 | Bacteria | 2697 |
| 1075 | Ga0495657_0008566 | 3300046675 | Bacteria | 7812 |
| 1076 | Ga0495657_0017487 | 3300046675 | Bacteria | 5203 |
| 1077 | Ga0495657_0075843 | 3300046675 | Bacteria | 2185 |
| 1078 | Ga0495599_0029916 | 3300046678 | Bacteria | 3416 |
| 1079 | Ga0495599_0036753 | 3300046678 | Bacteria | 3076 |
| 1080 | Ga0495599_0095308 | 3300046678 | Bacteria | 1856 |
| 1081 | Ga0495623_0002503 | 3300046679 | Bacteria | 12172 |
| 1082 | Ga0495623_0002644 | 3300046679 | Bacteria | 11821 |
| 1083 | Ga0495623_0034441 | 3300046679 | Bacteria | 3247 |
| 1084 | Ga0495646_0011541 | 3300046680 | Bacteria | 5609 |
| 1085 | Ga0495646_0037089 | 3300046680 | Bacteria | 3017 |
| 1086 | Ga0495646_0039108 | 3300046680 | Bacteria | 2926 |
| 1087 | Ga0495646_0069665 | 3300046680 | Bacteria | 2074 |
| 1088 | Ga0495647_0002731 | 3300046681 | Bacteria | 5599 |
| 1089 | Ga0495647_0005717 | 3300046681 | Bacteria | 4089 |
| 1090 | Ga0495647_0020426 | 3300046681 | Bacteria | 2377 |
| 1091 | Ga0495658_0006761 | 3300046683 | Bacteria | 5643 |
| 1092 | Ga0495658_0019872 | 3300046683 | Bacteria | 3513 |
| 1093 | Ga0495658_0038304 | 3300046683 | Bacteria | 2654 |
| 1094 | Ga0495658_0131430 | 3300046683 | Bacteria | 1524 |
| 1095 | Ga0495669_0035049 | 3300046684 | Bacteria | 2215 |
| 1096 | Ga0495613_0045913 | 3300046689 | Bacteria | 3230 |
| 1097 | Ga0495613_0047306 | 3300046689 | Bacteria | 3178 |
| 1098 | Ga0495613_0101469 | 3300046689 | Bacteria | 2078 |
| 1099 | Ga0495613_0222408 | 3300046689 | Bacteria | 1325 |
| 1100 | Ga0495613_0264799 | 3300046689 | Bacteria | 1196 |
| 1101 | Ga0495624_0004214 | 3300046690 | Bacteria | 10559 |
| 1102 | Ga0495624_0067263 | 3300046690 | Bacteria | 2235 |
| 1103 | Ga0495670_0000652 | 3300046691 | Bacteria | 16575 |
| 1104 | Ga0495671_0155040 | 3300046692 | Bacteria | 1115 |
| 1105 | Ga0495671_0314924 | 3300046692 | Bacteria | 752 |
| 1106 | Ga0495649_0030157 | 3300046694 | Bacteria | 2996 |
| 1107 | Ga0495600_0000802 | 3300046809 | Bacteria | 16650 |
| 1108 | Ga0495600_0004409 | 3300046809 | Bacteria | 8417 |
| 1109 | Ga0495600_0057523 | 3300046809 | Bacteria | 2539 |
| 1110 | Ga0495600_0112870 | 3300046809 | Bacteria | 1769 |
| 1111 | Ga0495600_0170895 | 3300046809 | Bacteria | 1403 |
| 1112 | Ga0495581_0123148 | 3300047315 | Bacteria | 1509 |
| 1113 | Ga0495604_0000360 | 3300047317 | Bacteria | 40805 |
| 1114 | Ga0495604_0013734 | 3300047317 | Bacteria | 6457 |
| 1115 | Ga0495604_0021779 | 3300047317 | Bacteria | 5116 |
| 1116 | Ga0495604_0029690 | 3300047317 | Bacteria | 4349 |
| 1117 | Ga0495604_0044072 | 3300047317 | Bacteria | 3489 |
| 1118 | Ga0495604_0098888 | 3300047317 | Bacteria | 2148 |
| 1119 | Ga0495604_0288534 | 3300047317 | Bacteria | 1106 |
| 1120 | Ga0495674_0008238 | 3300047319 | Bacteria | 9945 |
| 1121 | Ga0495674_0020349 | 3300047319 | Bacteria | 6144 |
| 1122 | Ga0495674_0027922 | 3300047319 | Bacteria | 5153 |
| 1123 | Ga0495674_0119139 | 3300047319 | Bacteria | 2231 |
| 1124 | Ga0495674_0302464 | 3300047319 | Bacteria | 1306 |
| 1125 | Ga0495674_0387673 | 3300047319 | Bacteria | 1129 |
| 1126 | Ga0495676_0029954 | 3300047321 | Bacteria | 4626 |
| 1127 | Ga0495676_0088439 | 3300047321 | Bacteria | 2323 |
| 1128 | Ga0495676_0145853 | 3300047321 | Bacteria | 1691 |
| 1129 | Ga0495676_0257412 | 3300047321 | Bacteria | 1188 |
| 1130 | Ga0495680_0000313 | 3300047322 | Bacteria | 54486 |
| 1131 | Ga0495680_0008135 | 3300047322 | Bacteria | 9559 |
| 1132 | Ga0495680_0009019 | 3300047322 | Bacteria | 9012 |
| 1133 | Ga0495680_0009794 | 3300047322 | Bacteria | 8594 |
| 1134 | Ga0495680_0012298 | 3300047322 | Bacteria | 7542 |
| 1135 | Ga0495680_0021698 | 3300047322 | Bacteria | 5371 |
| 1136 | Ga0495683_0097902 | 3300047323 | Bacteria | 1414 |
| 1137 | Ga0495675_0002612 | 3300047444 | Bacteria | 10794 |
| 1138 | Ga0495675_0005504 | 3300047444 | Bacteria | 7726 |
| 1139 | Ga0495675_0023436 | 3300047444 | Bacteria | 3933 |
| 1140 | Ga0495675_0090715 | 3300047444 | Bacteria | 1918 |
| 1141 | Ga0495679_045429 | 3300047446 | Bacteria | 1342 |
| 1142 | Ga0495684_0006921 | 3300047471 | Bacteria | 8805 |
| 1143 | Ga0495684_0012904 | 3300047471 | Bacteria | 6449 |
| 1144 | Ga0495684_0028950 | 3300047471 | Bacteria | 4250 |
| 1145 | Ga0495684_0037199 | 3300047471 | Bacteria | 3733 |
| 1146 | Ga0495684_0154521 | 3300047471 | Bacteria | 1714 |
| 1147 | Ga0495684_0218035 | 3300047471 | Bacteria | 1400 |
| 1148 | Ga0495684_0404979 | 3300047471 | Bacteria | 957 |
| 1149 | Ga0495684_0595589 | 3300047471 | Bacteria | 746 |
| 1150 | Ga0495593_0009519 | 3300047673 | Bacteria | 5637 |
| 1151 | Ga0495593_0010594 | 3300047673 | Bacteria | 5318 |
| 1152 | Ga0495593_0013212 | 3300047673 | Bacteria | 4714 |
| 1153 | Ga0495593_0023469 | 3300047673 | Bacteria | 3429 |
| 1154 | Ga0495593_0043909 | 3300047673 | Bacteria | 2393 |
| 1155 | Ga0495602_0005154 | 3300048088 | Bacteria | 13692 |
| 1156 | Ga0495602_0010330 | 3300048088 | Bacteria | 9691 |
| 1157 | Ga0495602_0033303 | 3300048088 | Bacteria | 4836 |
| 1158 | Ga0495614_0008099 | 3300048089 | Bacteria | 4674 |
| 1159 | Ga0495614_0170827 | 3300048089 | Bacteria | 975 |
| 1160 | Ga0495614_0220273 | 3300048089 | Bacteria | 862 |
| 1161 | Ga0496100_0000330 | 3300048903 | Bacteria | 23211 |
| 1162 | Ga0496100_0009383 | 3300048903 | Bacteria | 5499 |
| 1163 | Ga0496100_0023823 | 3300048903 | Bacteria | 3725 |
| 1164 | Ga0496100_0029006 | 3300048903 | Bacteria | 3418 |
| 1165 | Ga0496100_0077564 | 3300048903 | Bacteria | 2234 |
| 1166 | Ga0496100_0145774 | 3300048903 | Bacteria | 1683 |
| 1167 | Ga0496100_0308741 | 3300048903 | Bacteria | 1185 |
| 1168 | Ga0496101_0000079 | 3300048904 | Bacteria | 107673 |
| 1169 | Ga0496101_0023269 | 3300048904 | Bacteria | 4278 |
| 1170 | Ga0496101_0118402 | 3300048904 | Bacteria | 2000 |
| 1171 | Ga0496101_0122285 | 3300048904 | Bacteria | 1969 |
| 1172 | Ga0496101_0207779 | 3300048904 | Bacteria | 1516 |
| 1173 | Ga0496102_0011543 | 3300048905 | Bacteria | 7621 |
| 1174 | Ga0496102_0016791 | 3300048905 | Bacteria | 6401 |
| 1175 | Ga0496102_0150356 | 3300048905 | Bacteria | 2188 |
| 1176 | Ga0496102_0330576 | 3300048905 | Bacteria | 1435 |
| 1177 | Ga0496103_0033302 | 3300048906 | Bacteria | 3147 |
| 1178 | Ga0496103_0053360 | 3300048906 | Bacteria | 2505 |
| 1179 | Ga0496103_0082012 | 3300048906 | Bacteria | 2029 |
| 1180 | Ga0496103_0143933 | 3300048906 | Bacteria | 1525 |
| 1181 | Ga0496103_0533931 | 3300048906 | Bacteria | 749 |
| 1182 | Ga0496104_0002973 | 3300048907 | Bacteria | 14606 |
| 1183 | Ga0496104_0004496 | 3300048907 | Bacteria | 12147 |
| 1184 | Ga0496104_0006726 | 3300048907 | Bacteria | 10123 |
| 1185 | Ga0496104_0032893 | 3300048907 | Bacteria | 4827 |
| 1186 | Ga0496104_0055353 | 3300048907 | Bacteria | 3751 |
| 1187 | Ga0496104_0237208 | 3300048907 | Bacteria | 1735 |
| 1188 | Ga0496104_0264241 | 3300048907 | Bacteria | 1633 |
| 1189 | Ga0496104_0458661 | 3300048907 | Bacteria | 1186 |
| 1190 | Ga0496105_0000168 | 3300048908 | Bacteria | 43805 |
| 1191 | Ga0496105_0006753 | 3300048908 | Bacteria | 8823 |
| 1192 | Ga0496105_0013976 | 3300048908 | Bacteria | 6384 |
| 1193 | Ga0496105_0074656 | 3300048908 | Bacteria | 2801 |
| 1194 | Ga0496105_0083503 | 3300048908 | Bacteria | 2638 |
| 1195 | Ga0496105_0096415 | 3300048908 | Bacteria | 2442 |
| 1196 | Ga0496105_0108576 | 3300048908 | Bacteria | 2291 |
| 1197 | Ga0496105_0254264 | 3300048908 | Bacteria | 1423 |
| 1198 | Ga0496106_0006208 | 3300048909 | Bacteria | 8839 |
| 1199 | Ga0496106_0029911 | 3300048909 | Bacteria | 4060 |
| 1200 | Ga0496106_0038114 | 3300048909 | Bacteria | 3596 |
| 1201 | Ga0496106_0040359 | 3300048909 | Bacteria | 3495 |
| 1202 | Ga0496106_0054441 | 3300048909 | Bacteria | 3023 |
| 1203 | Ga0496106_0092676 | 3300048909 | Bacteria | 2334 |
| 1204 | Ga0496106_0112137 | 3300048909 | Bacteria | 2124 |
| 1205 | Ga0496106_0155878 | 3300048909 | Bacteria | 1803 |
| 1206 | Ga0496106_0439510 | 3300048909 | Bacteria | 1048 |
| 1207 | Ga0496106_0461549 | 3300048909 | Bacteria | 1020 |
| 1208 | Ga0496106_0844964 | 3300048909 | Bacteria | 725 |
| 1209 | Ga0496107_0000143 | 3300048910 | Bacteria | 35680 |
| 1210 | Ga0496107_0018391 | 3300048910 | Bacteria | 4920 |
| 1211 | Ga0496107_0031013 | 3300048910 | Bacteria | 3811 |
| 1212 | Ga0496107_0066654 | 3300048910 | Bacteria | 2610 |
| 1213 | Ga0496107_0144818 | 3300048910 | Bacteria | 1756 |
| 1214 | Ga0496107_0189071 | 3300048910 | Bacteria | 1530 |
| 1215 | Ga0496107_0489529 | 3300048910 | Bacteria | 912 |
| 1216 | Ga0496108_0000698 | 3300048911 | Bacteria | 26059 |
| 1217 | Ga0496108_0002282 | 3300048911 | Bacteria | 15367 |
| 1218 | Ga0496108_0079539 | 3300048911 | Bacteria | 2776 |
| 1219 | Ga0496108_0105543 | 3300048911 | Bacteria | 2405 |
| 1220 | Ga0496108_0127622 | 3300048911 | Bacteria | 2185 |
| 1221 | Ga0496108_0168884 | 3300048911 | Bacteria | 1892 |
| 1222 | Ga0496109_0000372 | 3300048912 | Bacteria | 40804 |
| 1223 | Ga0496109_0001273 | 3300048912 | Bacteria | 20907 |
| 1224 | Ga0496109_0060513 | 3300048912 | Bacteria | 3460 |
| 1225 | Ga0496109_0067473 | 3300048912 | Bacteria | 3277 |
| 1226 | Ga0496109_0087794 | 3300048912 | Bacteria | 2873 |
| 1227 | Ga0496109_0098090 | 3300048912 | Bacteria | 2717 |
| 1228 | Ga0496109_0192314 | 3300048912 | Bacteria | 1917 |
| 1229 | Ga0496109_0234404 | 3300048912 | Bacteria | 1727 |
| 1230 | Ga0496110_0026148 | 3300048913 | Bacteria | 4991 |
| 1231 | Ga0496110_0046987 | 3300048913 | Bacteria | 3778 |
| 1232 | Ga0496110_0060214 | 3300048913 | Bacteria | 3347 |
| 1233 | Ga0496110_0183648 | 3300048913 | Bacteria | 1899 |
| 1234 | Ga0496110_0188174 | 3300048913 | Bacteria | 1875 |
| 1235 | Ga0496110_0355062 | 3300048913 | Bacteria | 1335 |
| 1236 | Ga0496111_0005807 | 3300048914 | Bacteria | 7958 |
| 1237 | Ga0496111_0062687 | 3300048914 | Bacteria | 2696 |
| 1238 | Ga0496111_0067957 | 3300048914 | Bacteria | 2589 |
| 1239 | Ga0496111_0242382 | 3300048914 | Bacteria | 1338 |
| 1240 | Ga0496112_0010618 | 3300048915 | Bacteria | 8364 |
| 1241 | Ga0496112_0025350 | 3300048915 | Bacteria | 5694 |
| 1242 | Ga0496112_0072202 | 3300048915 | Bacteria | 3411 |
| 1243 | Ga0496112_0183205 | 3300048915 | Bacteria | 2058 |
| 1244 | Ga0496112_0190144 | 3300048915 | Bacteria | 2015 |
| 1245 | Ga0496112_0507152 | 3300048915 | Bacteria | 1141 |
| 1246 | Ga0496112_0869176 | 3300048915 | Bacteria | 825 |
| 1247 | Ga0496113_0000303 | 3300048916 | Bacteria | 23409 |
| 1248 | Ga0496113_0018311 | 3300048916 | Bacteria | 4876 |
| 1249 | Ga0496113_0169256 | 3300048916 | Bacteria | 1730 |
| 1250 | Ga0496113_0190964 | 3300048916 | Bacteria | 1626 |
| 1251 | Ga0496114_0006447 | 3300048917 | Bacteria | 9242 |
| 1252 | Ga0496114_0006628 | 3300048917 | Bacteria | 9124 |
| 1253 | Ga0496114_0035294 | 3300048917 | Bacteria | 4128 |
| 1254 | Ga0496114_0072783 | 3300048917 | Bacteria | 2891 |
| 1255 | Ga0496114_0092133 | 3300048917 | Bacteria | 2574 |
| 1256 | Ga0496114_0156176 | 3300048917 | Bacteria | 1981 |
| 1257 | Ga0496114_0549100 | 3300048917 | Bacteria | 1021 |
| 1258 | Ga0496114_0640165 | 3300048917 | Bacteria | 936 |
| 1259 | Ga0496115_0000653 | 3300048918 | Bacteria | 25881 |
| 1260 | Ga0496115_0032306 | 3300048918 | Bacteria | 4129 |
| 1261 | Ga0496115_0057674 | 3300048918 | Bacteria | 3123 |
| 1262 | Ga0496115_0237146 | 3300048918 | Bacteria | 1503 |
| 1263 | Ga0496121_0315804 | 3300048924 | Bacteria | 1054 |
| 1264 | Ga0496125_0177061 | 3300048928 | Bacteria | 1426 |
| 1265 | Ga0501032_0428227 | 3300049569 | Bacteria | 849 |
| 1266 | Ga0501036_0286192 | 3300049572 | Bacteria | 1379 |
| 1267 | Ga0501038_0494806 | 3300049574 | Bacteria | 936 |
| 1268 | Ga0501040_0507677 | 3300049576 | Bacteria | 869 |
| 1269 | Ga0501041_0482298 | 3300049577 | Bacteria | 788 |
| 1270 | Ga0501042_0521071 | 3300049578 | Bacteria | 863 |
| 1271 | Ga0501043_0444979 | 3300049579 | Bacteria | 974 |
| 1272 | Ga0501046_0469607 | 3300049580 | Bacteria | 903 |
| 1273 | Ga0501047_0172166 | 3300049581 | Bacteria | 2034 |
| 1274 | Ga0501068_0227837 | 3300049584 | Bacteria | 1185 |
| 1275 | Ga0501073_0169869 | 3300049589 | Bacteria | 1510 |
| 1276 | Ga0501073_0467739 | 3300049589 | Bacteria | 872 |
| 1277 | Ga0501073_0555261 | 3300049589 | Bacteria | 793 |
| 1278 | Ga0501076_0246054 | 3300049592 | Bacteria | 1463 |
| 1279 | Ga0501077_0057332 | 3300049593 | Bacteria | 2473 |
| 1280 | Ga0501079_0066389 | 3300049741 | Bacteria | 2784 |
| 1281 | Ga0501079_0142917 | 3300049741 | Bacteria | 1864 |
| 1282 | Ga0501079_0238919 | 3300049741 | Bacteria | 1419 |
| 1283 | Ga0501080_0140727 | 3300049742 | Bacteria | 2231 |
| 1284 | Ga0501080_0886884 | 3300049742 | Bacteria | 778 |
| 1285 | Ga0501081_0218218 | 3300049743 | Bacteria | 1387 |
| 1286 | Ga0501035_0713528 | 3300049822 | Bacteria | 808 |
| 1287 | Ga0501044_0329102 | 3300049823 | Bacteria | 1451 |
| 1288 | Ga0501044_0546010 | 3300049823 | Bacteria | 1056 |
| 1289 | nmdc:mga03683_43877_c1 | 3300050489 | Bacteria | 1846 |
| 1290 | nmdc:mga03n38_24716_c1 | 3300050490 | Bacteria | 2459 |
| 1291 | nmdc:mga03n38_3107_c1 | 3300050490 | Bacteria | 5275 |
| 1292 | nmdc:mga00v17_4589_c1 | 3300050491 | Bacteria | 7203 |
| 1293 | nmdc:mga00v17_9497_c1 | 3300050491 | Bacteria | 5268 |
| 1294 | nmdc:mga0yw44_246680_c1 | 3300050492 | Bacteria | 1188 |
| 1295 | nmdc:mga0yw44_27074_c1 | 3300050492 | Bacteria | 3281 |
| 1296 | nmdc:mga0yw44_280357_c1 | 3300050492 | Bacteria | 1114 |
| 1297 | nmdc:mga0yw44_282133_c1 | 3300050492 | Bacteria | 1110 |
| 1298 | nmdc:mga0k408_6133_c1 | 3300050493 | Bacteria | 6409 |
| 1299 | nmdc:mga06z11_1635_c1 | 3300050494 | Bacteria | 8385 |
| 1300 | nmdc:mga06z11_213158_c1 | 3300050494 | Bacteria | 1126 |
| 1301 | nmdc:mga07m45_20193_c1 | 3300050496 | Bacteria | 1658 |
| 1302 | nmdc:mga07m45_284100_c1 | 3300050496 | Bacteria | 962 |
| 1303 | nmdc:mga07m45_35092_c2 | 3300050496 | Bacteria | 1775 |
| 1304 | nmdc:mga05p37_111_c2 | 3300050507 | Bacteria | 41438 |
| 1305 | nmdc:mga05p37_118283_c1 | 3300050507 | Bacteria | 3256 |
| 1306 | nmdc:mga05p37_126617_c1 | 3300050507 | Bacteria | 3137 |
| 1307 | nmdc:mga05p37_17687_c1 | 3300050507 | Bacteria | 8601 |
| 1308 | nmdc:mga05p37_181482_c1 | 3300050507 | Bacteria | 2560 |
| 1309 | nmdc:mga05p37_244589_c1 | 3300050507 | Bacteria | 2155 |
| 1310 | nmdc:mga05p37_359050_c1 | 3300050507 | Bacteria | 1713 |
| 1311 | nmdc:mga05p37_69071_c1 | 3300050507 | Bacteria | 4345 |
| 1312 | nmdc:mga09592_27955_c1 | 3300050508 | Bacteria | 4683 |
| 1313 | nmdc:mga0qj67_12821_c1 | 3300050509 | Bacteria | 6323 |
| 1314 | nmdc:mga0qj67_189_c1 | 3300050509 | Bacteria | 41860 |
| 1315 | nmdc:mga0qj67_455860_c1 | 3300050509 | Bacteria | 1030 |
| 1316 | nmdc:mga0qj67_529173_c1 | 3300050509 | Bacteria | 946 |
| 1317 | nmdc:mga0qj67_65800_c1 | 3300050509 | Bacteria | 2886 |
| 1318 | nmdc:mga06r32_10349_c1 | 3300050510 | Bacteria | 8414 |
| 1319 | nmdc:mga06r32_1248255_c1 | 3300050510 | Bacteria | 688 |
| 1320 | nmdc:mga06r32_496949_c1 | 3300050510 | Bacteria | 1197 |
| 1321 | nmdc:mga06r32_87163_c1 | 3300050510 | Bacteria | 3046 |
| 1322 | nmdc:mga08y16_1052_c1 | 3300050511 | Bacteria | 27127 |
| 1323 | nmdc:mga08y16_1139186_c1 | 3300050511 | Bacteria | 753 |
| 1324 | nmdc:mga08y16_24425_c1 | 3300050511 | Bacteria | 6379 |
| 1325 | nmdc:mga08y16_3254_c1 | 3300050511 | Bacteria | 16811 |
| 1326 | nmdc:mga08y16_338474_c1 | 3300050511 | Bacteria | 1547 |
| 1327 | nmdc:mga08y16_395135_c1 | 3300050511 | Bacteria | 1416 |
| 1328 | nmdc:mga08y16_4695_c1 | 3300050511 | Bacteria | 14238 |
| 1329 | nmdc:mga08y16_521552_c1 | 3300050511 | Bacteria | 1205 |
| 1330 | nmdc:mga0n895_193244_c1 | 3300050512 | Bacteria | 2066 |
| 1331 | nmdc:mga0n895_19600_c1 | 3300050512 | Bacteria | 6289 |
| 1332 | nmdc:mga0n895_28635_c1 | 3300050512 | Bacteria | 5301 |
| 1333 | nmdc:mga0n895_28850_c1 | 3300050512 | Bacteria | 5284 |
| 1334 | nmdc:mga0n895_424793_c1 | 3300050512 | Bacteria | 1343 |
| 1335 | nmdc:mga0n895_6052_c1 | 3300050512 | Bacteria | 10200 |
| 1336 | nmdc:mga0n895_61201_c1 | 3300050512 | Bacteria | 3716 |
| 1337 | nmdc:mga0rr50_23552_c1 | 3300050513 | Bacteria | 4248 |
| 1338 | nmdc:mga0rr50_276658_c1 | 3300050513 | Bacteria | 1400 |
| 1339 | nmdc:mga0rr50_316719_c1 | 3300050513 | Bacteria | 1307 |
| 1340 | nmdc:mga0rr50_45233_c1 | 3300050513 | Bacteria | 3234 |
| 1341 | nmdc:mga0rr50_565337_c1 | 3300050513 | Bacteria | 969 |
| 1342 | nmdc:mga08x19_119633_c1 | 3300050514 | Bacteria | 1764 |
| 1343 | nmdc:mga08x19_23491_c1 | 3300050514 | Bacteria | 3824 |
| 1344 | nmdc:mga08x19_99010_c1 | 3300050514 | Bacteria | 1932 |
| 1345 | nmdc:mga0a205_122710_c1 | 3300050515 | Bacteria | 2498 |
| 1346 | nmdc:mga0a205_2125_c1 | 3300050515 | Bacteria | 17392 |
| 1347 | nmdc:mga0a205_2281_c1 | 3300050515 | Bacteria | 16910 |
| 1348 | nmdc:mga0a205_238201_c1 | 3300050515 | Bacteria | 1701 |
| 1349 | nmdc:mga0a205_28775_c1 | 3300050515 | Bacteria | 5314 |
| 1350 | nmdc:mga0a205_553809_c1 | 3300050515 | Bacteria | 1005 |
| 1351 | nmdc:mga0sz30_4997_c1 | 3300050516 | Bacteria | 4840 |
| 1352 | Ga0495601_0000114 | 3300053077 | Bacteria | 44359 |
| 1353 | Ga0495601_0001485 | 3300053077 | Bacteria | 12934 |
| 1354 | Ga0495601_0013078 | 3300053077 | Bacteria | 4988 |
| 1355 | Ga0495601_0036766 | 3300053077 | Bacteria | 3059 |
| 1356 | Ga0495601_0054986 | 3300053077 | Bacteria | 2519 |
| 1357 | Ga0495601_0063087 | 3300053077 | Bacteria | 2354 |
| 1358 | Ga0495601_0088230 | 3300053077 | Bacteria | 1994 |
| 1359 | Ga0495612_0001226 | 3300053078 | Bacteria | 10568 |
| 1360 | Ga0495612_0005655 | 3300053078 | Bacteria | 5164 |
| 1361 | Ga0495612_0009022 | 3300053078 | Bacteria | 4044 |
| 1362 | Ga0495612_0025884 | 3300053078 | Bacteria | 2357 |
| 1363 | Ga0495612_0071136 | 3300053078 | Bacteria | 1450 |
| 1364 | Ga0495612_0104824 | 3300053078 | Bacteria | 1206 |
| 1365 | Ga0495595_0000718 | 3300053084 | Bacteria | 12615 |
| 1366 | Ga0495595_0001264 | 3300053084 | Bacteria | 9847 |
| 1367 | Ga0495595_0001866 | 3300053084 | Bacteria | 8183 |
| 1368 | Ga0495595_0004743 | 3300053084 | Bacteria | 5470 |
| 1369 | Ga0495595_0062728 | 3300053084 | Bacteria | 1743 |
| 1370 | Ga0495595_0133648 | 3300053084 | Bacteria | 1214 |
| 1371 | Ga0495595_0238950 | 3300053084 | Bacteria | 908 |
| 1372 | Ga0495619_0000201 | 3300053085 | Bacteria | 43295 |
| 1373 | Ga0495619_0000206 | 3300053085 | Bacteria | 42730 |
| 1374 | Ga0495619_0006226 | 3300053085 | Bacteria | 7566 |
| 1375 | Ga0495619_0009047 | 3300053085 | Bacteria | 6283 |
| 1376 | Ga0495619_0014776 | 3300053085 | Bacteria | 4932 |
| 1377 | Ga0495619_0025483 | 3300053085 | Bacteria | 3798 |
| 1378 | Ga0495619_0057902 | 3300053085 | Bacteria | 2571 |
| 1379 | Ga0495619_0061983 | 3300053085 | Bacteria | 2489 |
| 1380 | Ga0495619_0128449 | 3300053085 | Bacteria | 1741 |
| 1381 | Ga0495619_0199627 | 3300053085 | Bacteria | 1384 |
| 1382 | Ga0500554_014966 | 3300053102 | Bacteria | 2014 |
| 1383 | Ga0500593_001549 | 3300053117 | Bacteria | 8258 |
| 1384 | Ga0500595_001180 | 3300053119 | Bacteria | 14424 |
| 1385 | Ga0500652_000077 | 3300053131 | Bacteria | 42781 |
| 1386 | Ga0500658_0234398 | 3300053134 | Bacteria | 843 |
| 1387 | Ga0500590_099473 | 3300053148 | Bacteria | 1399 |
| 1388 | Ga0500603_035405 | 3300053150 | Bacteria | 1309 |
| 1389 | Ga0500637_0009067 | 3300053178 | Bacteria | 5050 |
| 1390 | Ga0500645_095559 | 3300053730 | Bacteria | 841 |
| 1391 | Ga0501084_0313371 | 3300054114 | Bacteria | 1325 |
| 1392 | Ga0500661_001671 | 3300055283 | Bacteria | 4170 |
| 1393 | Ga0501082_0000101 | 3300060353 | Bacteria | 66608 |
| 1394 | Ga0501082_0209664 | 3300060353 | Bacteria | 1695 |
| 1395 | Ga0530510_0434223 | 3300061734 | Unclassified | 992 |
| 1396 | Ga0070714_100279750 | |||
| 1397 | SwRhRL2b_contig_1529358 | |||
| 1398 | 2214745211 | |||
| 1399 | ARcpr5oldR_c000059 | |||
| 1400 | ARSoilYngRDRAFT_c00001 | |||
| 1401 | ARcpr5yngRDRAFT_c000001 | |||
| 1402 | ARSoilOldRDRAFT_c000066 | |||
| 1403 | ARCol0oldRDRAFT_c00439 | |||
| 1404 | ARCol0yngRDRAFT_1000014 | |||
| 1405 | JGI24746J21847_1002433 | |||
| 1406 | JGI24740J21852_10020451 | |||
| 1407 | JGI24739J22299_10010837 | |||
| 1408 | JGI24737J22298_10008285 | |||
| 1409 | JGI24735J21928_10011548 | |||
| 1410 | JGI24750J21931_1000154 | |||
| 1411 | JGI24745J21846_1000047 | |||
| 1412 | JGI24748J21848_1000162 | |||
| 1413 | JGI24738J21930_10000005 | |||
| 1414 | JGI24749J21850_1000444 | |||
| 1415 | JGI24749J21850_1003765 | |||
| 1416 | JGI24033J26618_1000407 | |||
| 1417 | JGI24034J26672_10000819 | |||
| 1418 | JGI24742J22300_10000203 | |||
| 1419 | JGI24751J29686_10011942 | |||
| 1420 | JGI25406J46586_10041430 | |||
| 1421 | JGI25405J52794_10024670 | |||
| 1422 | Ga0065704_10072903 | |||
| 1423 | Ga0065715_10003668 | |||
| 1424 | Ga0065715_10102699 | |||
| 1425 | Ga0070658_10703830 | |||
| 1426 | Ga0070676_10000087 | |||
| 1427 | Ga0070683_100000098 | |||
| 1428 | Ga0070683_100070578 | |||
| 1429 | Ga0070683_101141842 | |||
| 1430 | Ga0070690_100004710 | |||
| 1431 | Ga0070690_100036430 | |||
| 1432 | Ga0070690_100064871 | |||
| 1433 | Ga0070690_100209982 | |||
| 1434 | Ga0070690_100298987 | |||
| 1435 | Ga0070670_100062990 | |||
| 1436 | Ga0070670_100083177 | |||
| 1437 | Ga0070670_100133407 | |||
| 1438 | Ga0070670_100165242 | |||
| 1439 | Ga0070677_10000087 | |||
| 1440 | Ga0070677_10005921 | |||
| 1441 | Ga0068869_100007030 | |||
| 1442 | Ga0068869_100168436 | |||
| 1443 | Ga0068869_100195559 | |||
| 1444 | Ga0070666_10006074 | |||
| 1445 | Ga0070666_10139159 | |||
| 1446 | Ga0070666_10166879 | |||
| 1447 | Ga0070666_10213027 | |||
| 1448 | Ga0070680_100129126 | |||
| 1449 | Ga0070680_100715864 | |||
| 1450 | Ga0070680_100807244 | |||
| 1451 | Ga0070682_100003963 | |||
| 1452 | Ga0070682_100229025 | |||
| 1453 | Ga0070682_100363791 | |||
| 1454 | Ga0068868_100020059 | |||
| 1455 | Ga0068868_100281521 | |||
| 1456 | Ga0070660_100008367 | |||
| 1457 | Ga0070660_100063999 | |||
| 1458 | Ga0070689_100002716 | |||
| 1459 | Ga0070689_100023410 | |||
| 1460 | Ga0070689_100041942 | |||
| 1461 | Ga0070689_100153285 | |||
| 1462 | Ga0070689_100212072 | |||
| 1463 | Ga0070689_100232835 | |||
| 1464 | Ga0070691_10006879 | |||
| 1465 | Ga0070687_100027779 | |||
| 1466 | Ga0070687_100050664 | |||
| 1467 | Ga0070661_100000153 | |||
| 1468 | Ga0070661_100032632 | |||
| 1469 | Ga0070661_100046668 | |||
| 1470 | Ga0070692_10028938 | |||
| 1471 | Ga0070668_100054761 | |||
| 1472 | Ga0070668_100235655 | |||
| 1473 | Ga0070668_100310033 | |||
| 1474 | Ga0070669_100018867 | |||
| 1475 | Ga0070669_100134784 | |||
| 1476 | Ga0070669_100496769 | |||
| 1477 | Ga0070675_100010385 | |||
| 1478 | Ga0070675_100058672 | |||
| 1479 | Ga0070675_100319369 | |||
| 1480 | Ga0070675_100638054 | |||
| 1481 | Ga0070671_100000087 | |||
| 1482 | Ga0070671_100011988 | |||
| 1483 | Ga0070671_100087488 | |||
| 1484 | Ga0070671_100275396 | |||
| 1485 | Ga0070674_100003304 | |||
| 1486 | Ga0070674_100018767 | |||
| 1487 | Ga0070674_100036515 | |||
| 1488 | Ga0070673_100005718 | |||
| 1489 | Ga0070673_100039017 | |||
| 1490 | Ga0070673_100147552 | |||
| 1491 | Ga0070673_100182500 | |||
| 1492 | Ga0070688_100048957 | |||
| 1493 | Ga0070688_100079522 | |||
| 1494 | Ga0070688_100154850 | |||
| 1495 | Ga0070688_100155055 | |||
| 1496 | Ga0070688_100373345 | |||
| 1497 | Ga0070659_100009167 | |||
| 1498 | Ga0070659_100152918 | |||
| 1499 | Ga0070659_100164242 | |||
| 1500 | Ga0070659_100322980 | |||
| 1501 | Ga0070659_100531013 | |||
| 1502 | Ga0070667_100027461 | |||
| 1503 | Ga0070667_100042852 | |||
| 1504 | Ga0070667_100193919 | |||
| 1505 | Ga0070667_100792549 | |||
| 1506 | Ga0070703_10034267 | |||
| 1507 | Ga0070709_10001851 | |||
| 1508 | Ga0070709_10014055 | |||
| 1509 | Ga0070709_10343819 | |||
| 1510 | Ga0070714_100049571 | |||
| 1511 | Ga0070714_100066424 | |||
| 1512 | Ga0070714_100209348 | |||
| 1513 | Ga0070713_100001450 | |||
| 1514 | Ga0070713_100022950 | |||
| 1515 | Ga0070713_100083011 | |||
| 1516 | Ga0070713_100120596 | |||
| 1517 | Ga0070713_100140940 | |||
| 1518 | Ga0070713_100201076 | |||
| 1519 | Ga0070713_100249189 | |||
| 1520 | Ga0070713_100538581 | |||
| 1521 | Ga0070713_100766477 | |||
| 1522 | Ga0070710_10003954 | |||
| 1523 | Ga0070701_10001447 | |||
| 1524 | Ga0070701_10014027 | |||
| 1525 | Ga0070701_10052667 | |||
| 1526 | Ga0070701_10072974 | |||
| 1527 | Ga0070711_100033186 | |||
| 1528 | Ga0070711_100042334 | |||
| 1529 | Ga0070711_100081215 | |||
| 1530 | Ga0070711_100111727 | |||
| 1531 | Ga0070705_100014389 | |||
| 1532 | Ga0070705_100219093 | |||
| 1533 | Ga0070700_100010178 | |||
| 1534 | Ga0070700_100011271 | |||
| 1535 | Ga0070694_100034125 | |||
| 1536 | Ga0070694_100316720 | |||
| 1537 | Ga0070694_100440471 | |||
| 1538 | Ga0070694_100511649 | |||
| 1539 | Ga0070708_100162550 | |||
| 1540 | Ga0070663_100015960 | |||
| 1541 | Ga0070663_100048158 | |||
| 1542 | Ga0070663_100085275 | |||
| 1543 | Ga0070663_100127767 | |||
| 1544 | Ga0070663_100785481 | |||
| 1545 | Ga0070678_100000090 | |||
| 1546 | Ga0070678_100040261 | |||
| 1547 | Ga0070678_100088267 | |||
| 1548 | Ga0070678_100162412 | |||
| 1549 | Ga0070678_100232850 | |||
| 1550 | Ga0070662_100042407 | |||
| 1551 | Ga0070662_100050569 | |||
| 1552 | Ga0070662_100105908 | |||
| 1553 | Ga0070662_100192539 | |||
| 1554 | Ga0070681_10032354 | |||
| 1555 | Ga0070681_10200388 | |||
| 1556 | Ga0070681_10247460 | |||
| 1557 | Ga0070681_10564977 | |||
| 1558 | Ga0070681_11009290 | |||
| 1559 | Ga0068867_100008100 | |||
| 1560 | Ga0068867_100252836 | |||
| 1561 | Ga0068867_100414460 | |||
| 1562 | Ga0070685_10003606 | |||
| 1563 | Ga0070685_10004710 | |||
| 1564 | Ga0070685_10028131 | |||
| 1565 | Ga0070685_10061747 | |||
| 1566 | Ga0070706_100141717 | |||
| 1567 | Ga0070699_100369093 | |||
| 1568 | Ga0070679_100057812 | |||
| 1569 | Ga0070679_100158506 | |||
| 1570 | Ga0070679_100178646 | |||
| 1571 | Ga0070679_100197288 | |||
| 1572 | Ga0070679_100252262 | |||
| 1573 | Ga0070679_100332067 | |||
| 1574 | Ga0070684_100007412 | |||
| 1575 | Ga0070684_100010741 | |||
| 1576 | Ga0070697_100129350 | |||
| 1577 | Ga0068853_100011425 | |||
| 1578 | Ga0068853_100218038 | |||
| 1579 | Ga0068853_100238329 | |||
| 1580 | Ga0068853_100329417 | |||
| 1581 | Ga0070672_100003453 | |||
| 1582 | Ga0070672_100023218 | |||
| 1583 | Ga0070672_100377437 | |||
| 1584 | Ga0070686_100001736 | |||
| 1585 | Ga0070686_100012700 | |||
| 1586 | Ga0070686_100014361 | |||
| 1587 | Ga0070686_100039869 | |||
| 1588 | Ga0070686_100173841 | |||
| 1589 | Ga0070695_100117562 | |||
| 1590 | Ga0070695_100132327 | |||
| 1591 | Ga0070695_100442081 | |||
| 1592 | Ga0070695_100628178 | |||
| 1593 | Ga0070696_100037459 | |||
| 1594 | Ga0070696_100150142 | |||
| 1595 | Ga0070696_100349612 | |||
| 1596 | Ga0070693_100020625 | |||
| 1597 | Ga0070693_100078790 | |||
| 1598 | Ga0070665_100025741 | |||
| 1599 | Ga0070665_100083333 | |||
| 1600 | Ga0070665_100257373 | |||
| 1601 | Ga0070665_101067113 | |||
| 1602 | Ga0070704_100013532 | |||
| 1603 | Ga0070704_100184961 | |||
| 1604 | Ga0070704_100220936 | |||
| 1605 | Ga0070704_100430988 | |||
| 1606 | Ga0068855_100029468 | |||
| 1607 | Ga0068855_100589779 | |||
| 1608 | Ga0068855_100719578 | |||
| 1609 | Ga0070664_100003492 | |||
| 1610 | Ga0070664_100029633 | |||
| 1611 | Ga0068857_100001853 | |||
| 1612 | Ga0068854_100051068 | |||
| 1613 | Ga0068854_100324849 | |||
| 1614 | Ga0068854_100909408 | |||
| 1615 | Ga0068856_100000429 | |||
| 1616 | Ga0068856_100077570 | |||
| 1617 | Ga0068856_100174255 | |||
| 1618 | Ga0068856_100360392 | |||
| 1619 | Ga0068856_100578360 | |||
| 1620 | Ga0068856_100998077 | |||
| 1621 | Ga0070702_100000021 | |||
| 1622 | Ga0070702_100012355 | |||
| 1623 | Ga0070702_100232408 | |||
| 1624 | Ga0068852_100079650 | |||
| 1625 | Ga0068859_100045661 | |||
| 1626 | Ga0068859_100187867 | |||
| 1627 | Ga0068864_100051399 | |||
| 1628 | Ga0068864_100074171 | |||
| 1629 | Ga0068864_100113244 | |||
| 1630 | Ga0068864_100581797 | |||
| 1631 | Ga0068866_10000919 | |||
| 1632 | Ga0068866_10018320 | |||
| 1633 | Ga0068866_10077263 | |||
| 1634 | Ga0068866_10207964 | |||
| 1635 | Ga0068861_100002149 | |||
| 1636 | Ga0068861_100067791 | |||
| 1637 | Ga0068861_100131007 | |||
| 1638 | Ga0068861_100196432 | |||
| 1639 | Ga0068861_100228759 | |||
| 1640 | Ga0068861_100783057 | |||
| 1641 | Ga0068851_10359784 | |||
| 1642 | Ga0068870_10000588 | |||
| 1643 | Ga0068870_10014308 | |||
| 1644 | Ga0068863_100001459 | |||
| 1645 | Ga0068863_100045935 | |||
| 1646 | Ga0068863_100244222 | |||
| 1647 | Ga0068858_100116038 | |||
| 1648 | Ga0068858_100302872 | |||
| 1649 | Ga0068858_100334154 | |||
| 1650 | Ga0068858_100615929 | |||
| 1651 | Ga0068860_100016194 | |||
| 1652 | Ga0068860_100020090 | |||
| 1653 | Ga0068860_100036305 | |||
| 1654 | Ga0068862_100036033 | |||
| 1655 | Ga0068862_100250035 | |||
| 1656 | Ga0081455_10000002 | |||
| 1657 | Ga0081455_10003269 | |||
| 1658 | Ga0081455_10003886 | |||
| 1659 | Ga0081455_10022547 | |||
| 1660 | Ga0081455_10120655 | |||
| 1661 | Ga0081455_10139546 | |||
| 1662 | Ga0081455_10194436 | |||
| 1663 | Ga0081540_1010355 | |||
| 1664 | Ga0081540_1031460 | |||
| 1665 | Ga0081539_10002901 | |||
| 1666 | Ga0070717_10001529 | |||
| 1667 | Ga0070717_10008327 | |||
| 1668 | Ga0070717_10233626 | |||
| 1669 | Ga0070717_10250189 | |||
| 1670 | Ga0075365_10001671 | |||
| 1671 | Ga0075365_10026637 | |||
| 1672 | Ga0075365_10095029 | |||
| 1673 | Ga0075365_10160523 | |||
| 1674 | Ga0075368_10028171 | |||
| 1675 | Ga0075363_100001378 | |||
| 1676 | Ga0075363_100012518 | |||
| 1677 | Ga0075363_100034923 | |||
| 1678 | Ga0075364_10005413 | |||
| 1679 | Ga0075364_10041419 | |||
| 1680 | Ga0075364_10470023 | |||
| 1681 | Ga0070715_10000379 | |||
| 1682 | Ga0070715_10058215 | |||
| 1683 | Ga0070715_10069483 | |||
| 1684 | Ga0070715_10078723 | |||
| 1685 | Ga0070716_100041362 | |||
| 1686 | Ga0070716_100577985 | |||
| 1687 | Ga0070712_100010590 | |||
| 1688 | Ga0070712_100171040 | |||
| 1689 | Ga0070712_100297739 | |||
| 1690 | Ga0075362_10010849 | |||
| 1691 | Ga0075362_10012472 | |||
| 1692 | Ga0075362_10209336 | |||
| 1693 | Ga0075367_10001203 | |||
| 1694 | Ga0075367_10053037 | |||
| 1695 | Ga0075367_10127068 | |||
| 1696 | Ga0075369_10005459 | |||
| 1697 | Ga0075427_10000093 | |||
| 1698 | Ga0075366_10006427 | |||
| 1699 | Ga0075366_10031698 | |||
| 1700 | Ga0097621_100000012 | |||
| 1701 | Ga0097621_100032038 | |||
| 1702 | Ga0097621_100323904 | |||
| 1703 | Ga0097621_100354308 | |||
| 1704 | Ga0075370_10262301 | |||
| 1705 | Ga0068871_100000138 | |||
| 1706 | Ga0068871_100008692 | |||
| 1707 | Ga0068871_100087680 | |||
| 1708 | Ga0068871_100298467 | |||
| 1709 | Ga0075428_100036127 | |||
| 1710 | Ga0075428_100087699 | |||
| 1711 | Ga0075428_100161541 | |||
| 1712 | Ga0075428_100185144 | |||
| 1713 | Ga0075428_100233494 | |||
| 1714 | Ga0075428_100609429 | |||
| 1715 | Ga0075430_100000014 | |||
| 1716 | Ga0075430_100003974 | |||
| 1717 | Ga0075430_100009563 | |||
| 1718 | Ga0075430_100411982 | |||
| 1719 | Ga0075431_100005449 | |||
| 1720 | Ga0075431_100140324 | |||
| 1721 | Ga0075431_100163948 | |||
| 1722 | Ga0075433_10000100 | |||
| 1723 | Ga0075433_10038428 | |||
| 1724 | Ga0075433_10095241 | |||
| 1725 | Ga0075434_100018712 | |||
| 1726 | Ga0075434_100038552 | |||
| 1727 | Ga0075434_100045780 | |||
| 1728 | Ga0075434_100061573 | |||
| 1729 | Ga0075434_100075803 | |||
| 1730 | Ga0075434_100457505 | |||
| 1731 | Ga0075434_100830966 | |||
| 1732 | Ga0075429_100004155 | |||
| 1733 | Ga0068865_100015586 | |||
| 1734 | Ga0068865_100104993 | |||
| 1735 | Ga0068865_100182872 | |||
| 1736 | Ga0075436_100111964 | |||
| 1737 | Ga0075436_100120146 | |||
| 1738 | Ga0075436_100135614 | |||
| 1739 | Ga0075436_100400398 | |||
| 1740 | Ga0075436_100525802 | |||
| 1741 | Ga0097620_100045654 | |||
| 1742 | Ga0097620_100187848 | |||
| 1743 | Ga0075435_100061289 | |||
| 1744 | Ga0075435_100067947 | |||
| 1745 | Ga0075435_100105192 | |||
| 1746 | Ga0075435_100267411 | |||
| 1747 | Ga0075435_100309827 | |||
| 1748 | Ga0075435_100392122 | |||
| 1749 | Ga0075435_100477353 | |||
| 1750 | Ga0099795_10004915 | |||
| 1751 | Ga0105251_10027453 | |||
| 1752 | Ga0105250_10038833 | |||
| 1753 | Ga0105250_10048561 | |||
| 1754 | Ga0105240_10020624 | |||
| 1755 | Ga0105240_10054015 | |||
| 1756 | Ga0105240_10538318 | |||
| 1757 | Ga0111539_10010658 | |||
| 1758 | Ga0111539_10031589 | |||
| 1759 | Ga0111539_10046646 | |||
| 1760 | Ga0111539_10107930 | |||
| 1761 | Ga0111539_10187325 | |||
| 1762 | Ga0111539_10207051 | |||
| 1763 | Ga0111539_10290381 | |||
| 1764 | Ga0111539_10394916 | |||
| 1765 | Ga0111539_10421369 | |||
| 1766 | Ga0111539_10725552 | |||
| 1767 | Ga0105245_10001132 | |||
| 1768 | Ga0105245_10028479 | |||
| 1769 | Ga0105245_10313858 | |||
| 1770 | Ga0105247_10011973 | |||
| 1771 | Ga0105247_10057718 | |||
| 1772 | Ga0105247_10089867 | |||
| 1773 | Ga0105247_10098594 | |||
| 1774 | Ga0114129_10002014 | |||
| 1775 | Ga0114129_10011877 | |||
| 1776 | Ga0114129_10019370 | |||
| 1777 | Ga0114129_10053795 | |||
| 1778 | Ga0114129_10078363 | |||
| 1779 | Ga0114129_10262075 | |||
| 1780 | Ga0114129_10321372 | |||
| 1781 | Ga0114129_10554657 | |||
| 1782 | Ga0105243_10021892 | |||
| 1783 | Ga0105243_10062102 | |||
| 1784 | Ga0105243_10216178 | |||
| 1785 | Ga0105243_10436681 | |||
| 1786 | Ga0105241_10009988 | |||
| 1787 | Ga0105241_10157156 | |||
| 1788 | Ga0105242_10000623 | |||
| 1789 | Ga0105242_10063821 | |||
| 1790 | Ga0105242_10089675 | |||
| 1791 | Ga0105242_10099801 | |||
| 1792 | Ga0105242_10543833 | |||
| 1793 | Ga0105248_10037821 | |||
| 1794 | Ga0105248_10080147 | |||
| 1795 | Ga0105248_10169653 | |||
| 1796 | Ga0105248_10180002 | |||
| 1797 | Ga0105248_10229032 | |||
| 1798 | Ga0105248_10508627 | |||
| 1799 | Ga0105237_10052924 | |||
| 1800 | Ga0105237_10103835 | |||
| 1801 | Ga0105237_10195426 | |||
| 1802 | Ga0105237_10477616 | |||
| 1803 | Ga0105237_10488024 | |||
| 1804 | Ga0105238_10006101 | |||
| 1805 | Ga0105238_10068460 | |||
| 1806 | Ga0105238_10083410 | |||
| 1807 | Ga0105249_10026638 | |||
| 1808 | Ga0105249_10084761 | |||
| 1809 | Ga0105249_10168270 | |||
| 1810 | Ga0105249_10172880 | |||
| 1811 | Ga0105249_10173692 | |||
| 1812 | Ga0105249_10228917 | |||
| 1813 | Ga0105249_11639760 | |||
| 1814 | Ga0099796_10005106 | |||
| 1815 | Ga0105239_10029848 | |||
| 1816 | Ga0105239_10038880 | |||
| 1817 | Ga0105239_10048338 | |||
| 1818 | Ga0105239_10720401 | |||
| 1819 | Ga0105246_10001183 | |||
| 1820 | Ga0105246_10572213 | |||
| 1821 | Ga0105246_10938328 | |||
| 1822 | Ga0157373_10012880 | |||
| 1823 | Ga0157373_10246400 | |||
| 1824 | Ga0157373_10295000 | |||
| 1825 | Ga0157371_10057659 | |||
| 1826 | Ga0157371_10135387 | |||
| 1827 | Ga0157371_10595984 | |||
| 1828 | Ga0157370_10108378 | |||
| 1829 | Ga0157370_10776615 | |||
| 1830 | Ga0157369_10193404 | |||
| 1831 | Ga0157369_10423619 | |||
| 1832 | Ga0157374_10001601 | |||
| 1833 | Ga0157374_10124095 | |||
| 1834 | Ga0157374_10128465 | |||
| 1835 | Ga0157374_10422485 | |||
| 1836 | Ga0157374_10958114 | |||
| 1837 | Ga0157378_10002020 | |||
| 1838 | Ga0157378_10133677 | |||
| 1839 | Ga0163162_10032396 | |||
| 1840 | Ga0163162_10114861 | |||
| 1841 | Ga0163162_10206623 | |||
| 1842 | Ga0163162_10208911 | |||
| 1843 | Ga0163162_10348941 | |||
| 1844 | Ga0157372_10288614 | |||
| 1845 | Ga0157375_10029102 | |||
| 1846 | Ga0157375_10044806 | |||
| 1847 | Ga0157375_10367402 | |||
| 1848 | Ga0157375_10782202 | |||
| 1849 | Ga0157375_10851229 | |||
| 1850 | Ga0157375_11170870 | |||
| 1851 | Ga0163163_10049673 | |||
| 1852 | Ga0163163_10127282 | |||
| 1853 | Ga0163163_10157490 | |||
| 1854 | Ga0163163_10180826 | |||
| 1855 | Ga0163163_10341401 | |||
| 1856 | Ga0157380_10104618 | |||
| 1857 | Ga0157380_10182785 | |||
| 1858 | Ga0157380_10196047 | |||
| 1859 | Ga0157377_10000196 | |||
| 1860 | Ga0157377_10179011 | |||
| 1861 | Ga0157379_10021402 | |||
| 1862 | Ga0157379_10049072 | |||
| 1863 | Ga0157379_10151547 | |||
| 1864 | Ga0157379_10161364 | |||
| 1865 | Ga0157379_10677320 | |||
| 1866 | Ga0157379_11012124 | |||
| 1867 | Ga0157376_10000168 | |||
| 1868 | Ga0157376_10145651 | |||
| 1869 | Ga0157376_10162625 | |||
| 1870 | Ga0157376_10249994 | |||
| 1871 | Ga0163161_10000511 | |||
| 1872 | Ga0163161_10067114 | |||
| 1873 | Ga0163161_10102191 | |||
| 1874 | Ga0213874_10077144 | |||
| 1875 | Ga0213876_10067575 | |||
| 1876 | Ga0213876_10177992 | |||
| 1877 | Ga0207666_1000296 | |||
| 1878 | Ga0207673_1000056 | |||
| 1879 | Ga0207697_10006861 | |||
| 1880 | Ga0207697_10204838 | |||
| 1881 | Ga0207713_1063657 | |||
| 1882 | Ga0207682_10000064 | |||
| 1883 | Ga0207682_10001593 | |||
| 1884 | Ga0207692_10026576 | |||
| 1885 | Ga0207692_10135720 | |||
| 1886 | Ga0207692_10155744 | |||
| 1887 | Ga0207642_10006630 | |||
| 1888 | Ga0207642_10029164 | |||
| 1889 | Ga0207710_10007378 | |||
| 1890 | Ga0207710_10012495 | |||
| 1891 | Ga0207688_10000117 | |||
| 1892 | Ga0207688_10000195 | |||
| 1893 | Ga0207688_10356869 | |||
| 1894 | Ga0207680_10126150 | |||
| 1895 | Ga0207680_10127971 | |||
| 1896 | Ga0207680_10162594 | |||
| 1897 | Ga0207680_10164890 | |||
| 1898 | Ga0207680_10691915 | |||
| 1899 | Ga0207647_10032286 | |||
| 1900 | Ga0207647_10112320 | |||
| 1901 | Ga0207685_10022403 | |||
| 1902 | Ga0207685_10044028 | |||
| 1903 | Ga0207685_10076764 | |||
| 1904 | Ga0207699_10101144 | |||
| 1905 | Ga0207699_10220282 | |||
| 1906 | Ga0207699_10236930 | |||
| 1907 | Ga0207699_10462537 | |||
| 1908 | Ga0207699_10489897 | |||
| 1909 | Ga0207645_10000040 | |||
| 1910 | Ga0207643_10000072 | |||
| 1911 | Ga0207643_10000291 | |||
| 1912 | Ga0207705_10551007 | |||
| 1913 | Ga0207684_10084148 | |||
| 1914 | Ga0207654_10010446 | |||
| 1915 | Ga0207654_10045184 | |||
| 1916 | Ga0207654_10202484 | |||
| 1917 | Ga0207654_10239909 | |||
| 1918 | Ga0207654_10358344 | |||
| 1919 | Ga0207707_10003512 | |||
| 1920 | Ga0207707_10281862 | |||
| 1921 | Ga0207695_10432255 | |||
| 1922 | Ga0207671_10026718 | |||
| 1923 | Ga0207671_10324099 | |||
| 1924 | Ga0207693_10004617 | |||
| 1925 | Ga0207693_10005019 | |||
| 1926 | Ga0207693_10007075 | |||
| 1927 | Ga0207693_10021399 | |||
| 1928 | Ga0207693_10059962 | |||
| 1929 | Ga0207693_10111959 | |||
| 1930 | Ga0207693_10122397 | |||
| 1931 | Ga0207693_10122592 | |||
| 1932 | Ga0207693_10137568 | |||
| 1933 | Ga0207663_10102395 | |||
| 1934 | Ga0207663_10129151 | |||
| 1935 | Ga0207663_10529915 | |||
| 1936 | Ga0207660_10003460 | |||
| 1937 | Ga0207660_10032727 | |||
| 1938 | Ga0207660_10206010 | |||
| 1939 | Ga0207660_10461750 | |||
| 1940 | Ga0207662_10010243 | |||
| 1941 | Ga0207662_10065808 | |||
| 1942 | Ga0207662_10261625 | |||
| 1943 | Ga0207657_10051887 | |||
| 1944 | Ga0207657_10075361 | |||
| 1945 | Ga0207657_10079987 | |||
| 1946 | Ga0207657_10125762 | |||
| 1947 | Ga0207657_10159561 | |||
| 1948 | Ga0207649_10000086 | |||
| 1949 | Ga0207652_10004335 | |||
| 1950 | Ga0207652_10148105 | |||
| 1951 | Ga0207652_10231094 | |||
| 1952 | Ga0207652_10384661 | |||
| 1953 | Ga0207646_10048472 | |||
| 1954 | Ga0207646_10995330 | |||
| 1955 | Ga0207681_10000451 | |||
| 1956 | Ga0207694_10103727 | |||
| 1957 | Ga0207694_10297751 | |||
| 1958 | Ga0207694_10531258 | |||
| 1959 | Ga0207650_10000972 | |||
| 1960 | Ga0207650_10008027 | |||
| 1961 | Ga0207650_10046577 | |||
| 1962 | Ga0207650_10201795 | |||
| 1963 | Ga0207659_10000478 | |||
| 1964 | Ga0207659_10027849 | |||
| 1965 | Ga0207659_10053244 | |||
| 1966 | Ga0207659_10060168 | |||
| 1967 | Ga0207659_10176572 | |||
| 1968 | Ga0207659_10210254 | |||
| 1969 | Ga0207687_10000144 | |||
| 1970 | Ga0207687_10005852 | |||
| 1971 | Ga0207687_10007800 | |||
| 1972 | Ga0207687_10017010 | |||
| 1973 | Ga0207687_10595119 | |||
| 1974 | Ga0207700_10007883 | |||
| 1975 | Ga0207700_10010360 | |||
| 1976 | Ga0207700_10103349 | |||
| 1977 | Ga0207700_10209693 | |||
| 1978 | Ga0207700_10238468 | |||
| 1979 | Ga0207700_10246473 | |||
| 1980 | Ga0207700_10333255 | |||
| 1981 | Ga0207664_10052117 | |||
| 1982 | Ga0207664_10311302 | |||
| 1983 | Ga0207664_10558659 | |||
| 1984 | Ga0207644_10001694 | |||
| 1985 | Ga0207644_10007672 | |||
| 1986 | Ga0207644_10010699 | |||
| 1987 | Ga0207644_10028186 | |||
| 1988 | Ga0207690_10000086 | |||
| 1989 | Ga0207690_10071142 | |||
| 1990 | Ga0207690_10093526 | |||
| 1991 | Ga0207690_10204089 | |||
| 1992 | Ga0207690_10441232 | |||
| 1993 | Ga0207706_10013203 | |||
| 1994 | Ga0207706_10039372 | |||
| 1995 | Ga0207706_10186999 | |||
| 1996 | Ga0207686_10000287 | |||
| 1997 | Ga0207686_10026795 | |||
| 1998 | Ga0207686_10129282 | |||
| 1999 | Ga0207686_10196937 | |||
| 2000 | Ga0207709_10000431 | |||
| 2001 | Ga0207709_10044459 | |||
| 2002 | Ga0207709_10425584 | |||
| 2003 | Ga0207670_10010207 | |||
| 2004 | Ga0207670_10011186 | |||
| 2005 | Ga0207670_10061434 | |||
| 2006 | Ga0207670_10100941 | |||
| 2007 | Ga0207670_10165734 | |||
| 2008 | Ga0207670_10300161 | |||
| 2009 | Ga0207669_10000050 | |||
| 2010 | Ga0207669_10022824 | |||
| 2011 | Ga0207669_10171196 | |||
| 2012 | Ga0207669_10402567 | |||
| 2013 | Ga0207704_10000774 | |||
| 2014 | Ga0207704_10006265 | |||
| 2015 | Ga0207704_10014495 | |||
| 2016 | Ga0207704_10225989 | |||
| 2017 | Ga0207704_10464271 | |||
| 2018 | Ga0207665_10001033 | |||
| 2019 | Ga0207665_10016224 | |||
| 2020 | Ga0207665_10109746 | |||
| 2021 | Ga0207665_10545867 | |||
| 2022 | Ga0207691_10002007 | |||
| 2023 | Ga0207691_10019090 | |||
| 2024 | Ga0207691_10020643 | |||
| 2025 | Ga0207711_10011783 | |||
| 2026 | Ga0207711_10036115 | |||
| 2027 | Ga0207711_10036907 | |||
| 2028 | Ga0207711_10041690 | |||
| 2029 | Ga0207689_10000115 | |||
| 2030 | Ga0207689_10002877 | |||
| 2031 | Ga0207689_10109931 | |||
| 2032 | Ga0207661_10000094 | |||
| 2033 | Ga0207661_10091112 | |||
| 2034 | Ga0207679_10000025 | |||
| 2035 | Ga0207679_10015384 | |||
| 2036 | Ga0207679_10340404 | |||
| 2037 | Ga0207679_10695165 | |||
| 2038 | Ga0207679_10738468 | |||
| 2039 | Ga0207667_10047924 | |||
| 2040 | Ga0207667_10957064 | |||
| 2041 | Ga0207651_10000081 | |||
| 2042 | Ga0207651_10082069 | |||
| 2043 | Ga0207712_10000315 | |||
| 2044 | Ga0207712_10017744 | |||
| 2045 | Ga0207712_10097480 | |||
| 2046 | Ga0207668_10000098 | |||
| 2047 | Ga0207668_10240575 | |||
| 2048 | Ga0207640_10000104 | |||
| 2049 | Ga0207640_10067074 | |||
| 2050 | Ga0207640_10224233 | |||
| 2051 | Ga0207640_10287503 | |||
| 2052 | Ga0207658_10022108 | |||
| 2053 | Ga0207658_10043430 | |||
| 2054 | Ga0207658_10119607 | |||
| 2055 | Ga0207658_10264654 | |||
| 2056 | Ga0207677_10034106 | |||
| 2057 | Ga0207677_10137379 | |||
| 2058 | Ga0207677_10240490 | |||
| 2059 | Ga0207703_10046816 | |||
| 2060 | Ga0207703_10088275 | |||
| 2061 | Ga0207703_10483725 | |||
| 2062 | Ga0207639_10000954 | |||
| 2063 | Ga0207639_10112920 | |||
| 2064 | Ga0207639_10194149 | |||
| 2065 | Ga0207639_10281884 | |||
| 2066 | Ga0207639_10313196 | |||
| 2067 | Ga0207678_10001162 | |||
| 2068 | Ga0207678_10008097 | |||
| 2069 | Ga0207678_10009832 | |||
| 2070 | Ga0207678_10145462 | |||
| 2071 | Ga0207678_10380604 | |||
| 2072 | Ga0207708_10001029 | |||
| 2073 | Ga0207708_10019521 | |||
| 2074 | Ga0207708_10131875 | |||
| 2075 | Ga0207708_10252786 | |||
| 2076 | Ga0207708_10338657 | |||
| 2077 | Ga0207702_10002785 | |||
| 2078 | Ga0207702_10272978 | |||
| 2079 | Ga0207702_10277859 | |||
| 2080 | Ga0207702_10278883 | |||
| 2081 | Ga0207702_10919652 | |||
| 2082 | Ga0207641_10000364 | |||
| 2083 | Ga0207641_10029516 | |||
| 2084 | Ga0207641_10036719 | |||
| 2085 | Ga0207648_10017434 | |||
| 2086 | Ga0207648_10023601 | |||
| 2087 | Ga0207648_10027119 | |||
| 2088 | Ga0207648_10213726 | |||
| 2089 | Ga0207648_10267297 | |||
| 2090 | Ga0207648_10408896 | |||
| 2091 | Ga0207676_10003923 | |||
| 2092 | Ga0207676_10004707 | |||
| 2093 | Ga0207676_10006878 | |||
| 2094 | Ga0207676_10246146 | |||
| 2095 | Ga0207676_10652954 | |||
| 2096 | Ga0207674_10019868 | |||
| 2097 | Ga0207674_10240199 | |||
| 2098 | Ga0207674_10713633 | |||
| 2099 | Ga0207675_100002392 | |||
| 2100 | Ga0207675_100083025 | |||
| 2101 | Ga0207675_100142583 | |||
| 2102 | Ga0207675_100268304 | |||
| 2103 | Ga0207683_10000001 | |||
| 2104 | Ga0207683_10000918 | |||
| 2105 | Ga0207683_10004123 | |||
| 2106 | Ga0207683_10033169 | |||
| 2107 | Ga0207683_10082865 | |||
| 2108 | Ga0207698_10011125 | |||
| 2109 | Ga0207698_10731019 | |||
| 2110 | Ga0209967_1004004 | |||
| 2111 | Ga0209984_1003477 | |||
| 2112 | Ga0209970_1007141 | |||
| 2113 | Ga0209983_1003280 | |||
| 2114 | Ga0209971_1003510 | |||
| 2115 | Ga0209966_1001211 | |||
| 2116 | Ga0209998_10012805 | |||
| 2117 | Ga0209998_10015130 | |||
| 2118 | Ga0209974_10045558 | |||
| 2119 | Ga0209974_10047488 | |||
| 2120 | Ga0207428_10000146 | |||
| 2121 | Ga0207428_10000221 | |||
| 2122 | Ga0207428_10000524 | |||
| 2123 | Ga0268266_10036070 | |||
| 2124 | Ga0268266_10064002 | |||
| 2125 | Ga0268266_10093484 | |||
| 2126 | Ga0268266_10213454 | |||
| 2127 | Ga0268265_10000350 | |||
| 2128 | Ga0268265_10205052 | |||
| 2129 | Ga0268265_10836915 | |||
| 2130 | Ga0268264_10021698 | |||
| 2131 | Ga0268264_10136895 | |||
| 2132 | Ga0268264_10793015 | |||
| 2133 | Ga0265337_1006088 | |||
| 2134 | Ga0265318_10016381 | |||
| 2135 | Ga0265338_10008028 | |||
| 2136 | Ga0265760_10044756 | |||
| 2137 | Ga0265760_10046630 | |||
| 2138 | Ga0265760_10058917 | |||
| 2139 | Ga0265760_10064269 | |||
| 2140 | Ga0265330_10100356 | |||
| 2141 | Ga0265332_10011248 | |||
| 2142 | Ga0265332_10017669 | |||
| 2143 | Ga0265325_10015013 | |||
| 2144 | Ga0265340_10031418 | |||
| 2145 | Ga0265339_10000096 | |||
| 2146 | Ga0265339_10021879 | |||
| 2147 | Ga0265316_10051989 | |||
| 2148 | Ga0307408_101063056 | |||
| 2149 | Ga0265313_10000024 | |||
| 2150 | Ga0316575_10055211 | |||
| 2151 | Ga0265314_10283896 | |||
| 2152 | Ga0265342_10000230 | |||
| 2153 | Ga0265342_10059320 | |||
| 2154 | Ga0316578_10066629 | |||
| 2155 | Ga0307406_11020210 | |||
| 2156 | Ga0373930_0001414 | |||
| 2157 | Ga0373930_0004022 | |||
| 2158 | Ga0373948_0003227 | |||
| 2159 | Ga0373948_0032879 | |||
| 2160 | Ga0373950_0000233 | |||
| 2161 | Ga0373958_0000271 | |||
| 2162 | Ga0373958_0004321 | |||
| 2163 | Ga0373959_0002070 | |||
| 2164 | Ga0373938_0014635 | |||
| 2165 | Ga0373938_0019336 | |||
| 2166 | Ga0373938_0020613 | |||
| 2167 | Ga0373926_0006063 | |||
| 2168 | Ga0373928_0012174 | |||
| 2169 | Ga0373929_0000054 | |||
| 2170 | Ga0373934_0032784 | |||
| 2171 | Ga0373934_0033349 | |||
| 2172 | Ga0373940_0000308 | |||
| 2173 | Ga0373940_0001216 | |||
| 2174 | Ga0373940_0018543 | |||
| 2175 | Ga0373940_0051906 | |||
| 2176 | Ga0373944_0005528 | |||
| 2177 | Ga0373944_0009262 | |||
| 2178 | Ga0373944_0063225 | |||
| 2179 | Ga0373951_0006408 | |||
| 2180 | Ga0373951_0018048 | |||
| 2181 | Ga0373952_0001176 | |||
| 2182 | Ga0373952_0004129 | |||
| 2183 | Ga0373923_0007797 | |||
| 2184 | Ga0373923_0009424 | |||
| 2185 | Ga0373932_0000513 | |||
| 2186 | Ga0373932_0004289 | |||
| 2187 | Ga0373932_0004716 | |||
| 2188 | Ga0373936_0008189 | |||
| 2189 | Ga0373936_0060285 | |||
| 2190 | Ga0373936_0078942 | |||
| 2191 | Ga0373936_0269599 | |||
| 2192 | Ga0373939_0000835 | |||
| 2193 | Ga0373939_0002022 | |||
| 2194 | Ga0373939_0002422 | |||
| 2195 | Ga0373939_0056971 | |||
| 2196 | Ga0373941_0000446 | |||
| 2197 | Ga0373941_0001331 | |||
| 2198 | Ga0373941_0018235 | |||
| 2199 | Ga0373945_0002888 | |||
| 2200 | Ga0373945_0026173 | |||
| 2201 | Ga0373953_0006422 | |||
| 2202 | Ga0373953_0022517 | |||
| 2203 | Ga0373953_0027003 | |||
| 2204 | Ga0373953_0053410 | |||
| 2205 | Ga0373954_0005543 | |||
| 2206 | Ga0373954_0019638 | |||
| 2207 | Ga0373954_0097191 | |||
| 2208 | Ga0373954_0150530 | |||
| 2209 | Ga0373956_0001402 | |||
| 2210 | Ga0373956_0058468 | |||
| 2211 | Ga0373956_0134111 | |||
| 2212 | Ga0373957_0001296 | |||
| 2213 | Ga0373957_0024719 | |||
| 2214 | Ga0373957_0169052 | |||
| 2215 | Ga0373960_0001375 | |||
| 2216 | Ga0373960_0010662 | |||
| 2217 | Ga0373943_0000604 | |||
| 2218 | Ga0373943_0039468 | |||
| 2219 | Ga0373943_0047410 | |||
| 2220 | Ga0373943_0057544 | |||
| 2221 | Ga0373943_0062098 | |||
| 2222 | Ga0373943_0080638 | |||
| 2223 | Ga0373946_0003645 | |||
| 2224 | Ga0373946_0026555 | |||
| 2225 | Ga0373946_0029375 | |||
| 2226 | Ga0373946_0087903 | |||
| 2227 | Ga0373946_0114705 | |||
| 2228 | Ga0373955_0001931 | |||
| 2229 | Ga0373955_0069643 | |||
| 2230 | Ga0373955_0233880 | |||
| 2231 | Ga0373955_0277221 | |||
| 2232 | Ga0373942_0001024 | |||
| 2233 | Ga0373942_0002937 | |||
| 2234 | Ga0373942_0086196 | |||
| 2235 | Ga0373961_0000356 | |||
| 2236 | Ga0373961_0014739 | |||
| 2237 | Ga0373962_0016277 | |||
| 2238 | Ga0373962_0017415 | |||
| 2239 | Ga0373924_0005132 | |||
| 2240 | Ga0373931_0000593 | |||
| 2241 | Ga0373931_0007758 | |||
| 2242 | Ga0373931_0022947 | |||
| 2243 | Ga0373931_0030252 | |||
| 2244 | Ga0373931_0145219 | |||
| 2245 | Ga0373935_0001442 | |||
| 2246 | Ga0373935_0012660 | |||
| 2247 | Ga0373935_0097321 | |||
| 2248 | Ga0373935_0114225 | |||
| 2249 | Ga0373935_0143522 | |||
| 2250 | Ga0373935_0375206 | |||
| 2251 | Ga0373935_0508065 | |||
| 2252 | Ga0373927_0002603 | |||
| 2253 | Ga0373927_0007920 | |||
| 2254 | Ga0373927_0008533 | |||
| 2255 | Ga0373927_0008946 | |||
| 2256 | Ga0373927_0041540 | |||
| 2257 | Ga0373927_0085335 | |||
| 2258 | Ga0373927_0221080 | |||
| 2259 | Ga0373927_0449996 | |||
| 2260 | Ga0373933_0001968 | |||
| 2261 | Ga0373933_0064420 | |||
| 2262 | Ga0373933_0085482 | |||
| 2263 | Ga0373933_0108034 | |||
| 2264 | Ga0373933_0254034 | |||
| 2265 | Ga0373933_0439949 | |||
| 2266 | Ga0373947_0000168 | |||
| 2267 | Ga0373947_0009446 | |||
| 2268 | Ga0373947_0011068 | |||
| 2269 | Ga0373947_0088433 | |||
| 2270 | Ga0373947_0166258 | |||
| 2271 | Ga0373947_0230637 | |||
| 2272 | Ga0373947_0378566 | |||
| 2273 | Ga0373947_0469169 | |||
| 2274 | Ga0373937_0000814 | |||
| 2275 | Ga0373937_0001859 | |||
| 2276 | Ga0373937_0002452 | |||
| 2277 | Ga0373937_0033958 | |||
| 2278 | Ga0373937_0117315 | |||
| 2279 | Ga0373937_0120795 | |||
| 2280 | Ga0373937_0148066 | |||
| 2281 | Ga0373937_0289058 | |||
| 2282 | Ga0316584_0005534 | |||
| 2283 | Ga0316584_0120026 | |||
| 2284 | Ga0373925_0013667 | |||
| 2285 | Ga0373925_0017035 | |||
| 2286 | Ga0373925_0044216 | |||
| 2287 | Ga0373925_0075111 | |||
| 2288 | Ga0373925_0251594 | |||
| 2289 | Ga0373925_0486544 | |||
| 2290 | Ga0395899_0008835 | |||
| 2291 | Ga0395899_0204640 | |||
| 2292 | Ga0395899_0249719 | |||
| 2293 | Ga0395899_0538303 | |||
| 2294 | Ga0395900_0000709 | |||
| 2295 | Ga0395900_0103524 | |||
| 2296 | Ga0395900_0164184 | |||
| 2297 | Ga0395900_1010770 | |||
| 2298 | Ga0395898_0023683 | |||
| 2299 | Ga0395898_0072915 | |||
| 2300 | Ga0395898_0083680 | |||
| 2301 | Ga0395898_0508850 | |||
| 2302 | Ga0395905_0120346 | |||
| 2303 | Ga0436364_0671098 | |||
| 2304 | Ga0436364_1035362 | |||
| 2305 | Ga0395901_0011960 | |||
| 2306 | Ga0395901_0207765 | |||
| 2307 | Ga0395901_0635086 | |||
| 2308 | Ga0395901_1117792 | |||
| 2309 | Ga0436365_0909129 | |||
| 2310 | Ga0436360_0063464 | |||
| 2311 | Ga0436360_0067730 | |||
| 2312 | Ga0436361_0174670 | |||
| 2313 | Ga0436361_0329200 | |||
| 2314 | Ga0436361_0825759 | |||
| 2315 | Ga0436363_0431026 | |||
| 2316 | Ga0436363_0450495 | |||
| 2317 | Ga0436363_0738257 | |||
| 2318 | Ga0451793_1911136 | |||
| 2319 | Ga0439445_0129412 | |||
| 2320 | Ga0439450_006590 | |||
| 2321 | Ga0439455_0004874 | |||
| 2322 | Ga0439464_0038648 | |||
| 2323 | Ga0439460_0008770 | |||
| 2324 | Ga0451577_0026107 | |||
| 2325 | Ga0439440_0007658 | |||
| 2326 | Ga0466963_0033242 | |||
| 2327 | Ga0453684_0049507 | |||
| 2328 | Ga0466957_0061173 | |||
| 2329 | Ga0451576_0225795 | |||
| 2330 | Ga0466958_0085752 | |||
| 2331 | Ga0466967_0001077 | |||
| 2332 | Ga0495592_0011257 | |||
| 2333 | Ga0495592_0016998 | |||
| 2334 | Ga0495592_0060432 | |||
| 2335 | Ga0495592_0095181 | |||
| 2336 | Ga0495592_0118079 | |||
| 2337 | Ga0495592_0134747 | |||
| 2338 | Ga0495592_0202512 | |||
| 2339 | Ga0495591_020020 | |||
| 2340 | Ga0495629_0000230 | |||
| 2341 | Ga0495629_0001246 | |||
| 2342 | Ga0495629_0062243 | |||
| 2343 | Ga0495629_0086466 | |||
| 2344 | Ga0495629_0113085 | |||
| 2345 | Ga0495629_0206469 | |||
| 2346 | Ga0495629_0249472 | |||
| 2347 | Ga0495641_0021558 | |||
| 2348 | Ga0495641_0027803 | |||
| 2349 | Ga0495641_0124457 | |||
| 2350 | Ga0495641_0217734 | |||
| 2351 | Ga0495651_0000514 | |||
| 2352 | Ga0495651_0015536 | |||
| 2353 | Ga0495651_0038788 | |||
| 2354 | Ga0495651_0163357 | |||
| 2355 | Ga0495653_0000928 | |||
| 2356 | Ga0495653_0017250 | |||
| 2357 | Ga0495653_0019183 | |||
| 2358 | Ga0495650_0024137 | |||
| 2359 | Ga0495580_0021820 | |||
| 2360 | Ga0495580_0022796 | |||
| 2361 | Ga0495580_0107751 | |||
| 2362 | Ga0495580_0113425 | |||
| 2363 | Ga0495580_0182045 | |||
| 2364 | Ga0495582_0013255 | |||
| 2365 | Ga0495582_0028396 | |||
| 2366 | Ga0495582_0241590 | |||
| 2367 | Ga0495582_0284537 | |||
| 2368 | Ga0495605_0034824 | |||
| 2369 | Ga0495639_0237218 | |||
| 2370 | Ga0495662_0008984 | |||
| 2371 | Ga0495662_0122940 | |||
| 2372 | Ga0495662_0131930 | |||
| 2373 | Ga0495662_0231796 | |||
| 2374 | Ga0495664_0012425 | |||
| 2375 | Ga0495664_0021800 | |||
| 2376 | Ga0495664_0025369 | |||
| 2377 | Ga0495664_0037733 | |||
| 2378 | Ga0495664_0085136 | |||
| 2379 | Ga0495664_0089763 | |||
| 2380 | Ga0495664_0143878 | |||
| 2381 | Ga0495584_0038768 | |||
| 2382 | Ga0495584_0087774 | |||
| 2383 | Ga0495585_0012824 | |||
| 2384 | Ga0495585_0171157 | |||
| 2385 | Ga0495594_0080692 | |||
| 2386 | Ga0495607_0028730 | |||
| 2387 | Ga0495608_0000211 | |||
| 2388 | Ga0495608_0013911 | |||
| 2389 | Ga0495608_0017291 | |||
| 2390 | Ga0495608_0028242 | |||
| 2391 | Ga0495616_0116940 | |||
| 2392 | Ga0495618_0004258 | |||
| 2393 | Ga0495618_0007886 | |||
| 2394 | Ga0495618_0061862 | |||
| 2395 | Ga0495618_0087832 | |||
| 2396 | Ga0495628_0001017 | |||
| 2397 | Ga0495628_0058738 | |||
| 2398 | Ga0495628_0060309 | |||
| 2399 | Ga0495628_0242728 | |||
| 2400 | Ga0495628_0581616 | |||
| 2401 | Ga0495630_0030857 | |||
| 2402 | Ga0495630_0033639 | |||
| 2403 | Ga0495630_0047187 | |||
| 2404 | Ga0495630_0310397 | |||
| 2405 | Ga0495630_0429917 | |||
| 2406 | Ga0495637_0017568 | |||
| 2407 | Ga0495643_0152182 | |||
| 2408 | Ga0495644_0000207 | |||
| 2409 | Ga0495663_0108428 | |||
| 2410 | Ga0495666_0008778 | |||
| 2411 | Ga0495666_0057605 | |||
| 2412 | Ga0495652_0009353 | |||
| 2413 | Ga0495652_0010381 | |||
| 2414 | Ga0495652_0049242 | |||
| 2415 | Ga0495652_0053555 | |||
| 2416 | Ga0495652_0181217 | |||
| 2417 | Ga0495652_0399323 | |||
| 2418 | Ga0495665_0005144 | |||
| 2419 | Ga0495665_0029177 | |||
| 2420 | Ga0495640_0002965 | |||
| 2421 | Ga0495640_0025900 | |||
| 2422 | Ga0495640_0058225 | |||
| 2423 | Ga0495640_0088902 | |||
| 2424 | Ga0495640_0153154 | |||
| 2425 | Ga0495587_0003782 | |||
| 2426 | Ga0495587_0012005 | |||
| 2427 | Ga0495587_0012054 | |||
| 2428 | Ga0495587_0038988 | |||
| 2429 | Ga0495598_0102915 | |||
| 2430 | Ga0495609_0024001 | |||
| 2431 | Ga0495609_0025772 | |||
| 2432 | Ga0495621_0053497 | |||
| 2433 | Ga0495645_0005364 | |||
| 2434 | Ga0495645_0025415 | |||
| 2435 | Ga0495645_0035601 | |||
| 2436 | Ga0495645_0061742 | |||
| 2437 | Ga0495645_0526320 | |||
| 2438 | Ga0495622_0032721 | |||
| 2439 | Ga0495633_0007791 | |||
| 2440 | Ga0495633_0320059 | |||
| 2441 | Ga0495667_0004263 | |||
| 2442 | Ga0495667_0019341 | |||
| 2443 | Ga0495667_0030062 | |||
| 2444 | Ga0495667_0039123 | |||
| 2445 | Ga0495667_0068781 | |||
| 2446 | Ga0495667_0113311 | |||
| 2447 | Ga0495667_0453675 | |||
| 2448 | Ga0495656_0000115 | |||
| 2449 | Ga0495656_0168039 | |||
| 2450 | Ga0495668_0192854 | |||
| 2451 | Ga0495634_0016926 | |||
| 2452 | Ga0495634_0030683 | |||
| 2453 | Ga0495634_0043090 | |||
| 2454 | Ga0495634_0098548 | |||
| 2455 | Ga0495634_0136460 | |||
| 2456 | Ga0495634_0218727 | |||
| 2457 | Ga0495611_0000905 | |||
| 2458 | Ga0495611_0141749 | |||
| 2459 | Ga0495635_0011378 | |||
| 2460 | Ga0495635_0023649 | |||
| 2461 | Ga0495635_0024578 | |||
| 2462 | Ga0495635_0026118 | |||
| 2463 | Ga0495635_0118612 | |||
| 2464 | Ga0495635_0361528 | |||
| 2465 | Ga0495635_0470423 | |||
| 2466 | Ga0495659_0000545 | |||
| 2467 | Ga0495659_0012800 | |||
| 2468 | Ga0495659_0214901 | |||
| 2469 | Ga0495588_0030812 | |||
| 2470 | Ga0495657_0008566 | |||
| 2471 | Ga0495657_0017487 | |||
| 2472 | Ga0495657_0075843 | |||
| 2473 | Ga0495599_0029916 | |||
| 2474 | Ga0495599_0036753 | |||
| 2475 | Ga0495599_0095308 | |||
| 2476 | Ga0495623_0002503 | |||
| 2477 | Ga0495623_0002644 | |||
| 2478 | Ga0495623_0034441 | |||
| 2479 | Ga0495646_0011541 | |||
| 2480 | Ga0495646_0037089 | |||
| 2481 | Ga0495646_0039108 | |||
| 2482 | Ga0495646_0069665 | |||
| 2483 | Ga0495647_0002731 | |||
| 2484 | Ga0495647_0005717 | |||
| 2485 | Ga0495647_0020426 | |||
| 2486 | Ga0495658_0006761 | |||
| 2487 | Ga0495658_0019872 | |||
| 2488 | Ga0495658_0038304 | |||
| 2489 | Ga0495658_0131430 | |||
| 2490 | Ga0495669_0035049 | |||
| 2491 | Ga0495613_0045913 | |||
| 2492 | Ga0495613_0047306 | |||
| 2493 | Ga0495613_0101469 | |||
| 2494 | Ga0495613_0222408 | |||
| 2495 | Ga0495613_0264799 | |||
| 2496 | Ga0495624_0004214 | |||
| 2497 | Ga0495624_0067263 | |||
| 2498 | Ga0495670_0000652 | |||
| 2499 | Ga0495671_0155040 | |||
| 2500 | Ga0495671_0314924 | |||
| 2501 | Ga0495649_0030157 | |||
| 2502 | Ga0495600_0000802 | |||
| 2503 | Ga0495600_0004409 | |||
| 2504 | Ga0495600_0057523 | |||
| 2505 | Ga0495600_0112870 | |||
| 2506 | Ga0495600_0170895 | |||
| 2507 | Ga0495581_0123148 | |||
| 2508 | Ga0495604_0000360 | |||
| 2509 | Ga0495604_0013734 | |||
| 2510 | Ga0495604_0021779 | |||
| 2511 | Ga0495604_0029690 | |||
| 2512 | Ga0495604_0044072 | |||
| 2513 | Ga0495604_0098888 | |||
| 2514 | Ga0495604_0288534 | |||
| 2515 | Ga0495674_0008238 | |||
| 2516 | Ga0495674_0020349 | |||
| 2517 | Ga0495674_0027922 | |||
| 2518 | Ga0495674_0119139 | |||
| 2519 | Ga0495674_0302464 | |||
| 2520 | Ga0495674_0387673 | |||
| 2521 | Ga0495676_0029954 | |||
| 2522 | Ga0495676_0088439 | |||
| 2523 | Ga0495676_0145853 | |||
| 2524 | Ga0495676_0257412 | |||
| 2525 | Ga0495680_0000313 | |||
| 2526 | Ga0495680_0008135 | |||
| 2527 | Ga0495680_0009019 | |||
| 2528 | Ga0495680_0009794 | |||
| 2529 | Ga0495680_0012298 | |||
| 2530 | Ga0495680_0021698 | |||
| 2531 | Ga0495683_0097902 | |||
| 2532 | Ga0495675_0002612 | |||
| 2533 | Ga0495675_0005504 | |||
| 2534 | Ga0495675_0023436 | |||
| 2535 | Ga0495675_0090715 | |||
| 2536 | Ga0495679_045429 | |||
| 2537 | Ga0495684_0006921 | |||
| 2538 | Ga0495684_0012904 | |||
| 2539 | Ga0495684_0028950 | |||
| 2540 | Ga0495684_0037199 | |||
| 2541 | Ga0495684_0154521 | |||
| 2542 | Ga0495684_0218035 | |||
| 2543 | Ga0495684_0404979 | |||
| 2544 | Ga0495684_0595589 | |||
| 2545 | Ga0495593_0009519 | |||
| 2546 | Ga0495593_0010594 | |||
| 2547 | Ga0495593_0013212 | |||
| 2548 | Ga0495593_0023469 | |||
| 2549 | Ga0495593_0043909 | |||
| 2550 | Ga0495602_0005154 | |||
| 2551 | Ga0495602_0010330 | |||
| 2552 | Ga0495602_0033303 | |||
| 2553 | Ga0495614_0008099 | |||
| 2554 | Ga0495614_0170827 | |||
| 2555 | Ga0495614_0220273 | |||
| 2556 | Ga0496100_0000330 | |||
| 2557 | Ga0496100_0009383 | |||
| 2558 | Ga0496100_0023823 | |||
| 2559 | Ga0496100_0029006 | |||
| 2560 | Ga0496100_0077564 | |||
| 2561 | Ga0496100_0145774 | |||
| 2562 | Ga0496100_0308741 | |||
| 2563 | Ga0496101_0000079 | |||
| 2564 | Ga0496101_0023269 | |||
| 2565 | Ga0496101_0118402 | |||
| 2566 | Ga0496101_0122285 | |||
| 2567 | Ga0496101_0207779 | |||
| 2568 | Ga0496102_0011543 | |||
| 2569 | Ga0496102_0016791 | |||
| 2570 | Ga0496102_0150356 | |||
| 2571 | Ga0496102_0330576 | |||
| 2572 | Ga0496103_0033302 | |||
| 2573 | Ga0496103_0053360 | |||
| 2574 | Ga0496103_0082012 | |||
| 2575 | Ga0496103_0143933 | |||
| 2576 | Ga0496103_0533931 | |||
| 2577 | Ga0496104_0002973 | |||
| 2578 | Ga0496104_0004496 | |||
| 2579 | Ga0496104_0006726 | |||
| 2580 | Ga0496104_0032893 | |||
| 2581 | Ga0496104_0055353 | |||
| 2582 | Ga0496104_0237208 | |||
| 2583 | Ga0496104_0264241 | |||
| 2584 | Ga0496104_0458661 | |||
| 2585 | Ga0496105_0000168 | |||
| 2586 | Ga0496105_0006753 | |||
| 2587 | Ga0496105_0013976 | |||
| 2588 | Ga0496105_0074656 | |||
| 2589 | Ga0496105_0083503 | |||
| 2590 | Ga0496105_0096415 | |||
| 2591 | Ga0496105_0108576 | |||
| 2592 | Ga0496105_0254264 | |||
| 2593 | Ga0496106_0006208 | |||
| 2594 | Ga0496106_0029911 | |||
| 2595 | Ga0496106_0038114 | |||
| 2596 | Ga0496106_0040359 | |||
| 2597 | Ga0496106_0054441 | |||
| 2598 | Ga0496106_0092676 | |||
| 2599 | Ga0496106_0112137 | |||
| 2600 | Ga0496106_0155878 | |||
| 2601 | Ga0496106_0439510 | |||
| 2602 | Ga0496106_0461549 | |||
| 2603 | Ga0496106_0844964 | |||
| 2604 | Ga0496107_0000143 | |||
| 2605 | Ga0496107_0018391 | |||
| 2606 | Ga0496107_0031013 | |||
| 2607 | Ga0496107_0066654 | |||
| 2608 | Ga0496107_0144818 | |||
| 2609 | Ga0496107_0189071 | |||
| 2610 | Ga0496107_0489529 | |||
| 2611 | Ga0496108_0000698 | |||
| 2612 | Ga0496108_0002282 | |||
| 2613 | Ga0496108_0079539 | |||
| 2614 | Ga0496108_0105543 | |||
| 2615 | Ga0496108_0127622 | |||
| 2616 | Ga0496108_0168884 | |||
| 2617 | Ga0496109_0000372 | |||
| 2618 | Ga0496109_0001273 | |||
| 2619 | Ga0496109_0060513 | |||
| 2620 | Ga0496109_0067473 | |||
| 2621 | Ga0496109_0087794 | |||
| 2622 | Ga0496109_0098090 | |||
| 2623 | Ga0496109_0192314 | |||
| 2624 | Ga0496109_0234404 | |||
| 2625 | Ga0496110_0026148 | |||
| 2626 | Ga0496110_0046987 | |||
| 2627 | Ga0496110_0060214 | |||
| 2628 | Ga0496110_0183648 | |||
| 2629 | Ga0496110_0188174 | |||
| 2630 | Ga0496110_0355062 | |||
| 2631 | Ga0496111_0005807 | |||
| 2632 | Ga0496111_0062687 | |||
| 2633 | Ga0496111_0067957 | |||
| 2634 | Ga0496111_0242382 | |||
| 2635 | Ga0496112_0010618 | |||
| 2636 | Ga0496112_0025350 | |||
| 2637 | Ga0496112_0072202 | |||
| 2638 | Ga0496112_0183205 | |||
| 2639 | Ga0496112_0190144 | |||
| 2640 | Ga0496112_0507152 | |||
| 2641 | Ga0496112_0869176 | |||
| 2642 | Ga0496113_0000303 | |||
| 2643 | Ga0496113_0018311 | |||
| 2644 | Ga0496113_0169256 | |||
| 2645 | Ga0496113_0190964 | |||
| 2646 | Ga0496114_0006447 | |||
| 2647 | Ga0496114_0006628 | |||
| 2648 | Ga0496114_0035294 | |||
| 2649 | Ga0496114_0072783 | |||
| 2650 | Ga0496114_0092133 | |||
| 2651 | Ga0496114_0156176 | |||
| 2652 | Ga0496114_0549100 | |||
| 2653 | Ga0496114_0640165 | |||
| 2654 | Ga0496115_0000653 | |||
| 2655 | Ga0496115_0032306 | |||
| 2656 | Ga0496115_0057674 | |||
| 2657 | Ga0496115_0237146 | |||
| 2658 | Ga0496121_0315804 | |||
| 2659 | Ga0496125_0177061 | |||
| 2660 | Ga0501032_0428227 | |||
| 2661 | Ga0501036_0286192 | |||
| 2662 | Ga0501038_0494806 | |||
| 2663 | Ga0501040_0507677 | |||
| 2664 | Ga0501041_0482298 | |||
| 2665 | Ga0501042_0521071 | |||
| 2666 | Ga0501043_0444979 | |||
| 2667 | Ga0501046_0469607 | |||
| 2668 | Ga0501047_0172166 | |||
| 2669 | Ga0501068_0227837 | |||
| 2670 | Ga0501073_0169869 | |||
| 2671 | Ga0501073_0467739 | |||
| 2672 | Ga0501073_0555261 | |||
| 2673 | Ga0501076_0246054 | |||
| 2674 | Ga0501077_0057332 | |||
| 2675 | Ga0501079_0066389 | |||
| 2676 | Ga0501079_0142917 | |||
| 2677 | Ga0501079_0238919 | |||
| 2678 | Ga0501080_0140727 | |||
| 2679 | Ga0501080_0886884 | |||
| 2680 | Ga0501081_0218218 | |||
| 2681 | Ga0501035_0713528 | |||
| 2682 | Ga0501044_0329102 | |||
| 2683 | Ga0501044_0546010 | |||
| 2684 | nmdc:mga03683_43877_c1 | |||
| 2685 | nmdc:mga03n38_24716_c1 | |||
| 2686 | nmdc:mga03n38_3107_c1 | |||
| 2687 | nmdc:mga00v17_4589_c1 | |||
| 2688 | nmdc:mga00v17_9497_c1 | |||
| 2689 | nmdc:mga0yw44_246680_c1 | |||
| 2690 | nmdc:mga0yw44_27074_c1 | |||
| 2691 | nmdc:mga0yw44_280357_c1 | |||
| 2692 | nmdc:mga0yw44_282133_c1 | |||
| 2693 | nmdc:mga0k408_6133_c1 | |||
| 2694 | nmdc:mga06z11_1635_c1 | |||
| 2695 | nmdc:mga06z11_213158_c1 | |||
| 2696 | nmdc:mga07m45_20193_c1 | |||
| 2697 | nmdc:mga07m45_284100_c1 | |||
| 2698 | nmdc:mga07m45_35092_c2 | |||
| 2699 | nmdc:mga05p37_111_c2 | |||
| 2700 | nmdc:mga05p37_118283_c1 | |||
| 2701 | nmdc:mga05p37_126617_c1 | |||
| 2702 | nmdc:mga05p37_17687_c1 | |||
| 2703 | nmdc:mga05p37_181482_c1 | |||
| 2704 | nmdc:mga05p37_244589_c1 | |||
| 2705 | nmdc:mga05p37_359050_c1 | |||
| 2706 | nmdc:mga05p37_69071_c1 | |||
| 2707 | nmdc:mga09592_27955_c1 | |||
| 2708 | nmdc:mga0qj67_12821_c1 | |||
| 2709 | nmdc:mga0qj67_189_c1 | |||
| 2710 | nmdc:mga0qj67_455860_c1 | |||
| 2711 | nmdc:mga0qj67_529173_c1 | |||
| 2712 | nmdc:mga0qj67_65800_c1 | |||
| 2713 | nmdc:mga06r32_10349_c1 | |||
| 2714 | nmdc:mga06r32_1248255_c1 | |||
| 2715 | nmdc:mga06r32_496949_c1 | |||
| 2716 | nmdc:mga06r32_87163_c1 | |||
| 2717 | nmdc:mga08y16_1052_c1 | |||
| 2718 | nmdc:mga08y16_1139186_c1 | |||
| 2719 | nmdc:mga08y16_24425_c1 | |||
| 2720 | nmdc:mga08y16_3254_c1 | |||
| 2721 | nmdc:mga08y16_338474_c1 | |||
| 2722 | nmdc:mga08y16_395135_c1 | |||
| 2723 | nmdc:mga08y16_4695_c1 | |||
| 2724 | nmdc:mga08y16_521552_c1 | |||
| 2725 | nmdc:mga0n895_193244_c1 | |||
| 2726 | nmdc:mga0n895_19600_c1 | |||
| 2727 | nmdc:mga0n895_28635_c1 | |||
| 2728 | nmdc:mga0n895_28850_c1 | |||
| 2729 | nmdc:mga0n895_424793_c1 | |||
| 2730 | nmdc:mga0n895_6052_c1 | |||
| 2731 | nmdc:mga0n895_61201_c1 | |||
| 2732 | nmdc:mga0rr50_23552_c1 | |||
| 2733 | nmdc:mga0rr50_276658_c1 | |||
| 2734 | nmdc:mga0rr50_316719_c1 | |||
| 2735 | nmdc:mga0rr50_45233_c1 | |||
| 2736 | nmdc:mga0rr50_565337_c1 | |||
| 2737 | nmdc:mga08x19_119633_c1 | |||
| 2738 | nmdc:mga08x19_23491_c1 | |||
| 2739 | nmdc:mga08x19_99010_c1 | |||
| 2740 | nmdc:mga0a205_122710_c1 | |||
| 2741 | nmdc:mga0a205_2125_c1 | |||
| 2742 | nmdc:mga0a205_2281_c1 | |||
| 2743 | nmdc:mga0a205_238201_c1 | |||
| 2744 | nmdc:mga0a205_28775_c1 | |||
| 2745 | nmdc:mga0a205_553809_c1 | |||
| 2746 | nmdc:mga0sz30_4997_c1 | |||
| 2747 | Ga0495601_0000114 | |||
| 2748 | Ga0495601_0001485 | |||
| 2749 | Ga0495601_0013078 | |||
| 2750 | Ga0495601_0036766 | |||
| 2751 | Ga0495601_0054986 | |||
| 2752 | Ga0495601_0063087 | |||
| 2753 | Ga0495601_0088230 | |||
| 2754 | Ga0495612_0001226 | |||
| 2755 | Ga0495612_0005655 | |||
| 2756 | Ga0495612_0009022 | |||
| 2757 | Ga0495612_0025884 | |||
| 2758 | Ga0495612_0071136 | |||
| 2759 | Ga0495612_0104824 | |||
| 2760 | Ga0495595_0000718 | |||
| 2761 | Ga0495595_0001264 | |||
| 2762 | Ga0495595_0001866 | |||
| 2763 | Ga0495595_0004743 | |||
| 2764 | Ga0495595_0062728 | |||
| 2765 | Ga0495595_0133648 | |||
| 2766 | Ga0495595_0238950 | |||
| 2767 | Ga0495619_0000201 | |||
| 2768 | Ga0495619_0000206 | |||
| 2769 | Ga0495619_0006226 | |||
| 2770 | Ga0495619_0009047 | |||
| 2771 | Ga0495619_0014776 | |||
| 2772 | Ga0495619_0025483 | |||
| 2773 | Ga0495619_0057902 | |||
| 2774 | Ga0495619_0061983 | |||
| 2775 | Ga0495619_0128449 | |||
| 2776 | Ga0495619_0199627 | |||
| 2777 | Ga0500554_014966 | |||
| 2778 | Ga0500593_001549 | |||
| 2779 | Ga0500595_001180 | |||
| 2780 | Ga0500652_000077 | |||
| 2781 | Ga0500658_0234398 | |||
| 2782 | Ga0500590_099473 | |||
| 2783 | Ga0500603_035405 | |||
| 2784 | Ga0500637_0009067 | |||
| 2785 | Ga0500645_095559 | |||
| 2786 | Ga0501084_0313371 | |||
| 2787 | Ga0500661_001671 | |||
| 2788 | Ga0501082_0000101 | |||
| 2789 | Ga0501082_0209664 | |||
| 2790 | Ga0530510_0434223 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fem-assembly1.cif.gz_A | mutant r188m of the cytidine monophosphate kinase from e. coli | 0.8761 | 2 | 205 |
| 1cke-assembly1.cif.gz_A | cmp kinase from escherichia coli free enzyme structure | 0.8755 | 2 | 205 |
| 4e22-assembly1.cif.gz_A | structure of cytidine monophosphate kinase from yersinia pseudotuberculosis | 0.8716 | 2 | 204 |
| 3r20-assembly1.cif.gz_A | crystal structure of cytidylate kinase from mycobacterium smegmatis | 0.8539 | 1 | 200 |
| 2feo-assembly1.cif.gz_A | mutant r188m of the cytidine monophosphate kinase from e. coli complexed with dcmp | 0.8395 | 2 | 204 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2femA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8761 | 2 | 205 | 3.40.50.300 |
| af_P96391_36_146_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8744 | 1 | 25 | 3.40.50.300 |
| af_D3ZKU6_1_282_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8287 | 1 | 22 | 3.40.50.300 |
| 2h92C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8068 | 1 | 204 | 3.40.50.300 |
| 2h92C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7762 | 1 | 204 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A285M6Y7-F1-model_v4 | Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) | 0.9881 | 1 | 207 |
GO:0005524
GO:0005737 GO:0006220 GO:0036430 GO:0036431 |
| AF-A0A528PHJ3-F1-model_v4 | deleted | 0.9812 | 106 | 212 |
|
| AF-A0A3D2W2X5-F1-model_v4 | (d)CMP kinase (EC 2.7.4.25) | 0.9787 | 98 | 206 |
GO:0004127
GO:0005524 |
| AF-A0A529AYW8-F1-model_v4 | (d)CMP kinase (EC 2.7.4.25) | 0.9778 | 94 | 212 |
GO:0005524
GO:0036430 GO:0036431 |
| AF-A0A350LRY6-F1-model_v4 | (d)CMP kinase (EC 2.7.4.25) | 0.9765 | 102 | 206 |
GO:0004127
GO:0005524 |