F493617

General Info

Members Datasets Scaffolds Average Seq Length
1395 465 2790 212

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100279750|Ga0070714_1002797501
Length 244
Sequence VHVVLDALIGLDLHACVHVDILRTVAHDIPWNMIIAIDGPAASGKGTIAKQVAAIYGLPHLDTGLIYRAVARAVLDAGYPPDNVEKAIDAAIALDPRGFDESALKAPAITEAASVVAAIPEVRQALMNYQRAFATKPPGAVLDGRDIGTVIAPGADVKIFVVATPEVRAARRTAEMRARGEAADEREVLADLLRRDERDSRRTAAPLKAAPDAHLLDTTHLGIDAAFRAAVDIIEAVRTGRKRG

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
5 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
6 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
7 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
8 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
9 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
10 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
16 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
17 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
18 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
19 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
20 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
21 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
22 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
23 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
24 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
60 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
63 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
69 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
70 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
71 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
85 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
86 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
95 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
96 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
97 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
100 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
101 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
102 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
103 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
104 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
105 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
106 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
107 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
108 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
109 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
110 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
111 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
112 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
113 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
114 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
115 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
116 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
118 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
119 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
120 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
121 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
122 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
123 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
124 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
125 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
126 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
127 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
129 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
130 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
131 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
132 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
133 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
134 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
135 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
136 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
138 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
139 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
140 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
141 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
142 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
143 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
144 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
145 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
146 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
147 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
148 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
149 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
150 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
151 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
152 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
153 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
154 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
155 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
156 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
157 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
158 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
159 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
160 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
161 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
162 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
163 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
164 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
166 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
242 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
246 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
247 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
248 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
250 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
251 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
252 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
253 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
254 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
255 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
256 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
257 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
258 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
259 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
260 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
261 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
262 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
263 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
264 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
265 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
266 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
267 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
268 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
269 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
270 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
271 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
272 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
273 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
274 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
275 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
276 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
277 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
278 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
279 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
280 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
281 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
282 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
283 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
284 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
285 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
286 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
287 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
288 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
289 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
290 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
291 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
292 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
293 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
294 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
295 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
296 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
297 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
298 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
299 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
300 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
301 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
302 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
303 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
304 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
305 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
306 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
307 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
308 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
309 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
310 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
311 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
312 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
313 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
314 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
315 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
316 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
317 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
318 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
319 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
320 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
321 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
322 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
323 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
324 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
325 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
326 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
327 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
328 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
329 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
330 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
331 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
332 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
333 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
334 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
335 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
336 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
337 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
338 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
339 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
340 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
341 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
342 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
343 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
344 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
345 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
346 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
347 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
348 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
349 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
350 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
351 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
352 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
353 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
354 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
355 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
356 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
357 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
358 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
359 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
360 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
361 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
362 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
363 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
364 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
365 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
366 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
367 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
368 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
369 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
370 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
371 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
372 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
373 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
374 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
375 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
376 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
377 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
378 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
379 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
380 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
381 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
382 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
383 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
384 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
385 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
386 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
387 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
388 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
389 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
390 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
391 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
392 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
393 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
394 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
395 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
396 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
397 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
398 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
399 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
400 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
401 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
402 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
403 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
404 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
405 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
406 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
407 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
408 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
409 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
410 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
411 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
412 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
413 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
414 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
424 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
425 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
426 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
427 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
428 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
429 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
430 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
432 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
433 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
434 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
435 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
436 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
437 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
438 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
439 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
440 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
441 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
442 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
443 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
444 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
445 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
446 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
447 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
448 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
449 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
450 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
451 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
452 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
453 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
454 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
455 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
456 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
457 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
458 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
459 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
460 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
461 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
462 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
463 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
464 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
465 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.37
Nodule 0
Rhizoplane 7.38
Rhizosphere 88.46
Stem 0
Stem Tuber 0
Unclassified 0.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100279750 3300005435 Bacteria 1550
2 SwRhRL2b_contig_1529358 2162886007 Bacteria 996
3 2214745211 2209111006 Bacteria 14800
4 ARcpr5oldR_c000059 3300000041 Bacteria 20360
5 ARSoilYngRDRAFT_c00001 3300000042 Bacteria 59233
6 ARcpr5yngRDRAFT_c000001 3300000043 Bacteria 58937
7 ARSoilOldRDRAFT_c000066 3300000044 Bacteria 20359
8 ARCol0oldRDRAFT_c00439 3300000045 Bacteria 3971
9 ARCol0yngRDRAFT_1000014 3300000652 Bacteria 35008
10 JGI24746J21847_1002433 3300001977 Bacteria 2965
11 JGI24740J21852_10020451 3300001979 Bacteria 2308
12 JGI24739J22299_10010837 3300001989 Bacteria 3375
13 JGI24737J22298_10008285 3300001990 Bacteria 3486
14 JGI24735J21928_10011548 3300002067 Bacteria 2797
15 JGI24750J21931_1000154 3300002070 Bacteria 11402
16 JGI24745J21846_1000047 3300002073 Bacteria 8297
17 JGI24748J21848_1000162 3300002074 Bacteria 9733
18 JGI24738J21930_10000005 3300002075 Bacteria 42207
19 JGI24749J21850_1000444 3300002076 Bacteria 6172
20 JGI24749J21850_1003765 3300002076 Bacteria 2119
21 JGI24033J26618_1000407 3300002155 Bacteria 4353
22 JGI24034J26672_10000819 3300002239 Bacteria 4027
23 JGI24742J22300_10000203 3300002244 Bacteria 8766
24 JGI24751J29686_10011942 3300002459 Bacteria 1791
25 JGI25406J46586_10041430 3300003203 Bacteria 1621
26 JGI25405J52794_10024670 3300003911 Bacteria 1229
27 Ga0065704_10072903 3300005289 Bacteria 7838
28 Ga0065715_10003668 3300005293 Bacteria 5170
29 Ga0065715_10102699 3300005293 Bacteria 3090
30 Ga0070658_10703830 3300005327 Bacteria 877
31 Ga0070676_10000087 3300005328 Bacteria 31855
32 Ga0070683_100000098 3300005329 Bacteria 57301
33 Ga0070683_100070578 3300005329 Bacteria 3258
34 Ga0070683_101141842 3300005329 Bacteria 748
35 Ga0070690_100004710 3300005330 Bacteria 7603
36 Ga0070690_100036430 3300005330 Bacteria 3091
37 Ga0070690_100064871 3300005330 Bacteria 2360
38 Ga0070690_100209982 3300005330 Bacteria 1359
39 Ga0070690_100298987 3300005330 Bacteria 1154
40 Ga0070670_100062990 3300005331 Bacteria 3183
41 Ga0070670_100083177 3300005331 Bacteria 2750
42 Ga0070670_100133407 3300005331 Bacteria 2145
43 Ga0070670_100165242 3300005331 Bacteria 1919
44 Ga0070677_10000087 3300005333 Bacteria 29691
45 Ga0070677_10005921 3300005333 Bacteria 4051
46 Ga0068869_100007030 3300005334 Bacteria 7167
47 Ga0068869_100168436 3300005334 Bacteria 1710
48 Ga0068869_100195559 3300005334 Bacteria 1592
49 Ga0070666_10006074 3300005335 Bacteria 7421
50 Ga0070666_10139159 3300005335 Bacteria 1690
51 Ga0070666_10166879 3300005335 Bacteria 1540
52 Ga0070666_10213027 3300005335 Bacteria 1361
53 Ga0070680_100129126 3300005336 Bacteria 2113
54 Ga0070680_100715864 3300005336 Bacteria 861
55 Ga0070680_100807244 3300005336 Bacteria 808
56 Ga0070682_100003963 3300005337 Bacteria 8220
57 Ga0070682_100229025 3300005337 Bacteria 1327
58 Ga0070682_100363791 3300005337 Bacteria 1082
59 Ga0068868_100020059 3300005338 Bacteria 5016
60 Ga0068868_100281521 3300005338 Bacteria 1408
61 Ga0070660_100008367 3300005339 Bacteria 7233
62 Ga0070660_100063999 3300005339 Bacteria 2861
63 Ga0070689_100002716 3300005340 Bacteria 11589
64 Ga0070689_100023410 3300005340 Bacteria 4623
65 Ga0070689_100041942 3300005340 Bacteria 3513
66 Ga0070689_100153285 3300005340 Bacteria 1859
67 Ga0070689_100212072 3300005340 Bacteria 1585
68 Ga0070689_100232835 3300005340 Bacteria 1515
69 Ga0070691_10006879 3300005341 Bacteria 5202
70 Ga0070687_100027779 3300005343 Bacteria 2737
71 Ga0070687_100050664 3300005343 Bacteria 2145
72 Ga0070661_100000153 3300005344 Bacteria 56652
73 Ga0070661_100032632 3300005344 Bacteria 3768
74 Ga0070661_100046668 3300005344 Bacteria 3169
75 Ga0070692_10028938 3300005345 Bacteria 2758
76 Ga0070668_100054761 3300005347 Bacteria 3077
77 Ga0070668_100235655 3300005347 Bacteria 1515
78 Ga0070668_100310033 3300005347 Bacteria 1326
79 Ga0070669_100018867 3300005353 Bacteria 4930
80 Ga0070669_100134784 3300005353 Bacteria 1898
81 Ga0070669_100496769 3300005353 Bacteria 1011
82 Ga0070675_100010385 3300005354 Bacteria 7272
83 Ga0070675_100058672 3300005354 Bacteria 3174
84 Ga0070675_100319369 3300005354 Bacteria 1372
85 Ga0070675_100638054 3300005354 Bacteria 967
86 Ga0070671_100000087 3300005355 Bacteria 59534
87 Ga0070671_100011988 3300005355 Bacteria 6973
88 Ga0070671_100087488 3300005355 Bacteria 2607
89 Ga0070671_100275396 3300005355 Bacteria 1430
90 Ga0070674_100003304 3300005356 Bacteria 9027
91 Ga0070674_100018767 3300005356 Bacteria 4381
92 Ga0070674_100036515 3300005356 Bacteria 3299
93 Ga0070673_100005718 3300005364 Bacteria 7996
94 Ga0070673_100039017 3300005364 Bacteria 3631
95 Ga0070673_100147552 3300005364 Bacteria 1989
96 Ga0070673_100182500 3300005364 Bacteria 1797
97 Ga0070688_100048957 3300005365 Bacteria 2628
98 Ga0070688_100079522 3300005365 Bacteria 2118
99 Ga0070688_100154850 3300005365 Bacteria 1569
100 Ga0070688_100155055 3300005365 Bacteria 1568
101 Ga0070688_100373345 3300005365 Bacteria 1049
102 Ga0070659_100009167 3300005366 Bacteria 7258
103 Ga0070659_100152918 3300005366 Bacteria 1883
104 Ga0070659_100164242 3300005366 Bacteria 1816
105 Ga0070659_100322980 3300005366 Bacteria 1290
106 Ga0070659_100531013 3300005366 Bacteria 1005
107 Ga0070667_100027461 3300005367 Bacteria 4735
108 Ga0070667_100042852 3300005367 Bacteria 3797
109 Ga0070667_100193919 3300005367 Bacteria 1801
110 Ga0070667_100792549 3300005367 Bacteria 879
111 Ga0070703_10034267 3300005406 Bacteria 1549
112 Ga0070709_10001851 3300005434 Bacteria 11474
113 Ga0070709_10014055 3300005434 Bacteria 4518
114 Ga0070709_10343819 3300005434 Bacteria 1100
115 Ga0070714_100049571 3300005435 Bacteria 3574
116 Ga0070714_100066424 3300005435 Bacteria 3108
117 Ga0070714_100209348 3300005435 Bacteria 1787
118 Ga0070713_100001450 3300005436 Bacteria 15134
119 Ga0070713_100022950 3300005436 Bacteria 4831
120 Ga0070713_100083011 3300005436 Bacteria 2738
121 Ga0070713_100120596 3300005436 Bacteria 2299
122 Ga0070713_100140940 3300005436 Bacteria 2135
123 Ga0070713_100201076 3300005436 Bacteria 1799
124 Ga0070713_100249189 3300005436 Bacteria 1619
125 Ga0070713_100538581 3300005436 Bacteria 1105
126 Ga0070713_100766477 3300005436 Bacteria 924
127 Ga0070710_10003954 3300005437 Bacteria 7023
128 Ga0070701_10001447 3300005438 Bacteria 8796
129 Ga0070701_10014027 3300005438 Bacteria 3664
130 Ga0070701_10052667 3300005438 Bacteria 2115
131 Ga0070701_10072974 3300005438 Bacteria 1839
132 Ga0070711_100033186 3300005439 Bacteria 3436
133 Ga0070711_100042334 3300005439 Bacteria 3078
134 Ga0070711_100081215 3300005439 Bacteria 2310
135 Ga0070711_100111727 3300005439 Bacteria 2006
136 Ga0070705_100014389 3300005440 Bacteria 4068
137 Ga0070705_100219093 3300005440 Bacteria 1317
138 Ga0070700_100010178 3300005441 Bacteria 5185
139 Ga0070700_100011271 3300005441 Bacteria 4949
140 Ga0070694_100034125 3300005444 Bacteria 3353
141 Ga0070694_100316720 3300005444 Bacteria 1199
142 Ga0070694_100440471 3300005444 Bacteria 1027
143 Ga0070694_100511649 3300005444 Bacteria 957
144 Ga0070708_100162550 3300005445 Bacteria 2081
145 Ga0070663_100015960 3300005455 Bacteria 4863
146 Ga0070663_100048158 3300005455 Bacteria 3021
147 Ga0070663_100085275 3300005455 Bacteria 2330
148 Ga0070663_100127767 3300005455 Bacteria 1927
149 Ga0070663_100785481 3300005455 Bacteria 815
150 Ga0070678_100000090 3300005456 Bacteria 34718
151 Ga0070678_100040261 3300005456 Bacteria 3305
152 Ga0070678_100088267 3300005456 Bacteria 2370
153 Ga0070678_100162412 3300005456 Bacteria 1811
154 Ga0070678_100232850 3300005456 Bacteria 1536
155 Ga0070662_100042407 3300005457 Bacteria 3250
156 Ga0070662_100050569 3300005457 Bacteria 2998
157 Ga0070662_100105908 3300005457 Bacteria 2135
158 Ga0070662_100192539 3300005457 Bacteria 1614
159 Ga0070681_10032354 3300005458 Bacteria 5248
160 Ga0070681_10200388 3300005458 Bacteria 1914
161 Ga0070681_10247460 3300005458 Bacteria 1696
162 Ga0070681_10564977 3300005458 Bacteria 1051
163 Ga0070681_11009290 3300005458 Bacteria 752
164 Ga0068867_100008100 3300005459 Bacteria 7427
165 Ga0068867_100252836 3300005459 Bacteria 1434
166 Ga0068867_100414460 3300005459 Bacteria 1139
167 Ga0070685_10003606 3300005466 Bacteria 7854
168 Ga0070685_10004710 3300005466 Bacteria 6903
169 Ga0070685_10028131 3300005466 Bacteria 3113
170 Ga0070685_10061747 3300005466 Bacteria 2195
171 Ga0070706_100141717 3300005467 Bacteria 2244
172 Ga0070699_100369093 3300005518 Bacteria 1294
173 Ga0070679_100057812 3300005530 Bacteria 3865
174 Ga0070679_100158506 3300005530 Bacteria 2237
175 Ga0070679_100178646 3300005530 Bacteria 2095
176 Ga0070679_100197288 3300005530 Bacteria 1980
177 Ga0070679_100252262 3300005530 Bacteria 1720
178 Ga0070679_100332067 3300005530 Bacteria 1469
179 Ga0070684_100007412 3300005535 Bacteria 8526
180 Ga0070684_100010741 3300005535 Bacteria 7269
181 Ga0070697_100129350 3300005536 Bacteria 2117
182 Ga0068853_100011425 3300005539 Bacteria 7214
183 Ga0068853_100218038 3300005539 Bacteria 1741
184 Ga0068853_100238329 3300005539 Bacteria 1666
185 Ga0068853_100329417 3300005539 Bacteria 1417
186 Ga0070672_100003453 3300005543 Bacteria 10240
187 Ga0070672_100023218 3300005543 Bacteria 4569
188 Ga0070672_100377437 3300005543 Bacteria 1212
189 Ga0070686_100001736 3300005544 Bacteria 12183
190 Ga0070686_100012700 3300005544 Bacteria 4805
191 Ga0070686_100014361 3300005544 Bacteria 4565
192 Ga0070686_100039869 3300005544 Bacteria 2929
193 Ga0070686_100173841 3300005544 Bacteria 1525
194 Ga0070695_100117562 3300005545 Bacteria 1814
195 Ga0070695_100132327 3300005545 Bacteria 1720
196 Ga0070695_100442081 3300005545 Bacteria 995
197 Ga0070695_100628178 3300005545 Bacteria 846
198 Ga0070696_100037459 3300005546 Bacteria 3346
199 Ga0070696_100150142 3300005546 Bacteria 1710
200 Ga0070696_100349612 3300005546 Bacteria 1144
201 Ga0070693_100020625 3300005547 Bacteria 3479
202 Ga0070693_100078790 3300005547 Bacteria 1959
203 Ga0070665_100025741 3300005548 Bacteria 5927
204 Ga0070665_100083333 3300005548 Bacteria 3202
205 Ga0070665_100257373 3300005548 Bacteria 1747
206 Ga0070665_101067113 3300005548 Bacteria 819
207 Ga0070704_100013532 3300005549 Bacteria 5064
208 Ga0070704_100184961 3300005549 Bacteria 1670
209 Ga0070704_100220936 3300005549 Bacteria 1540
210 Ga0070704_100430988 3300005549 Bacteria 1131
211 Ga0068855_100029468 3300005563 Bacteria 6561
212 Ga0068855_100589779 3300005563 Bacteria 1200
213 Ga0068855_100719578 3300005563 Bacteria 1067
214 Ga0070664_100003492 3300005564 Bacteria 12699
215 Ga0070664_100029633 3300005564 Bacteria 4564
216 Ga0068857_100001853 3300005577 Bacteria 17029
217 Ga0068854_100051068 3300005578 Bacteria 2961
218 Ga0068854_100324849 3300005578 Bacteria 1252
219 Ga0068854_100909408 3300005578 Bacteria 774
220 Ga0068856_100000429 3300005614 Bacteria 46191
221 Ga0068856_100077570 3300005614 Bacteria 3292
222 Ga0068856_100174255 3300005614 Bacteria 2164
223 Ga0068856_100360392 3300005614 Bacteria 1473
224 Ga0068856_100578360 3300005614 Bacteria 1144
225 Ga0068856_100998077 3300005614 Bacteria 855
226 Ga0070702_100000021 3300005615 Bacteria 44632
227 Ga0070702_100012355 3300005615 Bacteria 4275
228 Ga0070702_100232408 3300005615 Bacteria 1240
229 Ga0068852_100079650 3300005616 Bacteria 2902
230 Ga0068859_100045661 3300005617 Bacteria 4401
231 Ga0068859_100187867 3300005617 Bacteria 2150
232 Ga0068864_100051399 3300005618 Bacteria 3550
233 Ga0068864_100074171 3300005618 Bacteria 2968
234 Ga0068864_100113244 3300005618 Bacteria 2418
235 Ga0068864_100581797 3300005618 Bacteria 1085
236 Ga0068866_10000919 3300005718 Bacteria 12924
237 Ga0068866_10018320 3300005718 Bacteria 3164
238 Ga0068866_10077263 3300005718 Bacteria 1778
239 Ga0068866_10207964 3300005718 Bacteria 1173
240 Ga0068861_100002149 3300005719 Bacteria 12765
241 Ga0068861_100067791 3300005719 Bacteria 2755
242 Ga0068861_100131007 3300005719 Bacteria 2036
243 Ga0068861_100196432 3300005719 Bacteria 1690
244 Ga0068861_100228759 3300005719 Bacteria 1576
245 Ga0068861_100783057 3300005719 Bacteria 894
246 Ga0068851_10359784 3300005834 Bacteria 848
247 Ga0068870_10000588 3300005840 Bacteria 13807
248 Ga0068870_10014308 3300005840 Bacteria 3746
249 Ga0068863_100001459 3300005841 Bacteria 23446
250 Ga0068863_100045935 3300005841 Bacteria 4145
251 Ga0068863_100244222 3300005841 Bacteria 1733
252 Ga0068858_100116038 3300005842 Bacteria 2502
253 Ga0068858_100302872 3300005842 Bacteria 1525
254 Ga0068858_100334154 3300005842 Bacteria 1449
255 Ga0068858_100615929 3300005842 Bacteria 1054
256 Ga0068860_100016194 3300005843 Bacteria 7272
257 Ga0068860_100020090 3300005843 Bacteria 6471
258 Ga0068860_100036305 3300005843 Bacteria 4723
259 Ga0068862_100036033 3300005844 Bacteria 4191
260 Ga0068862_100250035 3300005844 Bacteria 1615
261 Ga0081455_10000002 3300005937 Bacteria 460472
262 Ga0081455_10003269 3300005937 Bacteria 18754
263 Ga0081455_10003886 3300005937 Bacteria 17015
264 Ga0081455_10022547 3300005937 Bacteria 5884
265 Ga0081455_10120655 3300005937 Bacteria 2066
266 Ga0081455_10139546 3300005937 Bacteria 1884
267 Ga0081455_10194436 3300005937 Bacteria 1525
268 Ga0081540_1010355 3300005983 Bacteria 6324
269 Ga0081540_1031460 3300005983 Bacteria 2916
270 Ga0081539_10002901 3300005985 Bacteria 22688
271 Ga0070717_10001529 3300006028 Bacteria 16025
272 Ga0070717_10008327 3300006028 Bacteria 7743
273 Ga0070717_10233626 3300006028 Bacteria 1619
274 Ga0070717_10250189 3300006028 Bacteria 1565
275 Ga0075365_10001671 3300006038 Bacteria 10246
276 Ga0075365_10026637 3300006038 Bacteria 3672
277 Ga0075365_10095029 3300006038 Bacteria 2035
278 Ga0075365_10160523 3300006038 Bacteria 1566
279 Ga0075368_10028171 3300006042 Bacteria 2169
280 Ga0075363_100001378 3300006048 Bacteria 9157
281 Ga0075363_100012518 3300006048 Bacteria 4093
282 Ga0075363_100034923 3300006048 Bacteria 2627
283 Ga0075364_10005413 3300006051 Bacteria 7413
284 Ga0075364_10041419 3300006051 Bacteria 2991
285 Ga0075364_10470023 3300006051 Bacteria 859
286 Ga0070715_10000379 3300006163 Bacteria 11125
287 Ga0070715_10058215 3300006163 Bacteria 1686
288 Ga0070715_10069483 3300006163 Bacteria 1569
289 Ga0070715_10078723 3300006163 Bacteria 1491
290 Ga0070716_100041362 3300006173 Bacteria 2567
291 Ga0070716_100577985 3300006173 Bacteria 842
292 Ga0070712_100010590 3300006175 Bacteria 5823
293 Ga0070712_100171040 3300006175 Bacteria 1686
294 Ga0070712_100297739 3300006175 Bacteria 1305
295 Ga0075362_10010849 3300006177 Bacteria 3573
296 Ga0075362_10012472 3300006177 Bacteria 3378
297 Ga0075362_10209336 3300006177 Bacteria 951
298 Ga0075367_10001203 3300006178 Bacteria 10851
299 Ga0075367_10053037 3300006178 Bacteria 2402
300 Ga0075367_10127068 3300006178 Bacteria 1574
301 Ga0075369_10005459 3300006186 Bacteria 4753
302 Ga0075427_10000093 3300006194 Bacteria 7279
303 Ga0075366_10006427 3300006195 Bacteria 6440
304 Ga0075366_10031698 3300006195 Bacteria 3112
305 Ga0097621_100000012 3300006237 Bacteria 105108
306 Ga0097621_100032038 3300006237 Bacteria 4176
307 Ga0097621_100323904 3300006237 Bacteria 1365
308 Ga0097621_100354308 3300006237 Bacteria 1306
309 Ga0075370_10262301 3300006353 Bacteria 1025
310 Ga0068871_100000138 3300006358 Bacteria 46912
311 Ga0068871_100008692 3300006358 Bacteria 7306
312 Ga0068871_100087680 3300006358 Bacteria 2588
313 Ga0068871_100298467 3300006358 Bacteria 1413
314 Ga0075428_100036127 3300006844 Bacteria 5444
315 Ga0075428_100087699 3300006844 Bacteria 3394
316 Ga0075428_100161541 3300006844 Bacteria 2432
317 Ga0075428_100185144 3300006844 Bacteria 2253
318 Ga0075428_100233494 3300006844 Bacteria 1985
319 Ga0075428_100609429 3300006844 Bacteria 1166
320 Ga0075430_100000014 3300006846 Bacteria 90404
321 Ga0075430_100003974 3300006846 Bacteria 12467
322 Ga0075430_100009563 3300006846 Bacteria 8190
323 Ga0075430_100411982 3300006846 Bacteria 1116
324 Ga0075431_100005449 3300006847 Bacteria 12571
325 Ga0075431_100140324 3300006847 Bacteria 2491
326 Ga0075431_100163948 3300006847 Bacteria 2285
327 Ga0075433_10000100 3300006852 Bacteria 41448
328 Ga0075433_10038428 3300006852 Bacteria 4134
329 Ga0075433_10095241 3300006852 Bacteria 2634
330 Ga0075434_100018712 3300006871 Bacteria 6693
331 Ga0075434_100038552 3300006871 Bacteria 4732
332 Ga0075434_100045780 3300006871 Bacteria 4340
333 Ga0075434_100061573 3300006871 Bacteria 3734
334 Ga0075434_100075803 3300006871 Bacteria 3358
335 Ga0075434_100457505 3300006871 Bacteria 1297
336 Ga0075434_100830966 3300006871 Bacteria 940
337 Ga0075429_100004155 3300006880 Bacteria 12386
338 Ga0068865_100015586 3300006881 Bacteria 4849
339 Ga0068865_100104993 3300006881 Bacteria 2075
340 Ga0068865_100182872 3300006881 Bacteria 1615
341 Ga0075436_100111964 3300006914 Bacteria 1906
342 Ga0075436_100120146 3300006914 Bacteria 1838
343 Ga0075436_100135614 3300006914 Bacteria 1728
344 Ga0075436_100400398 3300006914 Bacteria 995
345 Ga0075436_100525802 3300006914 Bacteria 867
346 Ga0097620_100045654 3300006931 Bacteria 4401
347 Ga0097620_100187848 3300006931 Bacteria 2150
348 Ga0075435_100061289 3300007076 Bacteria 3052
349 Ga0075435_100067947 3300007076 Bacteria 2902
350 Ga0075435_100105192 3300007076 Bacteria 2342
351 Ga0075435_100267411 3300007076 Bacteria 1458
352 Ga0075435_100309827 3300007076 Bacteria 1351
353 Ga0075435_100392122 3300007076 Bacteria 1193
354 Ga0075435_100477353 3300007076 Bacteria 1077
355 Ga0099795_10004915 3300007788 Bacteria 3501
356 Ga0105251_10027453 3300009011 Bacteria 2886
357 Ga0105250_10038833 3300009092 Bacteria 1909
358 Ga0105250_10048561 3300009092 Bacteria 1702
359 Ga0105240_10020624 3300009093 Bacteria 8786
360 Ga0105240_10054015 3300009093 Bacteria 5037
361 Ga0105240_10538318 3300009093 Bacteria 1294
362 Ga0111539_10010658 3300009094 Bacteria 11577
363 Ga0111539_10031589 3300009094 Bacteria 6433
364 Ga0111539_10046646 3300009094 Bacteria 5182
365 Ga0111539_10107930 3300009094 Bacteria 3266
366 Ga0111539_10187325 3300009094 Bacteria 2416
367 Ga0111539_10207051 3300009094 Bacteria 2286
368 Ga0111539_10290381 3300009094 Bacteria 1903
369 Ga0111539_10394916 3300009094 Bacteria 1611
370 Ga0111539_10421369 3300009094 Bacteria 1555
371 Ga0111539_10725552 3300009094 Bacteria 1157
372 Ga0105245_10001132 3300009098 Bacteria 24118
373 Ga0105245_10028479 3300009098 Bacteria 4929
374 Ga0105245_10313858 3300009098 Bacteria 1542
375 Ga0105247_10011973 3300009101 Bacteria 5211
376 Ga0105247_10057718 3300009101 Bacteria 2400
377 Ga0105247_10089867 3300009101 Bacteria 1948
378 Ga0105247_10098594 3300009101 Bacteria 1865
379 Ga0114129_10002014 3300009147 Bacteria 27856
380 Ga0114129_10011877 3300009147 Bacteria 12386
381 Ga0114129_10019370 3300009147 Bacteria 9691
382 Ga0114129_10053795 3300009147 Bacteria 5646
383 Ga0114129_10078363 3300009147 Bacteria 4596
384 Ga0114129_10262075 3300009147 Bacteria 2316
385 Ga0114129_10321372 3300009147 Bacteria 2057
386 Ga0114129_10554657 3300009147 Bacteria 1494
387 Ga0105243_10021892 3300009148 Bacteria 4854
388 Ga0105243_10062102 3300009148 Bacteria 2990
389 Ga0105243_10216178 3300009148 Bacteria 1691
390 Ga0105243_10436681 3300009148 Bacteria 1225
391 Ga0105241_10009988 3300009174 Bacteria 6972
392 Ga0105241_10157156 3300009174 Bacteria 1866
393 Ga0105242_10000623 3300009176 Bacteria 27811
394 Ga0105242_10063821 3300009176 Bacteria 3034
395 Ga0105242_10089675 3300009176 Bacteria 2585
396 Ga0105242_10099801 3300009176 Bacteria 2458
397 Ga0105242_10543833 3300009176 Bacteria 1112
398 Ga0105248_10037821 3300009177 Bacteria 5400
399 Ga0105248_10080147 3300009177 Bacteria 3669
400 Ga0105248_10169653 3300009177 Bacteria 2459
401 Ga0105248_10180002 3300009177 Bacteria 2382
402 Ga0105248_10229032 3300009177 Bacteria 2092
403 Ga0105248_10508627 3300009177 Bacteria 1358
404 Ga0105237_10052924 3300009545 Bacteria 4073
405 Ga0105237_10103835 3300009545 Bacteria 2834
406 Ga0105237_10195426 3300009545 Bacteria 2023
407 Ga0105237_10477616 3300009545 Bacteria 1253
408 Ga0105237_10488024 3300009545 Bacteria 1238
409 Ga0105238_10006101 3300009551 Bacteria 11953
410 Ga0105238_10068460 3300009551 Bacteria 3551
411 Ga0105238_10083410 3300009551 Bacteria 3185
412 Ga0105249_10026638 3300009553 Bacteria 5212
413 Ga0105249_10084761 3300009553 Bacteria 2951
414 Ga0105249_10168270 3300009553 Bacteria 2124
415 Ga0105249_10172880 3300009553 Bacteria 2096
416 Ga0105249_10173692 3300009553 Bacteria 2091
417 Ga0105249_10228917 3300009553 Bacteria 1833
418 Ga0105249_11639760 3300009553 Bacteria 716
419 Ga0099796_10005106 3300010159 Bacteria 3247
420 Ga0105239_10029848 3300010375 Bacteria 5996
421 Ga0105239_10038880 3300010375 Bacteria 5212
422 Ga0105239_10048338 3300010375 Bacteria 4665
423 Ga0105239_10720401 3300010375 Bacteria 1141
424 Ga0105246_10001183 3300011119 Bacteria 15175
425 Ga0105246_10572213 3300011119 Bacteria 972
426 Ga0105246_10938328 3300011119 Bacteria 779
427 Ga0157373_10012880 3300013100 Bacteria 6140
428 Ga0157373_10246400 3300013100 Bacteria 1263
429 Ga0157373_10295000 3300013100 Bacteria 1150
430 Ga0157371_10057659 3300013102 Bacteria 2754
431 Ga0157371_10135387 3300013102 Bacteria 1754
432 Ga0157371_10595984 3300013102 Bacteria 822
433 Ga0157370_10108378 3300013104 Bacteria 2597
434 Ga0157370_10776615 3300013104 Bacteria 872
435 Ga0157369_10193404 3300013105 Bacteria 2137
436 Ga0157369_10423619 3300013105 Bacteria 1380
437 Ga0157374_10001601 3300013296 Bacteria 18992
438 Ga0157374_10124095 3300013296 Bacteria 2495
439 Ga0157374_10128465 3300013296 Bacteria 2451
440 Ga0157374_10422485 3300013296 Bacteria 1332
441 Ga0157374_10958114 3300013296 Bacteria 874
442 Ga0157378_10002020 3300013297 Bacteria 18147
443 Ga0157378_10133677 3300013297 Bacteria 2298
444 Ga0163162_10032396 3300013306 Bacteria 5191
445 Ga0163162_10114861 3300013306 Bacteria 2792
446 Ga0163162_10206623 3300013306 Bacteria 2093
447 Ga0163162_10208911 3300013306 Bacteria 2082
448 Ga0163162_10348941 3300013306 Bacteria 1613
449 Ga0157372_10288614 3300013307 Bacteria 1908
450 Ga0157375_10029102 3300013308 Bacteria 5190
451 Ga0157375_10044806 3300013308 Bacteria 4302
452 Ga0157375_10367402 3300013308 Bacteria 1605
453 Ga0157375_10782202 3300013308 Bacteria 1104
454 Ga0157375_10851229 3300013308 Bacteria 1058
455 Ga0157375_11170870 3300013308 Bacteria 901
456 Ga0163163_10049673 3300014325 Bacteria 4128
457 Ga0163163_10127282 3300014325 Bacteria 2585
458 Ga0163163_10157490 3300014325 Bacteria 2316
459 Ga0163163_10180826 3300014325 Bacteria 2156
460 Ga0163163_10341401 3300014325 Bacteria 1553
461 Ga0157380_10104618 3300014326 Bacteria 2365
462 Ga0157380_10182785 3300014326 Bacteria 1844
463 Ga0157380_10196047 3300014326 Bacteria 1787
464 Ga0157377_10000196 3300014745 Bacteria 33816
465 Ga0157377_10179011 3300014745 Bacteria 1332
466 Ga0157379_10021402 3300014968 Bacteria 5724
467 Ga0157379_10049072 3300014968 Bacteria 3768
468 Ga0157379_10151547 3300014968 Bacteria 2091
469 Ga0157379_10161364 3300014968 Bacteria 2023
470 Ga0157379_10677320 3300014968 Bacteria 967
471 Ga0157379_11012124 3300014968 Bacteria 792
472 Ga0157376_10000168 3300014969 Bacteria 45352
473 Ga0157376_10145651 3300014969 Bacteria 2130
474 Ga0157376_10162625 3300014969 Bacteria 2025
475 Ga0157376_10249994 3300014969 Bacteria 1655
476 Ga0163161_10000511 3300017792 Bacteria 31657
477 Ga0163161_10067114 3300017792 Bacteria 2620
478 Ga0163161_10102191 3300017792 Bacteria 2135
479 Ga0213874_10077144 3300021377 Bacteria 1073
480 Ga0213876_10067575 3300021384 Bacteria 1888
481 Ga0213876_10177992 3300021384 Bacteria 1131
482 Ga0207666_1000296 3300025271 Bacteria 7022
483 Ga0207673_1000056 3300025290 Bacteria 9521
484 Ga0207697_10006861 3300025315 Bacteria 5109
485 Ga0207697_10204838 3300025315 Bacteria 868
486 Ga0207713_1063657 3300025735 Bacteria 1392
487 Ga0207682_10000064 3300025893 Bacteria 46752
488 Ga0207682_10001593 3300025893 Bacteria 10438
489 Ga0207692_10026576 3300025898 Bacteria 2716
490 Ga0207692_10135720 3300025898 Bacteria 1394
491 Ga0207692_10155744 3300025898 Bacteria 1312
492 Ga0207642_10006630 3300025899 Bacteria 3862
493 Ga0207642_10029164 3300025899 Bacteria 2282
494 Ga0207710_10007378 3300025900 Bacteria 4658
495 Ga0207710_10012495 3300025900 Bacteria 3573
496 Ga0207688_10000117 3300025901 Bacteria 32379
497 Ga0207688_10000195 3300025901 Bacteria 26893
498 Ga0207688_10356869 3300025901 Bacteria 901
499 Ga0207680_10126150 3300025903 Bacteria 1681
500 Ga0207680_10127971 3300025903 Bacteria 1670
501 Ga0207680_10162594 3300025903 Bacteria 1498
502 Ga0207680_10164890 3300025903 Bacteria 1488
503 Ga0207680_10691915 3300025903 Bacteria 731
504 Ga0207647_10032286 3300025904 Bacteria 3366
505 Ga0207647_10112320 3300025904 Bacteria 1610
506 Ga0207685_10022403 3300025905 Bacteria 2135
507 Ga0207685_10044028 3300025905 Bacteria 1685
508 Ga0207685_10076764 3300025905 Bacteria 1370
509 Ga0207699_10101144 3300025906 Bacteria 1829
510 Ga0207699_10220282 3300025906 Bacteria 1295
511 Ga0207699_10236930 3300025906 Bacteria 1252
512 Ga0207699_10462537 3300025906 Bacteria 911
513 Ga0207699_10489897 3300025906 Bacteria 886
514 Ga0207645_10000040 3300025907 Bacteria 87876
515 Ga0207643_10000072 3300025908 Bacteria 65857
516 Ga0207643_10000291 3300025908 Bacteria 34985
517 Ga0207705_10551007 3300025909 Bacteria 896
518 Ga0207684_10084148 3300025910 Bacteria 2709
519 Ga0207654_10010446 3300025911 Bacteria 4728
520 Ga0207654_10045184 3300025911 Bacteria 2506
521 Ga0207654_10202484 3300025911 Bacteria 1308
522 Ga0207654_10239909 3300025911 Bacteria 1211
523 Ga0207654_10358344 3300025911 Bacteria 1006
524 Ga0207707_10003512 3300025912 Bacteria 13877
525 Ga0207707_10281862 3300025912 Bacteria 1439
526 Ga0207695_10432255 3300025913 Bacteria 1200
527 Ga0207671_10026718 3300025914 Bacteria 4322
528 Ga0207671_10324099 3300025914 Bacteria 1219
529 Ga0207693_10004617 3300025915 Bacteria 11623
530 Ga0207693_10005019 3300025915 Bacteria 11108
531 Ga0207693_10007075 3300025915 Bacteria 9262
532 Ga0207693_10021399 3300025915 Bacteria 5140
533 Ga0207693_10059962 3300025915 Bacteria 2981
534 Ga0207693_10111959 3300025915 Bacteria 2141
535 Ga0207693_10122397 3300025915 Bacteria 2043
536 Ga0207693_10122592 3300025915 Bacteria 2042
537 Ga0207693_10137568 3300025915 Bacteria 1921
538 Ga0207663_10102395 3300025916 Bacteria 1926
539 Ga0207663_10129151 3300025916 Bacteria 1743
540 Ga0207663_10529915 3300025916 Bacteria 918
541 Ga0207660_10003460 3300025917 Bacteria 10295
542 Ga0207660_10032727 3300025917 Bacteria 3590
543 Ga0207660_10206010 3300025917 Bacteria 1538
544 Ga0207660_10461750 3300025917 Bacteria 1028
545 Ga0207662_10010243 3300025918 Bacteria 5171
546 Ga0207662_10065808 3300025918 Bacteria 2183
547 Ga0207662_10261625 3300025918 Bacteria 1139
548 Ga0207657_10051887 3300025919 Bacteria 3563
549 Ga0207657_10075361 3300025919 Bacteria 2847
550 Ga0207657_10079987 3300025919 Bacteria 2748
551 Ga0207657_10125762 3300025919 Bacteria 2106
552 Ga0207657_10159561 3300025919 Bacteria 1832
553 Ga0207649_10000086 3300025920 Bacteria 79546
554 Ga0207652_10004335 3300025921 Bacteria 11560
555 Ga0207652_10148105 3300025921 Bacteria 2101
556 Ga0207652_10231094 3300025921 Bacteria 1667
557 Ga0207652_10384661 3300025921 Bacteria 1266
558 Ga0207646_10048472 3300025922 Bacteria 3808
559 Ga0207646_10995330 3300025922 Bacteria 741
560 Ga0207681_10000451 3300025923 Bacteria 28809
561 Ga0207694_10103727 3300025924 Bacteria 2255
562 Ga0207694_10297751 3300025924 Bacteria 1328
563 Ga0207694_10531258 3300025924 Bacteria 986
564 Ga0207650_10000972 3300025925 Bacteria 21558
565 Ga0207650_10008027 3300025925 Bacteria 7194
566 Ga0207650_10046577 3300025925 Bacteria 3193
567 Ga0207650_10201795 3300025925 Bacteria 1593
568 Ga0207659_10000478 3300025926 Bacteria 24069
569 Ga0207659_10027849 3300025926 Bacteria 3832
570 Ga0207659_10053244 3300025926 Bacteria 2886
571 Ga0207659_10060168 3300025926 Bacteria 2733
572 Ga0207659_10176572 3300025926 Bacteria 1689
573 Ga0207659_10210254 3300025926 Bacteria 1559
574 Ga0207687_10000144 3300025927 Bacteria 47356
575 Ga0207687_10005852 3300025927 Bacteria 8133
576 Ga0207687_10007800 3300025927 Bacteria 7021
577 Ga0207687_10017010 3300025927 Bacteria 4781
578 Ga0207687_10595119 3300025927 Bacteria 932
579 Ga0207700_10007883 3300025928 Bacteria 6551
580 Ga0207700_10010360 3300025928 Bacteria 5877
581 Ga0207700_10103349 3300025928 Bacteria 2278
582 Ga0207700_10209693 3300025928 Bacteria 1646
583 Ga0207700_10238468 3300025928 Bacteria 1549
584 Ga0207700_10246473 3300025928 Bacteria 1525
585 Ga0207700_10333255 3300025928 Bacteria 1317
586 Ga0207664_10052117 3300025929 Bacteria 3235
587 Ga0207664_10311302 3300025929 Bacteria 1387
588 Ga0207664_10558659 3300025929 Bacteria 1027
589 Ga0207644_10001694 3300025931 Bacteria 14217
590 Ga0207644_10007672 3300025931 Bacteria 7037
591 Ga0207644_10010699 3300025931 Bacteria 6050
592 Ga0207644_10028186 3300025931 Bacteria 3885
593 Ga0207690_10000086 3300025932 Bacteria 77995
594 Ga0207690_10071142 3300025932 Bacteria 2398
595 Ga0207690_10093526 3300025932 Bacteria 2131
596 Ga0207690_10204089 3300025932 Bacteria 1503
597 Ga0207690_10441232 3300025932 Bacteria 1045
598 Ga0207706_10013203 3300025933 Bacteria 7515
599 Ga0207706_10039372 3300025933 Bacteria 4190
600 Ga0207706_10186999 3300025933 Bacteria 1819
601 Ga0207686_10000287 3300025934 Bacteria 37285
602 Ga0207686_10026795 3300025934 Bacteria 3367
603 Ga0207686_10129282 3300025934 Bacteria 1730
604 Ga0207686_10196937 3300025934 Bacteria 1440
605 Ga0207709_10000431 3300025935 Bacteria 40052
606 Ga0207709_10044459 3300025935 Bacteria 2684
607 Ga0207709_10425584 3300025935 Bacteria 1021
608 Ga0207670_10010207 3300025936 Bacteria 5400
609 Ga0207670_10011186 3300025936 Bacteria 5199
610 Ga0207670_10061434 3300025936 Bacteria 2564
611 Ga0207670_10100941 3300025936 Bacteria 2061
612 Ga0207670_10165734 3300025936 Bacteria 1653
613 Ga0207670_10300161 3300025936 Bacteria 1257
614 Ga0207669_10000050 3300025937 Bacteria 60155
615 Ga0207669_10022824 3300025937 Bacteria 3330
616 Ga0207669_10171196 3300025937 Bacteria 1546
617 Ga0207669_10402567 3300025937 Bacteria 1072
618 Ga0207704_10000774 3300025938 Bacteria 14048
619 Ga0207704_10006265 3300025938 Bacteria 5533
620 Ga0207704_10014495 3300025938 Bacteria 3981
621 Ga0207704_10225989 3300025938 Bacteria 1388
622 Ga0207704_10464271 3300025938 Bacteria 1013
623 Ga0207665_10001033 3300025939 Bacteria 18741
624 Ga0207665_10016224 3300025939 Bacteria 4891
625 Ga0207665_10109746 3300025939 Bacteria 1937
626 Ga0207665_10545867 3300025939 Bacteria 900
627 Ga0207691_10002007 3300025940 Bacteria 19920
628 Ga0207691_10019090 3300025940 Bacteria 6493
629 Ga0207691_10020643 3300025940 Bacteria 6228
630 Ga0207711_10011783 3300025941 Bacteria 7263
631 Ga0207711_10036115 3300025941 Bacteria 4192
632 Ga0207711_10036907 3300025941 Bacteria 4147
633 Ga0207711_10041690 3300025941 Bacteria 3910
634 Ga0207689_10000115 3300025942 Bacteria 66254
635 Ga0207689_10002877 3300025942 Bacteria 15867
636 Ga0207689_10109931 3300025942 Bacteria 2265
637 Ga0207661_10000094 3300025944 Bacteria 56621
638 Ga0207661_10091112 3300025944 Bacteria 2540
639 Ga0207679_10000025 3300025945 Bacteria 203699
640 Ga0207679_10015384 3300025945 Bacteria 5055
641 Ga0207679_10340404 3300025945 Bacteria 1304
642 Ga0207679_10695165 3300025945 Bacteria 922
643 Ga0207679_10738468 3300025945 Bacteria 895
644 Ga0207667_10047924 3300025949 Bacteria 4520
645 Ga0207667_10957064 3300025949 Bacteria 845
646 Ga0207651_10000081 3300025960 Bacteria 42817
647 Ga0207651_10082069 3300025960 Bacteria 2326
648 Ga0207712_10000315 3300025961 Bacteria 44324
649 Ga0207712_10017744 3300025961 Bacteria 4627
650 Ga0207712_10097480 3300025961 Bacteria 2178
651 Ga0207668_10000098 3300025972 Bacteria 62195
652 Ga0207668_10240575 3300025972 Bacteria 1464
653 Ga0207640_10000104 3300025981 Bacteria 65093
654 Ga0207640_10067074 3300025981 Bacteria 2399
655 Ga0207640_10224233 3300025981 Bacteria 1441
656 Ga0207640_10287503 3300025981 Bacteria 1295
657 Ga0207658_10022108 3300025986 Bacteria 4424
658 Ga0207658_10043430 3300025986 Bacteria 3267
659 Ga0207658_10119607 3300025986 Bacteria 2097
660 Ga0207658_10264654 3300025986 Bacteria 1467
661 Ga0207677_10034106 3300026023 Bacteria 3292
662 Ga0207677_10137379 3300026023 Bacteria 1866
663 Ga0207677_10240490 3300026023 Bacteria 1464
664 Ga0207703_10046816 3300026035 Bacteria 3485
665 Ga0207703_10088275 3300026035 Bacteria 2602
666 Ga0207703_10483725 3300026035 Bacteria 1160
667 Ga0207639_10000954 3300026041 Bacteria 19615
668 Ga0207639_10112920 3300026041 Bacteria 2218
669 Ga0207639_10194149 3300026041 Bacteria 1736
670 Ga0207639_10281884 3300026041 Bacteria 1462
671 Ga0207639_10313196 3300026041 Bacteria 1391
672 Ga0207678_10001162 3300026067 Bacteria 24108
673 Ga0207678_10008097 3300026067 Bacteria 9269
674 Ga0207678_10009832 3300026067 Bacteria 8406
675 Ga0207678_10145462 3300026067 Bacteria 2023
676 Ga0207678_10380604 3300026067 Bacteria 1220
677 Ga0207708_10001029 3300026075 Bacteria 20873
678 Ga0207708_10019521 3300026075 Bacteria 5111
679 Ga0207708_10131875 3300026075 Bacteria 1954
680 Ga0207708_10252786 3300026075 Bacteria 1421
681 Ga0207708_10338657 3300026075 Bacteria 1231
682 Ga0207702_10002785 3300026078 Bacteria 16385
683 Ga0207702_10272978 3300026078 Bacteria 1596
684 Ga0207702_10277859 3300026078 Bacteria 1582
685 Ga0207702_10278883 3300026078 Bacteria 1579
686 Ga0207702_10919652 3300026078 Bacteria 867
687 Ga0207641_10000364 3300026088 Bacteria 53999
688 Ga0207641_10029516 3300026088 Bacteria 4536
689 Ga0207641_10036719 3300026088 Bacteria 4090
690 Ga0207648_10017434 3300026089 Bacteria 6534
691 Ga0207648_10023601 3300026089 Bacteria 5507
692 Ga0207648_10027119 3300026089 Bacteria 5088
693 Ga0207648_10213726 3300026089 Bacteria 1713
694 Ga0207648_10267297 3300026089 Bacteria 1527
695 Ga0207648_10408896 3300026089 Bacteria 1231
696 Ga0207676_10003923 3300026095 Bacteria 10503
697 Ga0207676_10004707 3300026095 Bacteria 9666
698 Ga0207676_10006878 3300026095 Bacteria 8058
699 Ga0207676_10246146 3300026095 Bacteria 1607
700 Ga0207676_10652954 3300026095 Bacteria 1015
701 Ga0207674_10019868 3300026116 Bacteria 7270
702 Ga0207674_10240199 3300026116 Bacteria 1758
703 Ga0207674_10713633 3300026116 Bacteria 968
704 Ga0207675_100002392 3300026118 Bacteria 18578
705 Ga0207675_100083025 3300026118 Bacteria 3005
706 Ga0207675_100142583 3300026118 Bacteria 2277
707 Ga0207675_100268304 3300026118 Bacteria 1656
708 Ga0207683_10000001 3300026121 Bacteria 352047
709 Ga0207683_10000918 3300026121 Bacteria 27095
710 Ga0207683_10004123 3300026121 Bacteria 12568
711 Ga0207683_10033169 3300026121 Bacteria 4484
712 Ga0207683_10082865 3300026121 Bacteria 2850
713 Ga0207698_10011125 3300026142 Bacteria 5817
714 Ga0207698_10731019 3300026142 Bacteria 987
715 Ga0209967_1004004 3300027364 Bacteria 1946
716 Ga0209984_1003477 3300027424 Bacteria 1807
717 Ga0209970_1007141 3300027614 Bacteria 1831
718 Ga0209983_1003280 3300027665 Bacteria 3473
719 Ga0209971_1003510 3300027682 Bacteria 3709
720 Ga0209966_1001211 3300027695 Bacteria 4595
721 Ga0209998_10012805 3300027717 Bacteria 1743
722 Ga0209998_10015130 3300027717 Bacteria 1613
723 Ga0209974_10045558 3300027876 Bacteria 1465
724 Ga0209974_10047488 3300027876 Bacteria 1438
725 Ga0207428_10000146 3300027907 Bacteria 95417
726 Ga0207428_10000221 3300027907 Bacteria 79234
727 Ga0207428_10000524 3300027907 Bacteria 45818
728 Ga0268266_10036070 3300028379 Bacteria 4207
729 Ga0268266_10064002 3300028379 Bacteria 3176
730 Ga0268266_10093484 3300028379 Bacteria 2638
731 Ga0268266_10213454 3300028379 Bacteria 1771
732 Ga0268265_10000350 3300028380 Bacteria 49940
733 Ga0268265_10205052 3300028380 Bacteria 1713
734 Ga0268265_10836915 3300028380 Bacteria 899
735 Ga0268264_10021698 3300028381 Bacteria 5243
736 Ga0268264_10136895 3300028381 Bacteria 2178
737 Ga0268264_10793015 3300028381 Bacteria 946
738 Ga0265337_1006088 3300028556 Bacteria 4698
739 Ga0265318_10016381 3300028577 Bacteria 3062
740 Ga0265338_10008028 3300028800 Bacteria 12916
741 Ga0265760_10044756 3300031090 Bacteria 1325
742 Ga0265760_10046630 3300031090 Bacteria 1300
743 Ga0265760_10058917 3300031090 Bacteria 1165
744 Ga0265760_10064269 3300031090 Bacteria 1119
745 Ga0265330_10100356 3300031235 Bacteria 1239
746 Ga0265332_10011248 3300031238 Bacteria 3979
747 Ga0265332_10017669 3300031238 Bacteria 3147
748 Ga0265325_10015013 3300031241 Bacteria 4365
749 Ga0265340_10031418 3300031247 Bacteria 2655
750 Ga0265339_10000096 3300031249 Bacteria 74964
751 Ga0265339_10021879 3300031249 Bacteria 3711
752 Ga0265316_10051989 3300031344 Bacteria 3216
753 Ga0307408_101063056 3300031548 Bacteria 749
754 Ga0265313_10000024 3300031595 Bacteria 138587
755 Ga0316575_10055211 3300031665 Bacteria 1582
756 Ga0265314_10283896 3300031711 Bacteria 935
757 Ga0265342_10000230 3300031712 Bacteria 62706
758 Ga0265342_10059320 3300031712 Bacteria 2260
759 Ga0316578_10066629 3300031728 Bacteria 2127
760 Ga0307406_11020210 3300031901 Bacteria 711
761 Ga0373930_0001414 3300034816 Bacteria 3560
762 Ga0373930_0004022 3300034816 Bacteria 2369
763 Ga0373948_0003227 3300034817 Bacteria 2489
764 Ga0373948_0032879 3300034817 Bacteria 1053
765 Ga0373950_0000233 3300034818 Bacteria 7281
766 Ga0373958_0000271 3300034819 Bacteria 6111
767 Ga0373958_0004321 3300034819 Bacteria 2099
768 Ga0373959_0002070 3300034820 Bacteria 3199
769 Ga0373938_0014635 3300034957 Bacteria 1509
770 Ga0373938_0019336 3300034957 Bacteria 1361
771 Ga0373938_0020613 3300034957 Bacteria 1329
772 Ga0373926_0006063 3300035083 Bacteria 4000
773 Ga0373928_0012174 3300035084 Bacteria 1712
774 Ga0373929_0000054 3300035085 Bacteria 20951
775 Ga0373934_0032784 3300035086 Bacteria 2038
776 Ga0373934_0033349 3300035086 Bacteria 2021
777 Ga0373940_0000308 3300035088 Bacteria 7071
778 Ga0373940_0001216 3300035088 Bacteria 4544
779 Ga0373940_0018543 3300035088 Bacteria 1748
780 Ga0373940_0051906 3300035088 Bacteria 1154
781 Ga0373944_0005528 3300035089 Bacteria 3330
782 Ga0373944_0009262 3300035089 Bacteria 2668
783 Ga0373944_0063225 3300035089 Bacteria 1191
784 Ga0373951_0006408 3300035091 Bacteria 2692
785 Ga0373951_0018048 3300035091 Bacteria 1601
786 Ga0373952_0001176 3300035092 Bacteria 4777
787 Ga0373952_0004129 3300035092 Bacteria 2624
788 Ga0373923_0007797 3300035111 Bacteria 3782
789 Ga0373923_0009424 3300035111 Bacteria 3522
790 Ga0373932_0000513 3300035112 Bacteria 11912
791 Ga0373932_0004289 3300035112 Bacteria 3384
792 Ga0373932_0004716 3300035112 Bacteria 3217
793 Ga0373936_0008189 3300035113 Bacteria 3929
794 Ga0373936_0060285 3300035113 Bacteria 1548
795 Ga0373936_0078942 3300035113 Bacteria 1367
796 Ga0373936_0269599 3300035113 Bacteria 763
797 Ga0373939_0000835 3300035114 Bacteria 7629
798 Ga0373939_0002022 3300035114 Bacteria 4843
799 Ga0373939_0002422 3300035114 Bacteria 4395
800 Ga0373939_0056971 3300035114 Bacteria 1232
801 Ga0373941_0000446 3300035115 Bacteria 8210
802 Ga0373941_0001331 3300035115 Bacteria 5199
803 Ga0373941_0018235 3300035115 Bacteria 1936
804 Ga0373945_0002888 3300035116 Bacteria 5396
805 Ga0373945_0026173 3300035116 Bacteria 2031
806 Ga0373953_0006422 3300035117 Bacteria 3871
807 Ga0373953_0022517 3300035117 Bacteria 2377
808 Ga0373953_0027003 3300035117 Bacteria 2203
809 Ga0373953_0053410 3300035117 Bacteria 1638
810 Ga0373954_0005543 3300035118 Bacteria 5465
811 Ga0373954_0019638 3300035118 Bacteria 3050
812 Ga0373954_0097191 3300035118 Bacteria 1419
813 Ga0373954_0150530 3300035118 Bacteria 1137
814 Ga0373956_0001402 3300035119 Bacteria 9970
815 Ga0373956_0058468 3300035119 Bacteria 1743
816 Ga0373956_0134111 3300035119 Bacteria 1161
817 Ga0373957_0001296 3300035120 Bacteria 6707
818 Ga0373957_0024719 3300035120 Bacteria 2159
819 Ga0373957_0169052 3300035120 Bacteria 903
820 Ga0373960_0001375 3300035121 Bacteria 5368
821 Ga0373960_0010662 3300035121 Bacteria 2249
822 Ga0373943_0000604 3300035170 Bacteria 15625
823 Ga0373943_0039468 3300035170 Bacteria 2274
824 Ga0373943_0047410 3300035170 Bacteria 2100
825 Ga0373943_0057544 3300035170 Bacteria 1932
826 Ga0373943_0062098 3300035170 Bacteria 1869
827 Ga0373943_0080638 3300035170 Bacteria 1668
828 Ga0373946_0003645 3300035171 Bacteria 5455
829 Ga0373946_0026555 3300035171 Bacteria 2285
830 Ga0373946_0029375 3300035171 Bacteria 2188
831 Ga0373946_0087903 3300035171 Bacteria 1372
832 Ga0373946_0114705 3300035171 Bacteria 1223
833 Ga0373955_0001931 3300035172 Bacteria 8945
834 Ga0373955_0069643 3300035172 Bacteria 1963
835 Ga0373955_0233880 3300035172 Bacteria 1100
836 Ga0373955_0277221 3300035172 Bacteria 1008
837 Ga0373942_0001024 3300035207 Bacteria 7615
838 Ga0373942_0002937 3300035207 Bacteria 4040
839 Ga0373942_0086196 3300035207 Bacteria 940
840 Ga0373961_0000356 3300035241 Bacteria 19781
841 Ga0373961_0014739 3300035241 Bacteria 1989
842 Ga0373962_0016277 3300035242 Bacteria 1916
843 Ga0373962_0017415 3300035242 Bacteria 1862
844 Ga0373924_0005132 3300035410 Bacteria 4621
845 Ga0373931_0000593 3300035691 Bacteria 14946
846 Ga0373931_0007758 3300035691 Bacteria 5068
847 Ga0373931_0022947 3300035691 Bacteria 3145
848 Ga0373931_0030252 3300035691 Bacteria 2786
849 Ga0373931_0145219 3300035691 Bacteria 1378
850 Ga0373935_0001442 3300035692 Bacteria 13189
851 Ga0373935_0012660 3300035692 Bacteria 5076
852 Ga0373935_0097321 3300035692 Bacteria 1935
853 Ga0373935_0114225 3300035692 Bacteria 1796
854 Ga0373935_0143522 3300035692 Bacteria 1614
855 Ga0373935_0375206 3300035692 Bacteria 1018
856 Ga0373935_0508065 3300035692 Bacteria 875
857 Ga0373927_0002603 3300035695 Bacteria 13149
858 Ga0373927_0007920 3300035695 Bacteria 7176
859 Ga0373927_0008533 3300035695 Bacteria 6893
860 Ga0373927_0008946 3300035695 Bacteria 6725
861 Ga0373927_0041540 3300035695 Bacteria 2982
862 Ga0373927_0085335 3300035695 Bacteria 2049
863 Ga0373927_0221080 3300035695 Bacteria 1244
864 Ga0373927_0449996 3300035695 Bacteria 850
865 Ga0373933_0001968 3300035724 Bacteria 11834
866 Ga0373933_0064420 3300035724 Bacteria 2217
867 Ga0373933_0085482 3300035724 Bacteria 1940
868 Ga0373933_0108034 3300035724 Bacteria 1733
869 Ga0373933_0254034 3300035724 Bacteria 1132
870 Ga0373933_0439949 3300035724 Bacteria 852
871 Ga0373947_0000168 3300035725 Bacteria 35315
872 Ga0373947_0009446 3300035725 Bacteria 5600
873 Ga0373947_0011068 3300035725 Bacteria 5178
874 Ga0373947_0088433 3300035725 Bacteria 1928
875 Ga0373947_0166258 3300035725 Bacteria 1429
876 Ga0373947_0230637 3300035725 Bacteria 1219
877 Ga0373947_0378566 3300035725 Bacteria 953
878 Ga0373947_0469169 3300035725 Bacteria 853
879 Ga0373937_0000814 3300036401 Bacteria 26684
880 Ga0373937_0001859 3300036401 Bacteria 17748
881 Ga0373937_0002452 3300036401 Bacteria 15416
882 Ga0373937_0033958 3300036401 Bacteria 4637
883 Ga0373937_0117315 3300036401 Bacteria 2479
884 Ga0373937_0120795 3300036401 Bacteria 2441
885 Ga0373937_0148066 3300036401 Bacteria 2198
886 Ga0373937_0289058 3300036401 Bacteria 1549
887 Ga0316584_0005534 3300036712 Bacteria 8489
888 Ga0316584_0120026 3300036712 Bacteria 1965
889 Ga0373925_0013667 3300037068 Bacteria 5879
890 Ga0373925_0017035 3300037068 Bacteria 5260
891 Ga0373925_0044216 3300037068 Bacteria 3307
892 Ga0373925_0075111 3300037068 Bacteria 2560
893 Ga0373925_0251594 3300037068 Bacteria 1417
894 Ga0373925_0486544 3300037068 Bacteria 1012
895 Ga0395899_0008835 3300037312 Bacteria 7756
896 Ga0395899_0204640 3300037312 Bacteria 1374
897 Ga0395899_0249719 3300037312 Bacteria 1218
898 Ga0395899_0538303 3300037312 Bacteria 752
899 Ga0395900_0000709 3300037418 Bacteria 44342
900 Ga0395900_0103524 3300037418 Bacteria 2924
901 Ga0395900_0164184 3300037418 Bacteria 2264
902 Ga0395900_1010770 3300037418 Bacteria 751
903 Ga0395898_0023683 3300037466 Bacteria 6198
904 Ga0395898_0072915 3300037466 Bacteria 3316
905 Ga0395898_0083680 3300037466 Bacteria 3075
906 Ga0395898_0508850 3300037466 Bacteria 1145
907 Ga0395905_0120346 3300037471 Bacteria 2468
908 Ga0436364_0671098 3300037853 Bacteria 1085
909 Ga0436364_1035362 3300037853 Bacteria 2326
910 Ga0395901_0011960 3300038443 Bacteria 8800
911 Ga0395901_0207765 3300038443 Bacteria 2050
912 Ga0395901_0635086 3300038443 Bacteria 1073
913 Ga0395901_1117792 3300038443 Bacteria 758
914 Ga0436365_0909129 3300039437 Bacteria 1965
915 Ga0436360_0063464 3300039438 Bacteria 1240
916 Ga0436360_0067730 3300039438 Bacteria 940
917 Ga0436361_0174670 3300039447 Bacteria 866
918 Ga0436361_0329200 3300039447 Bacteria 2074
919 Ga0436361_0825759 3300039447 Bacteria 3160
920 Ga0436363_0431026 3300039450 Bacteria 1086
921 Ga0436363_0450495 3300039450 Bacteria 3991
922 Ga0436363_0738257 3300039450 Bacteria 1823
923 Ga0451793_1911136 3300041452 Bacteria 1506
924 Ga0439445_0129412 3300042004 Bacteria 728
925 Ga0439450_006590 3300042008 Bacteria 2096
926 Ga0439455_0004874 3300042012 Bacteria 2690
927 Ga0439464_0038648 3300042439 Bacteria 1355
928 Ga0439460_0008770 3300042461 Bacteria 2557
929 Ga0451577_0026107 3300042876 Bacteria 5292
930 Ga0439440_0007658 3300042993 Bacteria 2200
931 Ga0466963_0033242 3300044694 Bacteria 3346
932 Ga0453684_0049507 3300044712 Bacteria 5541
933 Ga0466957_0061173 3300044842 Bacteria 2310
934 Ga0451576_0225795 3300045051 Bacteria 1955
935 Ga0466958_0085752 3300045836 Bacteria 1943
936 Ga0466967_0001077 3300045976 Bacteria 15096
937 Ga0495592_0011257 3300046454 Bacteria 6764
938 Ga0495592_0016998 3300046454 Bacteria 5523
939 Ga0495592_0060432 3300046454 Bacteria 2787
940 Ga0495592_0095181 3300046454 Bacteria 2130
941 Ga0495592_0118079 3300046454 Bacteria 1869
942 Ga0495592_0134747 3300046454 Bacteria 1724
943 Ga0495592_0202512 3300046454 Bacteria 1338
944 Ga0495591_020020 3300046458 Bacteria 2223
945 Ga0495629_0000230 3300046459 Bacteria 49922
946 Ga0495629_0001246 3300046459 Bacteria 19991
947 Ga0495629_0062243 3300046459 Bacteria 2607
948 Ga0495629_0086466 3300046459 Bacteria 2187
949 Ga0495629_0113085 3300046459 Bacteria 1892
950 Ga0495629_0206469 3300046459 Bacteria 1357
951 Ga0495629_0249472 3300046459 Bacteria 1221
952 Ga0495641_0021558 3300046461 Bacteria 3240
953 Ga0495641_0027803 3300046461 Bacteria 2744
954 Ga0495641_0124457 3300046461 Bacteria 1150
955 Ga0495641_0217734 3300046461 Bacteria 856
956 Ga0495651_0000514 3300046462 Bacteria 30081
957 Ga0495651_0015536 3300046462 Bacteria 5890
958 Ga0495651_0038788 3300046462 Bacteria 3709
959 Ga0495651_0163357 3300046462 Bacteria 1593
960 Ga0495653_0000928 3300046463 Bacteria 22666
961 Ga0495653_0017250 3300046463 Bacteria 5872
962 Ga0495653_0019183 3300046463 Bacteria 5548
963 Ga0495650_0024137 3300046471 Bacteria 2877
964 Ga0495580_0021820 3300046472 Bacteria 4722
965 Ga0495580_0022796 3300046472 Bacteria 4603
966 Ga0495580_0107751 3300046472 Bacteria 1935
967 Ga0495580_0113425 3300046472 Bacteria 1883
968 Ga0495580_0182045 3300046472 Bacteria 1451
969 Ga0495582_0013255 3300046473 Bacteria 4537
970 Ga0495582_0028396 3300046473 Bacteria 3070
971 Ga0495582_0241590 3300046473 Bacteria 1035
972 Ga0495582_0284537 3300046473 Bacteria 950
973 Ga0495605_0034824 3300046474 Bacteria 2548
974 Ga0495639_0237218 3300046475 Bacteria 899
975 Ga0495662_0008984 3300046476 Bacteria 4907
976 Ga0495662_0122940 3300046476 Bacteria 1274
977 Ga0495662_0131930 3300046476 Bacteria 1228
978 Ga0495662_0231796 3300046476 Bacteria 910
979 Ga0495664_0012425 3300046477 Bacteria 4823
980 Ga0495664_0021800 3300046477 Bacteria 3702
981 Ga0495664_0025369 3300046477 Bacteria 3450
982 Ga0495664_0037733 3300046477 Bacteria 2852
983 Ga0495664_0085136 3300046477 Bacteria 1898
984 Ga0495664_0089763 3300046477 Bacteria 1847
985 Ga0495664_0143878 3300046477 Bacteria 1446
986 Ga0495584_0038768 3300046491 Bacteria 2408
987 Ga0495584_0087774 3300046491 Bacteria 1568
988 Ga0495585_0012824 3300046492 Bacteria 4929
989 Ga0495585_0171157 3300046492 Bacteria 1122
990 Ga0495594_0080692 3300046499 Bacteria 1816
991 Ga0495607_0028730 3300046501 Bacteria 3427
992 Ga0495608_0000211 3300046511 Bacteria 41989
993 Ga0495608_0013911 3300046511 Bacteria 5584
994 Ga0495608_0017291 3300046511 Bacteria 4989
995 Ga0495608_0028242 3300046511 Bacteria 3813
996 Ga0495616_0116940 3300046513 Bacteria 1234
997 Ga0495618_0004258 3300046514 Bacteria 8827
998 Ga0495618_0007886 3300046514 Bacteria 6444
999 Ga0495618_0061862 3300046514 Bacteria 2375
1000 Ga0495618_0087832 3300046514 Bacteria 1988
1001 Ga0495628_0001017 3300046516 Bacteria 25597
1002 Ga0495628_0058738 3300046516 Bacteria 3021
1003 Ga0495628_0060309 3300046516 Bacteria 2976
1004 Ga0495628_0242728 3300046516 Bacteria 1347
1005 Ga0495628_0581616 3300046516 Bacteria 801
1006 Ga0495630_0030857 3300046517 Bacteria 3989
1007 Ga0495630_0033639 3300046517 Bacteria 3823
1008 Ga0495630_0047187 3300046517 Bacteria 3221
1009 Ga0495630_0310397 3300046517 Bacteria 1205
1010 Ga0495630_0429917 3300046517 Bacteria 1012
1011 Ga0495637_0017568 3300046520 Bacteria 3331
1012 Ga0495643_0152182 3300046522 Bacteria 1145
1013 Ga0495644_0000207 3300046523 Bacteria 27708
1014 Ga0495663_0108428 3300046525 Bacteria 921
1015 Ga0495666_0008778 3300046526 Bacteria 5064
1016 Ga0495666_0057605 3300046526 Bacteria 1860
1017 Ga0495652_0009353 3300046529 Bacteria 8906
1018 Ga0495652_0010381 3300046529 Bacteria 8440
1019 Ga0495652_0049242 3300046529 Bacteria 3608
1020 Ga0495652_0053555 3300046529 Bacteria 3438
1021 Ga0495652_0181217 3300046529 Bacteria 1616
1022 Ga0495652_0399323 3300046529 Bacteria 974
1023 Ga0495665_0005144 3300046531 Bacteria 7053
1024 Ga0495665_0029177 3300046531 Bacteria 2956
1025 Ga0495640_0002965 3300046533 Bacteria 13663
1026 Ga0495640_0025900 3300046533 Bacteria 4247
1027 Ga0495640_0058225 3300046533 Bacteria 2635
1028 Ga0495640_0088902 3300046533 Bacteria 2041
1029 Ga0495640_0153154 3300046533 Bacteria 1480
1030 Ga0495587_0003782 3300046536 Bacteria 10043
1031 Ga0495587_0012005 3300046536 Bacteria 5471
1032 Ga0495587_0012054 3300046536 Bacteria 5460
1033 Ga0495587_0038988 3300046536 Bacteria 2846
1034 Ga0495598_0102915 3300046537 Bacteria 947
1035 Ga0495609_0024001 3300046538 Bacteria 2799
1036 Ga0495609_0025772 3300046538 Bacteria 2694
1037 Ga0495621_0053497 3300046539 Bacteria 1449
1038 Ga0495645_0005364 3300046543 Bacteria 8790
1039 Ga0495645_0025415 3300046543 Bacteria 4297
1040 Ga0495645_0035601 3300046543 Bacteria 3628
1041 Ga0495645_0061742 3300046543 Bacteria 2715
1042 Ga0495645_0526320 3300046543 Bacteria 736
1043 Ga0495622_0032721 3300046557 Bacteria 2427
1044 Ga0495633_0007791 3300046558 Bacteria 6120
1045 Ga0495633_0320059 3300046558 Bacteria 704
1046 Ga0495667_0004263 3300046559 Bacteria 9640
1047 Ga0495667_0019341 3300046559 Bacteria 4595
1048 Ga0495667_0030062 3300046559 Bacteria 3653
1049 Ga0495667_0039123 3300046559 Bacteria 3155
1050 Ga0495667_0068781 3300046559 Bacteria 2312
1051 Ga0495667_0113311 3300046559 Bacteria 1752
1052 Ga0495667_0453675 3300046559 Bacteria 805
1053 Ga0495656_0000115 3300046615 Bacteria 31179
1054 Ga0495656_0168039 3300046615 Bacteria 1070
1055 Ga0495668_0192854 3300046616 Bacteria 1116
1056 Ga0495634_0016926 3300046642 Bacteria 5207
1057 Ga0495634_0030683 3300046642 Bacteria 3709
1058 Ga0495634_0043090 3300046642 Bacteria 3059
1059 Ga0495634_0098548 3300046642 Bacteria 1891
1060 Ga0495634_0136460 3300046642 Bacteria 1560
1061 Ga0495634_0218727 3300046642 Bacteria 1177
1062 Ga0495611_0000905 3300046648 Bacteria 16099
1063 Ga0495611_0141749 3300046648 Bacteria 1122
1064 Ga0495635_0011378 3300046663 Bacteria 6240
1065 Ga0495635_0023649 3300046663 Bacteria 4280
1066 Ga0495635_0024578 3300046663 Bacteria 4199
1067 Ga0495635_0026118 3300046663 Bacteria 4066
1068 Ga0495635_0118612 3300046663 Bacteria 1805
1069 Ga0495635_0361528 3300046663 Bacteria 967
1070 Ga0495635_0470423 3300046663 Bacteria 829
1071 Ga0495659_0000545 3300046664 Bacteria 13925
1072 Ga0495659_0012800 3300046664 Bacteria 2724
1073 Ga0495659_0214901 3300046664 Bacteria 792
1074 Ga0495588_0030812 3300046674 Bacteria 2697
1075 Ga0495657_0008566 3300046675 Bacteria 7812
1076 Ga0495657_0017487 3300046675 Bacteria 5203
1077 Ga0495657_0075843 3300046675 Bacteria 2185
1078 Ga0495599_0029916 3300046678 Bacteria 3416
1079 Ga0495599_0036753 3300046678 Bacteria 3076
1080 Ga0495599_0095308 3300046678 Bacteria 1856
1081 Ga0495623_0002503 3300046679 Bacteria 12172
1082 Ga0495623_0002644 3300046679 Bacteria 11821
1083 Ga0495623_0034441 3300046679 Bacteria 3247
1084 Ga0495646_0011541 3300046680 Bacteria 5609
1085 Ga0495646_0037089 3300046680 Bacteria 3017
1086 Ga0495646_0039108 3300046680 Bacteria 2926
1087 Ga0495646_0069665 3300046680 Bacteria 2074
1088 Ga0495647_0002731 3300046681 Bacteria 5599
1089 Ga0495647_0005717 3300046681 Bacteria 4089
1090 Ga0495647_0020426 3300046681 Bacteria 2377
1091 Ga0495658_0006761 3300046683 Bacteria 5643
1092 Ga0495658_0019872 3300046683 Bacteria 3513
1093 Ga0495658_0038304 3300046683 Bacteria 2654
1094 Ga0495658_0131430 3300046683 Bacteria 1524
1095 Ga0495669_0035049 3300046684 Bacteria 2215
1096 Ga0495613_0045913 3300046689 Bacteria 3230
1097 Ga0495613_0047306 3300046689 Bacteria 3178
1098 Ga0495613_0101469 3300046689 Bacteria 2078
1099 Ga0495613_0222408 3300046689 Bacteria 1325
1100 Ga0495613_0264799 3300046689 Bacteria 1196
1101 Ga0495624_0004214 3300046690 Bacteria 10559
1102 Ga0495624_0067263 3300046690 Bacteria 2235
1103 Ga0495670_0000652 3300046691 Bacteria 16575
1104 Ga0495671_0155040 3300046692 Bacteria 1115
1105 Ga0495671_0314924 3300046692 Bacteria 752
1106 Ga0495649_0030157 3300046694 Bacteria 2996
1107 Ga0495600_0000802 3300046809 Bacteria 16650
1108 Ga0495600_0004409 3300046809 Bacteria 8417
1109 Ga0495600_0057523 3300046809 Bacteria 2539
1110 Ga0495600_0112870 3300046809 Bacteria 1769
1111 Ga0495600_0170895 3300046809 Bacteria 1403
1112 Ga0495581_0123148 3300047315 Bacteria 1509
1113 Ga0495604_0000360 3300047317 Bacteria 40805
1114 Ga0495604_0013734 3300047317 Bacteria 6457
1115 Ga0495604_0021779 3300047317 Bacteria 5116
1116 Ga0495604_0029690 3300047317 Bacteria 4349
1117 Ga0495604_0044072 3300047317 Bacteria 3489
1118 Ga0495604_0098888 3300047317 Bacteria 2148
1119 Ga0495604_0288534 3300047317 Bacteria 1106
1120 Ga0495674_0008238 3300047319 Bacteria 9945
1121 Ga0495674_0020349 3300047319 Bacteria 6144
1122 Ga0495674_0027922 3300047319 Bacteria 5153
1123 Ga0495674_0119139 3300047319 Bacteria 2231
1124 Ga0495674_0302464 3300047319 Bacteria 1306
1125 Ga0495674_0387673 3300047319 Bacteria 1129
1126 Ga0495676_0029954 3300047321 Bacteria 4626
1127 Ga0495676_0088439 3300047321 Bacteria 2323
1128 Ga0495676_0145853 3300047321 Bacteria 1691
1129 Ga0495676_0257412 3300047321 Bacteria 1188
1130 Ga0495680_0000313 3300047322 Bacteria 54486
1131 Ga0495680_0008135 3300047322 Bacteria 9559
1132 Ga0495680_0009019 3300047322 Bacteria 9012
1133 Ga0495680_0009794 3300047322 Bacteria 8594
1134 Ga0495680_0012298 3300047322 Bacteria 7542
1135 Ga0495680_0021698 3300047322 Bacteria 5371
1136 Ga0495683_0097902 3300047323 Bacteria 1414
1137 Ga0495675_0002612 3300047444 Bacteria 10794
1138 Ga0495675_0005504 3300047444 Bacteria 7726
1139 Ga0495675_0023436 3300047444 Bacteria 3933
1140 Ga0495675_0090715 3300047444 Bacteria 1918
1141 Ga0495679_045429 3300047446 Bacteria 1342
1142 Ga0495684_0006921 3300047471 Bacteria 8805
1143 Ga0495684_0012904 3300047471 Bacteria 6449
1144 Ga0495684_0028950 3300047471 Bacteria 4250
1145 Ga0495684_0037199 3300047471 Bacteria 3733
1146 Ga0495684_0154521 3300047471 Bacteria 1714
1147 Ga0495684_0218035 3300047471 Bacteria 1400
1148 Ga0495684_0404979 3300047471 Bacteria 957
1149 Ga0495684_0595589 3300047471 Bacteria 746
1150 Ga0495593_0009519 3300047673 Bacteria 5637
1151 Ga0495593_0010594 3300047673 Bacteria 5318
1152 Ga0495593_0013212 3300047673 Bacteria 4714
1153 Ga0495593_0023469 3300047673 Bacteria 3429
1154 Ga0495593_0043909 3300047673 Bacteria 2393
1155 Ga0495602_0005154 3300048088 Bacteria 13692
1156 Ga0495602_0010330 3300048088 Bacteria 9691
1157 Ga0495602_0033303 3300048088 Bacteria 4836
1158 Ga0495614_0008099 3300048089 Bacteria 4674
1159 Ga0495614_0170827 3300048089 Bacteria 975
1160 Ga0495614_0220273 3300048089 Bacteria 862
1161 Ga0496100_0000330 3300048903 Bacteria 23211
1162 Ga0496100_0009383 3300048903 Bacteria 5499
1163 Ga0496100_0023823 3300048903 Bacteria 3725
1164 Ga0496100_0029006 3300048903 Bacteria 3418
1165 Ga0496100_0077564 3300048903 Bacteria 2234
1166 Ga0496100_0145774 3300048903 Bacteria 1683
1167 Ga0496100_0308741 3300048903 Bacteria 1185
1168 Ga0496101_0000079 3300048904 Bacteria 107673
1169 Ga0496101_0023269 3300048904 Bacteria 4278
1170 Ga0496101_0118402 3300048904 Bacteria 2000
1171 Ga0496101_0122285 3300048904 Bacteria 1969
1172 Ga0496101_0207779 3300048904 Bacteria 1516
1173 Ga0496102_0011543 3300048905 Bacteria 7621
1174 Ga0496102_0016791 3300048905 Bacteria 6401
1175 Ga0496102_0150356 3300048905 Bacteria 2188
1176 Ga0496102_0330576 3300048905 Bacteria 1435
1177 Ga0496103_0033302 3300048906 Bacteria 3147
1178 Ga0496103_0053360 3300048906 Bacteria 2505
1179 Ga0496103_0082012 3300048906 Bacteria 2029
1180 Ga0496103_0143933 3300048906 Bacteria 1525
1181 Ga0496103_0533931 3300048906 Bacteria 749
1182 Ga0496104_0002973 3300048907 Bacteria 14606
1183 Ga0496104_0004496 3300048907 Bacteria 12147
1184 Ga0496104_0006726 3300048907 Bacteria 10123
1185 Ga0496104_0032893 3300048907 Bacteria 4827
1186 Ga0496104_0055353 3300048907 Bacteria 3751
1187 Ga0496104_0237208 3300048907 Bacteria 1735
1188 Ga0496104_0264241 3300048907 Bacteria 1633
1189 Ga0496104_0458661 3300048907 Bacteria 1186
1190 Ga0496105_0000168 3300048908 Bacteria 43805
1191 Ga0496105_0006753 3300048908 Bacteria 8823
1192 Ga0496105_0013976 3300048908 Bacteria 6384
1193 Ga0496105_0074656 3300048908 Bacteria 2801
1194 Ga0496105_0083503 3300048908 Bacteria 2638
1195 Ga0496105_0096415 3300048908 Bacteria 2442
1196 Ga0496105_0108576 3300048908 Bacteria 2291
1197 Ga0496105_0254264 3300048908 Bacteria 1423
1198 Ga0496106_0006208 3300048909 Bacteria 8839
1199 Ga0496106_0029911 3300048909 Bacteria 4060
1200 Ga0496106_0038114 3300048909 Bacteria 3596
1201 Ga0496106_0040359 3300048909 Bacteria 3495
1202 Ga0496106_0054441 3300048909 Bacteria 3023
1203 Ga0496106_0092676 3300048909 Bacteria 2334
1204 Ga0496106_0112137 3300048909 Bacteria 2124
1205 Ga0496106_0155878 3300048909 Bacteria 1803
1206 Ga0496106_0439510 3300048909 Bacteria 1048
1207 Ga0496106_0461549 3300048909 Bacteria 1020
1208 Ga0496106_0844964 3300048909 Bacteria 725
1209 Ga0496107_0000143 3300048910 Bacteria 35680
1210 Ga0496107_0018391 3300048910 Bacteria 4920
1211 Ga0496107_0031013 3300048910 Bacteria 3811
1212 Ga0496107_0066654 3300048910 Bacteria 2610
1213 Ga0496107_0144818 3300048910 Bacteria 1756
1214 Ga0496107_0189071 3300048910 Bacteria 1530
1215 Ga0496107_0489529 3300048910 Bacteria 912
1216 Ga0496108_0000698 3300048911 Bacteria 26059
1217 Ga0496108_0002282 3300048911 Bacteria 15367
1218 Ga0496108_0079539 3300048911 Bacteria 2776
1219 Ga0496108_0105543 3300048911 Bacteria 2405
1220 Ga0496108_0127622 3300048911 Bacteria 2185
1221 Ga0496108_0168884 3300048911 Bacteria 1892
1222 Ga0496109_0000372 3300048912 Bacteria 40804
1223 Ga0496109_0001273 3300048912 Bacteria 20907
1224 Ga0496109_0060513 3300048912 Bacteria 3460
1225 Ga0496109_0067473 3300048912 Bacteria 3277
1226 Ga0496109_0087794 3300048912 Bacteria 2873
1227 Ga0496109_0098090 3300048912 Bacteria 2717
1228 Ga0496109_0192314 3300048912 Bacteria 1917
1229 Ga0496109_0234404 3300048912 Bacteria 1727
1230 Ga0496110_0026148 3300048913 Bacteria 4991
1231 Ga0496110_0046987 3300048913 Bacteria 3778
1232 Ga0496110_0060214 3300048913 Bacteria 3347
1233 Ga0496110_0183648 3300048913 Bacteria 1899
1234 Ga0496110_0188174 3300048913 Bacteria 1875
1235 Ga0496110_0355062 3300048913 Bacteria 1335
1236 Ga0496111_0005807 3300048914 Bacteria 7958
1237 Ga0496111_0062687 3300048914 Bacteria 2696
1238 Ga0496111_0067957 3300048914 Bacteria 2589
1239 Ga0496111_0242382 3300048914 Bacteria 1338
1240 Ga0496112_0010618 3300048915 Bacteria 8364
1241 Ga0496112_0025350 3300048915 Bacteria 5694
1242 Ga0496112_0072202 3300048915 Bacteria 3411
1243 Ga0496112_0183205 3300048915 Bacteria 2058
1244 Ga0496112_0190144 3300048915 Bacteria 2015
1245 Ga0496112_0507152 3300048915 Bacteria 1141
1246 Ga0496112_0869176 3300048915 Bacteria 825
1247 Ga0496113_0000303 3300048916 Bacteria 23409
1248 Ga0496113_0018311 3300048916 Bacteria 4876
1249 Ga0496113_0169256 3300048916 Bacteria 1730
1250 Ga0496113_0190964 3300048916 Bacteria 1626
1251 Ga0496114_0006447 3300048917 Bacteria 9242
1252 Ga0496114_0006628 3300048917 Bacteria 9124
1253 Ga0496114_0035294 3300048917 Bacteria 4128
1254 Ga0496114_0072783 3300048917 Bacteria 2891
1255 Ga0496114_0092133 3300048917 Bacteria 2574
1256 Ga0496114_0156176 3300048917 Bacteria 1981
1257 Ga0496114_0549100 3300048917 Bacteria 1021
1258 Ga0496114_0640165 3300048917 Bacteria 936
1259 Ga0496115_0000653 3300048918 Bacteria 25881
1260 Ga0496115_0032306 3300048918 Bacteria 4129
1261 Ga0496115_0057674 3300048918 Bacteria 3123
1262 Ga0496115_0237146 3300048918 Bacteria 1503
1263 Ga0496121_0315804 3300048924 Bacteria 1054
1264 Ga0496125_0177061 3300048928 Bacteria 1426
1265 Ga0501032_0428227 3300049569 Bacteria 849
1266 Ga0501036_0286192 3300049572 Bacteria 1379
1267 Ga0501038_0494806 3300049574 Bacteria 936
1268 Ga0501040_0507677 3300049576 Bacteria 869
1269 Ga0501041_0482298 3300049577 Bacteria 788
1270 Ga0501042_0521071 3300049578 Bacteria 863
1271 Ga0501043_0444979 3300049579 Bacteria 974
1272 Ga0501046_0469607 3300049580 Bacteria 903
1273 Ga0501047_0172166 3300049581 Bacteria 2034
1274 Ga0501068_0227837 3300049584 Bacteria 1185
1275 Ga0501073_0169869 3300049589 Bacteria 1510
1276 Ga0501073_0467739 3300049589 Bacteria 872
1277 Ga0501073_0555261 3300049589 Bacteria 793
1278 Ga0501076_0246054 3300049592 Bacteria 1463
1279 Ga0501077_0057332 3300049593 Bacteria 2473
1280 Ga0501079_0066389 3300049741 Bacteria 2784
1281 Ga0501079_0142917 3300049741 Bacteria 1864
1282 Ga0501079_0238919 3300049741 Bacteria 1419
1283 Ga0501080_0140727 3300049742 Bacteria 2231
1284 Ga0501080_0886884 3300049742 Bacteria 778
1285 Ga0501081_0218218 3300049743 Bacteria 1387
1286 Ga0501035_0713528 3300049822 Bacteria 808
1287 Ga0501044_0329102 3300049823 Bacteria 1451
1288 Ga0501044_0546010 3300049823 Bacteria 1056
1289 nmdc:mga03683_43877_c1 3300050489 Bacteria 1846
1290 nmdc:mga03n38_24716_c1 3300050490 Bacteria 2459
1291 nmdc:mga03n38_3107_c1 3300050490 Bacteria 5275
1292 nmdc:mga00v17_4589_c1 3300050491 Bacteria 7203
1293 nmdc:mga00v17_9497_c1 3300050491 Bacteria 5268
1294 nmdc:mga0yw44_246680_c1 3300050492 Bacteria 1188
1295 nmdc:mga0yw44_27074_c1 3300050492 Bacteria 3281
1296 nmdc:mga0yw44_280357_c1 3300050492 Bacteria 1114
1297 nmdc:mga0yw44_282133_c1 3300050492 Bacteria 1110
1298 nmdc:mga0k408_6133_c1 3300050493 Bacteria 6409
1299 nmdc:mga06z11_1635_c1 3300050494 Bacteria 8385
1300 nmdc:mga06z11_213158_c1 3300050494 Bacteria 1126
1301 nmdc:mga07m45_20193_c1 3300050496 Bacteria 1658
1302 nmdc:mga07m45_284100_c1 3300050496 Bacteria 962
1303 nmdc:mga07m45_35092_c2 3300050496 Bacteria 1775
1304 nmdc:mga05p37_111_c2 3300050507 Bacteria 41438
1305 nmdc:mga05p37_118283_c1 3300050507 Bacteria 3256
1306 nmdc:mga05p37_126617_c1 3300050507 Bacteria 3137
1307 nmdc:mga05p37_17687_c1 3300050507 Bacteria 8601
1308 nmdc:mga05p37_181482_c1 3300050507 Bacteria 2560
1309 nmdc:mga05p37_244589_c1 3300050507 Bacteria 2155
1310 nmdc:mga05p37_359050_c1 3300050507 Bacteria 1713
1311 nmdc:mga05p37_69071_c1 3300050507 Bacteria 4345
1312 nmdc:mga09592_27955_c1 3300050508 Bacteria 4683
1313 nmdc:mga0qj67_12821_c1 3300050509 Bacteria 6323
1314 nmdc:mga0qj67_189_c1 3300050509 Bacteria 41860
1315 nmdc:mga0qj67_455860_c1 3300050509 Bacteria 1030
1316 nmdc:mga0qj67_529173_c1 3300050509 Bacteria 946
1317 nmdc:mga0qj67_65800_c1 3300050509 Bacteria 2886
1318 nmdc:mga06r32_10349_c1 3300050510 Bacteria 8414
1319 nmdc:mga06r32_1248255_c1 3300050510 Bacteria 688
1320 nmdc:mga06r32_496949_c1 3300050510 Bacteria 1197
1321 nmdc:mga06r32_87163_c1 3300050510 Bacteria 3046
1322 nmdc:mga08y16_1052_c1 3300050511 Bacteria 27127
1323 nmdc:mga08y16_1139186_c1 3300050511 Bacteria 753
1324 nmdc:mga08y16_24425_c1 3300050511 Bacteria 6379
1325 nmdc:mga08y16_3254_c1 3300050511 Bacteria 16811
1326 nmdc:mga08y16_338474_c1 3300050511 Bacteria 1547
1327 nmdc:mga08y16_395135_c1 3300050511 Bacteria 1416
1328 nmdc:mga08y16_4695_c1 3300050511 Bacteria 14238
1329 nmdc:mga08y16_521552_c1 3300050511 Bacteria 1205
1330 nmdc:mga0n895_193244_c1 3300050512 Bacteria 2066
1331 nmdc:mga0n895_19600_c1 3300050512 Bacteria 6289
1332 nmdc:mga0n895_28635_c1 3300050512 Bacteria 5301
1333 nmdc:mga0n895_28850_c1 3300050512 Bacteria 5284
1334 nmdc:mga0n895_424793_c1 3300050512 Bacteria 1343
1335 nmdc:mga0n895_6052_c1 3300050512 Bacteria 10200
1336 nmdc:mga0n895_61201_c1 3300050512 Bacteria 3716
1337 nmdc:mga0rr50_23552_c1 3300050513 Bacteria 4248
1338 nmdc:mga0rr50_276658_c1 3300050513 Bacteria 1400
1339 nmdc:mga0rr50_316719_c1 3300050513 Bacteria 1307
1340 nmdc:mga0rr50_45233_c1 3300050513 Bacteria 3234
1341 nmdc:mga0rr50_565337_c1 3300050513 Bacteria 969
1342 nmdc:mga08x19_119633_c1 3300050514 Bacteria 1764
1343 nmdc:mga08x19_23491_c1 3300050514 Bacteria 3824
1344 nmdc:mga08x19_99010_c1 3300050514 Bacteria 1932
1345 nmdc:mga0a205_122710_c1 3300050515 Bacteria 2498
1346 nmdc:mga0a205_2125_c1 3300050515 Bacteria 17392
1347 nmdc:mga0a205_2281_c1 3300050515 Bacteria 16910
1348 nmdc:mga0a205_238201_c1 3300050515 Bacteria 1701
1349 nmdc:mga0a205_28775_c1 3300050515 Bacteria 5314
1350 nmdc:mga0a205_553809_c1 3300050515 Bacteria 1005
1351 nmdc:mga0sz30_4997_c1 3300050516 Bacteria 4840
1352 Ga0495601_0000114 3300053077 Bacteria 44359
1353 Ga0495601_0001485 3300053077 Bacteria 12934
1354 Ga0495601_0013078 3300053077 Bacteria 4988
1355 Ga0495601_0036766 3300053077 Bacteria 3059
1356 Ga0495601_0054986 3300053077 Bacteria 2519
1357 Ga0495601_0063087 3300053077 Bacteria 2354
1358 Ga0495601_0088230 3300053077 Bacteria 1994
1359 Ga0495612_0001226 3300053078 Bacteria 10568
1360 Ga0495612_0005655 3300053078 Bacteria 5164
1361 Ga0495612_0009022 3300053078 Bacteria 4044
1362 Ga0495612_0025884 3300053078 Bacteria 2357
1363 Ga0495612_0071136 3300053078 Bacteria 1450
1364 Ga0495612_0104824 3300053078 Bacteria 1206
1365 Ga0495595_0000718 3300053084 Bacteria 12615
1366 Ga0495595_0001264 3300053084 Bacteria 9847
1367 Ga0495595_0001866 3300053084 Bacteria 8183
1368 Ga0495595_0004743 3300053084 Bacteria 5470
1369 Ga0495595_0062728 3300053084 Bacteria 1743
1370 Ga0495595_0133648 3300053084 Bacteria 1214
1371 Ga0495595_0238950 3300053084 Bacteria 908
1372 Ga0495619_0000201 3300053085 Bacteria 43295
1373 Ga0495619_0000206 3300053085 Bacteria 42730
1374 Ga0495619_0006226 3300053085 Bacteria 7566
1375 Ga0495619_0009047 3300053085 Bacteria 6283
1376 Ga0495619_0014776 3300053085 Bacteria 4932
1377 Ga0495619_0025483 3300053085 Bacteria 3798
1378 Ga0495619_0057902 3300053085 Bacteria 2571
1379 Ga0495619_0061983 3300053085 Bacteria 2489
1380 Ga0495619_0128449 3300053085 Bacteria 1741
1381 Ga0495619_0199627 3300053085 Bacteria 1384
1382 Ga0500554_014966 3300053102 Bacteria 2014
1383 Ga0500593_001549 3300053117 Bacteria 8258
1384 Ga0500595_001180 3300053119 Bacteria 14424
1385 Ga0500652_000077 3300053131 Bacteria 42781
1386 Ga0500658_0234398 3300053134 Bacteria 843
1387 Ga0500590_099473 3300053148 Bacteria 1399
1388 Ga0500603_035405 3300053150 Bacteria 1309
1389 Ga0500637_0009067 3300053178 Bacteria 5050
1390 Ga0500645_095559 3300053730 Bacteria 841
1391 Ga0501084_0313371 3300054114 Bacteria 1325
1392 Ga0500661_001671 3300055283 Bacteria 4170
1393 Ga0501082_0000101 3300060353 Bacteria 66608
1394 Ga0501082_0209664 3300060353 Bacteria 1695
1395 Ga0530510_0434223 3300061734 Unclassified 992
1396 Ga0070714_100279750
1397 SwRhRL2b_contig_1529358
1398 2214745211
1399 ARcpr5oldR_c000059
1400 ARSoilYngRDRAFT_c00001
1401 ARcpr5yngRDRAFT_c000001
1402 ARSoilOldRDRAFT_c000066
1403 ARCol0oldRDRAFT_c00439
1404 ARCol0yngRDRAFT_1000014
1405 JGI24746J21847_1002433
1406 JGI24740J21852_10020451
1407 JGI24739J22299_10010837
1408 JGI24737J22298_10008285
1409 JGI24735J21928_10011548
1410 JGI24750J21931_1000154
1411 JGI24745J21846_1000047
1412 JGI24748J21848_1000162
1413 JGI24738J21930_10000005
1414 JGI24749J21850_1000444
1415 JGI24749J21850_1003765
1416 JGI24033J26618_1000407
1417 JGI24034J26672_10000819
1418 JGI24742J22300_10000203
1419 JGI24751J29686_10011942
1420 JGI25406J46586_10041430
1421 JGI25405J52794_10024670
1422 Ga0065704_10072903
1423 Ga0065715_10003668
1424 Ga0065715_10102699
1425 Ga0070658_10703830
1426 Ga0070676_10000087
1427 Ga0070683_100000098
1428 Ga0070683_100070578
1429 Ga0070683_101141842
1430 Ga0070690_100004710
1431 Ga0070690_100036430
1432 Ga0070690_100064871
1433 Ga0070690_100209982
1434 Ga0070690_100298987
1435 Ga0070670_100062990
1436 Ga0070670_100083177
1437 Ga0070670_100133407
1438 Ga0070670_100165242
1439 Ga0070677_10000087
1440 Ga0070677_10005921
1441 Ga0068869_100007030
1442 Ga0068869_100168436
1443 Ga0068869_100195559
1444 Ga0070666_10006074
1445 Ga0070666_10139159
1446 Ga0070666_10166879
1447 Ga0070666_10213027
1448 Ga0070680_100129126
1449 Ga0070680_100715864
1450 Ga0070680_100807244
1451 Ga0070682_100003963
1452 Ga0070682_100229025
1453 Ga0070682_100363791
1454 Ga0068868_100020059
1455 Ga0068868_100281521
1456 Ga0070660_100008367
1457 Ga0070660_100063999
1458 Ga0070689_100002716
1459 Ga0070689_100023410
1460 Ga0070689_100041942
1461 Ga0070689_100153285
1462 Ga0070689_100212072
1463 Ga0070689_100232835
1464 Ga0070691_10006879
1465 Ga0070687_100027779
1466 Ga0070687_100050664
1467 Ga0070661_100000153
1468 Ga0070661_100032632
1469 Ga0070661_100046668
1470 Ga0070692_10028938
1471 Ga0070668_100054761
1472 Ga0070668_100235655
1473 Ga0070668_100310033
1474 Ga0070669_100018867
1475 Ga0070669_100134784
1476 Ga0070669_100496769
1477 Ga0070675_100010385
1478 Ga0070675_100058672
1479 Ga0070675_100319369
1480 Ga0070675_100638054
1481 Ga0070671_100000087
1482 Ga0070671_100011988
1483 Ga0070671_100087488
1484 Ga0070671_100275396
1485 Ga0070674_100003304
1486 Ga0070674_100018767
1487 Ga0070674_100036515
1488 Ga0070673_100005718
1489 Ga0070673_100039017
1490 Ga0070673_100147552
1491 Ga0070673_100182500
1492 Ga0070688_100048957
1493 Ga0070688_100079522
1494 Ga0070688_100154850
1495 Ga0070688_100155055
1496 Ga0070688_100373345
1497 Ga0070659_100009167
1498 Ga0070659_100152918
1499 Ga0070659_100164242
1500 Ga0070659_100322980
1501 Ga0070659_100531013
1502 Ga0070667_100027461
1503 Ga0070667_100042852
1504 Ga0070667_100193919
1505 Ga0070667_100792549
1506 Ga0070703_10034267
1507 Ga0070709_10001851
1508 Ga0070709_10014055
1509 Ga0070709_10343819
1510 Ga0070714_100049571
1511 Ga0070714_100066424
1512 Ga0070714_100209348
1513 Ga0070713_100001450
1514 Ga0070713_100022950
1515 Ga0070713_100083011
1516 Ga0070713_100120596
1517 Ga0070713_100140940
1518 Ga0070713_100201076
1519 Ga0070713_100249189
1520 Ga0070713_100538581
1521 Ga0070713_100766477
1522 Ga0070710_10003954
1523 Ga0070701_10001447
1524 Ga0070701_10014027
1525 Ga0070701_10052667
1526 Ga0070701_10072974
1527 Ga0070711_100033186
1528 Ga0070711_100042334
1529 Ga0070711_100081215
1530 Ga0070711_100111727
1531 Ga0070705_100014389
1532 Ga0070705_100219093
1533 Ga0070700_100010178
1534 Ga0070700_100011271
1535 Ga0070694_100034125
1536 Ga0070694_100316720
1537 Ga0070694_100440471
1538 Ga0070694_100511649
1539 Ga0070708_100162550
1540 Ga0070663_100015960
1541 Ga0070663_100048158
1542 Ga0070663_100085275
1543 Ga0070663_100127767
1544 Ga0070663_100785481
1545 Ga0070678_100000090
1546 Ga0070678_100040261
1547 Ga0070678_100088267
1548 Ga0070678_100162412
1549 Ga0070678_100232850
1550 Ga0070662_100042407
1551 Ga0070662_100050569
1552 Ga0070662_100105908
1553 Ga0070662_100192539
1554 Ga0070681_10032354
1555 Ga0070681_10200388
1556 Ga0070681_10247460
1557 Ga0070681_10564977
1558 Ga0070681_11009290
1559 Ga0068867_100008100
1560 Ga0068867_100252836
1561 Ga0068867_100414460
1562 Ga0070685_10003606
1563 Ga0070685_10004710
1564 Ga0070685_10028131
1565 Ga0070685_10061747
1566 Ga0070706_100141717
1567 Ga0070699_100369093
1568 Ga0070679_100057812
1569 Ga0070679_100158506
1570 Ga0070679_100178646
1571 Ga0070679_100197288
1572 Ga0070679_100252262
1573 Ga0070679_100332067
1574 Ga0070684_100007412
1575 Ga0070684_100010741
1576 Ga0070697_100129350
1577 Ga0068853_100011425
1578 Ga0068853_100218038
1579 Ga0068853_100238329
1580 Ga0068853_100329417
1581 Ga0070672_100003453
1582 Ga0070672_100023218
1583 Ga0070672_100377437
1584 Ga0070686_100001736
1585 Ga0070686_100012700
1586 Ga0070686_100014361
1587 Ga0070686_100039869
1588 Ga0070686_100173841
1589 Ga0070695_100117562
1590 Ga0070695_100132327
1591 Ga0070695_100442081
1592 Ga0070695_100628178
1593 Ga0070696_100037459
1594 Ga0070696_100150142
1595 Ga0070696_100349612
1596 Ga0070693_100020625
1597 Ga0070693_100078790
1598 Ga0070665_100025741
1599 Ga0070665_100083333
1600 Ga0070665_100257373
1601 Ga0070665_101067113
1602 Ga0070704_100013532
1603 Ga0070704_100184961
1604 Ga0070704_100220936
1605 Ga0070704_100430988
1606 Ga0068855_100029468
1607 Ga0068855_100589779
1608 Ga0068855_100719578
1609 Ga0070664_100003492
1610 Ga0070664_100029633
1611 Ga0068857_100001853
1612 Ga0068854_100051068
1613 Ga0068854_100324849
1614 Ga0068854_100909408
1615 Ga0068856_100000429
1616 Ga0068856_100077570
1617 Ga0068856_100174255
1618 Ga0068856_100360392
1619 Ga0068856_100578360
1620 Ga0068856_100998077
1621 Ga0070702_100000021
1622 Ga0070702_100012355
1623 Ga0070702_100232408
1624 Ga0068852_100079650
1625 Ga0068859_100045661
1626 Ga0068859_100187867
1627 Ga0068864_100051399
1628 Ga0068864_100074171
1629 Ga0068864_100113244
1630 Ga0068864_100581797
1631 Ga0068866_10000919
1632 Ga0068866_10018320
1633 Ga0068866_10077263
1634 Ga0068866_10207964
1635 Ga0068861_100002149
1636 Ga0068861_100067791
1637 Ga0068861_100131007
1638 Ga0068861_100196432
1639 Ga0068861_100228759
1640 Ga0068861_100783057
1641 Ga0068851_10359784
1642 Ga0068870_10000588
1643 Ga0068870_10014308
1644 Ga0068863_100001459
1645 Ga0068863_100045935
1646 Ga0068863_100244222
1647 Ga0068858_100116038
1648 Ga0068858_100302872
1649 Ga0068858_100334154
1650 Ga0068858_100615929
1651 Ga0068860_100016194
1652 Ga0068860_100020090
1653 Ga0068860_100036305
1654 Ga0068862_100036033
1655 Ga0068862_100250035
1656 Ga0081455_10000002
1657 Ga0081455_10003269
1658 Ga0081455_10003886
1659 Ga0081455_10022547
1660 Ga0081455_10120655
1661 Ga0081455_10139546
1662 Ga0081455_10194436
1663 Ga0081540_1010355
1664 Ga0081540_1031460
1665 Ga0081539_10002901
1666 Ga0070717_10001529
1667 Ga0070717_10008327
1668 Ga0070717_10233626
1669 Ga0070717_10250189
1670 Ga0075365_10001671
1671 Ga0075365_10026637
1672 Ga0075365_10095029
1673 Ga0075365_10160523
1674 Ga0075368_10028171
1675 Ga0075363_100001378
1676 Ga0075363_100012518
1677 Ga0075363_100034923
1678 Ga0075364_10005413
1679 Ga0075364_10041419
1680 Ga0075364_10470023
1681 Ga0070715_10000379
1682 Ga0070715_10058215
1683 Ga0070715_10069483
1684 Ga0070715_10078723
1685 Ga0070716_100041362
1686 Ga0070716_100577985
1687 Ga0070712_100010590
1688 Ga0070712_100171040
1689 Ga0070712_100297739
1690 Ga0075362_10010849
1691 Ga0075362_10012472
1692 Ga0075362_10209336
1693 Ga0075367_10001203
1694 Ga0075367_10053037
1695 Ga0075367_10127068
1696 Ga0075369_10005459
1697 Ga0075427_10000093
1698 Ga0075366_10006427
1699 Ga0075366_10031698
1700 Ga0097621_100000012
1701 Ga0097621_100032038
1702 Ga0097621_100323904
1703 Ga0097621_100354308
1704 Ga0075370_10262301
1705 Ga0068871_100000138
1706 Ga0068871_100008692
1707 Ga0068871_100087680
1708 Ga0068871_100298467
1709 Ga0075428_100036127
1710 Ga0075428_100087699
1711 Ga0075428_100161541
1712 Ga0075428_100185144
1713 Ga0075428_100233494
1714 Ga0075428_100609429
1715 Ga0075430_100000014
1716 Ga0075430_100003974
1717 Ga0075430_100009563
1718 Ga0075430_100411982
1719 Ga0075431_100005449
1720 Ga0075431_100140324
1721 Ga0075431_100163948
1722 Ga0075433_10000100
1723 Ga0075433_10038428
1724 Ga0075433_10095241
1725 Ga0075434_100018712
1726 Ga0075434_100038552
1727 Ga0075434_100045780
1728 Ga0075434_100061573
1729 Ga0075434_100075803
1730 Ga0075434_100457505
1731 Ga0075434_100830966
1732 Ga0075429_100004155
1733 Ga0068865_100015586
1734 Ga0068865_100104993
1735 Ga0068865_100182872
1736 Ga0075436_100111964
1737 Ga0075436_100120146
1738 Ga0075436_100135614
1739 Ga0075436_100400398
1740 Ga0075436_100525802
1741 Ga0097620_100045654
1742 Ga0097620_100187848
1743 Ga0075435_100061289
1744 Ga0075435_100067947
1745 Ga0075435_100105192
1746 Ga0075435_100267411
1747 Ga0075435_100309827
1748 Ga0075435_100392122
1749 Ga0075435_100477353
1750 Ga0099795_10004915
1751 Ga0105251_10027453
1752 Ga0105250_10038833
1753 Ga0105250_10048561
1754 Ga0105240_10020624
1755 Ga0105240_10054015
1756 Ga0105240_10538318
1757 Ga0111539_10010658
1758 Ga0111539_10031589
1759 Ga0111539_10046646
1760 Ga0111539_10107930
1761 Ga0111539_10187325
1762 Ga0111539_10207051
1763 Ga0111539_10290381
1764 Ga0111539_10394916
1765 Ga0111539_10421369
1766 Ga0111539_10725552
1767 Ga0105245_10001132
1768 Ga0105245_10028479
1769 Ga0105245_10313858
1770 Ga0105247_10011973
1771 Ga0105247_10057718
1772 Ga0105247_10089867
1773 Ga0105247_10098594
1774 Ga0114129_10002014
1775 Ga0114129_10011877
1776 Ga0114129_10019370
1777 Ga0114129_10053795
1778 Ga0114129_10078363
1779 Ga0114129_10262075
1780 Ga0114129_10321372
1781 Ga0114129_10554657
1782 Ga0105243_10021892
1783 Ga0105243_10062102
1784 Ga0105243_10216178
1785 Ga0105243_10436681
1786 Ga0105241_10009988
1787 Ga0105241_10157156
1788 Ga0105242_10000623
1789 Ga0105242_10063821
1790 Ga0105242_10089675
1791 Ga0105242_10099801
1792 Ga0105242_10543833
1793 Ga0105248_10037821
1794 Ga0105248_10080147
1795 Ga0105248_10169653
1796 Ga0105248_10180002
1797 Ga0105248_10229032
1798 Ga0105248_10508627
1799 Ga0105237_10052924
1800 Ga0105237_10103835
1801 Ga0105237_10195426
1802 Ga0105237_10477616
1803 Ga0105237_10488024
1804 Ga0105238_10006101
1805 Ga0105238_10068460
1806 Ga0105238_10083410
1807 Ga0105249_10026638
1808 Ga0105249_10084761
1809 Ga0105249_10168270
1810 Ga0105249_10172880
1811 Ga0105249_10173692
1812 Ga0105249_10228917
1813 Ga0105249_11639760
1814 Ga0099796_10005106
1815 Ga0105239_10029848
1816 Ga0105239_10038880
1817 Ga0105239_10048338
1818 Ga0105239_10720401
1819 Ga0105246_10001183
1820 Ga0105246_10572213
1821 Ga0105246_10938328
1822 Ga0157373_10012880
1823 Ga0157373_10246400
1824 Ga0157373_10295000
1825 Ga0157371_10057659
1826 Ga0157371_10135387
1827 Ga0157371_10595984
1828 Ga0157370_10108378
1829 Ga0157370_10776615
1830 Ga0157369_10193404
1831 Ga0157369_10423619
1832 Ga0157374_10001601
1833 Ga0157374_10124095
1834 Ga0157374_10128465
1835 Ga0157374_10422485
1836 Ga0157374_10958114
1837 Ga0157378_10002020
1838 Ga0157378_10133677
1839 Ga0163162_10032396
1840 Ga0163162_10114861
1841 Ga0163162_10206623
1842 Ga0163162_10208911
1843 Ga0163162_10348941
1844 Ga0157372_10288614
1845 Ga0157375_10029102
1846 Ga0157375_10044806
1847 Ga0157375_10367402
1848 Ga0157375_10782202
1849 Ga0157375_10851229
1850 Ga0157375_11170870
1851 Ga0163163_10049673
1852 Ga0163163_10127282
1853 Ga0163163_10157490
1854 Ga0163163_10180826
1855 Ga0163163_10341401
1856 Ga0157380_10104618
1857 Ga0157380_10182785
1858 Ga0157380_10196047
1859 Ga0157377_10000196
1860 Ga0157377_10179011
1861 Ga0157379_10021402
1862 Ga0157379_10049072
1863 Ga0157379_10151547
1864 Ga0157379_10161364
1865 Ga0157379_10677320
1866 Ga0157379_11012124
1867 Ga0157376_10000168
1868 Ga0157376_10145651
1869 Ga0157376_10162625
1870 Ga0157376_10249994
1871 Ga0163161_10000511
1872 Ga0163161_10067114
1873 Ga0163161_10102191
1874 Ga0213874_10077144
1875 Ga0213876_10067575
1876 Ga0213876_10177992
1877 Ga0207666_1000296
1878 Ga0207673_1000056
1879 Ga0207697_10006861
1880 Ga0207697_10204838
1881 Ga0207713_1063657
1882 Ga0207682_10000064
1883 Ga0207682_10001593
1884 Ga0207692_10026576
1885 Ga0207692_10135720
1886 Ga0207692_10155744
1887 Ga0207642_10006630
1888 Ga0207642_10029164
1889 Ga0207710_10007378
1890 Ga0207710_10012495
1891 Ga0207688_10000117
1892 Ga0207688_10000195
1893 Ga0207688_10356869
1894 Ga0207680_10126150
1895 Ga0207680_10127971
1896 Ga0207680_10162594
1897 Ga0207680_10164890
1898 Ga0207680_10691915
1899 Ga0207647_10032286
1900 Ga0207647_10112320
1901 Ga0207685_10022403
1902 Ga0207685_10044028
1903 Ga0207685_10076764
1904 Ga0207699_10101144
1905 Ga0207699_10220282
1906 Ga0207699_10236930
1907 Ga0207699_10462537
1908 Ga0207699_10489897
1909 Ga0207645_10000040
1910 Ga0207643_10000072
1911 Ga0207643_10000291
1912 Ga0207705_10551007
1913 Ga0207684_10084148
1914 Ga0207654_10010446
1915 Ga0207654_10045184
1916 Ga0207654_10202484
1917 Ga0207654_10239909
1918 Ga0207654_10358344
1919 Ga0207707_10003512
1920 Ga0207707_10281862
1921 Ga0207695_10432255
1922 Ga0207671_10026718
1923 Ga0207671_10324099
1924 Ga0207693_10004617
1925 Ga0207693_10005019
1926 Ga0207693_10007075
1927 Ga0207693_10021399
1928 Ga0207693_10059962
1929 Ga0207693_10111959
1930 Ga0207693_10122397
1931 Ga0207693_10122592
1932 Ga0207693_10137568
1933 Ga0207663_10102395
1934 Ga0207663_10129151
1935 Ga0207663_10529915
1936 Ga0207660_10003460
1937 Ga0207660_10032727
1938 Ga0207660_10206010
1939 Ga0207660_10461750
1940 Ga0207662_10010243
1941 Ga0207662_10065808
1942 Ga0207662_10261625
1943 Ga0207657_10051887
1944 Ga0207657_10075361
1945 Ga0207657_10079987
1946 Ga0207657_10125762
1947 Ga0207657_10159561
1948 Ga0207649_10000086
1949 Ga0207652_10004335
1950 Ga0207652_10148105
1951 Ga0207652_10231094
1952 Ga0207652_10384661
1953 Ga0207646_10048472
1954 Ga0207646_10995330
1955 Ga0207681_10000451
1956 Ga0207694_10103727
1957 Ga0207694_10297751
1958 Ga0207694_10531258
1959 Ga0207650_10000972
1960 Ga0207650_10008027
1961 Ga0207650_10046577
1962 Ga0207650_10201795
1963 Ga0207659_10000478
1964 Ga0207659_10027849
1965 Ga0207659_10053244
1966 Ga0207659_10060168
1967 Ga0207659_10176572
1968 Ga0207659_10210254
1969 Ga0207687_10000144
1970 Ga0207687_10005852
1971 Ga0207687_10007800
1972 Ga0207687_10017010
1973 Ga0207687_10595119
1974 Ga0207700_10007883
1975 Ga0207700_10010360
1976 Ga0207700_10103349
1977 Ga0207700_10209693
1978 Ga0207700_10238468
1979 Ga0207700_10246473
1980 Ga0207700_10333255
1981 Ga0207664_10052117
1982 Ga0207664_10311302
1983 Ga0207664_10558659
1984 Ga0207644_10001694
1985 Ga0207644_10007672
1986 Ga0207644_10010699
1987 Ga0207644_10028186
1988 Ga0207690_10000086
1989 Ga0207690_10071142
1990 Ga0207690_10093526
1991 Ga0207690_10204089
1992 Ga0207690_10441232
1993 Ga0207706_10013203
1994 Ga0207706_10039372
1995 Ga0207706_10186999
1996 Ga0207686_10000287
1997 Ga0207686_10026795
1998 Ga0207686_10129282
1999 Ga0207686_10196937
2000 Ga0207709_10000431
2001 Ga0207709_10044459
2002 Ga0207709_10425584
2003 Ga0207670_10010207
2004 Ga0207670_10011186
2005 Ga0207670_10061434
2006 Ga0207670_10100941
2007 Ga0207670_10165734
2008 Ga0207670_10300161
2009 Ga0207669_10000050
2010 Ga0207669_10022824
2011 Ga0207669_10171196
2012 Ga0207669_10402567
2013 Ga0207704_10000774
2014 Ga0207704_10006265
2015 Ga0207704_10014495
2016 Ga0207704_10225989
2017 Ga0207704_10464271
2018 Ga0207665_10001033
2019 Ga0207665_10016224
2020 Ga0207665_10109746
2021 Ga0207665_10545867
2022 Ga0207691_10002007
2023 Ga0207691_10019090
2024 Ga0207691_10020643
2025 Ga0207711_10011783
2026 Ga0207711_10036115
2027 Ga0207711_10036907
2028 Ga0207711_10041690
2029 Ga0207689_10000115
2030 Ga0207689_10002877
2031 Ga0207689_10109931
2032 Ga0207661_10000094
2033 Ga0207661_10091112
2034 Ga0207679_10000025
2035 Ga0207679_10015384
2036 Ga0207679_10340404
2037 Ga0207679_10695165
2038 Ga0207679_10738468
2039 Ga0207667_10047924
2040 Ga0207667_10957064
2041 Ga0207651_10000081
2042 Ga0207651_10082069
2043 Ga0207712_10000315
2044 Ga0207712_10017744
2045 Ga0207712_10097480
2046 Ga0207668_10000098
2047 Ga0207668_10240575
2048 Ga0207640_10000104
2049 Ga0207640_10067074
2050 Ga0207640_10224233
2051 Ga0207640_10287503
2052 Ga0207658_10022108
2053 Ga0207658_10043430
2054 Ga0207658_10119607
2055 Ga0207658_10264654
2056 Ga0207677_10034106
2057 Ga0207677_10137379
2058 Ga0207677_10240490
2059 Ga0207703_10046816
2060 Ga0207703_10088275
2061 Ga0207703_10483725
2062 Ga0207639_10000954
2063 Ga0207639_10112920
2064 Ga0207639_10194149
2065 Ga0207639_10281884
2066 Ga0207639_10313196
2067 Ga0207678_10001162
2068 Ga0207678_10008097
2069 Ga0207678_10009832
2070 Ga0207678_10145462
2071 Ga0207678_10380604
2072 Ga0207708_10001029
2073 Ga0207708_10019521
2074 Ga0207708_10131875
2075 Ga0207708_10252786
2076 Ga0207708_10338657
2077 Ga0207702_10002785
2078 Ga0207702_10272978
2079 Ga0207702_10277859
2080 Ga0207702_10278883
2081 Ga0207702_10919652
2082 Ga0207641_10000364
2083 Ga0207641_10029516
2084 Ga0207641_10036719
2085 Ga0207648_10017434
2086 Ga0207648_10023601
2087 Ga0207648_10027119
2088 Ga0207648_10213726
2089 Ga0207648_10267297
2090 Ga0207648_10408896
2091 Ga0207676_10003923
2092 Ga0207676_10004707
2093 Ga0207676_10006878
2094 Ga0207676_10246146
2095 Ga0207676_10652954
2096 Ga0207674_10019868
2097 Ga0207674_10240199
2098 Ga0207674_10713633
2099 Ga0207675_100002392
2100 Ga0207675_100083025
2101 Ga0207675_100142583
2102 Ga0207675_100268304
2103 Ga0207683_10000001
2104 Ga0207683_10000918
2105 Ga0207683_10004123
2106 Ga0207683_10033169
2107 Ga0207683_10082865
2108 Ga0207698_10011125
2109 Ga0207698_10731019
2110 Ga0209967_1004004
2111 Ga0209984_1003477
2112 Ga0209970_1007141
2113 Ga0209983_1003280
2114 Ga0209971_1003510
2115 Ga0209966_1001211
2116 Ga0209998_10012805
2117 Ga0209998_10015130
2118 Ga0209974_10045558
2119 Ga0209974_10047488
2120 Ga0207428_10000146
2121 Ga0207428_10000221
2122 Ga0207428_10000524
2123 Ga0268266_10036070
2124 Ga0268266_10064002
2125 Ga0268266_10093484
2126 Ga0268266_10213454
2127 Ga0268265_10000350
2128 Ga0268265_10205052
2129 Ga0268265_10836915
2130 Ga0268264_10021698
2131 Ga0268264_10136895
2132 Ga0268264_10793015
2133 Ga0265337_1006088
2134 Ga0265318_10016381
2135 Ga0265338_10008028
2136 Ga0265760_10044756
2137 Ga0265760_10046630
2138 Ga0265760_10058917
2139 Ga0265760_10064269
2140 Ga0265330_10100356
2141 Ga0265332_10011248
2142 Ga0265332_10017669
2143 Ga0265325_10015013
2144 Ga0265340_10031418
2145 Ga0265339_10000096
2146 Ga0265339_10021879
2147 Ga0265316_10051989
2148 Ga0307408_101063056
2149 Ga0265313_10000024
2150 Ga0316575_10055211
2151 Ga0265314_10283896
2152 Ga0265342_10000230
2153 Ga0265342_10059320
2154 Ga0316578_10066629
2155 Ga0307406_11020210
2156 Ga0373930_0001414
2157 Ga0373930_0004022
2158 Ga0373948_0003227
2159 Ga0373948_0032879
2160 Ga0373950_0000233
2161 Ga0373958_0000271
2162 Ga0373958_0004321
2163 Ga0373959_0002070
2164 Ga0373938_0014635
2165 Ga0373938_0019336
2166 Ga0373938_0020613
2167 Ga0373926_0006063
2168 Ga0373928_0012174
2169 Ga0373929_0000054
2170 Ga0373934_0032784
2171 Ga0373934_0033349
2172 Ga0373940_0000308
2173 Ga0373940_0001216
2174 Ga0373940_0018543
2175 Ga0373940_0051906
2176 Ga0373944_0005528
2177 Ga0373944_0009262
2178 Ga0373944_0063225
2179 Ga0373951_0006408
2180 Ga0373951_0018048
2181 Ga0373952_0001176
2182 Ga0373952_0004129
2183 Ga0373923_0007797
2184 Ga0373923_0009424
2185 Ga0373932_0000513
2186 Ga0373932_0004289
2187 Ga0373932_0004716
2188 Ga0373936_0008189
2189 Ga0373936_0060285
2190 Ga0373936_0078942
2191 Ga0373936_0269599
2192 Ga0373939_0000835
2193 Ga0373939_0002022
2194 Ga0373939_0002422
2195 Ga0373939_0056971
2196 Ga0373941_0000446
2197 Ga0373941_0001331
2198 Ga0373941_0018235
2199 Ga0373945_0002888
2200 Ga0373945_0026173
2201 Ga0373953_0006422
2202 Ga0373953_0022517
2203 Ga0373953_0027003
2204 Ga0373953_0053410
2205 Ga0373954_0005543
2206 Ga0373954_0019638
2207 Ga0373954_0097191
2208 Ga0373954_0150530
2209 Ga0373956_0001402
2210 Ga0373956_0058468
2211 Ga0373956_0134111
2212 Ga0373957_0001296
2213 Ga0373957_0024719
2214 Ga0373957_0169052
2215 Ga0373960_0001375
2216 Ga0373960_0010662
2217 Ga0373943_0000604
2218 Ga0373943_0039468
2219 Ga0373943_0047410
2220 Ga0373943_0057544
2221 Ga0373943_0062098
2222 Ga0373943_0080638
2223 Ga0373946_0003645
2224 Ga0373946_0026555
2225 Ga0373946_0029375
2226 Ga0373946_0087903
2227 Ga0373946_0114705
2228 Ga0373955_0001931
2229 Ga0373955_0069643
2230 Ga0373955_0233880
2231 Ga0373955_0277221
2232 Ga0373942_0001024
2233 Ga0373942_0002937
2234 Ga0373942_0086196
2235 Ga0373961_0000356
2236 Ga0373961_0014739
2237 Ga0373962_0016277
2238 Ga0373962_0017415
2239 Ga0373924_0005132
2240 Ga0373931_0000593
2241 Ga0373931_0007758
2242 Ga0373931_0022947
2243 Ga0373931_0030252
2244 Ga0373931_0145219
2245 Ga0373935_0001442
2246 Ga0373935_0012660
2247 Ga0373935_0097321
2248 Ga0373935_0114225
2249 Ga0373935_0143522
2250 Ga0373935_0375206
2251 Ga0373935_0508065
2252 Ga0373927_0002603
2253 Ga0373927_0007920
2254 Ga0373927_0008533
2255 Ga0373927_0008946
2256 Ga0373927_0041540
2257 Ga0373927_0085335
2258 Ga0373927_0221080
2259 Ga0373927_0449996
2260 Ga0373933_0001968
2261 Ga0373933_0064420
2262 Ga0373933_0085482
2263 Ga0373933_0108034
2264 Ga0373933_0254034
2265 Ga0373933_0439949
2266 Ga0373947_0000168
2267 Ga0373947_0009446
2268 Ga0373947_0011068
2269 Ga0373947_0088433
2270 Ga0373947_0166258
2271 Ga0373947_0230637
2272 Ga0373947_0378566
2273 Ga0373947_0469169
2274 Ga0373937_0000814
2275 Ga0373937_0001859
2276 Ga0373937_0002452
2277 Ga0373937_0033958
2278 Ga0373937_0117315
2279 Ga0373937_0120795
2280 Ga0373937_0148066
2281 Ga0373937_0289058
2282 Ga0316584_0005534
2283 Ga0316584_0120026
2284 Ga0373925_0013667
2285 Ga0373925_0017035
2286 Ga0373925_0044216
2287 Ga0373925_0075111
2288 Ga0373925_0251594
2289 Ga0373925_0486544
2290 Ga0395899_0008835
2291 Ga0395899_0204640
2292 Ga0395899_0249719
2293 Ga0395899_0538303
2294 Ga0395900_0000709
2295 Ga0395900_0103524
2296 Ga0395900_0164184
2297 Ga0395900_1010770
2298 Ga0395898_0023683
2299 Ga0395898_0072915
2300 Ga0395898_0083680
2301 Ga0395898_0508850
2302 Ga0395905_0120346
2303 Ga0436364_0671098
2304 Ga0436364_1035362
2305 Ga0395901_0011960
2306 Ga0395901_0207765
2307 Ga0395901_0635086
2308 Ga0395901_1117792
2309 Ga0436365_0909129
2310 Ga0436360_0063464
2311 Ga0436360_0067730
2312 Ga0436361_0174670
2313 Ga0436361_0329200
2314 Ga0436361_0825759
2315 Ga0436363_0431026
2316 Ga0436363_0450495
2317 Ga0436363_0738257
2318 Ga0451793_1911136
2319 Ga0439445_0129412
2320 Ga0439450_006590
2321 Ga0439455_0004874
2322 Ga0439464_0038648
2323 Ga0439460_0008770
2324 Ga0451577_0026107
2325 Ga0439440_0007658
2326 Ga0466963_0033242
2327 Ga0453684_0049507
2328 Ga0466957_0061173
2329 Ga0451576_0225795
2330 Ga0466958_0085752
2331 Ga0466967_0001077
2332 Ga0495592_0011257
2333 Ga0495592_0016998
2334 Ga0495592_0060432
2335 Ga0495592_0095181
2336 Ga0495592_0118079
2337 Ga0495592_0134747
2338 Ga0495592_0202512
2339 Ga0495591_020020
2340 Ga0495629_0000230
2341 Ga0495629_0001246
2342 Ga0495629_0062243
2343 Ga0495629_0086466
2344 Ga0495629_0113085
2345 Ga0495629_0206469
2346 Ga0495629_0249472
2347 Ga0495641_0021558
2348 Ga0495641_0027803
2349 Ga0495641_0124457
2350 Ga0495641_0217734
2351 Ga0495651_0000514
2352 Ga0495651_0015536
2353 Ga0495651_0038788
2354 Ga0495651_0163357
2355 Ga0495653_0000928
2356 Ga0495653_0017250
2357 Ga0495653_0019183
2358 Ga0495650_0024137
2359 Ga0495580_0021820
2360 Ga0495580_0022796
2361 Ga0495580_0107751
2362 Ga0495580_0113425
2363 Ga0495580_0182045
2364 Ga0495582_0013255
2365 Ga0495582_0028396
2366 Ga0495582_0241590
2367 Ga0495582_0284537
2368 Ga0495605_0034824
2369 Ga0495639_0237218
2370 Ga0495662_0008984
2371 Ga0495662_0122940
2372 Ga0495662_0131930
2373 Ga0495662_0231796
2374 Ga0495664_0012425
2375 Ga0495664_0021800
2376 Ga0495664_0025369
2377 Ga0495664_0037733
2378 Ga0495664_0085136
2379 Ga0495664_0089763
2380 Ga0495664_0143878
2381 Ga0495584_0038768
2382 Ga0495584_0087774
2383 Ga0495585_0012824
2384 Ga0495585_0171157
2385 Ga0495594_0080692
2386 Ga0495607_0028730
2387 Ga0495608_0000211
2388 Ga0495608_0013911
2389 Ga0495608_0017291
2390 Ga0495608_0028242
2391 Ga0495616_0116940
2392 Ga0495618_0004258
2393 Ga0495618_0007886
2394 Ga0495618_0061862
2395 Ga0495618_0087832
2396 Ga0495628_0001017
2397 Ga0495628_0058738
2398 Ga0495628_0060309
2399 Ga0495628_0242728
2400 Ga0495628_0581616
2401 Ga0495630_0030857
2402 Ga0495630_0033639
2403 Ga0495630_0047187
2404 Ga0495630_0310397
2405 Ga0495630_0429917
2406 Ga0495637_0017568
2407 Ga0495643_0152182
2408 Ga0495644_0000207
2409 Ga0495663_0108428
2410 Ga0495666_0008778
2411 Ga0495666_0057605
2412 Ga0495652_0009353
2413 Ga0495652_0010381
2414 Ga0495652_0049242
2415 Ga0495652_0053555
2416 Ga0495652_0181217
2417 Ga0495652_0399323
2418 Ga0495665_0005144
2419 Ga0495665_0029177
2420 Ga0495640_0002965
2421 Ga0495640_0025900
2422 Ga0495640_0058225
2423 Ga0495640_0088902
2424 Ga0495640_0153154
2425 Ga0495587_0003782
2426 Ga0495587_0012005
2427 Ga0495587_0012054
2428 Ga0495587_0038988
2429 Ga0495598_0102915
2430 Ga0495609_0024001
2431 Ga0495609_0025772
2432 Ga0495621_0053497
2433 Ga0495645_0005364
2434 Ga0495645_0025415
2435 Ga0495645_0035601
2436 Ga0495645_0061742
2437 Ga0495645_0526320
2438 Ga0495622_0032721
2439 Ga0495633_0007791
2440 Ga0495633_0320059
2441 Ga0495667_0004263
2442 Ga0495667_0019341
2443 Ga0495667_0030062
2444 Ga0495667_0039123
2445 Ga0495667_0068781
2446 Ga0495667_0113311
2447 Ga0495667_0453675
2448 Ga0495656_0000115
2449 Ga0495656_0168039
2450 Ga0495668_0192854
2451 Ga0495634_0016926
2452 Ga0495634_0030683
2453 Ga0495634_0043090
2454 Ga0495634_0098548
2455 Ga0495634_0136460
2456 Ga0495634_0218727
2457 Ga0495611_0000905
2458 Ga0495611_0141749
2459 Ga0495635_0011378
2460 Ga0495635_0023649
2461 Ga0495635_0024578
2462 Ga0495635_0026118
2463 Ga0495635_0118612
2464 Ga0495635_0361528
2465 Ga0495635_0470423
2466 Ga0495659_0000545
2467 Ga0495659_0012800
2468 Ga0495659_0214901
2469 Ga0495588_0030812
2470 Ga0495657_0008566
2471 Ga0495657_0017487
2472 Ga0495657_0075843
2473 Ga0495599_0029916
2474 Ga0495599_0036753
2475 Ga0495599_0095308
2476 Ga0495623_0002503
2477 Ga0495623_0002644
2478 Ga0495623_0034441
2479 Ga0495646_0011541
2480 Ga0495646_0037089
2481 Ga0495646_0039108
2482 Ga0495646_0069665
2483 Ga0495647_0002731
2484 Ga0495647_0005717
2485 Ga0495647_0020426
2486 Ga0495658_0006761
2487 Ga0495658_0019872
2488 Ga0495658_0038304
2489 Ga0495658_0131430
2490 Ga0495669_0035049
2491 Ga0495613_0045913
2492 Ga0495613_0047306
2493 Ga0495613_0101469
2494 Ga0495613_0222408
2495 Ga0495613_0264799
2496 Ga0495624_0004214
2497 Ga0495624_0067263
2498 Ga0495670_0000652
2499 Ga0495671_0155040
2500 Ga0495671_0314924
2501 Ga0495649_0030157
2502 Ga0495600_0000802
2503 Ga0495600_0004409
2504 Ga0495600_0057523
2505 Ga0495600_0112870
2506 Ga0495600_0170895
2507 Ga0495581_0123148
2508 Ga0495604_0000360
2509 Ga0495604_0013734
2510 Ga0495604_0021779
2511 Ga0495604_0029690
2512 Ga0495604_0044072
2513 Ga0495604_0098888
2514 Ga0495604_0288534
2515 Ga0495674_0008238
2516 Ga0495674_0020349
2517 Ga0495674_0027922
2518 Ga0495674_0119139
2519 Ga0495674_0302464
2520 Ga0495674_0387673
2521 Ga0495676_0029954
2522 Ga0495676_0088439
2523 Ga0495676_0145853
2524 Ga0495676_0257412
2525 Ga0495680_0000313
2526 Ga0495680_0008135
2527 Ga0495680_0009019
2528 Ga0495680_0009794
2529 Ga0495680_0012298
2530 Ga0495680_0021698
2531 Ga0495683_0097902
2532 Ga0495675_0002612
2533 Ga0495675_0005504
2534 Ga0495675_0023436
2535 Ga0495675_0090715
2536 Ga0495679_045429
2537 Ga0495684_0006921
2538 Ga0495684_0012904
2539 Ga0495684_0028950
2540 Ga0495684_0037199
2541 Ga0495684_0154521
2542 Ga0495684_0218035
2543 Ga0495684_0404979
2544 Ga0495684_0595589
2545 Ga0495593_0009519
2546 Ga0495593_0010594
2547 Ga0495593_0013212
2548 Ga0495593_0023469
2549 Ga0495593_0043909
2550 Ga0495602_0005154
2551 Ga0495602_0010330
2552 Ga0495602_0033303
2553 Ga0495614_0008099
2554 Ga0495614_0170827
2555 Ga0495614_0220273
2556 Ga0496100_0000330
2557 Ga0496100_0009383
2558 Ga0496100_0023823
2559 Ga0496100_0029006
2560 Ga0496100_0077564
2561 Ga0496100_0145774
2562 Ga0496100_0308741
2563 Ga0496101_0000079
2564 Ga0496101_0023269
2565 Ga0496101_0118402
2566 Ga0496101_0122285
2567 Ga0496101_0207779
2568 Ga0496102_0011543
2569 Ga0496102_0016791
2570 Ga0496102_0150356
2571 Ga0496102_0330576
2572 Ga0496103_0033302
2573 Ga0496103_0053360
2574 Ga0496103_0082012
2575 Ga0496103_0143933
2576 Ga0496103_0533931
2577 Ga0496104_0002973
2578 Ga0496104_0004496
2579 Ga0496104_0006726
2580 Ga0496104_0032893
2581 Ga0496104_0055353
2582 Ga0496104_0237208
2583 Ga0496104_0264241
2584 Ga0496104_0458661
2585 Ga0496105_0000168
2586 Ga0496105_0006753
2587 Ga0496105_0013976
2588 Ga0496105_0074656
2589 Ga0496105_0083503
2590 Ga0496105_0096415
2591 Ga0496105_0108576
2592 Ga0496105_0254264
2593 Ga0496106_0006208
2594 Ga0496106_0029911
2595 Ga0496106_0038114
2596 Ga0496106_0040359
2597 Ga0496106_0054441
2598 Ga0496106_0092676
2599 Ga0496106_0112137
2600 Ga0496106_0155878
2601 Ga0496106_0439510
2602 Ga0496106_0461549
2603 Ga0496106_0844964
2604 Ga0496107_0000143
2605 Ga0496107_0018391
2606 Ga0496107_0031013
2607 Ga0496107_0066654
2608 Ga0496107_0144818
2609 Ga0496107_0189071
2610 Ga0496107_0489529
2611 Ga0496108_0000698
2612 Ga0496108_0002282
2613 Ga0496108_0079539
2614 Ga0496108_0105543
2615 Ga0496108_0127622
2616 Ga0496108_0168884
2617 Ga0496109_0000372
2618 Ga0496109_0001273
2619 Ga0496109_0060513
2620 Ga0496109_0067473
2621 Ga0496109_0087794
2622 Ga0496109_0098090
2623 Ga0496109_0192314
2624 Ga0496109_0234404
2625 Ga0496110_0026148
2626 Ga0496110_0046987
2627 Ga0496110_0060214
2628 Ga0496110_0183648
2629 Ga0496110_0188174
2630 Ga0496110_0355062
2631 Ga0496111_0005807
2632 Ga0496111_0062687
2633 Ga0496111_0067957
2634 Ga0496111_0242382
2635 Ga0496112_0010618
2636 Ga0496112_0025350
2637 Ga0496112_0072202
2638 Ga0496112_0183205
2639 Ga0496112_0190144
2640 Ga0496112_0507152
2641 Ga0496112_0869176
2642 Ga0496113_0000303
2643 Ga0496113_0018311
2644 Ga0496113_0169256
2645 Ga0496113_0190964
2646 Ga0496114_0006447
2647 Ga0496114_0006628
2648 Ga0496114_0035294
2649 Ga0496114_0072783
2650 Ga0496114_0092133
2651 Ga0496114_0156176
2652 Ga0496114_0549100
2653 Ga0496114_0640165
2654 Ga0496115_0000653
2655 Ga0496115_0032306
2656 Ga0496115_0057674
2657 Ga0496115_0237146
2658 Ga0496121_0315804
2659 Ga0496125_0177061
2660 Ga0501032_0428227
2661 Ga0501036_0286192
2662 Ga0501038_0494806
2663 Ga0501040_0507677
2664 Ga0501041_0482298
2665 Ga0501042_0521071
2666 Ga0501043_0444979
2667 Ga0501046_0469607
2668 Ga0501047_0172166
2669 Ga0501068_0227837
2670 Ga0501073_0169869
2671 Ga0501073_0467739
2672 Ga0501073_0555261
2673 Ga0501076_0246054
2674 Ga0501077_0057332
2675 Ga0501079_0066389
2676 Ga0501079_0142917
2677 Ga0501079_0238919
2678 Ga0501080_0140727
2679 Ga0501080_0886884
2680 Ga0501081_0218218
2681 Ga0501035_0713528
2682 Ga0501044_0329102
2683 Ga0501044_0546010
2684 nmdc:mga03683_43877_c1
2685 nmdc:mga03n38_24716_c1
2686 nmdc:mga03n38_3107_c1
2687 nmdc:mga00v17_4589_c1
2688 nmdc:mga00v17_9497_c1
2689 nmdc:mga0yw44_246680_c1
2690 nmdc:mga0yw44_27074_c1
2691 nmdc:mga0yw44_280357_c1
2692 nmdc:mga0yw44_282133_c1
2693 nmdc:mga0k408_6133_c1
2694 nmdc:mga06z11_1635_c1
2695 nmdc:mga06z11_213158_c1
2696 nmdc:mga07m45_20193_c1
2697 nmdc:mga07m45_284100_c1
2698 nmdc:mga07m45_35092_c2
2699 nmdc:mga05p37_111_c2
2700 nmdc:mga05p37_118283_c1
2701 nmdc:mga05p37_126617_c1
2702 nmdc:mga05p37_17687_c1
2703 nmdc:mga05p37_181482_c1
2704 nmdc:mga05p37_244589_c1
2705 nmdc:mga05p37_359050_c1
2706 nmdc:mga05p37_69071_c1
2707 nmdc:mga09592_27955_c1
2708 nmdc:mga0qj67_12821_c1
2709 nmdc:mga0qj67_189_c1
2710 nmdc:mga0qj67_455860_c1
2711 nmdc:mga0qj67_529173_c1
2712 nmdc:mga0qj67_65800_c1
2713 nmdc:mga06r32_10349_c1
2714 nmdc:mga06r32_1248255_c1
2715 nmdc:mga06r32_496949_c1
2716 nmdc:mga06r32_87163_c1
2717 nmdc:mga08y16_1052_c1
2718 nmdc:mga08y16_1139186_c1
2719 nmdc:mga08y16_24425_c1
2720 nmdc:mga08y16_3254_c1
2721 nmdc:mga08y16_338474_c1
2722 nmdc:mga08y16_395135_c1
2723 nmdc:mga08y16_4695_c1
2724 nmdc:mga08y16_521552_c1
2725 nmdc:mga0n895_193244_c1
2726 nmdc:mga0n895_19600_c1
2727 nmdc:mga0n895_28635_c1
2728 nmdc:mga0n895_28850_c1
2729 nmdc:mga0n895_424793_c1
2730 nmdc:mga0n895_6052_c1
2731 nmdc:mga0n895_61201_c1
2732 nmdc:mga0rr50_23552_c1
2733 nmdc:mga0rr50_276658_c1
2734 nmdc:mga0rr50_316719_c1
2735 nmdc:mga0rr50_45233_c1
2736 nmdc:mga0rr50_565337_c1
2737 nmdc:mga08x19_119633_c1
2738 nmdc:mga08x19_23491_c1
2739 nmdc:mga08x19_99010_c1
2740 nmdc:mga0a205_122710_c1
2741 nmdc:mga0a205_2125_c1
2742 nmdc:mga0a205_2281_c1
2743 nmdc:mga0a205_238201_c1
2744 nmdc:mga0a205_28775_c1
2745 nmdc:mga0a205_553809_c1
2746 nmdc:mga0sz30_4997_c1
2747 Ga0495601_0000114
2748 Ga0495601_0001485
2749 Ga0495601_0013078
2750 Ga0495601_0036766
2751 Ga0495601_0054986
2752 Ga0495601_0063087
2753 Ga0495601_0088230
2754 Ga0495612_0001226
2755 Ga0495612_0005655
2756 Ga0495612_0009022
2757 Ga0495612_0025884
2758 Ga0495612_0071136
2759 Ga0495612_0104824
2760 Ga0495595_0000718
2761 Ga0495595_0001264
2762 Ga0495595_0001866
2763 Ga0495595_0004743
2764 Ga0495595_0062728
2765 Ga0495595_0133648
2766 Ga0495595_0238950
2767 Ga0495619_0000201
2768 Ga0495619_0000206
2769 Ga0495619_0006226
2770 Ga0495619_0009047
2771 Ga0495619_0014776
2772 Ga0495619_0025483
2773 Ga0495619_0057902
2774 Ga0495619_0061983
2775 Ga0495619_0128449
2776 Ga0495619_0199627
2777 Ga0500554_014966
2778 Ga0500593_001549
2779 Ga0500595_001180
2780 Ga0500652_000077
2781 Ga0500658_0234398
2782 Ga0500590_099473
2783 Ga0500603_035405
2784 Ga0500637_0009067
2785 Ga0500645_095559
2786 Ga0501084_0313371
2787 Ga0500661_001671
2788 Ga0501082_0000101
2789 Ga0501082_0209664
2790 Ga0530510_0434223

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02224

Cytidylate_kin

Cytidylate kinase

35

236

0.94

PF13189

Cytidylate_kin2

Cytidylate kinase-like family

34

205

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fem-assembly1.cif.gz_A mutant r188m of the cytidine monophosphate kinase from e. coli 0.8761 2 205
1cke-assembly1.cif.gz_A cmp kinase from escherichia coli free enzyme structure 0.8755 2 205
4e22-assembly1.cif.gz_A structure of cytidine monophosphate kinase from yersinia pseudotuberculosis 0.8716 2 204
3r20-assembly1.cif.gz_A crystal structure of cytidylate kinase from mycobacterium smegmatis 0.8539 1 200
2feo-assembly1.cif.gz_A mutant r188m of the cytidine monophosphate kinase from e. coli complexed with dcmp 0.8395 2 204
ID Description Score Start End Superfamily
2femA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8761 2 205 3.40.50.300
af_P96391_36_146_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8744 1 25 3.40.50.300
af_D3ZKU6_1_282_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8287 1 22 3.40.50.300
2h92C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8068 1 204 3.40.50.300
2h92C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7762 1 204 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A285M6Y7-F1-model_v4 Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) 0.9881 1 207 GO:0005524
GO:0005737
GO:0006220
GO:0036430
GO:0036431
AF-A0A528PHJ3-F1-model_v4 deleted 0.9812 106 212
AF-A0A3D2W2X5-F1-model_v4 (d)CMP kinase (EC 2.7.4.25) 0.9787 98 206 GO:0004127
GO:0005524
AF-A0A529AYW8-F1-model_v4 (d)CMP kinase (EC 2.7.4.25) 0.9778 94 212 GO:0005524
GO:0036430
GO:0036431
AF-A0A350LRY6-F1-model_v4 (d)CMP kinase (EC 2.7.4.25) 0.9765 102 206 GO:0004127
GO:0005524

Map