F493528

General Info

Members Datasets Scaffolds Average Seq Length
1382 997 763 293

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3000135777|3000139708
Length 330
Sequence APFAPLSLKPRPRRKRRFSRLSPDTTTELCLDMSIQAIEDTKVKVFPAPPEPSKVIAFAPKARRRFDPLAILSKLAGTLLPPVVVIVLMLVVWQVACSSPTASLPPPSQVWNEAYDLIAHPFFDNGPQDIGLAWRVLISLQRVAIGFGLAAIVGVALGALVGQSVWAMRGLDPVFQILRTVPPLAWLPLSLAAFRDSSPSAIFVIFITSIWPVIINTAVGVRNIPEDYRNVARILRLNQIEFFVKIMVPAAAPYIFTGLRIGIGLSWLAIVAAEMLTGGVGIGFFIWDAWNSSRLPDIIVALAYIGVTGFCLDRLVAAVGGVVTRGTTAK

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
3 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
4 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
5 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
6 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
7 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
8 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
9 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
10 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
11 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
12 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
13 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
14 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
15 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
16 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
17 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
18 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
19 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
20 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
21 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
22 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
23 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
24 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
25 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
26 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
27 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
28 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
29 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
30 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
31 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
32 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
33 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
34 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
35 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
36 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
37 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
38 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
39 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
40 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
41 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
42 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
43 2519899620 Rhizobium sp. Pop5 Isolate Nodule
44 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
45 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
46 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
47 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
48 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
49 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
50 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
51 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
52 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
53 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
54 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
55 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
56 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
57 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
58 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
59 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
60 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
61 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
62 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
63 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
64 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
65 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
66 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
67 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
68 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
69 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
70 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
71 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
72 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
73 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
74 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
75 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
76 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
77 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
78 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
79 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
80 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
81 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
82 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
83 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
84 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
85 2643221568 Rhizobium sp. Root564 Isolate Unclassified
86 2643221582 Rhizobium sp. Root651 Isolate Unclassified
87 2643221607 Rhizobium sp. Root73 Isolate Unclassified
88 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
89 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
90 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
91 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
92 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
93 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
94 2643221693 Rhizobium sp. Root491 Isolate Unclassified
95 2643221719 Rhizobium sp. Root274 Isolate Unclassified
96 2643221734 Bosea sp. Root670 Isolate Unclassified
97 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
98 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
99 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
100 2718217882 Rhizobium sp. N741 Isolate Nodule
101 2718217927 Rhizobium sp. N324 Isolate Nodule
102 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
103 2718218009 Rhizobium sp. N561 Isolate Nodule
104 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
105 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
106 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
107 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
108 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
109 2718218363 Rhizobium sp. N113 Isolate Nodule
110 2718218365 Rhizobium sp. N731 Isolate Nodule
111 2718218366 Rhizobium sp. N621 Isolate Nodule
112 2718218423 Rhizobium sp. N941 Isolate Nodule
113 2721755514 Rhizobium sp. N6212 Isolate Nodule
114 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
115 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
116 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
117 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
118 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
119 2721755809 Rhizobium sp. N541 Isolate Nodule
120 2721755810 Rhizobium sp. N871 Isolate Nodule
121 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
122 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
123 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
124 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
125 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
126 2728369365 Rhizobium sp. N1341 Isolate Nodule
127 2728369397 Rhizobium sp. N1314 Isolate Nodule
128 2738541293 Rhizobium sp. GV031 Isolate Unclassified
129 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
130 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
131 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
132 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
133 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
134 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
135 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
136 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
137 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
138 2791355199
139 2791355256 Rhizobium sp. M10 Isolate Nodule
140 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
141 2791355260 Rhizobium sp. L9 Isolate Nodule
142 2791355261 Rhizobium sp. J15 Isolate Nodule
143 2791355262 Rhizobium sp. M1 Isolate Nodule
144 2791355263 Rhizobium chutanense C5 Isolate Nodule
145 2791355264 Rhizobium sp. S9 Isolate Nodule
146 2791355265 Rhizobium sp. H4 Isolate Nodule
147 2791355266 Rhizobium sp. L43 Isolate Nodule
148 2791355267 Rhizobium sp. L18 Isolate Nodule
149 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
150 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
151 2802429633 Rhizobium anhuiense J3 Isolate Nodule
152 2802429634 Rhizobium anhuiense S10 Isolate Nodule
153 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
154 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
155 2802429637 Rhizobium anhuiense C15 Isolate Nodule
156 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
157 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
158 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
159 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
160 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
161 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
162 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
163 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
164 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
165 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
166 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
167 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
168 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
169 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
170 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
171 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
172 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
173 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
174 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
175 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
176 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
177 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
178 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
179 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
180 2838048938 Rhizobium pisi 27/80 Isolate Nodule
181 2838061910 Rhizobium phaseoli L15 Isolate Nodule
182 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
183 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
184 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
185 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
186 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
187 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
188 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
189 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
190 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
191 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
192 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
193 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
194 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
195 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
196 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
197 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
198 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
199 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
200 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
201 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
202 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
203 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
204 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
205 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
206 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
207 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
208 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
209 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
210 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
211 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
212 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
213 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
214 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
215 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
216 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
217 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
218 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
219 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
220 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
221 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
222 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
223 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
224 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
225 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
226 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
227 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
228 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
229 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
230 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
231 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
232 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
233 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
234 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
235 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
236 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
237 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
238 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
239 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
240 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
241 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
242 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
243 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
244 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
245 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
246 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
247 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
248 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
249 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
250 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
251 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
252 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
253 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
254 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
255 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
256 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
257 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
258 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
259 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
260 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
261 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
262 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
263 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
264 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
265 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
266 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
267 2851182111 Bosea sp. Tri-44 Isolate Nodule
268 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
269 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
270 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
271 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
272 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
273 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
274 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
275 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
276 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
277 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
278 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
279 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
280 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
281 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
282 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
283 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
284 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
285 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
286 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
287 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
288 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
289 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
290 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
291 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
292 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
293 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
294 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
295 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
296 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
297 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
298 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
299 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
300 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
301 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
302 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
303 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
304 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
305 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
306 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
307 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
308 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
309 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
310 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
311 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
312 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
313 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
314 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
315 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
316 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
317 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
318 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
319 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
320 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
321 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
322 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
323 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
324 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
325 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
326 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
327 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
328 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
329 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
330 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
331 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
332 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
333 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
334 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
335 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
336 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
337 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
338 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
339 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
340 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
341 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
342 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
343 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
344 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
345 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
346 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
347 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
348 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
349 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
350 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
351 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
352 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
353 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
354 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
355 2904699407
356 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
357 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
358 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
359 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
360 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
361 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
362 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
363 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
364 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
365 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
366 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
367 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
368 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
369 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
370 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
371 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
372 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
373 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
374 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
375 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
376 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
377 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
378 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
379 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
380 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
381 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
382 2922368715
383 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
384 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
385 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
386 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
387 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
388 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
389 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
390 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
391 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
392 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
393 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
394 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
395 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
396 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
397 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
398 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
399 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
400 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
401 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
402 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
403 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
404 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
405 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
406 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
407 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
408 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
409 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
410 2933599457 Rhizobium phaseoli M3 Isolate Nodule
411 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
412 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
413 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
414 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
415 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
416 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
417 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
418 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
419 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
420 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
421 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
422 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
423 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
424 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
425 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
426 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
427 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
428 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
429 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
430 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
431 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
432 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
433 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
434 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
435 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
436 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
437 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
438 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
439 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
440 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
441 2936381700 Rhizobium chutanense C16 Isolate Unclassified
442 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
443 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
444 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
445 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
446 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
447 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
448 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
449 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
450 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
451 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
452 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
453 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
454 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
455 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
456 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
457 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
458 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
459 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
460 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
461 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
462 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
463 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
464 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
465 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
466 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
467 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
468 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
469 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
470 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
471 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
472 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
473 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
474 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
475 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
476 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
477 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
478 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
479 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
480 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
481 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
482 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
483 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
484 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
485 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
486 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
487 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
488 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
489 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
490 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
491 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
492 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
493 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
494 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
495 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
496 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
497 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
498 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
499 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
500 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
501 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
502 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
503 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
504 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
505 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
506 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
507 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
508 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
509 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
510 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
511 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
512 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
513 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
514 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
515 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
516 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
517 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
518 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
519 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
520 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
521 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
522 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
523 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
524 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
525 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
526 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
527 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
528 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
529 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
530 2996887358 Rhizobium sp. R711 Isolate Nodule
531 2996893221 Rhizobium sp. R635 Isolate Nodule
532 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
533 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
534 3004167301 Mesorhizobium loti 582 Isolate Unclassified
535 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
536 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
537 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
538 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
539 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
540 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
541 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
542 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
543 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
544 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
545 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
546 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
547 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
548 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
549 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
550 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
551 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
552 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
553 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
554 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
555 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
556 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
557 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
558 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
559 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
560 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
561 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
562 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
563 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
564 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
565 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
566 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
567 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
568 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
569 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
570 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
571 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
572 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
573 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
574 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
575 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
576 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
577 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
578 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
579 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
580 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
581 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
582 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
583 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
584 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
585 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
586 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
587 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
588 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
589 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
590 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
591 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
592 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
593 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
594 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
595 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
596 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
597 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
598 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
599 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
600 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
601 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
602 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
603 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
604 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
605 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
606 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
607 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
608 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
609 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
610 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
611 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
612 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
613 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
614 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
615 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
616 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
617 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
618 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
619 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
620 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
621 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
622 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
623 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
624 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
625 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
626 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
627 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
628 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
629 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
630 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
631 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
632 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
633 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
634 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
635 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
636 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
637 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
638 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
639 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
640 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
641 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
642 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
643 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
644 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
645 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
646 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
647 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
648 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
649 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
650 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
651 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
652 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
653 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
654 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
655 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
656 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
657 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
658 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
659 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
660 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
661 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
662 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
663 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
664 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
665 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
666 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
667 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
668 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
669 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
670 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
671 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
672 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
673 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
674 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
675 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
676 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
677 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
678 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
679 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
680 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
681 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
682 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
683 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
684 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
685 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
686 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
687 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
688 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
689 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
690 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
691 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
692 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
693 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
694 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
695 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
696 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
697 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
698 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
699 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
700 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
701 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
702 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
703 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
704 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
705 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
706 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
707 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
708 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
709 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
710 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
711 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
712 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
713 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
714 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
715 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
716 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
717 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
718 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
719 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
720 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
721 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
722 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
723 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
724 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
725 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
726 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
727 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
728 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
729 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
730 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
731 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
732 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
733 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
734 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
735 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
736 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
737 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
738 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
739 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
740 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
741 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
742 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
743 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
744 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
745 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
746 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
747 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
748 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
749 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
750 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
751 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
752 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
753 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
754 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
755 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
756 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
757 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
758 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
759 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
760 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
761 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
762 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
763 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
764 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
765 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
766 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
767 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
768 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
769 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
770 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
771 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
772 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
773 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
774 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
775 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
776 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
777 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
778 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
779 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
780 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
781 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
782 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
783 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
784 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
785 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
786 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
787 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
788 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
789 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
790 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
791 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
792 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
793 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
794 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
795 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
796 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
797 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
798 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
799 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
800 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
801 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
802 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
803 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
804 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
805 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
806 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
807 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
808 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
809 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
810 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
811 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
812 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
813 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
814 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
815 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
816 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
817 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
818 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
819 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
820 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
821 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
822 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
823 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
824 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
825 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
826 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
827 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
828 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
829 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
830 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
831 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
832 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
833 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
834 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
835 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
836 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
837 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
838 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
839 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
840 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
841 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
842 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
843 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
844 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
845 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
846 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
847 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
848 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
849 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
850 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
851 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
852 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
853 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
854 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
855 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
856 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
857 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
858 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
859 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
860 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
861 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
862 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
863 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
864 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
865 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
866 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
867 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
868 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
869 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
870 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
871 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
872 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
873 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
874 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
875 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
876 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
877 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
878 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
879 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
880 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
881 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
882 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
883 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
884 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
885 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
886 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
887 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
888 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
889 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
890 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
891 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
892 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
893 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
894 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
895 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
896 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
897 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
898 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
899 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
900 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
901 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
902 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
903 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
904 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
905 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
906 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
907 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
908 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
909 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
910 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
911 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
912 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
913 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
914 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
915 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
916 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
917 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
918 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
919 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
920 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
921 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
922 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
923 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
924 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
925 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
926 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
927 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
928 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
929 641522639 Methylobacterium sp. 4-46 Isolate Nodule
930 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
931 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
932 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
933 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
934 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
935 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
936 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
937 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
938 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
939 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
940 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
941 8005258706 Rhizobium sp. R693 Isolate Nodule
942 8005275841 Rhizobium sp. N4311 Isolate Nodule
943 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
944 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
945 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
946 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
947 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
948 8005321885 Rhizobium sp. R72 Isolate Nodule
949 8005382845 Rhizobium sp. R634 Isolate Nodule
950 8005395548 Rhizobium sp. R339 Isolate Nodule
951 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
952 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
953 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
954 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
955 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
956 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
957 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
958 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
959 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
960 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
961 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
962 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
963 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
964 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
965 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
966 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
967 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
968 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
969 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
970 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
971 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
972 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
973 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
974 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
975 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
976 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
977 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
978 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
979 8018176218 Rhizobium sp. N122 Isolate Nodule
980 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
981 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
982 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
983 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
984 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
985 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
986 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
987 8024501048 Rhizobium sp. H4 Isolate Nodule
988 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
989 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
990 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
991 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
992 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
993 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
994 8056382006 Rhizobium croatiense 13T Isolate Nodule
995 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
996 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
997 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 55.33
Metatranscriptomes 0
Isolates 44.67

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0
Endosphere 17.08
Nodule 34.15
Rhizoplane 3.47
Rhizosphere 29.45
Stem 0
Stem Tuber 0
Unclassified 15.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000538 3300001979 Bacteria 16194
2 JGI25155J39150_1000056 3300002704 Bacteria 73160
3 JGI25156J39149_1000007 3300002705 Bacteria 252108
4 JGI25162J39368_1001472 3300002737 Bacteria 12352
5 JGI25162J39368_1002141 3300002737 Bacteria 8281
6 JGI25154J39366_1000013 3300002738 Bacteria 268260
7 JGI25157J39369_1000099 3300002741 Bacteria 73678
8 JGI25157J39369_1000789 3300002741 Bacteria 16171
9 JGI25152J39213_1000256 3300002773 Bacteria 35313
10 JGI25152J39213_1002687 3300002773 Bacteria 6526
11 JGI25150J39212_1000501 3300002774 Bacteria 16267
12 JGI25151J46595_10000007 3300003187 Bacteria 411751
13 JGI25151J46595_10000166 3300003187 Bacteria 85475
14 JGI25151J46595_10001633 3300003187 Bacteria 14780
15 JGI25151J46595_10034603 3300003187 Bacteria 1930
16 JGI25406J46586_10002619 3300003203 Bacteria 8483
17 JGI25406J46586_10023243 3300003203 Bacteria 2452
18 JGI25165J46597_1001164 3300003214 Bacteria 16187
19 JGI25165J46597_1001468 3300003214 Bacteria 12294
20 JGI25153J46596_10000313 3300003215 Bacteria 35777
21 JGI25153J46596_10005646 3300003215 Bacteria 6534
22 JGI25153J46596_10007051 3300003215 Bacteria 5592
23 JGI25153J46596_10014527 3300003215 Bacteria 3268
24 JGI25153J46596_10018377 3300003215 Bacteria 2718
25 rootH1_10020516 3300003316 Bacteria 1867
26 JGI25160J50197_1010224 3300003354 Bacteria 3406
27 JGI25161J50226_1001176 3300003374 Bacteria 8615
28 JGI25404J52841_10001894 3300003659 Bacteria 3828
29 Ga0055526_1001232 3300003771 Bacteria 18382
30 Ga0055526_1001408 3300003771 Bacteria 17103
31 Ga0055526_1001712 3300003771 Bacteria 15279
32 Ga0055526_1003004 3300003771 Bacteria 11014
33 Ga0055526_1010710 3300003771 Bacteria 4230
34 Ga0055524_1000518 3300003775 Bacteria 29714
35 Ga0055524_1004966 3300003775 Bacteria 6030
36 Ga0055524_1007981 3300003775 Bacteria 4442
37 Ga0055524_1011428 3300003775 Bacteria 3473
38 Ga0055536_1015097 3300003781 Bacteria 2665
39 Ga0055528_1000067 3300003790 Bacteria 83853
40 Ga0055528_1000515 3300003790 Bacteria 30346
41 Ga0055540_1000131 3300003792 Bacteria 75615
42 Ga0055540_1012983 3300003792 Bacteria 2573
43 Ga0055531_10008117 3300003794 Bacteria 5594
44 Ga0055531_10010658 3300003794 Bacteria 4539
45 Ga0058692_1006972 3300003856 Bacteria 3042
46 Ga0055543_1001269 3300004625 Bacteria 10400
47 Ga0065165_1000853 3300005262 Bacteria 39889
48 Ga0065165_1001807 3300005262 Bacteria 21012
49 Ga0065165_1010313 3300005262 Bacteria 4056
50 Ga0065165_1012631 3300005262 Bacteria 3422
51 Ga0065165_1040556 3300005262 Bacteria 1387
52 Ga0070658_10018138 3300005327 Bacteria 5631
53 Ga0070658_10245760 3300005327 Bacteria 1518
54 Ga0070676_10082362 3300005328 Bacteria 1955
55 Ga0068869_100059708 3300005334 Bacteria 2793
56 Ga0070666_10039936 3300005335 Bacteria 3129
57 Ga0070680_100000827 3300005336 Bacteria 21866
58 Ga0070661_100162391 3300005344 Bacteria 1692
59 Ga0070668_100007882 3300005347 Bacteria 7907
60 Ga0070668_100235246 3300005347 Bacteria 1516
61 Ga0070668_100296586 3300005347 Bacteria 1355
62 Ga0070675_100356182 3300005354 Bacteria 1298
63 Ga0070671_100024365 3300005355 Bacteria 4953
64 Ga0070671_100073928 3300005355 Bacteria 2847
65 Ga0070671_100253244 3300005355 Bacteria 1496
66 Ga0070674_100097276 3300005356 Bacteria 2138
67 Ga0070674_100140987 3300005356 Bacteria 1809
68 Ga0070688_100111268 3300005365 Bacteria 1822
69 Ga0070667_100009165 3300005367 Bacteria 8194
70 Ga0070667_100377141 3300005367 Bacteria 1288
71 Ga0070713_100000526 3300005436 Bacteria 24268
72 Ga0070711_100027954 3300005439 Bacteria 3707
73 Ga0070711_100122903 3300005439 Bacteria 1923
74 Ga0070694_100046563 3300005444 Bacteria 2912
75 Ga0070708_100518268 3300005445 Bacteria 1124
76 Ga0070663_100398778 3300005455 Bacteria 1124
77 Ga0070681_10000681 3300005458 Bacteria 28134
78 Ga0070685_10201166 3300005466 Bacteria 1295
79 Ga0070706_100131498 3300005467 Bacteria 2335
80 Ga0070699_100130139 3300005518 Bacteria 2218
81 Ga0070679_100008706 3300005530 Bacteria 9566
82 Ga0068853_100195167 3300005539 Bacteria 1841
83 Ga0070686_100088230 3300005544 Bacteria 2069
84 Ga0070695_100014398 3300005545 Bacteria 4768
85 Ga0070665_100002095 3300005548 Bacteria 22353
86 Ga0070665_100005120 3300005548 Bacteria 13587
87 Ga0070665_100076453 3300005548 Bacteria 3355
88 Ga0070665_100084443 3300005548 Bacteria 3181
89 Ga0070665_100087923 3300005548 Bacteria 3113
90 Ga0070665_100341725 3300005548 Bacteria 1502
91 Ga0068855_100381886 3300005563 Bacteria 1547
92 Ga0068857_100112605 3300005577 Bacteria 2446
93 Ga0068856_100036031 3300005614 Bacteria 4852
94 Ga0068856_100159392 3300005614 Bacteria 2267
95 Ga0068859_100073860 3300005617 Bacteria 3448
96 Ga0068859_100162981 3300005617 Bacteria 2309
97 Ga0068864_100519544 3300005618 Bacteria 1148
98 Ga0068863_100210085 3300005841 Bacteria 1874
99 Ga0068862_100334261 3300005844 Bacteria 1402
100 Ga0081455_10007852 3300005937 Bacteria 11173
101 Ga0081455_10007920 3300005937 Bacteria 11119
102 Ga0081455_10009013 3300005937 Bacteria 10299
103 Ga0081455_10034510 3300005937 Bacteria 4531
104 Ga0081455_10048637 3300005937 Bacteria 3662
105 Ga0081538_10009799 3300005981 Bacteria 7929
106 Ga0081538_10075112 3300005981 Bacteria 1836
107 Ga0081540_1000620 3300005983 Bacteria 33727
108 Ga0081540_1009656 3300005983 Bacteria 6631
109 Ga0081540_1014865 3300005983 Bacteria 4956
110 Ga0081540_1019574 3300005983 Bacteria 4106
111 Ga0081539_10000220 3300005985 Bacteria 133834
112 Ga0081539_10002437 3300005985 Bacteria 26263
113 Ga0081539_10008096 3300005985 Bacteria 9295
114 Ga0070717_10000425 3300006028 Bacteria 27019
115 Ga0070717_10381551 3300006028 Bacteria 1264
116 Ga0075365_10011544 3300006038 Bacteria 5198
117 Ga0075365_10011946 3300006038 Bacteria 5131
118 Ga0075365_10017754 3300006038 Bacteria 4361
119 Ga0075365_10018335 3300006038 Bacteria 4303
120 Ga0075365_10022109 3300006038 Bacteria 3979
121 Ga0075365_10057514 3300006038 Bacteria 2587
122 Ga0075365_10154006 3300006038 Bacteria 1599
123 Ga0075368_10008690 3300006042 Bacteria 3629
124 Ga0075368_10018661 3300006042 Bacteria 2608
125 Ga0075368_10023143 3300006042 Bacteria 2370
126 Ga0075368_10071327 3300006042 Bacteria 1403
127 Ga0075368_10071757 3300006042 Bacteria 1399
128 Ga0075363_100004037 3300006048 Bacteria 6352
129 Ga0075363_100135547 3300006048 Bacteria 1383
130 Ga0075364_10026122 3300006051 Bacteria 3722
131 Ga0075364_10047814 3300006051 Bacteria 2788
132 Ga0075364_10106883 3300006051 Bacteria 1865
133 Ga0075364_10140011 3300006051 Bacteria 1627
134 Ga0070716_100002328 3300006173 Bacteria 8746
135 Ga0070716_100220925 3300006173 Bacteria 1273
136 Ga0070712_100077880 3300006175 Bacteria 2391
137 Ga0070712_100120014 3300006175 Bacteria 1977
138 Ga0075362_10012384 3300006177 Bacteria 3387
139 Ga0075362_10023553 3300006177 Bacteria 2605
140 Ga0075367_10002198 3300006178 Bacteria 8795
141 Ga0075367_10002330 3300006178 Bacteria 8638
142 Ga0075367_10029612 3300006178 Bacteria 3133
143 Ga0075367_10035948 3300006178 Bacteria 2870
144 Ga0075367_10036519 3300006178 Bacteria 2850
145 Ga0075367_10043320 3300006178 Bacteria 2636
146 Ga0075367_10150714 3300006178 Bacteria 1443
147 Ga0075367_10163874 3300006178 Bacteria 1383
148 Ga0075369_10013828 3300006186 Bacteria 3212
149 Ga0075369_10121883 3300006186 Bacteria 1181
150 Ga0075427_10001903 3300006194 Bacteria 2742
151 Ga0075366_10009512 3300006195 Bacteria 5426
152 Ga0075366_10011331 3300006195 Bacteria 5032
153 Ga0075366_10072866 3300006195 Bacteria 2047
154 Ga0075370_10003168 3300006353 Bacteria 7782
155 Ga0075370_10020067 3300006353 Bacteria 3647
156 Ga0075370_10024134 3300006353 Bacteria 3356
157 Ga0075370_10080226 3300006353 Bacteria 1875
158 Ga0075370_10123501 3300006353 Bacteria 1508
159 Ga0075370_10129962 3300006353 Bacteria 1469
160 Ga0075428_100005390 3300006844 Bacteria 14222
161 Ga0075428_100026013 3300006844 Bacteria 6481
162 Ga0075428_100030504 3300006844 Bacteria 5962
163 Ga0075428_100115849 3300006844 Bacteria 2919
164 Ga0075428_100143877 3300006844 Bacteria 2592
165 Ga0075430_100000140 3300006846 Bacteria 46272
166 Ga0075430_100166447 3300006846 Bacteria 1834
167 Ga0075431_100001318 3300006847 Bacteria 22699
168 Ga0075431_100158117 3300006847 Bacteria 2331
169 Ga0075431_100203657 3300006847 Bacteria 2024
170 Ga0075431_100372918 3300006847 Bacteria 1432
171 Ga0075431_100411232 3300006847 Bacteria 1353
172 Ga0075433_10000050 3300006852 Bacteria 50089
173 Ga0075434_100000179 3300006871 Bacteria 41085
174 Ga0075429_100001170 3300006880 Bacteria 21187
175 Ga0075429_100116506 3300006880 Bacteria 2335
176 Ga0097620_100073871 3300006931 Bacteria 3448
177 Ga0097620_100162996 3300006931 Bacteria 2309
178 Ga0099825_1021826 3300006941 Bacteria 4258
179 Ga0099824_1029608 3300006942 Bacteria 2309
180 Ga0099822_1005398 3300006943 Bacteria 16681
181 Ga0099823_1024510 3300006944 Bacteria 5451
182 Ga0079104_1000014 3300006946 Bacteria 337362
183 Ga0099826_10000297 3300006948 Bacteria 22278
184 Ga0099826_10095024 3300006948 Bacteria 1813
185 Ga0075435_100001211 3300007076 Bacteria 16537
186 Ga0105240_10002521 3300009093 Bacteria 29396
187 Ga0111539_10000565 3300009094 Bacteria 47399
188 Ga0111539_10010599 3300009094 Bacteria 11607
189 Ga0111539_10225523 3300009094 Bacteria 2183
190 Ga0111539_10235929 3300009094 Bacteria 2129
191 Ga0105245_10006247 3300009098 Bacteria 10481
192 Ga0105245_10203045 3300009098 Bacteria 1904
193 Ga0105245_10364746 3300009098 Bacteria 1434
194 Ga0105247_10086689 3300009101 Bacteria 1982
195 Ga0114129_10003182 3300009147 Bacteria 23025
196 Ga0114129_10085173 3300009147 Bacteria 4385
197 Ga0114129_10400906 3300009147 Bacteria 1808
198 Ga0114129_10502866 3300009147 Bacteria 1583
199 Ga0114129_10690294 3300009147 Bacteria 1313
200 Ga0105243_10018705 3300009148 Bacteria 5248
201 Ga0105243_10060918 3300009148 Bacteria 3016
202 Ga0105248_10285149 3300009177 Bacteria 1859
203 Ga0105248_10777425 3300009177 Bacteria 1081
204 Ga0105237_10073940 3300009545 Bacteria 3400
205 Ga0105237_10436622 3300009545 Bacteria 1315
206 Ga0105238_10068422 3300009551 Bacteria 3552
207 Ga0105238_10171507 3300009551 Bacteria 2146
208 Ga0105249_10197633 3300009553 Bacteria 1966
209 Ga0105249_10420514 3300009553 Bacteria 1370
210 Ga0123341_1000019 3300009765 Bacteria 80932
211 Ga0123342_1014594 3300009766 Bacteria 7436
212 Ga0123342_1021209 3300009766 Bacteria 4598
213 Ga0099796_10016009 3300010159 Bacteria 2205
214 Ga0099796_10058057 3300010159 Bacteria 1363
215 Ga0105246_10052627 3300011119 Bacteria 2799
216 Ga0157373_10103869 3300013100 Bacteria 1998
217 Ga0157373_10160983 3300013100 Bacteria 1579
218 Ga0157371_10000304 3300013102 Bacteria 64521
219 Ga0157370_10013708 3300013104 Bacteria 8334
220 Ga0157370_10065483 3300013104 Bacteria 3438
221 Ga0157374_10388413 3300013296 Bacteria 1391
222 Ga0157375_10423927 3300013308 Bacteria 1496
223 Ga0157376_10183948 3300014969 Bacteria 1912
224 Ga0214544_1000001 3300021320 Bacteria 783667
225 Ga0214542_1000037 3300021321 Bacteria 159256
226 Ga0214545_1000003 3300021324 Bacteria 720274
227 Ga0214543_1000002 3300021327 Bacteria 712733
228 Ga0213872_10068402 3300021361 Bacteria 1602
229 Ga0209435_100006 3300025206 Bacteria 542459
230 Ga0209437_100023 3300025233 Bacteria 614195
231 Ga0209437_100341 3300025233 Bacteria 56114
232 Ga0207425_1000018 3300025245 Bacteria 411841
233 Ga0207425_1006064 3300025245 Bacteria 3356
234 Ga0209646_1000015 3300025246 Bacteria 542459
235 Ga0209026_1000023 3300025250 Bacteria 357521
236 Ga0209026_1000046 3300025250 Bacteria 262031
237 Ga0209677_112928 3300025253 Bacteria 1212
238 Ga0209148_1003099 3300025254 Bacteria 4863
239 Ga0209759_1000005 3300025256 Bacteria 542459
240 Ga0209759_1001309 3300025256 Bacteria 14669
241 Ga0209759_1018812 3300025256 Bacteria 1660
242 Ga0209129_1000026 3300025258 Bacteria 411839
243 Ga0209129_1001183 3300025258 Bacteria 15019
244 Ga0209129_1002648 3300025258 Bacteria 8493
245 Ga0209129_1010344 3300025258 Bacteria 2338
246 Ga0209233_1000062 3300025261 Bacteria 399685
247 Ga0209233_1000970 3300025261 Bacteria 12354
248 Ga0209233_1001664 3300025261 Bacteria 8655
249 Ga0209233_1003296 3300025261 Bacteria 5727
250 Ga0209233_1007903 3300025261 Bacteria 3332
251 Ga0209673_1000005 3300025273 Bacteria 692788
252 Ga0209673_1000310 3300025273 Bacteria 89821
253 Ga0209673_1001376 3300025273 Bacteria 23910
254 Ga0209673_1018003 3300025273 Bacteria 2584
255 Ga0209673_1018699 3300025273 Bacteria 2510
256 Ga0209673_1022555 3300025273 Bacteria 2169
257 Ga0209673_1023198 3300025273 Bacteria 2120
258 Ga0209130_1000709 3300025284 Bacteria 29714
259 Ga0209675_1003671 3300025291 Bacteria 7172
260 Ga0209675_1010802 3300025291 Bacteria 3081
261 Ga0209675_1014261 3300025291 Bacteria 2429
262 Ga0209675_1023374 3300025291 Bacteria 1602
263 Ga0209025_1000035 3300025294 Bacteria 411841
264 Ga0209025_1000053 3300025294 Bacteria 317600
265 Ga0209025_1000397 3300025294 Bacteria 89703
266 Ga0209025_1002007 3300025294 Bacteria 23295
267 Ga0209025_1002687 3300025294 Bacteria 18144
268 Ga0209025_1007209 3300025294 Bacteria 8376
269 Ga0209025_1007433 3300025294 Bacteria 8170
270 Ga0209025_1010571 3300025294 Bacteria 6236
271 Ga0209564_1000137 3300025295 Bacteria 183874
272 Ga0209564_1000150 3300025295 Bacteria 170318
273 Ga0209564_1000191 3300025295 Bacteria 142504
274 Ga0209564_1000511 3300025295 Bacteria 63773
275 Ga0209564_1005137 3300025295 Bacteria 7603
276 Ga0209564_1006466 3300025295 Bacteria 6311
277 Ga0209564_1007023 3300025295 Bacteria 5905
278 Ga0209758_1000011 3300025297 Bacteria 1049685
279 Ga0209758_1000040 3300025297 Bacteria 411841
280 Ga0209758_1000477 3300025297 Bacteria 66111
281 Ga0209758_1000585 3300025297 Bacteria 56861
282 Ga0209758_1000662 3300025297 Bacteria 51542
283 Ga0209758_1001274 3300025297 Bacteria 31178
284 Ga0209758_1001596 3300025297 Bacteria 25926
285 Ga0209758_1002622 3300025297 Bacteria 17886
286 Ga0209758_1002716 3300025297 Bacteria 17425
287 Ga0209758_1004840 3300025297 Bacteria 10864
288 Ga0209758_1005670 3300025297 Bacteria 9445
289 Ga0209758_1013489 3300025297 Bacteria 4449
290 Ga0209758_1023161 3300025297 Bacteria 2818
291 Ga0209050_1001525 3300025298 Bacteria 24412
292 Ga0209256_1000108 3300025299 Bacteria 185884
293 Ga0209256_1000243 3300025299 Bacteria 96714
294 Ga0209256_1000740 3300025299 Bacteria 42806
295 Ga0209256_1003072 3300025299 Bacteria 12269
296 Ga0209256_1003322 3300025299 Bacteria 11411
297 Ga0209256_1005504 3300025299 Bacteria 7245
298 Ga0209256_1008896 3300025299 Bacteria 4532
299 Ga0207426_1000198 3300025302 Bacteria 146241
300 Ga0207426_1000292 3300025302 Bacteria 99342
301 Ga0207426_1000355 3300025302 Bacteria 83450
302 Ga0207426_1003205 3300025302 Bacteria 9213
303 Ga0207426_1057592 3300025302 Bacteria 1130
304 Ga0209051_1000038 3300025303 Bacteria 320926
305 Ga0209051_1002277 3300025303 Bacteria 14058
306 Ga0209051_1002823 3300025303 Bacteria 11969
307 Ga0209051_1037393 3300025303 Bacteria 1780
308 Ga0209257_1000654 3300025304 Bacteria 54783
309 Ga0209257_1008917 3300025304 Bacteria 5523
310 Ga0209257_1012956 3300025304 Bacteria 3772
311 Ga0207655_1047574 3300025728 Bacteria 1769
312 Ga0207713_1038563 3300025735 Bacteria 2026
313 Ga0207710_10033864 3300025900 Bacteria 2242
314 Ga0207710_10117633 3300025900 Bacteria 1267
315 Ga0207680_10027354 3300025903 Bacteria 3174
316 Ga0207647_10019881 3300025904 Bacteria 4509
317 Ga0207645_10072761 3300025907 Bacteria 2201
318 Ga0207705_10008204 3300025909 Bacteria 7641
319 Ga0207705_10323885 3300025909 Bacteria 1184
320 Ga0207707_10014526 3300025912 Bacteria 6857
321 Ga0207695_10055812 3300025913 Bacteria 4114
322 Ga0207671_10008285 3300025914 Bacteria 8839
323 Ga0207693_10005998 3300025915 Bacteria 10074
324 Ga0207693_10022689 3300025915 Bacteria 4987
325 Ga0207693_10087797 3300025915 Bacteria 2437
326 Ga0207663_10040021 3300025916 Bacteria 2846
327 Ga0207662_10033751 3300025918 Bacteria 2985
328 Ga0207652_10039117 3300025921 Bacteria 4024
329 Ga0207681_10091151 3300025923 Bacteria 2177
330 Ga0207694_10047057 3300025924 Bacteria 3336
331 Ga0207650_10127444 3300025925 Bacteria 1988
332 Ga0207687_10009010 3300025927 Bacteria 6523
333 Ga0207687_10116915 3300025927 Bacteria 1988
334 Ga0207700_10001358 3300025928 Bacteria 13877
335 Ga0207644_10014803 3300025931 Bacteria 5228
336 Ga0207644_10150474 3300025931 Bacteria 1800
337 Ga0207686_10129469 3300025934 Bacteria 1729
338 Ga0207709_10031822 3300025935 Bacteria 3084
339 Ga0207670_10041485 3300025936 Bacteria 3027
340 Ga0207665_10000837 3300025939 Bacteria 20779
341 Ga0207711_10051640 3300025941 Bacteria 3522
342 Ga0207711_10187050 3300025941 Bacteria 1886
343 Ga0207689_10068552 3300025942 Bacteria 2915
344 Ga0207689_10071966 3300025942 Bacteria 2840
345 Ga0207689_10101561 3300025942 Bacteria 2362
346 Ga0207667_10011494 3300025949 Bacteria 10284
347 Ga0207712_10063367 3300025961 Bacteria 2632
348 Ga0207668_10172844 3300025972 Bacteria 1696
349 Ga0207658_10089841 3300025986 Bacteria 2379
350 Ga0207703_10077531 3300026035 Bacteria 2759
351 Ga0207703_10090163 3300026035 Bacteria 2576
352 Ga0207639_10120702 3300026041 Bacteria 2153
353 Ga0207639_10159169 3300026041 Bacteria 1901
354 Ga0207678_10091910 3300026067 Bacteria 2594
355 Ga0207678_10448528 3300026067 Bacteria 1121
356 Ga0207708_10036315 3300026075 Bacteria 3752
357 Ga0207702_10025869 3300026078 Bacteria 4872
358 Ga0207702_10286621 3300026078 Bacteria 1559
359 Ga0207674_10135330 3300026116 Bacteria 2426
360 Ga0207683_10039324 3300026121 Bacteria 4126
361 Ga0207698_10476688 3300026142 Bacteria 1210
362 Ga0209281_1000032 3300027111 Bacteria 401727
363 Ga0209389_1000014 3300027296 Bacteria 188621
364 Ga0209389_1000077 3300027296 Bacteria 91273
365 Ga0209371_1000035 3300027312 Bacteria 368979
366 Ga0209371_1000135 3300027312 Bacteria 121718
367 Ga0209371_1000703 3300027312 Bacteria 28337
368 Ga0209371_1004170 3300027312 Bacteria 6449
369 Ga0209589_1000011 3300027357 Bacteria 236981
370 Ga0209589_1000020 3300027357 Bacteria 188617
371 Ga0209489_100012 3300027361 Bacteria 236981
372 Ga0209489_100251 3300027361 Bacteria 91273
373 Ga0209489_102003 3300027361 Bacteria 41928
374 Ga0209700_100019 3300027363 Bacteria 236981
375 Ga0209700_100271 3300027363 Bacteria 91215
376 Ga0209282_1001209 3300027666 Bacteria 13945
377 Ga0209282_1076496 3300027666 Bacteria 1802
378 Ga0209588_1017885 3300027671 Bacteria 2203
379 Ga0209813_10003425 3300027866 Bacteria 3712
380 Ga0209813_10005539 3300027866 Bacteria 3070
381 Ga0207428_10000485 3300027907 Bacteria 47761
382 Ga0207428_10078186 3300027907 Bacteria 2589
383 Ga0207428_10128621 3300027907 Bacteria 1939
384 Ga0268266_10013114 3300028379 Bacteria 7146
385 Ga0268266_10023772 3300028379 Bacteria 5215
386 Ga0268266_10125650 3300028379 Bacteria 2288
387 Ga0268266_10130106 3300028379 Bacteria 2250
388 Ga0268266_10131120 3300028379 Bacteria 2242
389 Ga0268266_10454598 3300028379 Bacteria 1218
390 Ga0268265_10157703 3300028380 Bacteria 1923
391 Ga0307517_10000386 3300028786 Bacteria 75442
392 Ga0307515_10001947 3300028794 Bacteria 45737
393 Ga0307515_10025212 3300028794 Bacteria 10304
394 Ga0307515_10068995 3300028794 Bacteria 4844
395 Ga0307515_10190817 3300028794 Bacteria 1960
396 Ga0268256_1000037 3300030500 Bacteria 367024
397 Ga0268256_1000148 3300030500 Bacteria 94347
398 Ga0268256_1003172 3300030500 Bacteria 7645
399 Ga0268256_1004304 3300030500 Bacteria 5951
400 Ga0316181_1153204 3300030744 Bacteria 1989
401 Ga0307513_10066256 3300031456 Bacteria 3796
402 Ga0307513_10131730 3300031456 Bacteria 2445
403 Ga0307509_10433490 3300031507 Bacteria 1012
404 Ga0307508_10093724 3300031616 Bacteria 2593
405 Ga0307514_10216527 3300031649 Bacteria 1181
406 Ga0265314_10002234 3300031711 Bacteria 20137
407 Ga0265342_10035892 3300031712 Bacteria 3031
408 Ga0307516_10091312 3300031730 Bacteria 2873
409 Ga0307405_10002301 3300031731 Bacteria 8376
410 Ga0307413_10064463 3300031824 Bacteria 2277
411 Ga0307406_10078984 3300031901 Bacteria 2181
412 Ga0307406_10285295 3300031901 Bacteria 1261
413 Ga0307407_10109960 3300031903 Bacteria 1728
414 Ga0307412_10311584 3300031911 Bacteria 1248
415 Ga0307409_100119217 3300031995 Bacteria 2230
416 Ga0307416_100082885 3300032002 Bacteria 2718
417 Ga0307414_10044225 3300032004 Bacteria 3039
418 Ga0307414_10087796 3300032004 Bacteria 2299
419 Ga0307414_10095536 3300032004 Bacteria 2221
420 Ga0307411_10093942 3300032005 Bacteria 2101
421 Ga0307411_10118561 3300032005 Bacteria 1910
422 Ga0307415_100068432 3300032126 Bacteria 2485
423 Ga0307510_10045610 3300033180 Bacteria 4727
424 Ga0315911_1000003 3300033442 Bacteria 502217
425 Ga0373932_0038383 3300035112 Bacteria 1369
426 Ga0373939_0002189 3300035114 Bacteria 4634
427 Ga0373960_0003305 3300035121 Bacteria 3649
428 Ga0373931_0002261 3300035691 Bacteria 8511
429 Ga0373931_0010721 3300035691 Bacteria 4412
430 Ga0373931_0038360 3300035691 Bacteria 2505
431 Ga0373927_0109363 3300035695 Bacteria 1801
432 Ga0373937_0148376 3300036401 Bacteria 2196
433 Ga0373925_0152005 3300037068 Bacteria 1818
434 Ga0395898_0483238 3300037466 Bacteria 1178
435 Ga0395905_0002940 3300037471 Bacteria 18526
436 Ga0395905_0010005 3300037471 Bacteria 9243
437 Ga0436361_0285992 3300039447 Bacteria 2381
438 Ga0439436_0017499 3300041404 Bacteria 2144
439 Ga0451833_0340930 3300041491 Bacteria 2025
440 Ga0451839_0143081 3300041496 Bacteria 1815
441 Ga0451845_0454358 3300041501 Bacteria 1975
442 Ga0451847_0186492 3300041503 Bacteria 2778
443 Ga0451849_0091961 3300041505 Bacteria 1677
444 Ga0451851_0082640 3300041507 Bacteria 2073
445 Ga0451843_0039079 3300041509 Bacteria 2411
446 Ga0451853_1011766 3300041512 Bacteria 1153
447 Ga0439431_0035001 3300041997 Bacteria 1261
448 Ga0439432_042969 3300042006 Bacteria 1428
449 Ga0439452_027434 3300042010 Bacteria 1429
450 Ga0439462_0027554 3300042015 Bacteria 1500
451 Ga0439463_042250 3300042016 Bacteria 1159
452 Ga0450906_022453 3300042145 Bacteria 1125
453 Ga0439464_0005917 3300042439 Bacteria 3178
454 Ga0439464_0011374 3300042439 Bacteria 2357
455 Ga0466972_0000113 3300044658 Bacteria 69042
456 Ga0466972_0022304 3300044658 Bacteria 3153
457 Ga0466966_0274186 3300044684 Bacteria 1015
458 Ga0466963_0008496 3300044694 Bacteria 6156
459 Ga0466964_0016443 3300044706 Bacteria 2826
460 Ga0466968_0000931 3300044735 Bacteria 10307
461 Ga0466970_0000129 3300044765 Bacteria 34329
462 Ga0466970_0187647 3300044765 Bacteria 1148
463 Ga0466957_0081268 3300044842 Bacteria 2018
464 Ga0466957_0140093 3300044842 Bacteria 1558
465 Ga0466960_0026578 3300044901 Bacteria 2631
466 Ga0466959_0113087 3300045049 Bacteria 1936
467 Ga0466958_0047489 3300045836 Bacteria 2592
468 Ga0466967_0116352 3300045976 Bacteria 2463
469 Ga0495603_0009391 3300046455 Bacteria 5910
470 Ga0495629_0004287 3300046459 Bacteria 10692
471 Ga0495638_0002696 3300046460 Bacteria 14292
472 Ga0495638_0059304 3300046460 Bacteria 2370
473 Ga0495638_0061881 3300046460 Bacteria 2311
474 Ga0495638_0179994 3300046460 Bacteria 1207
475 Ga0495641_0039292 3300046461 Bacteria 2207
476 Ga0495641_0084849 3300046461 Bacteria 1418
477 Ga0495651_0017446 3300046462 Bacteria 5559
478 Ga0495651_0138161 3300046462 Bacteria 1771
479 Ga0495653_0012380 3300046463 Bacteria 6963
480 Ga0495605_0016951 3300046474 Bacteria 3934
481 Ga0495585_0019507 3300046492 Bacteria 3909
482 Ga0495585_0024557 3300046492 Bacteria 3455
483 Ga0495585_0089445 3300046492 Bacteria 1660
484 Ga0495596_0027468 3300046500 Bacteria 2288
485 Ga0495583_0024494 3300046506 Bacteria 3032
486 Ga0495583_0079975 3300046506 Bacteria 1421
487 Ga0495606_0000196 3300046507 Bacteria 105765
488 Ga0495606_0001140 3300046507 Bacteria 37797
489 Ga0495631_0011407 3300046518 Bacteria 4370
490 Ga0495631_0063652 3300046518 Bacteria 1597
491 Ga0495632_0016742 3300046519 Bacteria 4067
492 Ga0495632_0032562 3300046519 Bacteria 2684
493 Ga0495637_0130553 3300046520 Bacteria 960
494 Ga0495643_0067174 3300046522 Bacteria 1890
495 Ga0495648_0016438 3300046524 Bacteria 5337
496 Ga0495648_0020584 3300046524 Bacteria 4595
497 Ga0495648_0192713 3300046524 Bacteria 1027
498 Ga0495654_0000063 3300046530 Bacteria 128630
499 Ga0495609_0099290 3300046538 Bacteria 1262
500 Ga0495622_0030645 3300046557 Bacteria 2513
501 Ga0495667_0077911 3300046559 Bacteria 2155
502 Ga0495656_0012565 3300046615 Bacteria 3129
503 Ga0495656_0187407 3300046615 Bacteria 1020
504 Ga0495668_0052938 3300046616 Bacteria 2245
505 Ga0495668_0154984 3300046616 Bacteria 1254
506 Ga0495611_0015229 3300046648 Bacteria 3288
507 Ga0495625_0021115 3300046660 Bacteria 5018
508 Ga0495635_0006167 3300046663 Bacteria 8355
509 Ga0495659_0015392 3300046664 Bacteria 2514
510 Ga0495659_0068205 3300046664 Bacteria 1328
511 Ga0495661_0000030 3300046665 Bacteria 171980
512 Ga0495661_0165995 3300046665 Bacteria 1181
513 Ga0495588_0011793 3300046674 Bacteria 4112
514 Ga0495657_0014577 3300046675 Bacteria 5768
515 Ga0495657_0079707 3300046675 Bacteria 2120
516 Ga0495646_0128852 3300046680 Bacteria 1426
517 Ga0495624_0193715 3300046690 Bacteria 1236
518 Ga0495670_0049448 3300046691 Bacteria 2104
519 Ga0495671_0058046 3300046692 Bacteria 1915
520 Ga0495671_0104843 3300046692 Bacteria 1381
521 Ga0495649_0000288 3300046694 Bacteria 44617
522 Ga0495600_0126975 3300046809 Bacteria 1659
523 Ga0495581_0042551 3300047315 Bacteria 2629
524 Ga0495604_0009755 3300047317 Bacteria 7595
525 Ga0495604_0011995 3300047317 Bacteria 6890
526 Ga0495674_0269825 3300047319 Bacteria 1396
527 Ga0495672_0012863 3300047320 Bacteria 5808
528 Ga0495672_0049801 3300047320 Bacteria 2477
529 Ga0495672_0078158 3300047320 Bacteria 1852
530 Ga0495676_0017023 3300047321 Bacteria 6435
531 Ga0495676_0028770 3300047321 Bacteria 4741
532 Ga0495683_0000018 3300047323 Bacteria 185871
533 Ga0495673_0097508 3300047469 Bacteria 1193
534 Ga0495686_0133206 3300047472 Bacteria 1472
535 Ga0495602_0244103 3300048088 Bacteria 1342
536 Ga0496100_0017973 3300048903 Bacteria 4185
537 Ga0496100_0246446 3300048903 Bacteria 1320
538 Ga0496101_0002506 3300048904 Bacteria 11287
539 Ga0496101_0084746 3300048904 Bacteria 2347
540 Ga0496101_0293806 3300048904 Bacteria 1272
541 Ga0496102_0118582 3300048905 Bacteria 2470
542 Ga0496102_0120234 3300048905 Bacteria 2453
543 Ga0496102_0139154 3300048905 Bacteria 2275
544 Ga0496104_0001254 3300048907 Bacteria 21878
545 Ga0496104_0159198 3300048907 Bacteria 2166
546 Ga0496104_0315146 3300048907 Bacteria 1477
547 Ga0496105_0030374 3300048908 Bacteria 4428
548 Ga0496105_0061087 3300048908 Bacteria 3109
549 Ga0496105_0075113 3300048908 Bacteria 2791
550 Ga0496105_0195109 3300048908 Bacteria 1654
551 Ga0496106_0032006 3300048909 Bacteria 3920
552 Ga0496106_0039230 3300048909 Bacteria 3547
553 Ga0496106_0040480 3300048909 Bacteria 3490
554 Ga0496106_0084026 3300048909 Bacteria 2449
555 Ga0496107_0019239 3300048910 Bacteria 4817
556 Ga0496108_0101013 3300048911 Bacteria 2460
557 Ga0496108_0429083 3300048911 Bacteria 1154
558 Ga0496109_0033706 3300048912 Bacteria 4608
559 Ga0496109_0064980 3300048912 Bacteria 3340
560 Ga0496109_0143700 3300048912 Bacteria 2231
561 Ga0496109_0202435 3300048912 Bacteria 1867
562 Ga0496110_0035179 3300048913 Bacteria 4344
563 Ga0496110_0372551 3300048913 Bacteria 1301
564 Ga0496112_0015338 3300048915 Bacteria 7145
565 Ga0496112_0043464 3300048915 Bacteria 4399
566 Ga0496112_0323276 3300048915 Bacteria 1487
567 Ga0496112_0401976 3300048915 Bacteria 1309
568 Ga0496113_0042834 3300048916 Bacteria 3346
569 Ga0496113_0476842 3300048916 Bacteria 1002
570 Ga0496114_0037868 3300048917 Bacteria 3990
571 Ga0496114_0195087 3300048917 Bacteria 1772
572 Ga0496114_0392131 3300048917 Bacteria 1230
573 Ga0496114_0576165 3300048917 Bacteria 993
574 Ga0496115_0005702 3300048918 Bacteria 9062
575 Ga0496115_0098103 3300048918 Bacteria 2399
576 Ga0496116_0000167 3300048919 Bacteria 132540
577 Ga0496116_0009413 3300048919 Bacteria 8328
578 Ga0496116_0011068 3300048919 Bacteria 7505
579 Ga0496116_0012692 3300048919 Bacteria 6854
580 Ga0496116_0047130 3300048919 Bacteria 2903
581 Ga0496116_0107045 3300048919 Bacteria 1654
582 Ga0496116_0149098 3300048919 Bacteria 1302
583 Ga0496117_0000052 3300048920 Bacteria 280463
584 Ga0496117_0008030 3300048920 Bacteria 10116
585 Ga0496117_0009706 3300048920 Bacteria 8895
586 Ga0496117_0068125 3300048920 Bacteria 2404
587 Ga0496117_0074519 3300048920 Bacteria 2259
588 Ga0496117_0185523 3300048920 Bacteria 1191
589 Ga0496118_0018034 3300048921 Bacteria 6392
590 Ga0496118_0094285 3300048921 Bacteria 2047
591 Ga0496118_0190535 3300048921 Bacteria 1227
592 Ga0496119_0000407 3300048922 Bacteria 59063
593 Ga0496119_0009404 3300048922 Bacteria 8397
594 Ga0496119_0017837 3300048922 Bacteria 5321
595 Ga0496119_0020002 3300048922 Bacteria 4900
596 Ga0496119_0037750 3300048922 Bacteria 3133
597 Ga0496119_0042872 3300048922 Bacteria 2865
598 Ga0496119_0055788 3300048922 Bacteria 2398
599 Ga0496119_0112682 3300048922 Bacteria 1507
600 Ga0496120_0000019 3300048923 Bacteria 260115
601 Ga0496120_0169916 3300048923 Bacteria 1079
602 Ga0496121_0000005 3300048924 Bacteria 1034486
603 Ga0496121_0000230 3300048924 Bacteria 120616
604 Ga0496121_0003624 3300048924 Bacteria 21750
605 Ga0496121_0027118 3300048924 Bacteria 5370
606 Ga0496121_0028245 3300048924 Bacteria 5227
607 Ga0496121_0140568 3300048924 Bacteria 1792
608 Ga0496121_0259512 3300048924 Bacteria 1200
609 Ga0496122_0000053 3300048925 Bacteria 260120
610 Ga0496122_0003439 3300048925 Bacteria 20818
611 Ga0496122_0004580 3300048925 Bacteria 17027
612 Ga0496122_0024574 3300048925 Bacteria 5268
613 Ga0496122_0064306 3300048925 Bacteria 2670
614 Ga0496122_0139424 3300048925 Bacteria 1520
615 Ga0496122_0168519 3300048925 Bacteria 1324
616 Ga0496123_0000038 3300048926 Bacteria 260120
617 Ga0496123_0002783 3300048926 Bacteria 20818
618 Ga0496123_0014707 3300048926 Bacteria 6468
619 Ga0496123_0022880 3300048926 Bacteria 4801
620 Ga0496123_0067145 3300048926 Bacteria 2266
621 Ga0496123_0090192 3300048926 Bacteria 1823
622 Ga0496124_0001723 3300048927 Bacteria 30828
623 Ga0496124_0017334 3300048927 Bacteria 6790
624 Ga0496124_0039011 3300048927 Bacteria 4119
625 Ga0496124_0096255 3300048927 Bacteria 2405
626 Ga0496124_0104449 3300048927 Bacteria 2291
627 Ga0496124_0104925 3300048927 Bacteria 2284
628 Ga0496125_0000159 3300048928 Bacteria 151205
629 Ga0496125_0000763 3300048928 Bacteria 52688
630 Ga0496125_0000796 3300048928 Bacteria 51436
631 Ga0496125_0008276 3300048928 Bacteria 10921
632 Ga0496125_0050643 3300048928 Bacteria 3436
633 Ga0496125_0076051 3300048928 Bacteria 2594
634 Ga0496125_0080691 3300048928 Bacteria 2488
635 Ga0496125_0353606 3300048928 Bacteria 876
636 Ga0496126_0000768 3300048929 Bacteria 58074
637 Ga0496126_0003924 3300048929 Bacteria 18222
638 Ga0496126_0018413 3300048929 Bacteria 6919
639 Ga0496126_0372776 3300048929 Bacteria 1163
640 Ga0496126_0470649 3300048929 Bacteria 1008
641 Ga0495678_027086 3300049459 Bacteria 2436
642 Ga0495678_031570 3300049459 Bacteria 2207
643 Ga0495682_0038135 3300049460 Bacteria 1766
644 Ga0501033_0201231 3300049570 Bacteria 1422
645 Ga0501034_0328983 3300049571 Bacteria 1460
646 Ga0501037_0165632 3300049573 Bacteria 1574
647 Ga0501038_0215268 3300049574 Bacteria 1535
648 Ga0501040_0463128 3300049576 Bacteria 913
649 Ga0501042_0293844 3300049578 Bacteria 1174
650 Ga0501046_0055698 3300049580 Bacteria 3106
651 Ga0501047_0042993 3300049581 Bacteria 4365
652 Ga0501047_0099757 3300049581 Bacteria 2783
653 Ga0501069_0153000 3300049585 Bacteria 1326
654 Ga0501073_0138282 3300049589 Bacteria 1688
655 Ga0501075_0479701 3300049591 Bacteria 949
656 Ga0501076_0016532 3300049592 Bacteria 5593
657 Ga0501280_006997 3300049776 Bacteria 1584
658 Ga0501035_0045861 3300049822 Bacteria 3932
659 nmdc:mga03683_10325_c1 3300050489 Bacteria 3347
660 nmdc:mga03683_26726_c1 3300050489 Bacteria 2279
661 nmdc:mga03683_7842_c1 3300050489 Bacteria 3727
662 nmdc:mga03n38_1718_c1 3300050490 Bacteria 6456
663 nmdc:mga03n38_70090_c1 3300050490 Bacteria 1621
664 nmdc:mga00v17_11_c1 3300050491 Bacteria 135478
665 nmdc:mga00v17_21333_c1 3300050491 Bacteria 3723
666 nmdc:mga00v17_31758_c1 3300050491 Bacteria 3116
667 nmdc:mga00v17_67568_c1 3300050491 Bacteria 2208
668 nmdc:mga00v17_88516_c1 3300050491 Bacteria 1942
669 nmdc:mga0yw44_114571_c1 3300050492 Bacteria 1731
670 nmdc:mga0yw44_1949_c1 3300050492 Bacteria 8548
671 nmdc:mga0yw44_291285_c1 3300050492 Bacteria 1092
672 nmdc:mga0yw44_32216_c1 3300050492 Bacteria 3053
673 nmdc:mga0yw44_528_c1 3300050492 Bacteria 13715
674 nmdc:mga0yw44_61812_c1 3300050492 Bacteria 2299
675 nmdc:mga0yw44_76197_c1 3300050492 Bacteria 2093
676 nmdc:mga0k408_110770_c1 3300050493 Bacteria 1623
677 nmdc:mga0k408_171939_c1 3300050493 Bacteria 1292
678 nmdc:mga0k408_21150_c1 3300050493 Bacteria 3652
679 nmdc:mga0k408_61733_c1 3300050493 Bacteria 2179
680 nmdc:mga06z11_72078_c1 3300050494 Bacteria 1831
681 nmdc:mga06z11_76648_c1 3300050494 Bacteria 1783
682 nmdc:mga04h51_48492_c1 3300050495 Bacteria 1416
683 nmdc:mga07m45_18250_c1 3300050496 Bacteria 3783
684 nmdc:mga07m45_207910_c1 3300050496 Bacteria 1139
685 nmdc:mga07m45_31840_c1 3300050496 Bacteria 2923
686 nmdc:mga07m45_6280_c1 3300050496 Bacteria 3722
687 nmdc:mga05p37_195993_c1 3300050507 Bacteria 2449
688 nmdc:mga05p37_219_c1 3300050507 Bacteria 57577
689 nmdc:mga05p37_321350_c1 3300050507 Bacteria 1832
690 nmdc:mga09592_232851_c1 3300050508 Bacteria 1596
691 nmdc:mga09592_452_c1 3300050508 Bacteria 30462
692 nmdc:mga0qj67_396_c1 3300050509 Bacteria 30122
693 nmdc:mga0qj67_54201_c1 3300050509 Bacteria 3175
694 nmdc:mga0qj67_57041_c1 3300050509 Bacteria 3096
695 nmdc:mga06r32_190711_c1 3300050510 Bacteria 2037
696 nmdc:mga06r32_220643_c1 3300050510 Bacteria 1884
697 nmdc:mga06r32_274_c1 3300050510 Bacteria 42858
698 nmdc:mga06r32_364722_c1 3300050510 Bacteria 1428
699 nmdc:mga06r32_41092_c1 3300050510 Bacteria 4393
700 nmdc:mga08y16_15638_c1 3300050511 Bacteria 7979
701 nmdc:mga08y16_26695_c1 3300050511 Bacteria 6087
702 nmdc:mga08y16_32934_c1 3300050511 Bacteria 5446
703 nmdc:mga08y16_377326_c1 3300050511 Bacteria 1454
704 nmdc:mga0n895_124_c1 3300050512 Bacteria 45833
705 nmdc:mga0n895_328624_c1 3300050512 Bacteria 1549
706 nmdc:mga0rr50_268356_c1 3300050513 Bacteria 1421
707 nmdc:mga0rr50_4689_c1 3300050513 Bacteria 8056
708 nmdc:mga0a205_97_c1 3300050515 Bacteria 49530
709 nmdc:mga0sz30_18802_c1 3300050516 Bacteria 2769
710 nmdc:mga0sz30_70141_c1 3300050516 Bacteria 1508
711 nmdc:mga0sz30_8151_c1 3300050516 Bacteria 3948
712 Ga0495601_0002483 3300053077 Bacteria 10493
713 Ga0495595_0001110 3300053084 Bacteria 10438
714 Ga0495619_0000145 3300053085 Bacteria 52248
715 Ga0500643_000218 3300053087 Bacteria 53579
716 Ga0500644_0001583 3300053088 Bacteria 5959
717 Ga0500644_0056856 3300053088 Bacteria 1363
718 Ga0500651_0001206 3300053093 Bacteria 12837
719 Ga0500566_0000562 3300053094 Bacteria 20869
720 Ga0500566_0042130 3300053094 Bacteria 2635
721 Ga0500640_030487 3300053095 Bacteria 2362
722 Ga0500641_0005846 3300053096 Bacteria 4355
723 Ga0500641_0107573 3300053096 Bacteria 1199
724 Ga0500555_008865 3300053103 Bacteria 2871
725 Ga0500560_017881 3300053107 Bacteria 1966
726 Ga0500569_009618 3300053109 Bacteria 2252
727 Ga0500593_000025 3300053117 Bacteria 51890
728 Ga0500595_000848 3300053119 Bacteria 17450
729 Ga0500595_001223 3300053119 Bacteria 14197
730 Ga0500595_001276 3300053119 Bacteria 13715
731 Ga0500595_001896 3300053119 Bacteria 10770
732 Ga0500595_020910 3300053119 Bacteria 2344
733 Ga0500614_014399 3300053123 Bacteria 1750
734 Ga0500618_000726 3300053125 Bacteria 18853
735 Ga0500618_003240 3300053125 Bacteria 5665
736 Ga0500642_0077637 3300053130 Bacteria 1520
737 Ga0500568_0000005 3300053139 Bacteria 614296
738 Ga0500568_0001438 3300053139 Bacteria 15421
739 Ga0500568_0035067 3300053139 Bacteria 2049
740 Ga0500573_0038452 3300053140 Bacteria 2764
741 Ga0500577_0122988 3300053142 Bacteria 1081
742 Ga0500579_081517 3300053143 Bacteria 1806
743 Ga0500604_0001887 3300053151 Bacteria 5822
744 Ga0500616_0000256 3300053153 Bacteria 82461
745 Ga0500616_0000472 3300053153 Bacteria 52191
746 Ga0500616_0004193 3300053153 Bacteria 10390
747 Ga0500616_0009442 3300053153 Bacteria 5934
748 Ga0500616_0034287 3300053153 Bacteria 2765
749 Ga0500622_0009196 3300053156 Bacteria 5484
750 Ga0500622_0013905 3300053156 Bacteria 4332
751 Ga0500622_0092080 3300053156 Bacteria 1503
752 Ga0500627_0004511 3300053158 Bacteria 4488
753 Ga0500627_0018511 3300053158 Bacteria 2758
754 Ga0500627_0050943 3300053158 Bacteria 1804
755 Ga0500634_0000011 3300053161 Bacteria 133329
756 Ga0500634_0012826 3300053161 Bacteria 4375
757 Ga0500636_0000039 3300053177 Bacteria 69891
758 Ga0500636_0001036 3300053177 Bacteria 14900
759 Ga0500636_0053454 3300053177 Bacteria 2370
760 Ga0500637_0000231 3300053178 Bacteria 20786
761 Ga0500645_042682 3300053730 Bacteria 1337
762 Ga0500609_002839 3300053731 Bacteria 2470
763 Ga0500601_003054 3300053737 Bacteria 1805

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005937 Ga0081455_10007920 Ga0081455_100079207 260
2 3300048929 Ga0496126_0018413 Ga0496126_0018413_5562_6458 262
3 3300053119 Ga0500595_000848 Ga0500595_000848_10955_11866 262
4 3300005327 Ga0070658_10245760 Ga0070658_102457602 264
5 3300005334 Ga0068869_100059708 Ga0068869_1000597082 264
6 3300005548 Ga0070665_100002095 Ga0070665_10000209510 264
7 3300025909 Ga0207705_10323885 Ga0207705_103238852 264
8 3300025942 Ga0207689_10071966 Ga0207689_100719663 264
9 3300028379 Ga0268266_10013114 Ga0268266_100131146 264
10 3300031911 Ga0307412_10311584 Ga0307412_103115842 264
11 3300042016 Ga0439463_042250 Ga0439463_042250_31_945 264
12 3300002741 JGI25157J39369_1000789 JGI25157J39369_10007893 265
13 3300009094 Ga0111539_10010599 Ga0111539_100105994 265
14 3300025250 Ga0209026_1000023 Ga0209026_1000023117 265
15 3300025256 Ga0209759_1001309 Ga0209759_10013095 265
16 3300027907 Ga0207428_10128621 Ga0207428_101286211 265
17 3300033442 Ga0315911_1000003 Ga0315911_1000003493 265
18 3300046461 Ga0495641_0039292 Ga0495641_0039292_270_1163 265
19 3300046507 Ga0495606_0000196 Ga0495606_0000196_15187_16080 265
20 3300053161 Ga0500634_0012826 Ga0500634_0012826_1787_2584 265
21 3300003856 Ga0058692_1006972 Ga0058692_10069723 266
22 3300005466 Ga0070685_10201166 Ga0070685_102011662 266
23 3300009101 Ga0105247_10086689 Ga0105247_100866892 266
24 3300027312 Ga0209371_1000135 Ga0209371_100013543 266
25 3300030500 Ga0268256_1000148 Ga0268256_100014843 266
26 3300035695 Ga0373927_0109363 Ga0373927_0109363_133_1038 266
27 3300042006 Ga0439432_042969 Ga0439432_042969_219_1064 266
28 3300042010 Ga0439452_027434 Ga0439452_027434_292_1137 266
29 3300042439 Ga0439464_0005917 Ga0439464_0005917_503_1348 266
30 3300042439 Ga0439464_0011374 Ga0439464_0011374_486_1331 266
31 3300048913 Ga0496110_0035179 Ga0496110_0035179_841_1746 266
32 3300048915 Ga0496112_0323276 Ga0496112_0323276_403_1308 266
33 3300050513 nmdc:mga0rr50_268356_c1 nmdc:mga0rr50_268356_c1_489_1394 266
34 3300009147 Ga0114129_10690294 Ga0114129_106902942 267
35 3300047323 Ga0495683_0000018 Ga0495683_0000018_50599_51402 267
36 3300050511 nmdc:mga08y16_32934_c1 nmdc:mga08y16_32934_c1_4247_5170 267
37 3300005841 Ga0068863_100210085 Ga0068863_1002100852 268
38 3300005983 Ga0081540_1000620 Ga0081540_10006205 268
39 3300009094 Ga0111539_10235929 Ga0111539_102359292 268
40 3300048905 Ga0496102_0118582 Ga0496102_0118582_91_999 268
41 3300050510 nmdc:mga06r32_220643_c1 nmdc:mga06r32_220643_c1_281_1204 268
42 3300050511 nmdc:mga08y16_377326_c1 nmdc:mga08y16_377326_c1_130_942 268
43 3300047320 Ga0495672_0049801 Ga0495672_0049801_493_1392 269
44 3300025291 Ga0209675_1010802 Ga0209675_10108022 270
45 3300046492 Ga0495585_0089445 Ga0495585_0089445_410_1303 270
46 3300046520 Ga0495637_0130553 Ga0495637_0130553_21_842 270
47 3300046665 Ga0495661_0165995 Ga0495661_0165995_58_951 270
48 iso_pu_bacteria 2849076700 2849078263 270
49 3300048917 Ga0496114_0195087 Ga0496114_0195087_29_874 271
50 3300025728 Ga0207655_1047574 Ga0207655_10475741 272
51 3300025735 Ga0207713_1038563 Ga0207713_10385632 272
52 3300037068 Ga0373925_0152005 Ga0373925_0152005_18_842 272
53 3300046680 Ga0495646_0128852 Ga0495646_0128852_549_1373 272
54 3300048908 Ga0496105_0195109 Ga0496105_0195109_34_858 272
55 3300049574 Ga0501038_0215268 Ga0501038_0215268_92_916 272
56 3300049576 Ga0501040_0463128 Ga0501040_0463128_41_865 272
57 3300049581 Ga0501047_0099757 Ga0501047_0099757_1466_2290 272
58 3300049822 Ga0501035_0045861 Ga0501035_0045861_1565_2389 272
59 iso_pu_bacteria 2829745981 2829746898 272
60 3300003771 Ga0055526_1001408 Ga0055526_10014085 273
61 3300003775 Ga0055524_1007981 Ga0055524_10079812 273
62 3300003790 Ga0055528_1000067 Ga0055528_100006714 273
63 3300025273 Ga0209673_1000310 Ga0209673_100031027 273
64 3300025295 Ga0209564_1000137 Ga0209564_100013774 273
65 3300025299 Ga0209256_1000243 Ga0209256_1000243155 273
66 3300028794 Ga0307515_10025212 Ga0307515_100252126 273
67 3300031456 Ga0307513_10066256 Ga0307513_100662562 273
68 3300046461 Ga0495641_0084849 Ga0495641_0084849_12_839 273
69 3300046518 Ga0495631_0063652 Ga0495631_0063652_424_1332 273
70 3300048917 Ga0496114_0576165 Ga0496114_0576165_15_842 273
71 3300053161 Ga0500634_0000011 Ga0500634_0000011_111757_112644 273
72 iso_pu_bacteria 2510065055 2510292177 273
73 iso_pu_bacteria 2917832318 2917832497 273
74 iso_pu_bacteria 2919125081 2919125296 273
75 iso_pu_bacteria 2984504281 2984508503 273
76 iso_pu_bacteria 8016728285 8016729244 273
77 3300005356 Ga0070674_100140987 Ga0070674_1001409872 274
78 3300005548 Ga0070665_100084443 Ga0070665_1000844433 274
79 3300006175 Ga0070712_100120014 Ga0070712_1001200142 274
80 3300006177 Ga0075362_10023553 Ga0075362_100235532 274
81 3300006178 Ga0075367_10163874 Ga0075367_101638742 274
82 3300032004 Ga0307414_10044225 Ga0307414_100442252 274
83 3300048927 Ga0496124_0104449 Ga0496124_0104449_863_1780 274
84 3300050489 nmdc:mga03683_26726_c1 nmdc:mga03683_26726_c1_810_1694 274
85 3300032004 Ga0307414_10087796 Ga0307414_100877962 275
86 3300032004 Ga0307414_10095536 Ga0307414_100955362 275
87 3300032005 Ga0307411_10118561 Ga0307411_101185612 275
88 3300036401 Ga0373937_0148376 Ga0373937_0148376_1006_1914 275
89 3300046460 Ga0495638_0179994 Ga0495638_0179994_101_1024 275
90 3300046462 Ga0495651_0138161 Ga0495651_0138161_287_1195 275
91 3300046559 Ga0495667_0077911 Ga0495667_0077911_1179_2087 275
92 3300046675 Ga0495657_0079707 Ga0495657_0079707_75_983 275
93 3300046809 Ga0495600_0126975 Ga0495600_0126975_730_1638 275
94 3300047317 Ga0495604_0011995 Ga0495604_0011995_1941_2849 275
95 3300047319 Ga0495674_0269825 Ga0495674_0269825_434_1342 275
96 3300048908 Ga0496105_0061087 Ga0496105_0061087_17_850 275
97 3300048928 Ga0496125_0353606 Ga0496125_0353606_38_865 275
98 3300053077 Ga0495601_0002483 Ga0495601_0002483_8828_9736 275
99 3300053084 Ga0495595_0001110 Ga0495595_0001110_1572_2480 275
100 3300053085 Ga0495619_0000145 Ga0495619_0000145_28977_29885 275
101 3300053151 Ga0500604_0001887 Ga0500604_0001887_4326_5219 275
102 3300005347 Ga0070668_100296586 Ga0070668_1002965861 276
103 3300005445 Ga0070708_100518268 Ga0070708_1005182681 276
104 3300005617 Ga0068859_100162981 Ga0068859_1001629812 276
105 3300006042 Ga0075368_10071757 Ga0075368_100717572 276
106 3300006178 Ga0075367_10029612 Ga0075367_100296122 276
107 3300006353 Ga0075370_10129962 Ga0075370_101299622 276
108 3300006931 Ga0097620_100162996 Ga0097620_1001629962 276
109 3300013308 Ga0157375_10423927 Ga0157375_104239272 276
110 3300028786 Ga0307517_10000386 Ga0307517_1000038622 276
111 3300050490 nmdc:mga03n38_70090_c1 nmdc:mga03n38_70090_c1_579_1475 276
112 3300050492 nmdc:mga0yw44_291285_c1 nmdc:mga0yw44_291285_c1_71_961 276
113 3300050496 nmdc:mga07m45_31840_c1 nmdc:mga07m45_31840_c1_504_1400 276
114 iso_pu_bacteria 3007315729 3007317415 276
115 3300009098 Ga0105245_10364746 Ga0105245_103647462 277
116 3300026041 Ga0207639_10159169 Ga0207639_101591692 277
117 iso_pu_bacteria 2990196909 2990197571 277
118 3300005548 Ga0070665_100005120 Ga0070665_10000512011 278
119 3300009094 Ga0111539_10225523 Ga0111539_102255232 278
120 3300009147 Ga0114129_10502866 Ga0114129_105028662 278
121 3300027907 Ga0207428_10078186 Ga0207428_100781863 278
122 3300028379 Ga0268266_10023772 Ga0268266_100237725 278
123 3300046664 Ga0495659_0068205 Ga0495659_0068205_350_1240 278
124 3300050510 nmdc:mga06r32_41092_c1 nmdc:mga06r32_41092_c1_3165_4070 278
125 3300050511 nmdc:mga08y16_15638_c1 nmdc:mga08y16_15638_c1_3324_4229 278
126 3300005444 Ga0070694_100046563 Ga0070694_1000465633 279
127 3300005545 Ga0070695_100014398 Ga0070695_1000143982 279
128 3300005981 Ga0081538_10009799 Ga0081538_100097993 279
129 3300006844 Ga0075428_100026013 Ga0075428_1000260132 279
130 3300026075 Ga0207708_10036315 Ga0207708_100363152 279
131 3300035112 Ga0373932_0038383 Ga0373932_0038383_436_1332 279
132 3300035114 Ga0373939_0002189 Ga0373939_0002189_704_1600 279
133 3300035121 Ga0373960_0003305 Ga0373960_0003305_461_1357 279
134 3300035691 Ga0373931_0038360 Ga0373931_0038360_741_1637 279
135 3300050507 nmdc:mga05p37_195993_c1 nmdc:mga05p37_195993_c1_788_1684 279
136 3300053119 Ga0500595_020910 Ga0500595_020910_1164_2087 279
137 3300053153 Ga0500616_0009442 Ga0500616_0009442_2289_3185 279
138 iso_pu_bacteria 2545555834 2545674107 279
139 iso_pu_bacteria 2881101125 2881101603 279
140 iso_pu_bacteria 641522639 641643914 279
141 3300046538 Ga0495609_0099290 Ga0495609_0099290_14_877 280
142 3300048919 Ga0496116_0000167 Ga0496116_0000167_45590_46519 280
143 3300048922 Ga0496119_0000407 Ga0496119_0000407_39249_40154 280
144 3300048922 Ga0496119_0055788 Ga0496119_0055788_318_1247 280
145 3300048929 Ga0496126_0000768 Ga0496126_0000768_11943_12872 280
146 iso_pu_bacteria 2861691609 2861692517 280
147 3300042015 Ga0439462_0027554 Ga0439462_0027554_461_1315 281
148 3300044658 Ga0466972_0000113 Ga0466972_0000113_43400_44296 281
149 3300047315 Ga0495581_0042551 Ga0495581_0042551_963_1874 281
150 3300003187 JGI25151J46595_10000166 JGI25151J46595_1000016634 282
151 3300006844 Ga0075428_100143877 Ga0075428_1001438772 282
152 3300006847 Ga0075431_100203657 Ga0075431_1002036572 282
153 3300006847 Ga0075431_100411232 Ga0075431_1004112322 282
154 3300009545 Ga0105237_10436622 Ga0105237_104366222 282
155 3300009551 Ga0105238_10171507 Ga0105238_101715072 282
156 3300025294 Ga0209025_1000053 Ga0209025_1000053166 282
157 3300025297 Ga0209758_1002716 Ga0209758_100271611 282
158 3300031456 Ga0307513_10131730 Ga0307513_101317302 282
159 3300031616 Ga0307508_10093724 Ga0307508_100937243 282
160 3300041997 Ga0439431_0035001 Ga0439431_0035001_222_1121 282
161 3300048925 Ga0496122_0168519 Ga0496122_0168519_242_1138 282
162 3300048927 Ga0496124_0104925 Ga0496124_0104925_402_1298 282
163 3300050508 nmdc:mga09592_232851_c1 nmdc:mga09592_232851_c1_536_1435 282
164 3300050509 nmdc:mga0qj67_54201_c1 nmdc:mga0qj67_54201_c1_107_1006 282
165 3300050510 nmdc:mga06r32_190711_c1 nmdc:mga06r32_190711_c1_489_1397 282
166 3300050510 nmdc:mga06r32_364722_c1 nmdc:mga06r32_364722_c1_221_1120 282
167 iso_pu_bacteria 2869169390 2869176670 282
168 iso_pu_bacteria 2906363423 2906367760 282
169 iso_pu_bacteria 2929199973 2929203816 282
170 iso_pu_bacteria 8055909800 8055916465 282
171 3300009553 Ga0105249_10197633 Ga0105249_101976332 283
172 3300037471 Ga0395905_0002940 Ga0395905_0002940_9899_10759 283
173 3300047320 Ga0495672_0078158 Ga0495672_0078158_437_1336 283
174 3300002737 JGI25162J39368_1002141 JGI25162J39368_10021415 284
175 3300003214 JGI25165J46597_1001164 JGI25165J46597_100116412 284
176 3300005937 Ga0081455_10034510 Ga0081455_100345105 284
177 3300005981 Ga0081538_10075112 Ga0081538_100751122 284
178 3300005983 Ga0081540_1019574 Ga0081540_10195742 284
179 3300006038 Ga0075365_10017754 Ga0075365_100177542 284
180 3300006038 Ga0075365_10018335 Ga0075365_100183352 284
181 3300046500 Ga0495596_0027468 Ga0495596_0027468_880_1827 284
182 3300048927 Ga0496124_0001723 Ga0496124_0001723_2132_3028 284
183 3300050492 nmdc:mga0yw44_32216_c1 nmdc:mga0yw44_32216_c1_2119_3015 284
184 3300050492 nmdc:mga0yw44_76197_c1 nmdc:mga0yw44_76197_c1_752_1648 284
185 3300053158 Ga0500627_0004511 Ga0500627_0004511_2928_3824 284
186 iso_pu_bacteria 2919450847 2919455535 284
187 iso_pu_bacteria 2977898635 2977903553 284
188 3300005937 Ga0081455_10009013 Ga0081455_100090132 285
189 3300025261 Ga0209233_1001664 Ga0209233_10016645 285
190 3300025294 Ga0209025_1002007 Ga0209025_100200710 285
191 3300028794 Ga0307515_10190817 Ga0307515_101908172 285
192 3300031824 Ga0307413_10064463 Ga0307413_100644632 285
193 3300053119 Ga0500595_001276 Ga0500595_001276_5874_6785 285
194 iso_pu_bacteria 2821443989 2821444334 285
195 iso_pu_bacteria 2844533157 2844538186 285
196 3300006941 Ga0099825_1021826 Ga0099825_10218264 286
197 3300006943 Ga0099822_1005398 Ga0099822_100539813 286
198 3300025261 Ga0209233_1007903 Ga0209233_10079032 286
199 3300025299 Ga0209256_1000740 Ga0209256_100074027 286
200 3300027357 Ga0209589_1000011 Ga0209589_100001184 286
201 3300027361 Ga0209489_100012 Ga0209489_10001284 286
202 3300027363 Ga0209700_100019 Ga0209700_10001984 286
203 3300044706 Ga0466964_0016443 Ga0466964_0016443_1376_2266 286
204 3300044765 Ga0466970_0187647 Ga0466970_0187647_225_1115 286
205 3300053093 Ga0500651_0001206 Ga0500651_0001206_4792_5703 286
206 3300053156 Ga0500622_0092080 Ga0500622_0092080_52_963 286
207 3300053158 Ga0500627_0018511 Ga0500627_0018511_797_1708 286
208 iso_pu_bacteria 2894772417 2894777215 286
209 3300046455 Ga0495603_0009391 Ga0495603_0009391_3208_4083 287
210 3300046463 Ga0495653_0012380 Ga0495653_0012380_4451_5326 287
211 3300046492 Ga0495585_0024557 Ga0495585_0024557_279_1154 287
212 3300046507 Ga0495606_0001140 Ga0495606_0001140_2524_3399 287
213 3300046665 Ga0495661_0000030 Ga0495661_0000030_74443_75318 287
214 3300046692 Ga0495671_0058046 Ga0495671_0058046_973_1848 287
215 3300046694 Ga0495649_0000288 Ga0495649_0000288_15017_15892 287
216 3300047321 Ga0495676_0028770 Ga0495676_0028770_873_1748 287
217 3300048929 Ga0496126_0003924 Ga0496126_0003924_3800_4708 287
218 3300049459 Ga0495678_027086 Ga0495678_027086_737_1612 287
219 3300053125 Ga0500618_003240 Ga0500618_003240_1687_2562 287
220 iso_pu_bacteria 2904699407 2904701087 287
221 iso_pu_bacteria 2908756301 2908758685 287
222 3300003203 JGI25406J46586_10023243 JGI25406J46586_100232431 288
223 3300003771 Ga0055526_1001712 Ga0055526_10017123 288
224 3300005985 Ga0081539_10000220 Ga0081539_1000022099 288
225 3300025295 Ga0209564_1000191 Ga0209564_100019130 288
226 3300046615 Ga0495656_0187407 Ga0495656_0187407_111_1004 288
227 3300048920 Ga0496117_0068125 Ga0496117_0068125_1227_2120 288
228 3300053088 Ga0500644_0001583 Ga0500644_0001583_4036_4944 288
229 3300053130 Ga0500642_0077637 Ga0500642_0077637_553_1428 288
230 3300053139 Ga0500568_0035067 Ga0500568_0035067_20_895 288
231 3300053153 Ga0500616_0000256 Ga0500616_0000256_9401_10309 288
232 3300053156 Ga0500622_0009196 Ga0500622_0009196_2471_3346 288
233 iso_pu_bacteria 2513237087 2513592842 288
234 iso_pu_bacteria 2523231067 2523469964 288
235 iso_pu_bacteria 2738543031 2739350482 288
236 iso_pu_bacteria 3004239961 3004240577 288
237 3300006942 Ga0099824_1029608 Ga0099824_10296082 289
238 3300025284 Ga0209130_1000709 Ga0209130_100070924 289
239 3300025302 Ga0207426_1000198 Ga0207426_100019846 289
240 3300026041 Ga0207639_10120702 Ga0207639_101207022 289
241 3300048929 Ga0496126_0470649 Ga0496126_0470649_66_959 289
242 iso_pu_bacteria 2510917030 2511195644 289
243 iso_pu_bacteria 2582581298 2585222421 289
244 iso_pu_bacteria 2585427529 2585544627 289
245 iso_pu_bacteria 2919100787 2919103005 289
246 iso_pu_bacteria 2922368715 2922375857 289
247 iso_pu_bacteria 8001845381 8001847348 289
248 3300002773 JGI25152J39213_1000256 JGI25152J39213_10002563 290
249 3300002774 JGI25150J39212_1000501 JGI25150J39212_10005013 290
250 3300003187 JGI25151J46595_10000007 JGI25151J46595_1000000749 290
251 3300003215 JGI25153J46596_10000313 JGI25153J46596_1000031316 290
252 3300006946 Ga0079104_1000014 Ga0079104_100001446 290
253 3300025245 Ga0207425_1000018 Ga0207425_1000018281 290
254 3300025258 Ga0209129_1000026 Ga0209129_100002648 290
255 3300025273 Ga0209673_1023198 Ga0209673_10231983 290
256 3300025294 Ga0209025_1000035 Ga0209025_100003548 290
257 3300025297 Ga0209758_1000040 Ga0209758_100004048 290
258 3300027111 Ga0209281_1000032 Ga0209281_100003248 290
259 3300031731 Ga0307405_10002301 Ga0307405_100023015 290
260 3300031901 Ga0307406_10078984 Ga0307406_100789843 290
261 3300044694 Ga0466963_0008496 Ga0466963_0008496_1073_1966 290
262 3300044765 Ga0466970_0000129 Ga0466970_0000129_23290_24183 290
263 3300044842 Ga0466957_0081268 Ga0466957_0081268_753_1646 290
264 3300045836 Ga0466958_0047489 Ga0466958_0047489_1090_1983 290
265 3300045976 Ga0466967_0116352 Ga0466967_0116352_419_1312 290
266 3300046474 Ga0495605_0016951 Ga0495605_0016951_1214_2107 290
267 3300046506 Ga0495583_0024494 Ga0495583_0024494_436_1329 290
268 3300046518 Ga0495631_0011407 Ga0495631_0011407_2453_3346 290
269 3300046519 Ga0495632_0032562 Ga0495632_0032562_135_1028 290
270 3300046522 Ga0495643_0067174 Ga0495643_0067174_507_1400 290
271 3300046524 Ga0495648_0192713 Ga0495648_0192713_24_917 290
272 3300046616 Ga0495668_0052938 Ga0495668_0052938_429_1322 290
273 3300046648 Ga0495611_0015229 Ga0495611_0015229_2247_3140 290
274 3300046660 Ga0495625_0021115 Ga0495625_0021115_1672_2565 290
275 3300046691 Ga0495670_0049448 Ga0495670_0049448_112_1005 290
276 3300048919 Ga0496116_0012692 Ga0496116_0012692_426_1319 290
277 3300048920 Ga0496117_0009706 Ga0496117_0009706_678_1571 290
278 3300048920 Ga0496117_0185523 Ga0496117_0185523_112_1008 290
279 3300048922 Ga0496119_0112682 Ga0496119_0112682_255_1148 290
280 3300048924 Ga0496121_0259512 Ga0496121_0259512_197_1090 290
281 3300048926 Ga0496123_0090192 Ga0496123_0090192_734_1627 290
282 3300048928 Ga0496125_0080691 Ga0496125_0080691_1154_2047 290
283 3300049459 Ga0495678_031570 Ga0495678_031570_477_1370 290
284 3300053109 Ga0500569_009618 Ga0500569_009618_1298_2191 290
285 3300053139 Ga0500568_0001438 Ga0500568_0001438_2148_3041 290
286 3300053142 Ga0500577_0122988 Ga0500577_0122988_81_974 290
287 3300053153 Ga0500616_0000472 Ga0500616_0000472_5741_6634 290
288 3300053158 Ga0500627_0050943 Ga0500627_0050943_456_1349 290
289 iso_pu_bacteria 2602042107 2603860744 290
290 3300005327 Ga0070658_10018138 Ga0070658_100181383 291
291 3300005336 Ga0070680_100000827 Ga0070680_10000082717 291
292 3300005458 Ga0070681_10000681 Ga0070681_1000068117 291
293 3300005530 Ga0070679_100008706 Ga0070679_1000087063 291
294 3300006847 Ga0075431_100372918 Ga0075431_1003729182 291
295 3300009093 Ga0105240_10002521 Ga0105240_1000252119 291
296 3300025909 Ga0207705_10008204 Ga0207705_100082046 291
297 3300025912 Ga0207707_10014526 Ga0207707_100145266 291
298 3300025913 Ga0207695_10055812 Ga0207695_100558122 291
299 3300025921 Ga0207652_10039117 Ga0207652_100391173 291
300 3300025949 Ga0207667_10011494 Ga0207667_100114946 291
301 3300031711 Ga0265314_10002234 Ga0265314_100022342 291
302 3300044842 Ga0466957_0140093 Ga0466957_0140093_44_937 291
303 3300048908 Ga0496105_0030374 Ga0496105_0030374_657_1547 291
304 3300050509 nmdc:mga0qj67_57041_c1 nmdc:mga0qj67_57041_c1_1604_2500 291
305 3300053117 Ga0500593_000025 Ga0500593_000025_24673_25569 291
306 3300053139 Ga0500568_0000005 Ga0500568_0000005_454022_454918 291
307 iso_pu_bacteria 2503198000 2503200081 291
308 iso_pu_bacteria 2508501127 2509140121 291
309 iso_pu_bacteria 2509276018 2509371368 291
310 iso_pu_bacteria 2510065059 2510315970 291
311 iso_pu_bacteria 2512875016 2512932448 291
312 iso_pu_bacteria 2513237090 2513608832 291
313 iso_pu_bacteria 2513237092 2513621727 291
314 iso_pu_bacteria 2513237095 2513651223 291
315 iso_pu_bacteria 2513237104 2513720810 291
316 iso_pu_bacteria 2513237159 2514002361 291
317 iso_pu_bacteria 2513237164 2514036457 291
318 iso_pu_bacteria 2513237305 2514422514 291
319 iso_pu_bacteria 2524023205 2524436144 291
320 iso_pu_bacteria 2524023210 2524468788 291
321 iso_pu_bacteria 2528768022 2528848841 291
322 iso_pu_bacteria 2582581306 2585266760 291
323 iso_pu_bacteria 2582581865 2585387801 291
324 iso_pu_bacteria 2617270735 2617352794 291
325 iso_pu_bacteria 2617270741 2617372864 291
326 iso_pu_bacteria 2643221607 2644048165 291
327 iso_pu_bacteria 2643221636 2644201891 291
328 iso_pu_bacteria 2643221686 2644480958 291
329 iso_pu_bacteria 2687453392 2688597973 291
330 iso_pu_bacteria 2721755686 2723576685 291
331 iso_pu_bacteria 2721755755 2723843557 291
332 iso_pu_bacteria 2744054633 2745080900 291
333 iso_pu_bacteria 2756170246 2756672037 291
334 iso_pu_bacteria 2791355196 2793061009 291
335 iso_pu_bacteria 2791355199 2793083914 291
336 iso_pu_bacteria 2816332527 2818236698 291
337 iso_pu_bacteria 2824600985 2824602916 291
338 iso_pu_bacteria 2824609381 2824611861 291
339 iso_pu_bacteria 2824653114 2824655092 291
340 iso_pu_bacteria 2824671348 2824672242 291
341 iso_pu_bacteria 2824679649 2824682187 291
342 iso_pu_bacteria 2824687955 2824688875 291
343 iso_pu_bacteria 2824704595 2824708447 291
344 iso_pu_bacteria 2824732956 2824733948 291
345 iso_pu_bacteria 2824746037 2824748380 291
346 iso_pu_bacteria 2824753945 2824757988 291
347 iso_pu_bacteria 2824763712 2824766477 291
348 iso_pu_bacteria 2828305725 2828306949 291
349 iso_pu_bacteria 2838122688 2838129354 291
350 iso_pu_bacteria 2841734538 2841736037 291
351 iso_pu_bacteria 2841941048 2841948966 291
352 iso_pu_bacteria 2841966195 2841972983 291
353 iso_pu_bacteria 2841974524 2841978346 291
354 iso_pu_bacteria 2841983080 2841990559 291
355 iso_pu_bacteria 2842521101 2842524331 291
356 iso_pu_bacteria 2844002411 2844008015 291
357 iso_pu_bacteria 2844009547 2844013191 291
358 iso_pu_bacteria 2847930680 2847937458 291
359 iso_pu_bacteria 2856320880 2856323182 291
360 iso_pu_bacteria 2856328259 2856333682 291
361 iso_pu_bacteria 2856334872 2856338071 291
362 iso_pu_bacteria 2856342000 2856345789 291
363 iso_pu_bacteria 2856349417 2856355303 291
364 iso_pu_bacteria 2856356410 2856362539 291
365 iso_pu_bacteria 2857367948 2857370316 291
366 iso_pu_bacteria 2869242130 2869243431 291
367 iso_pu_bacteria 2869249662 2869250983 291
368 iso_pu_bacteria 2869256925 2869261233 291
369 iso_pu_bacteria 2869264136 2869264301 291
370 iso_pu_bacteria 2869271264 2869275052 291
371 iso_pu_bacteria 2869278585 2869282732 291
372 iso_pu_bacteria 2871451962 2871455929 291
373 iso_pu_bacteria 2871459585 2871460280 291
374 iso_pu_bacteria 2871474448 2871480063 291
375 iso_pu_bacteria 2871481445 2871483600 291
376 iso_pu_bacteria 2871488783 2871488858 291
377 iso_pu_bacteria 2871495908 2871496655 291
378 iso_pu_bacteria 2874116593 2874119895 291
379 iso_pu_bacteria 2874123672 2874131100 291
380 iso_pu_bacteria 2874131515 2874138248 291
381 iso_pu_bacteria 2874139085 2874142390 291
382 iso_pu_bacteria 2874162495 2874165064 291
383 iso_pu_bacteria 2874168670 2874169266 291
384 iso_pu_bacteria 2874620515 2874628210 291
385 iso_pu_bacteria 2874628541 2874630186 291
386 iso_pu_bacteria 2876363079 2876367518 291
387 iso_pu_bacteria 2876386047 2876386602 291
388 iso_pu_bacteria 2876392853 2876398304 291
389 iso_pu_bacteria 2876399893 2876404995 291
390 iso_pu_bacteria 2876420981 2876421538 291
391 iso_pu_bacteria 2876761206 2876768229 291
392 iso_pu_bacteria 2878738818 2878744425 291
393 iso_pu_bacteria 2878753008 2878753621 291
394 iso_pu_bacteria 2878760144 2878760882 291
395 iso_pu_bacteria 2878767105 2878767845 291
396 iso_pu_bacteria 2878774303 2878779778 291
397 iso_pu_bacteria 2878781027 2878785102 291
398 iso_pu_bacteria 2879083081 2879084871 291
399 iso_pu_bacteria 2879099564 2879107851 291
400 iso_pu_bacteria 2881147464 2881151187 291
401 iso_pu_bacteria 2881155292 2881156640 291
402 iso_pu_bacteria 2881161766 2881167391 291
403 iso_pu_bacteria 2881665667 2881670066 291
404 iso_pu_bacteria 2881845957 2881852506 291
405 iso_pu_bacteria 2881853255 2881857559 291
406 iso_pu_bacteria 2881861095 2881866910 291
407 iso_pu_bacteria 2882632389 2882633538 291
408 iso_pu_bacteria 2882912400 2882918140 291
409 iso_pu_bacteria 2885305155 2885309293 291
410 iso_pu_bacteria 2885312484 2885314507 291
411 iso_pu_bacteria 2885318864 2885323789 291
412 iso_pu_bacteria 2885326080 2885330337 291
413 iso_pu_bacteria 2885334103 2885339538 291
414 iso_pu_bacteria 2885342637 2885349012 291
415 iso_pu_bacteria 2885350715 2885354520 291
416 iso_pu_bacteria 2885383462 2885387781 291
417 iso_pu_bacteria 2885409591 2885413820 291
418 iso_pu_bacteria 2888337043 2888338400 291
419 iso_pu_bacteria 2888343758 2888344007 291
420 iso_pu_bacteria 2888378607 2888385600 291
421 iso_pu_bacteria 2888388044 2888392651 291
422 iso_pu_bacteria 2888419890 2888425728 291
423 iso_pu_bacteria 2889033259 2889037862 291
424 iso_pu_bacteria 2903448605 2903450298 291
425 iso_pu_bacteria 2903492973 2903495517 291
426 iso_pu_bacteria 2903513507 2903518072 291
427 iso_pu_bacteria 2903521522 2903521965 291
428 iso_pu_bacteria 2903528002 2903528342 291
429 iso_pu_bacteria 2903540706 2903541453 291
430 iso_pu_bacteria 2904659560 2904664859 291
431 iso_pu_bacteria 2904666416 2904674172 291
432 iso_pu_bacteria 2904711408 2904711825 291
433 iso_pu_bacteria 2906378014 2906381556 291
434 iso_pu_bacteria 2906393657 2906397940 291
435 iso_pu_bacteria 2906401398 2906407034 291
436 iso_pu_bacteria 2906408224 2906413671 291
437 iso_pu_bacteria 2906427513 2906427631 291
438 iso_pu_bacteria 2906626472 2906627736 291
439 iso_pu_bacteria 2908775508 2908781313 291
440 iso_pu_bacteria 2922151315 2922156727 291
441 iso_pu_bacteria 2922172374 2922172679 291
442 iso_pu_bacteria 2922361189 2922361810 291
443 iso_pu_bacteria 2922393267 2922396937 291
444 iso_pu_bacteria 2924718760 2924722549 291
445 iso_pu_bacteria 2924733363 2924734867 291
446 iso_pu_bacteria 2924741084 2924741643 291
447 iso_pu_bacteria 2924748358 2924750009 291
448 iso_pu_bacteria 2924754689 2924759774 291
449 iso_pu_bacteria 2924762789 2924769036 291
450 iso_pu_bacteria 2924776078 2924782455 291
451 iso_pu_bacteria 2924784321 2924790059 291
452 iso_pu_bacteria 2929615660 2929621169 291
453 iso_pu_bacteria 2929624759 2929626000 291
454 iso_pu_bacteria 2932784394 2932785122 291
455 iso_pu_bacteria 2932809354 2932810150 291
456 iso_pu_bacteria 2932818245 2932821723 291
457 iso_pu_bacteria 2932828146 2932828959 291
458 iso_pu_bacteria 2933577622 2933582962 291
459 iso_pu_bacteria 2935616580 2935619622 291
460 iso_pu_bacteria 2935638405 2935638602 291
461 iso_pu_bacteria 2935665750 2935666546 291
462 iso_pu_bacteria 2935675223 2935676411 291
463 iso_pu_bacteria 2935684952 2935691073 291
464 iso_pu_bacteria 2935694250 2935694493 291
465 iso_pu_bacteria 2935703347 2935703608 291
466 iso_pu_bacteria 2935713505 2935718454 291
467 iso_pu_bacteria 2935722832 2935727566 291
468 iso_pu_bacteria 2935732158 2935736269 291
469 iso_pu_bacteria 2935741537 2935745649 291
470 iso_pu_bacteria 2935750917 2935756030 291
471 iso_pu_bacteria 2935760218 2935760710 291
472 iso_pu_bacteria 2935769743 2935777121 291
473 iso_pu_bacteria 2935785616 2935793003 291
474 iso_pu_bacteria 2935793552 2935801032 291
475 iso_pu_bacteria 2935801545 2935801745 291
476 iso_pu_bacteria 2935810662 2935814839 291
477 iso_pu_bacteria 2935827899 2935828096 291
478 iso_pu_bacteria 2935837841 2935842301 291
479 iso_pu_bacteria 2935855204 2935858063 291
480 iso_pu_bacteria 2935864058 2935867967 291
481 iso_pu_bacteria 2935873716 2935874009 291
482 iso_pu_bacteria 2935992306 2935993066 291
483 iso_pu_bacteria 2936002035 2936002978 291
484 iso_pu_bacteria 2936037263 2936040518 291
485 iso_pu_bacteria 2937822353 2937822856 291
486 iso_pu_bacteria 2937836603 2937836730 291
487 iso_pu_bacteria 2937861824 2937868811 291
488 iso_pu_bacteria 2937868953 2937870464 291
489 iso_pu_bacteria 2937877337 2937881096 291
490 iso_pu_bacteria 2937972304 2937977190 291
491 iso_pu_bacteria 2937980651 2937987072 291
492 iso_pu_bacteria 2937994558 2937995309 291
493 iso_pu_bacteria 2940556831 2940561995 291
494 iso_pu_bacteria 2941538514 2941542350 291
495 iso_pu_bacteria 2958034702 2958039515 291
496 iso_pu_bacteria 2958041894 2958052856 291
497 iso_pu_bacteria 2958071322 2958076097 291
498 iso_pu_bacteria 2958084443 2958088347 291
499 iso_pu_bacteria 2958092219 2958094076 291
500 iso_pu_bacteria 2958122699 2958128690 291
501 iso_pu_bacteria 2958137437 2958141941 291
502 iso_pu_bacteria 2958144490 2958145497 291
503 iso_pu_bacteria 2958158011 2958158580 291
504 iso_pu_bacteria 2958165035 2958165785 291
505 iso_pu_bacteria 2961114664 2961119858 291
506 iso_pu_bacteria 2961163497 2961164244 291
507 iso_pu_bacteria 2961170736 2961170811 291
508 iso_pu_bacteria 2961183825 2961189011 291
509 iso_pu_bacteria 2963644680 2963646755 291
510 iso_pu_bacteria 2965018300 2965019233 291
511 iso_pu_bacteria 2965025482 2965025975 291
512 iso_pu_bacteria 2965032056 2965034083 291
513 iso_pu_bacteria 2965040258 2965047021 291
514 iso_pu_bacteria 2965047637 2965053131 291
515 iso_pu_bacteria 2965110997 2965114709 291
516 iso_pu_bacteria 2967996073 2968003390 291
517 iso_pu_bacteria 2968003550 2968004157 291
518 iso_pu_bacteria 2968016561 2968020842 291
519 iso_pu_bacteria 2968083720 2968090454 291
520 iso_pu_bacteria 2968110612 2968116215 291
521 iso_pu_bacteria 2968138860 2968142174 291
522 iso_pu_bacteria 2968171901 2968172644 291
523 iso_pu_bacteria 2970469710 2970474139 291
524 iso_pu_bacteria 2970489779 2970493348 291
525 iso_pu_bacteria 2970503327 2970503401 291
526 iso_pu_bacteria 2970510686 2970512774 291
527 iso_pu_bacteria 2970524798 2970525711 291
528 iso_pu_bacteria 2970532167 2970532946 291
529 iso_pu_bacteria 2970540015 2970542497 291
530 iso_pu_bacteria 2970547951 2970551669 291
531 iso_pu_bacteria 2970554993 2970555737 291
532 iso_pu_bacteria 2970593180 2970597341 291
533 iso_pu_bacteria 2970619444 2970622660 291
534 iso_pu_bacteria 2970627176 2970630056 291
535 iso_pu_bacteria 2977821940 2977822838 291
536 iso_pu_bacteria 2977828996 2977833448 291
537 iso_pu_bacteria 2977851361 2977856524 291
538 iso_pu_bacteria 2977864932 2977870735 291
539 iso_pu_bacteria 2977872689 2977873195 291
540 iso_pu_bacteria 2977915119 2977916569 291
541 iso_pu_bacteria 2977935797 2977942065 291
542 iso_pu_bacteria 2977950692 2977954215 291
543 iso_pu_bacteria 2977957713 2977962971 291
544 iso_pu_bacteria 2979772303 2979774629 291
545 iso_pu_bacteria 2979793036 2979798065 291
546 iso_pu_bacteria 2979808191 2979815630 291
547 iso_pu_bacteria 2987659509 2987660250 291
548 iso_pu_bacteria 2987666974 2987672889 291
549 iso_pu_bacteria 2987673487 2987678258 291
550 iso_pu_bacteria 2996348954 2996352540 291
551 iso_pu_bacteria 2996386984 2996388848 291
552 iso_pu_bacteria 3004167301 3004168247 291
553 iso_pu_bacteria 3004188549 3004189299 291
554 iso_pu_bacteria 3004248173 3004251337 291
555 iso_pu_bacteria 3004268573 3004268745 291
556 iso_pu_bacteria 3004275668 3004279222 291
557 iso_pu_bacteria 3004334049 3004335632 291
558 iso_pu_bacteria 3005474847 3005481415 291
559 iso_pu_bacteria 3005483717 3005485534 291
560 iso_pu_bacteria 3005587118 3005588197 291
561 iso_pu_bacteria 637000159 637075546 291
562 iso_pu_bacteria 649633066 649872505 291
563 iso_pu_bacteria 8004300914 8004302941 291
564 iso_pu_bacteria 8004361976 8004366607 291
565 iso_pu_bacteria 8004374579 8004375194 291
566 iso_pu_bacteria 8004633249 8004634030 291
567 iso_pu_bacteria 8004695233 8004702349 291
568 iso_pu_bacteria 8004727605 8004728785 291
569 iso_pu_bacteria 8006984368 8006984574 291
570 iso_pu_bacteria 8016511872 8016520503 291
571 iso_pu_bacteria 8016530956 8016533719 291
572 iso_pu_bacteria 8016548790 8016555179 291
573 iso_pu_bacteria 8016557553 8016563548 291
574 iso_pu_bacteria 8016575299 8016576248 291
575 iso_pu_bacteria 8016583857 8016594518 291
576 iso_pu_bacteria 8016595262 8016601284 291
577 iso_pu_bacteria 8017057580 8017065072 291
578 iso_pu_bacteria 8019530166 8019533495 291
579 iso_pu_bacteria 8019576017 8019584455 291
580 iso_pu_bacteria 8019586578 8019592229 291
581 iso_pu_bacteria 8019608314 8019609309 291
582 iso_pu_bacteria 8055617313 8055617524 291
583 iso_pu_bacteria 8055742211 8055744969 291
584 iso_pu_bacteria 8056673599 8056680966 291
585 3300005467 Ga0070706_100131498 Ga0070706_1001314981 292
586 3300005518 Ga0070699_100130139 Ga0070699_1001301392 292
587 3300021361 Ga0213872_10068402 Ga0213872_100684022 292
588 3300031730 Ga0307516_10091312 Ga0307516_100913125 292
589 3300039447 Ga0436361_0285992 Ga0436361_0285992_912_1814 292
590 3300048924 Ga0496121_0000230 Ga0496121_0000230_21784_22674 292
591 iso_pu_bacteria 2510461069 2510839697 292
592 iso_pu_bacteria 2513237096 2513661771 292
593 iso_pu_bacteria 2513237144 2513910753 292
594 iso_pu_bacteria 2513237145 2513923418 292
595 iso_pu_bacteria 2513237146 2513927271 292
596 iso_pu_bacteria 2517572143 2517891200 292
597 iso_pu_bacteria 2558860983 2561467420 292
598 iso_pu_bacteria 2599185170 2599415288 292
599 iso_pu_bacteria 2600254933 2600376363 292
600 iso_pu_bacteria 2643221653 2644297578 292
601 iso_pu_bacteria 2643221719 2644655831 292
602 iso_pu_bacteria 2643221734 2644734624 292
603 iso_pu_bacteria 2667528175 2671123193 292
604 iso_pu_bacteria 2775507049 2776910522 292
605 iso_pu_bacteria 2838035591 2838038987 292
606 iso_pu_bacteria 2838661181 2838664421 292
607 iso_pu_bacteria 2851182111 2851186955 292
608 iso_pu_bacteria 2885374607 2885382931 292
609 iso_pu_bacteria 2903748898 2903749678 292
610 iso_pu_bacteria 2904690495 2904698889 292
611 iso_pu_bacteria 2906635258 2906638162 292
612 iso_pu_bacteria 2906660503 2906662837 292
613 iso_pu_bacteria 2908739725 2908741520 292
614 iso_pu_bacteria 2917699015 2917704073 292
615 iso_pu_bacteria 2933016740 2933017889 292
616 iso_pu_bacteria 2935630451 2935635825 292
617 iso_pu_bacteria 2937848649 2937851905 292
618 iso_pu_bacteria 2941507105 2941512338 292
619 iso_pu_bacteria 2941515067 2941520157 292
620 iso_pu_bacteria 2941523033 2941528306 292
621 iso_pu_bacteria 2977922695 2977925049 292
622 iso_pu_bacteria 2977986579 2977988206 292
623 iso_pu_bacteria 2989776772 2989777481 292
624 iso_pu_bacteria 3004211236 3004218160 292
625 iso_pu_bacteria 3004218560 3004220793 292
626 iso_pu_bacteria 3005445848 3005450913 292
627 iso_pu_bacteria 8005246636 8005250049 292
628 iso_pu_bacteria 8006933436 8006939297 292
629 iso_pu_bacteria 8006973647 8006978954 292
630 iso_pu_bacteria 8056689827 8056690654 292
631 3300003215 JGI25153J46596_10014527 JGI25153J46596_100145272 293
632 3300003794 Ga0055531_10010658 Ga0055531_100106583 293
633 3300005262 Ga0065165_1010313 Ga0065165_10103132 293
634 3300005365 Ga0070688_100111268 Ga0070688_1001112682 293
635 3300005367 Ga0070667_100377141 Ga0070667_1003771411 293
636 3300005539 Ga0068853_100195167 Ga0068853_1001951672 293
637 3300005563 Ga0068855_100381886 Ga0068855_1003818862 293
638 3300005618 Ga0068864_100519544 Ga0068864_1005195442 293
639 3300005937 Ga0081455_10048637 Ga0081455_100486374 293
640 3300006028 Ga0070717_10381551 Ga0070717_103815511 293
641 3300006173 Ga0070716_100220925 Ga0070716_1002209252 293
642 3300006186 Ga0075369_10121883 Ga0075369_101218831 293
643 3300009098 Ga0105245_10006247 Ga0105245_1000624711 293
644 3300009545 Ga0105237_10073940 Ga0105237_100739405 293
645 3300009551 Ga0105238_10068422 Ga0105238_100684223 293
646 3300010159 Ga0099796_10016009 Ga0099796_100160092 293
647 3300011119 Ga0105246_10052627 Ga0105246_100526272 293
648 3300025291 Ga0209675_1023374 Ga0209675_10233742 293
649 3300025295 Ga0209564_1005137 Ga0209564_10051372 293
650 3300025297 Ga0209758_1000011 Ga0209758_1000011457 293
651 3300025299 Ga0209256_1005504 Ga0209256_10055046 293
652 3300025303 Ga0209051_1037393 Ga0209051_10373932 293
653 3300025304 Ga0209257_1000654 Ga0209257_100065428 293
654 3300025900 Ga0207710_10117633 Ga0207710_101176332 293
655 3300025914 Ga0207671_10008285 Ga0207671_100082855 293
656 3300025915 Ga0207693_10087797 Ga0207693_100877972 293
657 3300025924 Ga0207694_10047057 Ga0207694_100470572 293
658 3300025927 Ga0207687_10009010 Ga0207687_100090104 293
659 3300025934 Ga0207686_10129469 Ga0207686_101294692 293
660 3300025941 Ga0207711_10187050 Ga0207711_101870502 293
661 3300037471 Ga0395905_0010005 Ga0395905_0010005_7827_8717 293
662 3300048903 Ga0496100_0246446 Ga0496100_0246446_350_1240 293
663 3300048904 Ga0496101_0293806 Ga0496101_0293806_204_1094 293
664 3300048924 Ga0496121_0028245 Ga0496121_0028245_851_1732 293
665 3300048928 Ga0496125_0050643 Ga0496125_0050643_468_1349 293
666 3300049573 Ga0501037_0165632 Ga0501037_0165632_571_1461 293
667 3300053156 Ga0500622_0013905 Ga0500622_0013905_2759_3640 293
668 iso_pu_bacteria 2509276021 2509390913 293
669 iso_pu_bacteria 2509276033 2509445345 293
670 iso_pu_bacteria 2510065019 2510137532 293
671 iso_pu_bacteria 2510461076 2510893428 293
672 iso_pu_bacteria 2510917022 2511133404 293
673 iso_pu_bacteria 2510917026 2511170525 293
674 iso_pu_bacteria 2510917028 2511184971 293
675 iso_pu_bacteria 2513237084 2513573914 293
676 iso_pu_bacteria 2513237085 2513575910 293
677 iso_pu_bacteria 2513237093 2513633657 293
678 iso_pu_bacteria 2513237103 2513712246 293
679 iso_pu_bacteria 2513237162 2514019120 293
680 iso_pu_bacteria 2515075009 2515109603 293
681 iso_pu_bacteria 2515154113 2515634368 293
682 iso_pu_bacteria 2515154114 2515641753 293
683 iso_pu_bacteria 2515154116 2515658979 293
684 iso_pu_bacteria 2515154134 2515742678 293
685 iso_pu_bacteria 2516653077 2517042670 293
686 iso_pu_bacteria 2516653085 2517081367 293
687 iso_pu_bacteria 2517093000 2517100250 293
688 iso_pu_bacteria 2517287029 2517411139 293
689 iso_pu_bacteria 2519899620 2520377525 293
690 iso_pu_bacteria 2529292951 2530648676 293
691 iso_pu_bacteria 2537561587 2537873084 293
692 iso_pu_bacteria 2554235003 2554245068 293
693 iso_pu_bacteria 2558860242 2559297101 293
694 iso_pu_bacteria 2582581283 2585167114 293
695 iso_pu_bacteria 2582581299 2585227740 293
696 iso_pu_bacteria 2582581304 2585255594 293
697 iso_pu_bacteria 2582581307 2585276726 293
698 iso_pu_bacteria 2582581316 2585332855 293
699 iso_pu_bacteria 2582581867 2585402541 293
700 iso_pu_bacteria 2585427526 2585526454 293
701 iso_pu_bacteria 2585427528 2585538708 293
702 iso_pu_bacteria 2585427531 2585562700 293
703 iso_pu_bacteria 2585427590 2585820535 293
704 iso_pu_bacteria 2585427593 2585836661 293
705 iso_pu_bacteria 2585427594 2585847677 293
706 iso_pu_bacteria 2585427608 2585899340 293
707 iso_pu_bacteria 2585427609 2585908743 293
708 iso_pu_bacteria 2585427633 2585997436 293
709 iso_pu_bacteria 2585427634 2586002042 293
710 iso_pu_bacteria 2585428125 2587984160 293
711 iso_pu_bacteria 2599185210 2599604934 293
712 iso_pu_bacteria 2600255279 2601611058 293
713 iso_pu_bacteria 2600255308 2601747831 293
714 iso_pu_bacteria 2615840624 2616294900 293
715 iso_pu_bacteria 2615840698 2616552205 293
716 iso_pu_bacteria 2643221568 2643858014 293
717 iso_pu_bacteria 2643221582 2643916736 293
718 iso_pu_bacteria 2643221634 2644195811 293
719 iso_pu_bacteria 2643221643 2644241020 293
720 iso_pu_bacteria 2643221689 2644497448 293
721 iso_pu_bacteria 2643221693 2644521344 293
722 iso_pu_bacteria 2667528174 2671116744 293
723 iso_pu_bacteria 2718217882 2719184933 293
724 iso_pu_bacteria 2718217927 2719389884 293
725 iso_pu_bacteria 2718217997 2719668934 293
726 iso_pu_bacteria 2718218009 2719728953 293
727 iso_pu_bacteria 2718218199 2720489627 293
728 iso_pu_bacteria 2718218232 2720610347 293
729 iso_pu_bacteria 2718218233 2720617766 293
730 iso_pu_bacteria 2718218235 2720628908 293
731 iso_pu_bacteria 2718218269 2720772857 293
732 iso_pu_bacteria 2718218363 2721144644 293
733 iso_pu_bacteria 2718218365 2721156149 293
734 iso_pu_bacteria 2718218366 2721162014 293
735 iso_pu_bacteria 2718218423 2721403523 293
736 iso_pu_bacteria 2721755514 2722843159 293
737 iso_pu_bacteria 2721755556 2723030301 293
738 iso_pu_bacteria 2721755684 2723564662 293
739 iso_pu_bacteria 2721755685 2723569652 293
740 iso_pu_bacteria 2721755809 2724035099 293
741 iso_pu_bacteria 2721755810 2724041978 293
742 iso_pu_bacteria 2721755819 2724092886 293
743 iso_pu_bacteria 2721755822 2724101199 293
744 iso_pu_bacteria 2721755823 2724113274 293
745 iso_pu_bacteria 2724679232 2725950896 293
746 iso_pu_bacteria 2728369352 2730110834 293
747 iso_pu_bacteria 2728369365 2730161048 293
748 iso_pu_bacteria 2728369397 2730295682 293
749 iso_pu_bacteria 2738541293 2738799935 293
750 iso_pu_bacteria 2738541333 2739034131 293
751 iso_pu_bacteria 2765235942 2766068203 293
752 iso_pu_bacteria 2775507266 2778178917 293
753 iso_pu_bacteria 2791355256 2793297345 293
754 iso_pu_bacteria 2791355259 2793317758 293
755 iso_pu_bacteria 2791355260 2793324435 293
756 iso_pu_bacteria 2791355261 2793328028 293
757 iso_pu_bacteria 2791355262 2793334151 293
758 iso_pu_bacteria 2791355263 2793340752 293
759 iso_pu_bacteria 2791355264 2793345821 293
760 iso_pu_bacteria 2791355265 2793354546 293
761 iso_pu_bacteria 2791355266 2793361840 293
762 iso_pu_bacteria 2791355267 2793367363 293
763 iso_pu_bacteria 2802429605 2805930196 293
764 iso_pu_bacteria 2802429606 2805934779 293
765 iso_pu_bacteria 2802429633 2806042928 293
766 iso_pu_bacteria 2802429634 2806050881 293
767 iso_pu_bacteria 2802429635 2806057951 293
768 iso_pu_bacteria 2802429636 2806065336 293
769 iso_pu_bacteria 2802429637 2806076819 293
770 iso_pu_bacteria 2808606387 2808988938 293
771 iso_pu_bacteria 2818991272 2819243340 293
772 iso_pu_bacteria 2818991439 2819561180 293
773 iso_pu_bacteria 2818991448 2819610119 293
774 iso_pu_bacteria 2821123053 2821128962 293
775 iso_pu_bacteria 2838016132 2838016982 293
776 iso_pu_bacteria 2838022645 2838027467 293
777 iso_pu_bacteria 2838029111 2838030641 293
778 iso_pu_bacteria 2838048938 2838050197 293
779 iso_pu_bacteria 2838061910 2838062309 293
780 iso_pu_bacteria 2838068647 2838069318 293
781 iso_pu_bacteria 2838668709 2838673087 293
782 iso_pu_bacteria 2838675328 2838678449 293
783 iso_pu_bacteria 2838680041 2838686140 293
784 iso_pu_bacteria 2838686498 2838688384 293
785 iso_pu_bacteria 2838694306 2838700489 293
786 iso_pu_bacteria 2838701080 2838705709 293
787 iso_pu_bacteria 2838707686 2838713768 293
788 iso_pu_bacteria 2838714209 2838716643 293
789 iso_pu_bacteria 2838719591 2838722745 293
790 iso_pu_bacteria 2838724970 2838727394 293
791 iso_pu_bacteria 2838729681 2838734481 293
792 iso_pu_bacteria 2838736955 2838742277 293
793 iso_pu_bacteria 2838742623 2838746940 293
794 iso_pu_bacteria 2841840854 2841846133 293
795 iso_pu_bacteria 2841846520 2841849012 293
796 iso_pu_bacteria 2841851746 2841852125 293
797 iso_pu_bacteria 2841859092 2841861967 293
798 iso_pu_bacteria 2841864319 2841865753 293
799 iso_pu_bacteria 2842077413 2842083079 293
800 iso_pu_bacteria 2842110456 2842111597 293
801 iso_pu_bacteria 2842118031 2842124113 293
802 iso_pu_bacteria 2842124991 2842128239 293
803 iso_pu_bacteria 2842130223 2842133342 293
804 iso_pu_bacteria 2842140634 2842145837 293
805 iso_pu_bacteria 2842152218 2842155335 293
806 iso_pu_bacteria 2842156927 2842158800 293
807 iso_pu_bacteria 2842163707 2842166229 293
808 iso_pu_bacteria 2842170452 2842173835 293
809 iso_pu_bacteria 2842175837 2842178956 293
810 iso_pu_bacteria 2842180545 2842182414 293
811 iso_pu_bacteria 2842187318 2842189751 293
812 iso_pu_bacteria 2842192696 2842196662 293
813 iso_pu_bacteria 2842198810 2842203007 293
814 iso_pu_bacteria 2842205361 2842209198 293
815 iso_pu_bacteria 2842211629 2842214065 293
816 iso_pu_bacteria 2842217011 2842222447 293
817 iso_pu_bacteria 2842224351 2842226785 293
818 iso_pu_bacteria 2842229732 2842234573 293
819 iso_pu_bacteria 2842237096 2842243181 293
820 iso_pu_bacteria 2842243621 2842248306 293
821 iso_pu_bacteria 2842250916 2842255389 293
822 iso_pu_bacteria 2842257432 2842262521 293
823 iso_pu_bacteria 2842264693 2842268568 293
824 iso_pu_bacteria 2842271015 2842272666 293
825 iso_pu_bacteria 2842278818 2842282756 293
826 iso_pu_bacteria 2842291075 2842297338 293
827 iso_pu_bacteria 2842304105 2842307893 293
828 iso_pu_bacteria 2842311132 2842312855 293
829 iso_pu_bacteria 2842317721 2842320437 293
830 iso_pu_bacteria 2842341865 2842345703 293
831 iso_pu_bacteria 2842363717 2842363999 293
832 iso_pu_bacteria 2842370503 2842376241 293
833 iso_pu_bacteria 2842377471 2842383732 293
834 iso_pu_bacteria 2842384541 2842390871 293
835 iso_pu_bacteria 2842402390 2842405590 293
836 iso_pu_bacteria 2842409023 2842412174 293
837 iso_pu_bacteria 2842415677 2842418820 293
838 iso_pu_bacteria 2842422224 2842422509 293
839 iso_pu_bacteria 2842428310 2842432540 293
840 iso_pu_bacteria 2842434925 2842438844 293
841 iso_pu_bacteria 2842441272 2842445319 293
842 iso_pu_bacteria 2842447887 2842449671 293
843 iso_pu_bacteria 2842462802 2842466483 293
844 iso_pu_bacteria 2842469257 2842473459 293
845 iso_pu_bacteria 2842475841 2842477078 293
846 iso_pu_bacteria 2842482326 2842485689 293
847 iso_pu_bacteria 2842489311 2842489397 293
848 iso_pu_bacteria 2842495871 2842497944 293
849 iso_pu_bacteria 2842502639 2842503875 293
850 iso_pu_bacteria 2842515876 2842517767 293
851 iso_pu_bacteria 2844454524 2844461564 293
852 iso_pu_bacteria 2854896431 2854901513 293
853 iso_pu_bacteria 2854916844 2854921310 293
854 iso_pu_bacteria 2857516855 2857520614 293
855 iso_pu_bacteria 2857531043 2857536381 293
856 iso_pu_bacteria 2899792073 2899794750 293
857 iso_pu_bacteria 2899803654 2899804370 293
858 iso_pu_bacteria 2899845264 2899845297 293
859 iso_pu_bacteria 2919114240 2919116860 293
860 iso_pu_bacteria 2919166419 2919171022 293
861 iso_pu_bacteria 2919171160 2919173732 293
862 iso_pu_bacteria 2919408235 2919413889 293
863 iso_pu_bacteria 2923556063 2923562006 293
864 iso_pu_bacteria 2926754445 2926758373 293
865 iso_pu_bacteria 2926760298 2926764068 293
866 iso_pu_bacteria 2929138655 2929142991 293
867 iso_pu_bacteria 2933006813 2933009286 293
868 iso_pu_bacteria 2933011516 2933013396 293
869 iso_pu_bacteria 2933570622 2933574344 293
870 iso_pu_bacteria 2933586486 2933590803 293
871 iso_pu_bacteria 2933594066 2933598267 293
872 iso_pu_bacteria 2933599457 2933599982 293
873 iso_pu_bacteria 2935894831 2935900806 293
874 iso_pu_bacteria 2935901341 2935907911 293
875 iso_pu_bacteria 2936367885 2936370773 293
876 iso_pu_bacteria 2936381700 2936382455 293
877 iso_pu_bacteria 2978969890 2978970453 293
878 iso_pu_bacteria 2979089926 2979090834 293
879 iso_pu_bacteria 2979095461 2979096359 293
880 iso_pu_bacteria 2979100975 2979101924 293
881 iso_pu_bacteria 2984509177 2984510138 293
882 iso_pu_bacteria 2984518228 2984519159 293
883 iso_pu_bacteria 2984537506 2984538479 293
884 iso_pu_bacteria 2984587000 2984587484 293
885 iso_pu_bacteria 2984601300 2984605201 293
886 iso_pu_bacteria 2996887358 2996887806 293
887 iso_pu_bacteria 2996893221 2996897260 293
888 iso_pu_bacteria 3003930520 3003933859 293
889 iso_pu_bacteria 3005416602 3005417232 293
890 iso_pu_bacteria 639633055 639650936 293
891 iso_pu_bacteria 650716007 650843528 293
892 iso_pu_bacteria 8003570095 8003573203 293
893 iso_pu_bacteria 8005258706 8005259152 293
894 iso_pu_bacteria 8005275841 8005276007 293
895 iso_pu_bacteria 8005282627 8005285919 293
896 iso_pu_bacteria 8005289223 8005295349 293
897 iso_pu_bacteria 8005301065 8005307289 293
898 iso_pu_bacteria 8005307578 8005311967 293
899 iso_pu_bacteria 8005314921 8005320519 293
900 iso_pu_bacteria 8005321885 8005322333 293
901 iso_pu_bacteria 8005382845 8005382962 293
902 iso_pu_bacteria 8005395548 8005398561 293
903 iso_pu_bacteria 8005430974 8005433501 293
904 iso_pu_bacteria 8005460587 8005466129 293
905 iso_pu_bacteria 8005484373 8005487488 293
906 iso_pu_bacteria 8005497431 8005502074 293
907 iso_pu_bacteria 8005556819 8005563077 293
908 iso_pu_bacteria 8005563573 8005564925 293
909 iso_pu_bacteria 8005570704 8005575781 293
910 iso_pu_bacteria 8005619151 8005624367 293
911 iso_pu_bacteria 8005626139 8005629629 293
912 iso_pu_bacteria 8005645114 8005647892 293
913 iso_pu_bacteria 8005668836 8005673497 293
914 iso_pu_bacteria 8005682033 8005684258 293
915 iso_pu_bacteria 8005688590 8005688850 293
916 iso_pu_bacteria 8005695170 8005695412 293
917 iso_pu_bacteria 8018127388 8018129247 293
918 iso_pu_bacteria 8018163183 8018169952 293
919 iso_pu_bacteria 8018176218 8018180891 293
920 iso_pu_bacteria 8023680758 8023685957 293
921 iso_pu_bacteria 8024479707 8024485425 293
922 iso_pu_bacteria 8024486573 8024486655 293
923 iso_pu_bacteria 8024501048 8024502925 293
924 iso_pu_bacteria 8054460903 8054463614 293
925 iso_pu_bacteria 8055431914 8055432596 293
926 iso_pu_bacteria 8056375014 8056381827 293
927 iso_pu_bacteria 8056382006 8056382289 293
928 iso_pu_bacteria 8057874678 8057876229 293
929 3300005328 Ga0070676_10082362 Ga0070676_100823622 294
930 3300005355 Ga0070671_100073928 Ga0070671_1000739283 294
931 3300005355 Ga0070671_100253244 Ga0070671_1002532442 294
932 3300005356 Ga0070674_100097276 Ga0070674_1000972762 294
933 3300005544 Ga0070686_100088230 Ga0070686_1000882302 294
934 3300005548 Ga0070665_100341725 Ga0070665_1003417252 294
935 3300006038 Ga0075365_10011946 Ga0075365_100119464 294
936 3300006048 Ga0075363_100135547 Ga0075363_1001355472 294
937 3300006051 Ga0075364_10026122 Ga0075364_100261222 294
938 3300006051 Ga0075364_10106883 Ga0075364_101068832 294
939 3300006177 Ga0075362_10012384 Ga0075362_100123842 294
940 3300006178 Ga0075367_10035948 Ga0075367_100359482 294
941 3300006195 Ga0075366_10011331 Ga0075366_100113313 294
942 3300006353 Ga0075370_10024134 Ga0075370_100241342 294
943 3300009177 Ga0105248_10777425 Ga0105248_107774251 294
944 3300010159 Ga0099796_10058057 Ga0099796_100580571 294
945 3300014969 Ga0157376_10183948 Ga0157376_101839482 294
946 3300025295 Ga0209564_1006466 Ga0209564_10064664 294
947 3300025907 Ga0207645_10072761 Ga0207645_100727612 294
948 3300025941 Ga0207711_10051640 Ga0207711_100516403 294
949 3300026121 Ga0207683_10039324 Ga0207683_100393244 294
950 3300027671 Ga0209588_1017885 Ga0209588_10178852 294
951 3300028379 Ga0268266_10454598 Ga0268266_104545981 294
952 3300035691 Ga0373931_0002261 Ga0373931_0002261_980_1879 294
953 3300035691 Ga0373931_0010721 Ga0373931_0010721_2407_3300 294
954 3300037466 Ga0395898_0483238 Ga0395898_0483238_93_986 294
955 3300044684 Ga0466966_0274186 Ga0466966_0274186_25_918 294
956 3300045049 Ga0466959_0113087 Ga0466959_0113087_1000_1893 294
957 3300046524 Ga0495648_0016438 Ga0495648_0016438_2318_3211 294
958 3300047320 Ga0495672_0012863 Ga0495672_0012863_3856_4752 294
959 3300048904 Ga0496101_0084746 Ga0496101_0084746_663_1556 294
960 3300048905 Ga0496102_0120234 Ga0496102_0120234_680_1573 294
961 3300048907 Ga0496104_0315146 Ga0496104_0315146_102_1001 294
962 3300048909 Ga0496106_0039230 Ga0496106_0039230_508_1401 294
963 3300048911 Ga0496108_0429083 Ga0496108_0429083_126_1019 294
964 3300048912 Ga0496109_0033706 Ga0496109_0033706_82_975 294
965 3300048912 Ga0496109_0202435 Ga0496109_0202435_302_1195 294
966 3300048913 Ga0496110_0372551 Ga0496110_0372551_53_952 294
967 3300048915 Ga0496112_0401976 Ga0496112_0401976_63_956 294
968 3300048916 Ga0496113_0476842 Ga0496113_0476842_41_934 294
969 3300048917 Ga0496114_0392131 Ga0496114_0392131_273_1166 294
970 3300048918 Ga0496115_0005702 Ga0496115_0005702_3415_4308 294
971 3300048919 Ga0496116_0009413 Ga0496116_0009413_6948_7859 294
972 3300048921 Ga0496118_0094285 Ga0496118_0094285_257_1168 294
973 3300048925 Ga0496122_0064306 Ga0496122_0064306_552_1463 294
974 3300048928 Ga0496125_0000763 Ga0496125_0000763_31130_32023 294
975 3300048928 Ga0496125_0000796 Ga0496125_0000796_41693_42586 294
976 3300048928 Ga0496125_0008276 Ga0496125_0008276_8247_9158 294
977 3300049571 Ga0501034_0328983 Ga0501034_0328983_146_1060 294
978 3300049591 Ga0501075_0479701 Ga0501075_0479701_27_920 294
979 3300050489 nmdc:mga03683_10325_c1 nmdc:mga03683_10325_c1_2128_3015 294
980 3300050491 nmdc:mga00v17_21333_c1 nmdc:mga00v17_21333_c1_2121_3032 294
981 3300050492 nmdc:mga0yw44_1949_c1 nmdc:mga0yw44_1949_c1_5797_6708 294
982 3300050493 nmdc:mga0k408_171939_c1 nmdc:mga0k408_171939_c1_362_1249 294
983 3300050496 nmdc:mga07m45_18250_c1 nmdc:mga07m45_18250_c1_2270_3157 294
984 3300050496 nmdc:mga07m45_6280_c1 nmdc:mga07m45_6280_c1_2671_3564 294
985 3300050516 nmdc:mga0sz30_18802_c1 nmdc:mga0sz30_18802_c1_1562_2473 294
986 3300053119 Ga0500595_001896 Ga0500595_001896_6761_7657 294
987 3300053730 Ga0500645_042682 Ga0500645_042682_368_1306 294
988 iso_pu_bacteria 2906370794 2906376784 294
989 3300003215 JGI25153J46596_10007051 JGI25153J46596_100070513 295
990 3300003215 JGI25153J46596_10018377 JGI25153J46596_100183772 295
991 3300003354 JGI25160J50197_1010224 JGI25160J50197_10102244 295
992 3300003659 JGI25404J52841_10001894 JGI25404J52841_100018943 295
993 3300003771 Ga0055526_1001232 Ga0055526_10012324 295
994 3300003775 Ga0055524_1000518 Ga0055524_10005187 295
995 3300005262 Ga0065165_1000853 Ga0065165_100085319 295
996 3300005262 Ga0065165_1001807 Ga0065165_100180715 295
997 3300005262 Ga0065165_1012631 Ga0065165_10126312 295
998 3300005262 Ga0065165_1040556 Ga0065165_10405561 295
999 3300005335 Ga0070666_10039936 Ga0070666_100399365 295
1000 3300005344 Ga0070661_100162391 Ga0070661_1001623911 295
1001 3300005354 Ga0070675_100356182 Ga0070675_1003561822 295
1002 3300005355 Ga0070671_100024365 Ga0070671_1000243652 295
1003 3300005436 Ga0070713_100000526 Ga0070713_1000005262 295
1004 3300005439 Ga0070711_100027954 Ga0070711_1000279543 295
1005 3300005439 Ga0070711_100122903 Ga0070711_1001229032 295
1006 3300005548 Ga0070665_100087923 Ga0070665_1000879232 295
1007 3300005577 Ga0068857_100112605 Ga0068857_1001126052 295
1008 3300005614 Ga0068856_100159392 Ga0068856_1001593921 295
1009 3300005617 Ga0068859_100073860 Ga0068859_1000738603 295
1010 3300005937 Ga0081455_10007852 Ga0081455_100078527 295
1011 3300005983 Ga0081540_1014865 Ga0081540_10148652 295
1012 3300005985 Ga0081539_10008096 Ga0081539_100080964 295
1013 3300006028 Ga0070717_10000425 Ga0070717_1000042521 295
1014 3300006038 Ga0075365_10022109 Ga0075365_100221094 295
1015 3300006038 Ga0075365_10057514 Ga0075365_100575143 295
1016 3300006038 Ga0075365_10154006 Ga0075365_101540062 295
1017 3300006042 Ga0075368_10018661 Ga0075368_100186612 295
1018 3300006042 Ga0075368_10023143 Ga0075368_100231432 295
1019 3300006173 Ga0070716_100002328 Ga0070716_1000023282 295
1020 3300006175 Ga0070712_100077880 Ga0070712_1000778802 295
1021 3300006178 Ga0075367_10002330 Ga0075367_100023305 295
1022 3300006178 Ga0075367_10043320 Ga0075367_100433203 295
1023 3300006194 Ga0075427_10001903 Ga0075427_100019032 295
1024 3300006195 Ga0075366_10072866 Ga0075366_100728662 295
1025 3300006353 Ga0075370_10020067 Ga0075370_100200672 295
1026 3300006844 Ga0075428_100005390 Ga0075428_1000053903 295
1027 3300006844 Ga0075428_100030504 Ga0075428_1000305045 295
1028 3300006844 Ga0075428_100115849 Ga0075428_1001158492 295
1029 3300006846 Ga0075430_100000140 Ga0075430_10000014022 295
1030 3300006846 Ga0075430_100166447 Ga0075430_1001664472 295
1031 3300006847 Ga0075431_100001318 Ga0075431_1000013183 295
1032 3300006847 Ga0075431_100158117 Ga0075431_1001581172 295
1033 3300006852 Ga0075433_10000050 Ga0075433_1000005025 295
1034 3300006871 Ga0075434_100000179 Ga0075434_10000017914 295
1035 3300006880 Ga0075429_100001170 Ga0075429_1000011709 295
1036 3300006880 Ga0075429_100116506 Ga0075429_1001165062 295
1037 3300006931 Ga0097620_100073871 Ga0097620_1000738713 295
1038 3300006944 Ga0099823_1024510 Ga0099823_10245102 295
1039 3300007076 Ga0075435_100001211 Ga0075435_1000012115 295
1040 3300009094 Ga0111539_10000565 Ga0111539_1000056522 295
1041 3300009098 Ga0105245_10203045 Ga0105245_102030452 295
1042 3300009147 Ga0114129_10003182 Ga0114129_100031829 295
1043 3300009147 Ga0114129_10085173 Ga0114129_100851732 295
1044 3300009147 Ga0114129_10400906 Ga0114129_104009062 295
1045 3300009148 Ga0105243_10060918 Ga0105243_100609182 295
1046 3300009177 Ga0105248_10285149 Ga0105248_102851492 295
1047 3300009553 Ga0105249_10420514 Ga0105249_104205142 295
1048 3300013296 Ga0157374_10388413 Ga0157374_103884132 295
1049 3300021320 Ga0214544_1000001 Ga0214544_1000001624 295
1050 3300021321 Ga0214542_1000037 Ga0214542_10000379 295
1051 3300021324 Ga0214545_1000003 Ga0214545_1000003136 295
1052 3300021327 Ga0214543_1000002 Ga0214543_1000002629 295
1053 3300025253 Ga0209677_112928 Ga0209677_1129281 295
1054 3300025261 Ga0209233_1003296 Ga0209233_10032962 295
1055 3300025273 Ga0209673_1022555 Ga0209673_10225552 295
1056 3300025291 Ga0209675_1003671 Ga0209675_10036712 295
1057 3300025295 Ga0209564_1000150 Ga0209564_100015020 295
1058 3300025297 Ga0209758_1000477 Ga0209758_100047745 295
1059 3300025297 Ga0209758_1002622 Ga0209758_100262212 295
1060 3300025297 Ga0209758_1005670 Ga0209758_10056707 295
1061 3300025297 Ga0209758_1013489 Ga0209758_10134893 295
1062 3300025299 Ga0209256_1000108 Ga0209256_100010820 295
1063 3300025302 Ga0207426_1000292 Ga0207426_100029234 295
1064 3300025302 Ga0207426_1003205 Ga0207426_10032055 295
1065 3300025302 Ga0207426_1057592 Ga0207426_10575921 295
1066 3300025900 Ga0207710_10033864 Ga0207710_100338642 295
1067 3300025903 Ga0207680_10027354 Ga0207680_100273542 295
1068 3300025904 Ga0207647_10019881 Ga0207647_100198815 295
1069 3300025915 Ga0207693_10005998 Ga0207693_100059987 295
1070 3300025915 Ga0207693_10022689 Ga0207693_100226894 295
1071 3300025916 Ga0207663_10040021 Ga0207663_100400211 295
1072 3300025918 Ga0207662_10033751 Ga0207662_100337513 295
1073 3300025925 Ga0207650_10127444 Ga0207650_101274442 295
1074 3300025927 Ga0207687_10116915 Ga0207687_101169152 295
1075 3300025928 Ga0207700_10001358 Ga0207700_100013589 295
1076 3300025931 Ga0207644_10014803 Ga0207644_100148033 295
1077 3300025931 Ga0207644_10150474 Ga0207644_101504742 295
1078 3300025936 Ga0207670_10041485 Ga0207670_100414853 295
1079 3300025939 Ga0207665_10000837 Ga0207665_1000083716 295
1080 3300025942 Ga0207689_10068552 Ga0207689_100685522 295
1081 3300025942 Ga0207689_10101561 Ga0207689_101015612 295
1082 3300025961 Ga0207712_10063367 Ga0207712_100633672 295
1083 3300025972 Ga0207668_10172844 Ga0207668_101728442 295
1084 3300026035 Ga0207703_10077531 Ga0207703_100775314 295
1085 3300026035 Ga0207703_10090163 Ga0207703_100901632 295
1086 3300026067 Ga0207678_10091910 Ga0207678_100919102 295
1087 3300026067 Ga0207678_10448528 Ga0207678_104485281 295
1088 3300026078 Ga0207702_10286621 Ga0207702_102866212 295
1089 3300026116 Ga0207674_10135330 Ga0207674_101353302 295
1090 3300026142 Ga0207698_10476688 Ga0207698_104766882 295
1091 3300027296 Ga0209389_1000014 Ga0209389_100001437 295
1092 3300027296 Ga0209389_1000077 Ga0209389_10000777 295
1093 3300027357 Ga0209589_1000020 Ga0209589_100002037 295
1094 3300027361 Ga0209489_100251 Ga0209489_1002517 295
1095 3300027361 Ga0209489_102003 Ga0209489_1020037 295
1096 3300027363 Ga0209700_100271 Ga0209700_1002716 295
1097 3300027907 Ga0207428_10000485 Ga0207428_1000048522 295
1098 3300028379 Ga0268266_10125650 Ga0268266_101256502 295
1099 3300028379 Ga0268266_10130106 Ga0268266_101301063 295
1100 3300028380 Ga0268265_10157703 Ga0268265_101577031 295
1101 3300028794 Ga0307515_10001947 Ga0307515_1000194725 295
1102 3300031507 Ga0307509_10433490 Ga0307509_104334901 295
1103 3300031649 Ga0307514_10216527 Ga0307514_102165272 295
1104 3300031712 Ga0265342_10035892 Ga0265342_100358922 295
1105 3300031901 Ga0307406_10285295 Ga0307406_102852951 295
1106 3300031903 Ga0307407_10109960 Ga0307407_101099602 295
1107 3300031995 Ga0307409_100119217 Ga0307409_1001192172 295
1108 3300032002 Ga0307416_100082885 Ga0307416_1000828852 295
1109 3300032005 Ga0307411_10093942 Ga0307411_100939422 295
1110 3300032126 Ga0307415_100068432 Ga0307415_1000684322 295
1111 3300033180 Ga0307510_10045610 Ga0307510_100456103 295
1112 3300041404 Ga0439436_0017499 Ga0439436_0017499_704_1597 295
1113 3300042145 Ga0450906_022453 Ga0450906_022453_120_1013 295
1114 3300044658 Ga0466972_0022304 Ga0466972_0022304_1639_2535 295
1115 3300044735 Ga0466968_0000931 Ga0466968_0000931_3789_4685 295
1116 3300044901 Ga0466960_0026578 Ga0466960_0026578_263_1159 295
1117 3300046459 Ga0495629_0004287 Ga0495629_0004287_5961_6857 295
1118 3300046460 Ga0495638_0002696 Ga0495638_0002696_586_1482 295
1119 3300046460 Ga0495638_0059304 Ga0495638_0059304_553_1446 295
1120 3300046462 Ga0495651_0017446 Ga0495651_0017446_184_1080 295
1121 3300046492 Ga0495585_0019507 Ga0495585_0019507_1184_2104 295
1122 3300046506 Ga0495583_0079975 Ga0495583_0079975_192_1088 295
1123 3300046524 Ga0495648_0020584 Ga0495648_0020584_582_1478 295
1124 3300046530 Ga0495654_0000063 Ga0495654_0000063_125577_126494 295
1125 3300046557 Ga0495622_0030645 Ga0495622_0030645_1574_2470 295
1126 3300046615 Ga0495656_0012565 Ga0495656_0012565_298_1218 295
1127 3300046616 Ga0495668_0154984 Ga0495668_0154984_224_1132 295
1128 3300046663 Ga0495635_0006167 Ga0495635_0006167_4864_5760 295
1129 3300046664 Ga0495659_0015392 Ga0495659_0015392_152_1072 295
1130 3300046675 Ga0495657_0014577 Ga0495657_0014577_325_1221 295
1131 3300046690 Ga0495624_0193715 Ga0495624_0193715_28_924 295
1132 3300047317 Ga0495604_0009755 Ga0495604_0009755_56_952 295
1133 3300047321 Ga0495676_0017023 Ga0495676_0017023_18_914 295
1134 3300047469 Ga0495673_0097508 Ga0495673_0097508_35_931 295
1135 3300048088 Ga0495602_0244103 Ga0495602_0244103_10_906 295
1136 3300048903 Ga0496100_0017973 Ga0496100_0017973_2384_3292 295
1137 3300048904 Ga0496101_0002506 Ga0496101_0002506_4032_4940 295
1138 3300048905 Ga0496102_0139154 Ga0496102_0139154_172_1080 295
1139 3300048907 Ga0496104_0001254 Ga0496104_0001254_13877_14773 295
1140 3300048908 Ga0496105_0075113 Ga0496105_0075113_1303_2211 295
1141 3300048909 Ga0496106_0032006 Ga0496106_0032006_2530_3426 295
1142 3300048909 Ga0496106_0040480 Ga0496106_0040480_581_1489 295
1143 3300048909 Ga0496106_0084026 Ga0496106_0084026_1419_2327 295
1144 3300048910 Ga0496107_0019239 Ga0496107_0019239_1991_2899 295
1145 3300048911 Ga0496108_0101013 Ga0496108_0101013_172_1080 295
1146 3300048912 Ga0496109_0064980 Ga0496109_0064980_1135_2031 295
1147 3300048912 Ga0496109_0143700 Ga0496109_0143700_124_1032 295
1148 3300048915 Ga0496112_0015338 Ga0496112_0015338_6066_6974 295
1149 3300048915 Ga0496112_0043464 Ga0496112_0043464_1195_2091 295
1150 3300048916 Ga0496113_0042834 Ga0496113_0042834_893_1801 295
1151 3300048917 Ga0496114_0037868 Ga0496114_0037868_611_1507 295
1152 3300048918 Ga0496115_0098103 Ga0496115_0098103_911_1819 295
1153 3300048919 Ga0496116_0011068 Ga0496116_0011068_1946_2842 295
1154 3300048922 Ga0496119_0017837 Ga0496119_0017837_3981_4877 295
1155 3300048923 Ga0496120_0169916 Ga0496120_0169916_22_918 295
1156 3300048924 Ga0496121_0003624 Ga0496121_0003624_946_1842 295
1157 3300048924 Ga0496121_0027118 Ga0496121_0027118_1944_2840 295
1158 3300048925 Ga0496122_0139424 Ga0496122_0139424_516_1403 295
1159 3300048927 Ga0496124_0096255 Ga0496124_0096255_1382_2278 295
1160 3300049460 Ga0495682_0038135 Ga0495682_0038135_845_1741 295
1161 3300049570 Ga0501033_0201231 Ga0501033_0201231_482_1381 295
1162 3300049578 Ga0501042_0293844 Ga0501042_0293844_92_1003 295
1163 3300049580 Ga0501046_0055698 Ga0501046_0055698_270_1169 295
1164 3300049581 Ga0501047_0042993 Ga0501047_0042993_320_1219 295
1165 3300049585 Ga0501069_0153000 Ga0501069_0153000_315_1223 295
1166 3300049589 Ga0501073_0138282 Ga0501073_0138282_593_1495 295
1167 3300049592 Ga0501076_0016532 Ga0501076_0016532_3960_4871 295
1168 3300050491 nmdc:mga00v17_31758_c1 nmdc:mga00v17_31758_c1_1352_2248 295
1169 3300050492 nmdc:mga0yw44_114571_c1 nmdc:mga0yw44_114571_c1_710_1606 295
1170 3300050492 nmdc:mga0yw44_61812_c1 nmdc:mga0yw44_61812_c1_950_1846 295
1171 3300050493 nmdc:mga0k408_21150_c1 nmdc:mga0k408_21150_c1_1130_2026 295
1172 3300050493 nmdc:mga0k408_61733_c1 nmdc:mga0k408_61733_c1_742_1653 295
1173 3300050507 nmdc:mga05p37_219_c1 nmdc:mga05p37_219_c1_27635_28543 295
1174 3300050507 nmdc:mga05p37_321350_c1 nmdc:mga05p37_321350_c1_178_1098 295
1175 3300050508 nmdc:mga09592_452_c1 nmdc:mga09592_452_c1_3422_4330 295
1176 3300050509 nmdc:mga0qj67_396_c1 nmdc:mga0qj67_396_c1_3422_4330 295
1177 3300050510 nmdc:mga06r32_274_c1 nmdc:mga06r32_274_c1_19434_20342 295
1178 3300050511 nmdc:mga08y16_26695_c1 nmdc:mga08y16_26695_c1_1758_2666 295
1179 3300050512 nmdc:mga0n895_124_c1 nmdc:mga0n895_124_c1_25728_26636 295
1180 3300050512 nmdc:mga0n895_328624_c1 nmdc:mga0n895_328624_c1_243_1151 295
1181 3300050513 nmdc:mga0rr50_4689_c1 nmdc:mga0rr50_4689_c1_5183_6091 295
1182 3300050515 nmdc:mga0a205_97_c1 nmdc:mga0a205_97_c1_25779_26687 295
1183 3300050516 nmdc:mga0sz30_8151_c1 nmdc:mga0sz30_8151_c1_1619_2518 295
1184 3300053087 Ga0500643_000218 Ga0500643_000218_33978_34874 295
1185 3300053088 Ga0500644_0056856 Ga0500644_0056856_144_1061 295
1186 3300053094 Ga0500566_0000562 Ga0500566_0000562_19593_20489 295
1187 3300053094 Ga0500566_0042130 Ga0500566_0042130_1369_2274 295
1188 3300053095 Ga0500640_030487 Ga0500640_030487_33_929 295
1189 3300053096 Ga0500641_0005846 Ga0500641_0005846_986_1885 295
1190 3300053096 Ga0500641_0107573 Ga0500641_0107573_82_978 295
1191 3300053103 Ga0500555_008865 Ga0500555_008865_206_1102 295
1192 3300053119 Ga0500595_001223 Ga0500595_001223_7964_8869 295
1193 3300053123 Ga0500614_014399 Ga0500614_014399_639_1535 295
1194 3300053125 Ga0500618_000726 Ga0500618_000726_12718_13611 295
1195 3300053140 Ga0500573_0038452 Ga0500573_0038452_1704_2597 295
1196 3300053143 Ga0500579_081517 Ga0500579_081517_45_941 295
1197 3300053153 Ga0500616_0034287 Ga0500616_0034287_44_940 295
1198 3300053177 Ga0500636_0001036 Ga0500636_0001036_4524_5420 295
1199 3300053178 Ga0500637_0000231 Ga0500637_0000231_8905_9810 295
1200 3300053731 Ga0500609_002839 Ga0500609_002839_946_1842 295
1201 3300053737 Ga0500601_003054 Ga0500601_003054_876_1772 295
1202 3300002773 JGI25152J39213_1002687 JGI25152J39213_10026873 296
1203 3300003203 JGI25406J46586_10002619 JGI25406J46586_100026195 296
1204 3300003215 JGI25153J46596_10005646 JGI25153J46596_100056464 296
1205 3300005347 Ga0070668_100007882 Ga0070668_1000078823 296
1206 3300005367 Ga0070667_100009165 Ga0070667_1000091653 296
1207 3300005455 Ga0070663_100398778 Ga0070663_1003987781 296
1208 3300005844 Ga0068862_100334261 Ga0068862_1003342612 296
1209 3300005983 Ga0081540_1009656 Ga0081540_10096562 296
1210 3300005985 Ga0081539_10002437 Ga0081539_100024378 296
1211 3300006042 Ga0075368_10008690 Ga0075368_100086902 296
1212 3300006353 Ga0075370_10080226 Ga0075370_100802262 296
1213 3300013104 Ga0157370_10065483 Ga0157370_100654832 296
1214 3300025245 Ga0207425_1006064 Ga0207425_10060643 296
1215 3300025258 Ga0209129_1001183 Ga0209129_10011839 296
1216 3300025294 Ga0209025_1007433 Ga0209025_10074334 296
1217 3300025297 Ga0209758_1000662 Ga0209758_10006629 296
1218 3300025297 Ga0209758_1023161 Ga0209758_10231612 296
1219 3300025923 Ga0207681_10091151 Ga0207681_100911512 296
1220 3300025935 Ga0207709_10031822 Ga0207709_100318223 296
1221 3300025986 Ga0207658_10089841 Ga0207658_100898412 296
1222 3300027866 Ga0209813_10005539 Ga0209813_100055392 296
1223 3300028379 Ga0268266_10131120 Ga0268266_101311203 296
1224 3300048920 Ga0496117_0074519 Ga0496117_0074519_872_1792 296
1225 3300048925 Ga0496122_0024574 Ga0496122_0024574_3780_4700 296
1226 3300048926 Ga0496123_0022880 Ga0496123_0022880_1290_2210 296
1227 3300049776 Ga0501280_006997 Ga0501280_006997_464_1360 296
1228 3300050494 nmdc:mga06z11_72078_c1 nmdc:mga06z11_72078_c1_913_1821 296
1229 3300050495 nmdc:mga04h51_48492_c1 nmdc:mga04h51_48492_c1_498_1406 296
1230 iso_pu_bacteria 2791355197 2793066543 296
1231 iso_pu_bacteria 2961136820 2961140192 296
1232 iso_pu_bacteria 2979764755 2979769581 296
1233 iso_pu_bacteria 3000135777 3000139708 296
1234 3300001979 JGI24740J21852_10000538 JGI24740J21852_100005387 297
1235 3300002704 JGI25155J39150_1000056 JGI25155J39150_100005674 297
1236 3300002705 JGI25156J39149_1000007 JGI25156J39149_1000007244 297
1237 3300002737 JGI25162J39368_1001472 JGI25162J39368_10014724 297
1238 3300002738 JGI25154J39366_1000013 JGI25154J39366_100001374 297
1239 3300002741 JGI25157J39369_1000099 JGI25157J39369_100009974 297
1240 3300003187 JGI25151J46595_10001633 JGI25151J46595_100016337 297
1241 3300003187 JGI25151J46595_10034603 JGI25151J46595_100346032 297
1242 3300003214 JGI25165J46597_1001468 JGI25165J46597_10014686 297
1243 3300003316 rootH1_10020516 rootH1_100205162 297
1244 3300003374 JGI25161J50226_1001176 JGI25161J50226_10011767 297
1245 3300003771 Ga0055526_1003004 Ga0055526_10030043 297
1246 3300003771 Ga0055526_1010710 Ga0055526_10107106 297
1247 3300003775 Ga0055524_1004966 Ga0055524_10049666 297
1248 3300003775 Ga0055524_1011428 Ga0055524_10114282 297
1249 3300003781 Ga0055536_1015097 Ga0055536_10150972 297
1250 3300003790 Ga0055528_1000515 Ga0055528_100051517 297
1251 3300003792 Ga0055540_1000131 Ga0055540_100013167 297
1252 3300003792 Ga0055540_1012983 Ga0055540_10129832 297
1253 3300003794 Ga0055531_10008117 Ga0055531_100081173 297
1254 3300004625 Ga0055543_1001269 Ga0055543_10012697 297
1255 3300005347 Ga0070668_100235246 Ga0070668_1002352462 297
1256 3300005548 Ga0070665_100076453 Ga0070665_1000764533 297
1257 3300005614 Ga0068856_100036031 Ga0068856_1000360312 297
1258 3300006038 Ga0075365_10011544 Ga0075365_100115442 297
1259 3300006042 Ga0075368_10071327 Ga0075368_100713271 297
1260 3300006048 Ga0075363_100004037 Ga0075363_1000040373 297
1261 3300006051 Ga0075364_10047814 Ga0075364_100478142 297
1262 3300006051 Ga0075364_10140011 Ga0075364_101400112 297
1263 3300006178 Ga0075367_10002198 Ga0075367_100021983 297
1264 3300006178 Ga0075367_10036519 Ga0075367_100365192 297
1265 3300006178 Ga0075367_10150714 Ga0075367_101507142 297
1266 3300006186 Ga0075369_10013828 Ga0075369_100138283 297
1267 3300006195 Ga0075366_10009512 Ga0075366_100095124 297
1268 3300006353 Ga0075370_10003168 Ga0075370_100031687 297
1269 3300006353 Ga0075370_10123501 Ga0075370_101235012 297
1270 3300006948 Ga0099826_10000297 Ga0099826_100002976 297
1271 3300006948 Ga0099826_10095024 Ga0099826_100950242 297
1272 3300009148 Ga0105243_10018705 Ga0105243_100187053 297
1273 3300009765 Ga0123341_1000019 Ga0123341_100001923 297
1274 3300009766 Ga0123342_1014594 Ga0123342_10145945 297
1275 3300009766 Ga0123342_1021209 Ga0123342_10212093 297
1276 3300013100 Ga0157373_10103869 Ga0157373_101038692 297
1277 3300013100 Ga0157373_10160983 Ga0157373_101609832 297
1278 3300013102 Ga0157371_10000304 Ga0157371_1000030425 297
1279 3300013104 Ga0157370_10013708 Ga0157370_100137082 297
1280 3300025206 Ga0209435_100006 Ga0209435_100006282 297
1281 3300025233 Ga0209437_100023 Ga0209437_100023382 297
1282 3300025233 Ga0209437_100341 Ga0209437_10034150 297
1283 3300025246 Ga0209646_1000015 Ga0209646_1000015253 297
1284 3300025250 Ga0209026_1000046 Ga0209026_1000046253 297
1285 3300025254 Ga0209148_1003099 Ga0209148_10030993 297
1286 3300025256 Ga0209759_1000005 Ga0209759_1000005282 297
1287 3300025256 Ga0209759_1018812 Ga0209759_10188122 297
1288 3300025258 Ga0209129_1002648 Ga0209129_10026488 297
1289 3300025258 Ga0209129_1010344 Ga0209129_10103442 297
1290 3300025261 Ga0209233_1000062 Ga0209233_100006293 297
1291 3300025261 Ga0209233_1000970 Ga0209233_10009704 297
1292 3300025273 Ga0209673_1000005 Ga0209673_1000005123 297
1293 3300025273 Ga0209673_1001376 Ga0209673_10013765 297
1294 3300025273 Ga0209673_1018003 Ga0209673_10180033 297
1295 3300025273 Ga0209673_1018699 Ga0209673_10186993 297
1296 3300025291 Ga0209675_1014261 Ga0209675_10142612 297
1297 3300025294 Ga0209025_1000397 Ga0209025_100039755 297
1298 3300025294 Ga0209025_1002687 Ga0209025_10026873 297
1299 3300025294 Ga0209025_1007209 Ga0209025_10072092 297
1300 3300025294 Ga0209025_1010571 Ga0209025_10105715 297
1301 3300025295 Ga0209564_1000511 Ga0209564_100051126 297
1302 3300025295 Ga0209564_1007023 Ga0209564_10070234 297
1303 3300025297 Ga0209758_1000585 Ga0209758_100058530 297
1304 3300025297 Ga0209758_1001274 Ga0209758_100127424 297
1305 3300025297 Ga0209758_1001596 Ga0209758_100159610 297
1306 3300025297 Ga0209758_1004840 Ga0209758_100484010 297
1307 3300025298 Ga0209050_1001525 Ga0209050_10015256 297
1308 3300025299 Ga0209256_1003072 Ga0209256_10030726 297
1309 3300025299 Ga0209256_1003322 Ga0209256_10033229 297
1310 3300025299 Ga0209256_1008896 Ga0209256_10088962 297
1311 3300025302 Ga0207426_1000355 Ga0207426_100035546 297
1312 3300025303 Ga0209051_1000038 Ga0209051_1000038296 297
1313 3300025303 Ga0209051_1002277 Ga0209051_10022775 297
1314 3300025303 Ga0209051_1002823 Ga0209051_10028233 297
1315 3300025304 Ga0209257_1008917 Ga0209257_10089172 297
1316 3300025304 Ga0209257_1012956 Ga0209257_10129562 297
1317 3300026078 Ga0207702_10025869 Ga0207702_100258692 297
1318 3300027312 Ga0209371_1000035 Ga0209371_1000035303 297
1319 3300027312 Ga0209371_1000703 Ga0209371_10007033 297
1320 3300027312 Ga0209371_1004170 Ga0209371_10041703 297
1321 3300027666 Ga0209282_1001209 Ga0209282_10012093 297
1322 3300027666 Ga0209282_1076496 Ga0209282_10764962 297
1323 3300027866 Ga0209813_10003425 Ga0209813_100034253 297
1324 3300028794 Ga0307515_10068995 Ga0307515_100689953 297
1325 3300030500 Ga0268256_1000037 Ga0268256_1000037302 297
1326 3300030500 Ga0268256_1003172 Ga0268256_10031723 297
1327 3300030500 Ga0268256_1004304 Ga0268256_10043044 297
1328 3300030744 Ga0316181_1153204 Ga0316181_11532042 297
1329 3300041491 Ga0451833_0340930 Ga0451833_0340930_936_1829 297
1330 3300041496 Ga0451839_0143081 Ga0451839_0143081_123_1016 297
1331 3300041501 Ga0451845_0454358 Ga0451845_0454358_207_1100 297
1332 3300041503 Ga0451847_0186492 Ga0451847_0186492_618_1511 297
1333 3300041505 Ga0451849_0091961 Ga0451849_0091961_426_1319 297
1334 3300041507 Ga0451851_0082640 Ga0451851_0082640_756_1649 297
1335 3300041509 Ga0451843_0039079 Ga0451843_0039079_791_1684 297
1336 3300041512 Ga0451853_1011766 Ga0451853_1011766_139_1032 297
1337 3300046460 Ga0495638_0061881 Ga0495638_0061881_375_1271 297
1338 3300046519 Ga0495632_0016742 Ga0495632_0016742_2671_3564 297
1339 3300046674 Ga0495588_0011793 Ga0495588_0011793_3001_3894 297
1340 3300046692 Ga0495671_0104843 Ga0495671_0104843_392_1285 297
1341 3300047472 Ga0495686_0133206 Ga0495686_0133206_495_1388 297
1342 3300048907 Ga0496104_0159198 Ga0496104_0159198_648_1541 297
1343 3300048919 Ga0496116_0047130 Ga0496116_0047130_231_1124 297
1344 3300048919 Ga0496116_0107045 Ga0496116_0107045_432_1325 297
1345 3300048919 Ga0496116_0149098 Ga0496116_0149098_180_1073 297
1346 3300048920 Ga0496117_0000052 Ga0496117_0000052_241752_242645 297
1347 3300048920 Ga0496117_0008030 Ga0496117_0008030_807_1700 297
1348 3300048921 Ga0496118_0018034 Ga0496118_0018034_1193_2086 297
1349 3300048921 Ga0496118_0190535 Ga0496118_0190535_246_1142 297
1350 3300048922 Ga0496119_0009404 Ga0496119_0009404_6450_7343 297
1351 3300048922 Ga0496119_0020002 Ga0496119_0020002_2934_3827 297
1352 3300048922 Ga0496119_0037750 Ga0496119_0037750_815_1708 297
1353 3300048922 Ga0496119_0042872 Ga0496119_0042872_1079_1972 297
1354 3300048923 Ga0496120_0000019 Ga0496120_0000019_221487_222380 297
1355 3300048924 Ga0496121_0000005 Ga0496121_0000005_882816_883709 297
1356 3300048924 Ga0496121_0140568 Ga0496121_0140568_847_1740 297
1357 3300048925 Ga0496122_0000053 Ga0496122_0000053_221487_222380 297
1358 3300048925 Ga0496122_0003439 Ga0496122_0003439_13238_14131 297
1359 3300048925 Ga0496122_0004580 Ga0496122_0004580_1142_2038 297
1360 3300048926 Ga0496123_0000038 Ga0496123_0000038_221487_222380 297
1361 3300048926 Ga0496123_0002783 Ga0496123_0002783_6688_7581 297
1362 3300048926 Ga0496123_0014707 Ga0496123_0014707_140_1033 297
1363 3300048926 Ga0496123_0067145 Ga0496123_0067145_729_1622 297
1364 3300048927 Ga0496124_0017334 Ga0496124_0017334_2001_2894 297
1365 3300048927 Ga0496124_0039011 Ga0496124_0039011_2233_3126 297
1366 3300048928 Ga0496125_0000159 Ga0496125_0000159_6914_7807 297
1367 3300048928 Ga0496125_0076051 Ga0496125_0076051_667_1560 297
1368 3300048929 Ga0496126_0372776 Ga0496126_0372776_70_963 297
1369 3300050489 nmdc:mga03683_7842_c1 nmdc:mga03683_7842_c1_610_1503 297
1370 3300050490 nmdc:mga03n38_1718_c1 nmdc:mga03n38_1718_c1_2610_3503 297
1371 3300050491 nmdc:mga00v17_11_c1 nmdc:mga00v17_11_c1_107410_108303 297
1372 3300050491 nmdc:mga00v17_67568_c1 nmdc:mga00v17_67568_c1_238_1131 297
1373 3300050491 nmdc:mga00v17_88516_c1 nmdc:mga00v17_88516_c1_497_1390 297
1374 3300050492 nmdc:mga0yw44_528_c1 nmdc:mga0yw44_528_c1_12052_12945 297
1375 3300050493 nmdc:mga0k408_110770_c1 nmdc:mga0k408_110770_c1_255_1148 297
1376 3300050494 nmdc:mga06z11_76648_c1 nmdc:mga06z11_76648_c1_421_1314 297
1377 3300050496 nmdc:mga07m45_207910_c1 nmdc:mga07m45_207910_c1_120_1013 297
1378 3300050516 nmdc:mga0sz30_70141_c1 nmdc:mga0sz30_70141_c1_532_1425 297
1379 3300053107 Ga0500560_017881 Ga0500560_017881_412_1305 297
1380 3300053153 Ga0500616_0004193 Ga0500616_0004193_8392_9285 297
1381 3300053177 Ga0500636_0000039 Ga0500636_0000039_59319_60215 297
1382 3300053177 Ga0500636_0053454 Ga0500636_0053454_451_1347 297

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

150

321

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahd-assembly1.cif.gz_A opua (e190q) occluded 0.8947 99 289
3dhw-assembly1.cif.gz_A crystal structure of methionine importer metni 0.8178 99 282
7ahd-assembly1.cif.gz_B opua (e190q) occluded 0.7924 53 289
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.7909 99 282
3dhw-assembly2.cif.gz_E crystal structure of methionine importer metni 0.7842 99 280
ID Description Score Start End Superfamily
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9616 102 292 1.10.3720.10
af_Q2G088_14_207_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9371 99 287 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9363 96 291 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9335 96 287 1.10.3720.10
af_O69722_23_210_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9321 99 284 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A530M5U9-F1-model_v4 deleted 0.98 114 258
AF-A0A530M5U9-F1-model_v4 deleted 0.9604 114 258
AF-A0A7W8LYU9-F1-model_v4 Nitrate/nitrite transport system permease protein 0.9508 14 293 GO:0005886
GO:0006811
GO:0015112
AF-A0A3N5GYZ6-F1-model_v4 ABC transporter permease subunit 0.9488 147 292 GO:0005886
GO:0055085
AF-S4M7U5-F1-model_v4 Putative Glycine betaine/carnitine transport permease protein GbuB 0.9432 106 290 GO:0005275
GO:0015226
GO:0015871
GO:0031460
GO:0043190

Feature Viewer

pLDDT pTM Quality
84 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map