F493528
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1382 | 997 | 763 | 293 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|3000135777|3000139708 |
| Length | 330 |
| Sequence | APFAPLSLKPRPRRKRRFSRLSPDTTTELCLDMSIQAIEDTKVKVFPAPPEPSKVIAFAPKARRRFDPLAILSKLAGTLLPPVVVIVLMLVVWQVACSSPTASLPPPSQVWNEAYDLIAHPFFDNGPQDIGLAWRVLISLQRVAIGFGLAAIVGVALGALVGQSVWAMRGLDPVFQILRTVPPLAWLPLSLAAFRDSSPSAIFVIFITSIWPVIINTAVGVRNIPEDYRNVARILRLNQIEFFVKIMVPAAAPYIFTGLRIGIGLSWLAIVAAEMLTGGVGIGFFIWDAWNSSRLPDIIVALAYIGVTGFCLDRLVAAVGGVVTRGTTAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 3 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 4 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 5 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 6 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 7 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 8 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 9 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 10 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 11 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 12 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 13 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 14 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 15 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 16 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 17 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 18 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 19 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 20 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 21 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 22 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 23 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 24 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 25 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 26 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 27 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 28 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 29 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 30 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 31 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 32 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 33 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 34 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 35 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 36 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 37 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 38 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 39 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 40 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 41 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 42 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 43 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 44 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 45 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 46 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 47 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 48 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 49 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 50 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 51 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 52 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 53 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 54 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 55 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 56 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 57 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 58 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 59 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 60 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 61 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 62 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 63 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 64 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 65 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 66 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 67 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 68 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 69 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 70 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 71 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 72 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 73 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 74 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 75 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 76 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 77 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 78 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 79 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 80 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 81 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 82 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 83 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 84 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 85 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 86 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 87 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 88 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 89 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 90 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 91 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 92 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 93 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 94 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 95 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 96 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 97 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 98 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 99 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 100 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 101 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 102 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 103 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 104 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 105 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 106 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 107 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 108 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 109 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 110 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 111 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 112 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 113 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 114 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 115 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 116 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 117 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 118 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 119 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 120 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 121 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 122 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 123 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 124 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 125 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 126 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 127 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 128 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 129 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 130 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 131 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 132 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 133 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 134 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 135 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 136 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 137 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 138 | 2791355199 | |||
| 139 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 140 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 141 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 142 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 143 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 144 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 145 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 146 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 147 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 148 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 149 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 150 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 151 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 152 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 153 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 154 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 155 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 156 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 157 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 158 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 159 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 160 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 161 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 162 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 163 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 164 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 165 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 166 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 167 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 168 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 169 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 170 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 171 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 172 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 173 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 174 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 175 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 176 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 177 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 178 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 179 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 180 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 181 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 182 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 183 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 184 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 185 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 186 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 187 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 188 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 189 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 190 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 191 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 192 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 193 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 194 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 195 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 196 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 197 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 198 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 199 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 200 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 201 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 202 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 203 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 204 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 205 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 206 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 207 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 208 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 209 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 210 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 211 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 212 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 213 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 214 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 215 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 216 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 217 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 218 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 219 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 220 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 221 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 222 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 223 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 224 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 225 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 226 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 227 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 228 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 229 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 230 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 231 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 232 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 233 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 234 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 235 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 236 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 237 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 238 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 239 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 240 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 241 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 242 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 243 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 244 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 245 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 246 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 247 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 248 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 249 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 250 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 251 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 252 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 253 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 254 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 255 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 256 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 257 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 258 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 259 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 260 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 261 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 262 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 263 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 264 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 265 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 266 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 267 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 268 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 269 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 270 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 271 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 272 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 273 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 274 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 275 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 276 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 277 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 278 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 279 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 280 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 281 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 282 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 283 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 284 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 285 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 286 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 287 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 288 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 289 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 290 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 291 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 292 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 293 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 294 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 295 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 296 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 297 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 298 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 299 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 300 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 301 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 302 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 303 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 304 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 305 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 306 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 307 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 308 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 309 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 310 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 311 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 312 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 313 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 314 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 315 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 316 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 317 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 318 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 319 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 320 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 321 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 322 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 323 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 324 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 325 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 326 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 327 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 328 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 329 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 330 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 331 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 332 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 333 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 334 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 335 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 336 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 337 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 338 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 339 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 340 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 341 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 342 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 343 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 344 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 345 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 346 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 347 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 348 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 349 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 350 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 351 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 352 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 353 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 354 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 355 | 2904699407 | |||
| 356 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 357 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 358 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 359 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 360 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 361 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 362 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 363 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 364 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 365 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 366 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 367 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 368 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 369 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 370 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 371 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 372 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 373 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 374 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 375 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 376 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 377 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 378 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 379 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 380 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 381 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 382 | 2922368715 | |||
| 383 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 384 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 385 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 386 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 387 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 388 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 389 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 390 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 391 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 392 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 393 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 394 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 395 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 396 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 397 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 398 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 399 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 400 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 401 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 402 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 403 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 404 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 405 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 406 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 407 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 408 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 409 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 410 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 411 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 412 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 413 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 414 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 415 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 416 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 417 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 418 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 419 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 420 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 421 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 422 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 423 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 424 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 425 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 426 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 427 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 428 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 429 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 430 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 431 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 432 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 433 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 434 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 435 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 436 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 437 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 438 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 439 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 440 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 441 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 442 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 443 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 444 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 445 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 446 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 447 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 448 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 449 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 450 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 451 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 452 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 453 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 454 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 455 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 456 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 457 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 458 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 459 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 460 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 461 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 462 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 463 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 464 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 465 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 466 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 467 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 468 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 469 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 470 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 471 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 472 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 473 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 474 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 475 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 476 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 477 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 478 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 479 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 480 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 481 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 482 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 483 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 484 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 485 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 486 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 487 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 488 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 489 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 490 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 491 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 492 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 493 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 494 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 495 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 496 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 497 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 498 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 499 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 500 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 501 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 502 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 503 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 504 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 505 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 506 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 507 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 508 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 509 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 510 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 511 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 512 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 513 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 514 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 515 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 516 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 517 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 518 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 519 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 520 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 521 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 522 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 523 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 524 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 525 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 526 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 527 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 528 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 529 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 530 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 531 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 532 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 533 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 534 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 535 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 536 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 537 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 538 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 539 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 540 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 541 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 542 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 543 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 544 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 545 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 546 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 547 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 548 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 549 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 550 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 551 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 552 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 553 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 554 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 555 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 556 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 557 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 558 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 559 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 560 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 561 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 562 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 563 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 564 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 565 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 566 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 567 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 568 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 569 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 570 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 571 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 572 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 573 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 574 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 575 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 576 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 577 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 578 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 579 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 580 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 581 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 582 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 583 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 584 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 585 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 586 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 587 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 588 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 589 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 590 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 591 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 592 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 593 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 594 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 595 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 596 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 597 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 598 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 599 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 600 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 601 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 602 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 603 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 604 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 605 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 606 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 607 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 608 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 609 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 610 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 611 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 612 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 613 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 614 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 615 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 616 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 617 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 618 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 619 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 620 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 621 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 622 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 623 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 624 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 625 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 626 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 627 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 628 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 629 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 630 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 631 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 632 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 633 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 634 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 635 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 636 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 637 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 638 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 639 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 640 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 641 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 642 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 643 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 644 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 645 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 646 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 647 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 648 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 649 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 650 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 651 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 652 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 653 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 654 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 655 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 656 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 657 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 658 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 659 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 660 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 661 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 662 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 663 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 664 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 665 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 666 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 667 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 668 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 669 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 670 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 671 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 672 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 673 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 674 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 675 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 676 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 677 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 678 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 679 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 680 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 681 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 682 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 683 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 684 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 685 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 686 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 687 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 688 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 689 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 690 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 691 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 692 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 693 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 694 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 695 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 696 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 697 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 698 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 699 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 700 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 701 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 702 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 703 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 704 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 705 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 706 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 707 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 708 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 709 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 710 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 711 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 712 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 713 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 714 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 715 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 716 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 717 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 718 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 719 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 720 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 721 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 722 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 723 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 724 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 725 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 726 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 727 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 728 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 729 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 730 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 731 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 732 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 733 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 734 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 735 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 736 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 737 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 738 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 739 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 740 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 741 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 742 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 743 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 744 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 745 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 746 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 747 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 748 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 749 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 750 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 751 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 752 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 753 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 754 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 755 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 756 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 757 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 758 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 759 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 760 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 761 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 762 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 763 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 764 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 765 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 766 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 767 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 768 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 769 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 770 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 771 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 772 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 773 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 774 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 775 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 776 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 777 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 778 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 779 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 780 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 781 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 782 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 783 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 784 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 785 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 786 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 787 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 788 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 789 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 790 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 791 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 792 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 793 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 794 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 795 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 796 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 797 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 798 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 799 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 800 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 801 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 802 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 803 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 804 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 805 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 806 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 807 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 808 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 809 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 810 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 811 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 812 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 813 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 814 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 815 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 816 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 817 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 818 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 819 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 820 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 821 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 822 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 823 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 824 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 825 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 826 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 827 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 828 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 829 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 830 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 831 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 832 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 833 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 834 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 835 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 836 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 837 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 838 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 839 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 840 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 841 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 842 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 843 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 844 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 845 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 846 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 847 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 848 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 849 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 850 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 851 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 852 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 853 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 854 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 855 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 856 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 857 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 858 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 859 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 860 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 861 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 862 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 863 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 864 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 865 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 866 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 867 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 868 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 869 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 870 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 871 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 872 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 873 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 874 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 875 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 876 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 877 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 878 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 879 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 880 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 881 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 882 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 883 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 884 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 885 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 886 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 887 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 888 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 889 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 890 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 891 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 892 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 893 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 894 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 895 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 896 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 897 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 898 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 899 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 900 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 901 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 902 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 903 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 904 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 905 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 906 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 907 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 908 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 909 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 910 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 911 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 912 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 913 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 914 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 915 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 916 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 917 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 918 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 919 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 920 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 921 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 922 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 923 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 924 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 925 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 926 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 927 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 928 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 929 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 930 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 931 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 932 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 933 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 934 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 935 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 936 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 937 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 938 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 939 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 940 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 941 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 942 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 943 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 944 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 945 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 946 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 947 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 948 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 949 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 950 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 951 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 952 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 953 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 954 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 955 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 956 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 957 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 958 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 959 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 960 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 961 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 962 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 963 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 964 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 965 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 966 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 967 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 968 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 969 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 970 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 971 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 972 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 973 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 974 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 975 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 976 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 977 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 978 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 979 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 980 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 981 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 982 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 983 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 984 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 985 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 986 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 987 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 988 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 989 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 990 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 991 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 992 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 993 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 994 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 995 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 996 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 997 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 55.33 |
| Metatranscriptomes | 0 |
| Isolates | 44.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.43 |
| Bulb | 0 |
| Endosphere | 17.08 |
| Nodule | 34.15 |
| Rhizoplane | 3.47 |
| Rhizosphere | 29.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000538 | 3300001979 | Bacteria | 16194 |
| 2 | JGI25155J39150_1000056 | 3300002704 | Bacteria | 73160 |
| 3 | JGI25156J39149_1000007 | 3300002705 | Bacteria | 252108 |
| 4 | JGI25162J39368_1001472 | 3300002737 | Bacteria | 12352 |
| 5 | JGI25162J39368_1002141 | 3300002737 | Bacteria | 8281 |
| 6 | JGI25154J39366_1000013 | 3300002738 | Bacteria | 268260 |
| 7 | JGI25157J39369_1000099 | 3300002741 | Bacteria | 73678 |
| 8 | JGI25157J39369_1000789 | 3300002741 | Bacteria | 16171 |
| 9 | JGI25152J39213_1000256 | 3300002773 | Bacteria | 35313 |
| 10 | JGI25152J39213_1002687 | 3300002773 | Bacteria | 6526 |
| 11 | JGI25150J39212_1000501 | 3300002774 | Bacteria | 16267 |
| 12 | JGI25151J46595_10000007 | 3300003187 | Bacteria | 411751 |
| 13 | JGI25151J46595_10000166 | 3300003187 | Bacteria | 85475 |
| 14 | JGI25151J46595_10001633 | 3300003187 | Bacteria | 14780 |
| 15 | JGI25151J46595_10034603 | 3300003187 | Bacteria | 1930 |
| 16 | JGI25406J46586_10002619 | 3300003203 | Bacteria | 8483 |
| 17 | JGI25406J46586_10023243 | 3300003203 | Bacteria | 2452 |
| 18 | JGI25165J46597_1001164 | 3300003214 | Bacteria | 16187 |
| 19 | JGI25165J46597_1001468 | 3300003214 | Bacteria | 12294 |
| 20 | JGI25153J46596_10000313 | 3300003215 | Bacteria | 35777 |
| 21 | JGI25153J46596_10005646 | 3300003215 | Bacteria | 6534 |
| 22 | JGI25153J46596_10007051 | 3300003215 | Bacteria | 5592 |
| 23 | JGI25153J46596_10014527 | 3300003215 | Bacteria | 3268 |
| 24 | JGI25153J46596_10018377 | 3300003215 | Bacteria | 2718 |
| 25 | rootH1_10020516 | 3300003316 | Bacteria | 1867 |
| 26 | JGI25160J50197_1010224 | 3300003354 | Bacteria | 3406 |
| 27 | JGI25161J50226_1001176 | 3300003374 | Bacteria | 8615 |
| 28 | JGI25404J52841_10001894 | 3300003659 | Bacteria | 3828 |
| 29 | Ga0055526_1001232 | 3300003771 | Bacteria | 18382 |
| 30 | Ga0055526_1001408 | 3300003771 | Bacteria | 17103 |
| 31 | Ga0055526_1001712 | 3300003771 | Bacteria | 15279 |
| 32 | Ga0055526_1003004 | 3300003771 | Bacteria | 11014 |
| 33 | Ga0055526_1010710 | 3300003771 | Bacteria | 4230 |
| 34 | Ga0055524_1000518 | 3300003775 | Bacteria | 29714 |
| 35 | Ga0055524_1004966 | 3300003775 | Bacteria | 6030 |
| 36 | Ga0055524_1007981 | 3300003775 | Bacteria | 4442 |
| 37 | Ga0055524_1011428 | 3300003775 | Bacteria | 3473 |
| 38 | Ga0055536_1015097 | 3300003781 | Bacteria | 2665 |
| 39 | Ga0055528_1000067 | 3300003790 | Bacteria | 83853 |
| 40 | Ga0055528_1000515 | 3300003790 | Bacteria | 30346 |
| 41 | Ga0055540_1000131 | 3300003792 | Bacteria | 75615 |
| 42 | Ga0055540_1012983 | 3300003792 | Bacteria | 2573 |
| 43 | Ga0055531_10008117 | 3300003794 | Bacteria | 5594 |
| 44 | Ga0055531_10010658 | 3300003794 | Bacteria | 4539 |
| 45 | Ga0058692_1006972 | 3300003856 | Bacteria | 3042 |
| 46 | Ga0055543_1001269 | 3300004625 | Bacteria | 10400 |
| 47 | Ga0065165_1000853 | 3300005262 | Bacteria | 39889 |
| 48 | Ga0065165_1001807 | 3300005262 | Bacteria | 21012 |
| 49 | Ga0065165_1010313 | 3300005262 | Bacteria | 4056 |
| 50 | Ga0065165_1012631 | 3300005262 | Bacteria | 3422 |
| 51 | Ga0065165_1040556 | 3300005262 | Bacteria | 1387 |
| 52 | Ga0070658_10018138 | 3300005327 | Bacteria | 5631 |
| 53 | Ga0070658_10245760 | 3300005327 | Bacteria | 1518 |
| 54 | Ga0070676_10082362 | 3300005328 | Bacteria | 1955 |
| 55 | Ga0068869_100059708 | 3300005334 | Bacteria | 2793 |
| 56 | Ga0070666_10039936 | 3300005335 | Bacteria | 3129 |
| 57 | Ga0070680_100000827 | 3300005336 | Bacteria | 21866 |
| 58 | Ga0070661_100162391 | 3300005344 | Bacteria | 1692 |
| 59 | Ga0070668_100007882 | 3300005347 | Bacteria | 7907 |
| 60 | Ga0070668_100235246 | 3300005347 | Bacteria | 1516 |
| 61 | Ga0070668_100296586 | 3300005347 | Bacteria | 1355 |
| 62 | Ga0070675_100356182 | 3300005354 | Bacteria | 1298 |
| 63 | Ga0070671_100024365 | 3300005355 | Bacteria | 4953 |
| 64 | Ga0070671_100073928 | 3300005355 | Bacteria | 2847 |
| 65 | Ga0070671_100253244 | 3300005355 | Bacteria | 1496 |
| 66 | Ga0070674_100097276 | 3300005356 | Bacteria | 2138 |
| 67 | Ga0070674_100140987 | 3300005356 | Bacteria | 1809 |
| 68 | Ga0070688_100111268 | 3300005365 | Bacteria | 1822 |
| 69 | Ga0070667_100009165 | 3300005367 | Bacteria | 8194 |
| 70 | Ga0070667_100377141 | 3300005367 | Bacteria | 1288 |
| 71 | Ga0070713_100000526 | 3300005436 | Bacteria | 24268 |
| 72 | Ga0070711_100027954 | 3300005439 | Bacteria | 3707 |
| 73 | Ga0070711_100122903 | 3300005439 | Bacteria | 1923 |
| 74 | Ga0070694_100046563 | 3300005444 | Bacteria | 2912 |
| 75 | Ga0070708_100518268 | 3300005445 | Bacteria | 1124 |
| 76 | Ga0070663_100398778 | 3300005455 | Bacteria | 1124 |
| 77 | Ga0070681_10000681 | 3300005458 | Bacteria | 28134 |
| 78 | Ga0070685_10201166 | 3300005466 | Bacteria | 1295 |
| 79 | Ga0070706_100131498 | 3300005467 | Bacteria | 2335 |
| 80 | Ga0070699_100130139 | 3300005518 | Bacteria | 2218 |
| 81 | Ga0070679_100008706 | 3300005530 | Bacteria | 9566 |
| 82 | Ga0068853_100195167 | 3300005539 | Bacteria | 1841 |
| 83 | Ga0070686_100088230 | 3300005544 | Bacteria | 2069 |
| 84 | Ga0070695_100014398 | 3300005545 | Bacteria | 4768 |
| 85 | Ga0070665_100002095 | 3300005548 | Bacteria | 22353 |
| 86 | Ga0070665_100005120 | 3300005548 | Bacteria | 13587 |
| 87 | Ga0070665_100076453 | 3300005548 | Bacteria | 3355 |
| 88 | Ga0070665_100084443 | 3300005548 | Bacteria | 3181 |
| 89 | Ga0070665_100087923 | 3300005548 | Bacteria | 3113 |
| 90 | Ga0070665_100341725 | 3300005548 | Bacteria | 1502 |
| 91 | Ga0068855_100381886 | 3300005563 | Bacteria | 1547 |
| 92 | Ga0068857_100112605 | 3300005577 | Bacteria | 2446 |
| 93 | Ga0068856_100036031 | 3300005614 | Bacteria | 4852 |
| 94 | Ga0068856_100159392 | 3300005614 | Bacteria | 2267 |
| 95 | Ga0068859_100073860 | 3300005617 | Bacteria | 3448 |
| 96 | Ga0068859_100162981 | 3300005617 | Bacteria | 2309 |
| 97 | Ga0068864_100519544 | 3300005618 | Bacteria | 1148 |
| 98 | Ga0068863_100210085 | 3300005841 | Bacteria | 1874 |
| 99 | Ga0068862_100334261 | 3300005844 | Bacteria | 1402 |
| 100 | Ga0081455_10007852 | 3300005937 | Bacteria | 11173 |
| 101 | Ga0081455_10007920 | 3300005937 | Bacteria | 11119 |
| 102 | Ga0081455_10009013 | 3300005937 | Bacteria | 10299 |
| 103 | Ga0081455_10034510 | 3300005937 | Bacteria | 4531 |
| 104 | Ga0081455_10048637 | 3300005937 | Bacteria | 3662 |
| 105 | Ga0081538_10009799 | 3300005981 | Bacteria | 7929 |
| 106 | Ga0081538_10075112 | 3300005981 | Bacteria | 1836 |
| 107 | Ga0081540_1000620 | 3300005983 | Bacteria | 33727 |
| 108 | Ga0081540_1009656 | 3300005983 | Bacteria | 6631 |
| 109 | Ga0081540_1014865 | 3300005983 | Bacteria | 4956 |
| 110 | Ga0081540_1019574 | 3300005983 | Bacteria | 4106 |
| 111 | Ga0081539_10000220 | 3300005985 | Bacteria | 133834 |
| 112 | Ga0081539_10002437 | 3300005985 | Bacteria | 26263 |
| 113 | Ga0081539_10008096 | 3300005985 | Bacteria | 9295 |
| 114 | Ga0070717_10000425 | 3300006028 | Bacteria | 27019 |
| 115 | Ga0070717_10381551 | 3300006028 | Bacteria | 1264 |
| 116 | Ga0075365_10011544 | 3300006038 | Bacteria | 5198 |
| 117 | Ga0075365_10011946 | 3300006038 | Bacteria | 5131 |
| 118 | Ga0075365_10017754 | 3300006038 | Bacteria | 4361 |
| 119 | Ga0075365_10018335 | 3300006038 | Bacteria | 4303 |
| 120 | Ga0075365_10022109 | 3300006038 | Bacteria | 3979 |
| 121 | Ga0075365_10057514 | 3300006038 | Bacteria | 2587 |
| 122 | Ga0075365_10154006 | 3300006038 | Bacteria | 1599 |
| 123 | Ga0075368_10008690 | 3300006042 | Bacteria | 3629 |
| 124 | Ga0075368_10018661 | 3300006042 | Bacteria | 2608 |
| 125 | Ga0075368_10023143 | 3300006042 | Bacteria | 2370 |
| 126 | Ga0075368_10071327 | 3300006042 | Bacteria | 1403 |
| 127 | Ga0075368_10071757 | 3300006042 | Bacteria | 1399 |
| 128 | Ga0075363_100004037 | 3300006048 | Bacteria | 6352 |
| 129 | Ga0075363_100135547 | 3300006048 | Bacteria | 1383 |
| 130 | Ga0075364_10026122 | 3300006051 | Bacteria | 3722 |
| 131 | Ga0075364_10047814 | 3300006051 | Bacteria | 2788 |
| 132 | Ga0075364_10106883 | 3300006051 | Bacteria | 1865 |
| 133 | Ga0075364_10140011 | 3300006051 | Bacteria | 1627 |
| 134 | Ga0070716_100002328 | 3300006173 | Bacteria | 8746 |
| 135 | Ga0070716_100220925 | 3300006173 | Bacteria | 1273 |
| 136 | Ga0070712_100077880 | 3300006175 | Bacteria | 2391 |
| 137 | Ga0070712_100120014 | 3300006175 | Bacteria | 1977 |
| 138 | Ga0075362_10012384 | 3300006177 | Bacteria | 3387 |
| 139 | Ga0075362_10023553 | 3300006177 | Bacteria | 2605 |
| 140 | Ga0075367_10002198 | 3300006178 | Bacteria | 8795 |
| 141 | Ga0075367_10002330 | 3300006178 | Bacteria | 8638 |
| 142 | Ga0075367_10029612 | 3300006178 | Bacteria | 3133 |
| 143 | Ga0075367_10035948 | 3300006178 | Bacteria | 2870 |
| 144 | Ga0075367_10036519 | 3300006178 | Bacteria | 2850 |
| 145 | Ga0075367_10043320 | 3300006178 | Bacteria | 2636 |
| 146 | Ga0075367_10150714 | 3300006178 | Bacteria | 1443 |
| 147 | Ga0075367_10163874 | 3300006178 | Bacteria | 1383 |
| 148 | Ga0075369_10013828 | 3300006186 | Bacteria | 3212 |
| 149 | Ga0075369_10121883 | 3300006186 | Bacteria | 1181 |
| 150 | Ga0075427_10001903 | 3300006194 | Bacteria | 2742 |
| 151 | Ga0075366_10009512 | 3300006195 | Bacteria | 5426 |
| 152 | Ga0075366_10011331 | 3300006195 | Bacteria | 5032 |
| 153 | Ga0075366_10072866 | 3300006195 | Bacteria | 2047 |
| 154 | Ga0075370_10003168 | 3300006353 | Bacteria | 7782 |
| 155 | Ga0075370_10020067 | 3300006353 | Bacteria | 3647 |
| 156 | Ga0075370_10024134 | 3300006353 | Bacteria | 3356 |
| 157 | Ga0075370_10080226 | 3300006353 | Bacteria | 1875 |
| 158 | Ga0075370_10123501 | 3300006353 | Bacteria | 1508 |
| 159 | Ga0075370_10129962 | 3300006353 | Bacteria | 1469 |
| 160 | Ga0075428_100005390 | 3300006844 | Bacteria | 14222 |
| 161 | Ga0075428_100026013 | 3300006844 | Bacteria | 6481 |
| 162 | Ga0075428_100030504 | 3300006844 | Bacteria | 5962 |
| 163 | Ga0075428_100115849 | 3300006844 | Bacteria | 2919 |
| 164 | Ga0075428_100143877 | 3300006844 | Bacteria | 2592 |
| 165 | Ga0075430_100000140 | 3300006846 | Bacteria | 46272 |
| 166 | Ga0075430_100166447 | 3300006846 | Bacteria | 1834 |
| 167 | Ga0075431_100001318 | 3300006847 | Bacteria | 22699 |
| 168 | Ga0075431_100158117 | 3300006847 | Bacteria | 2331 |
| 169 | Ga0075431_100203657 | 3300006847 | Bacteria | 2024 |
| 170 | Ga0075431_100372918 | 3300006847 | Bacteria | 1432 |
| 171 | Ga0075431_100411232 | 3300006847 | Bacteria | 1353 |
| 172 | Ga0075433_10000050 | 3300006852 | Bacteria | 50089 |
| 173 | Ga0075434_100000179 | 3300006871 | Bacteria | 41085 |
| 174 | Ga0075429_100001170 | 3300006880 | Bacteria | 21187 |
| 175 | Ga0075429_100116506 | 3300006880 | Bacteria | 2335 |
| 176 | Ga0097620_100073871 | 3300006931 | Bacteria | 3448 |
| 177 | Ga0097620_100162996 | 3300006931 | Bacteria | 2309 |
| 178 | Ga0099825_1021826 | 3300006941 | Bacteria | 4258 |
| 179 | Ga0099824_1029608 | 3300006942 | Bacteria | 2309 |
| 180 | Ga0099822_1005398 | 3300006943 | Bacteria | 16681 |
| 181 | Ga0099823_1024510 | 3300006944 | Bacteria | 5451 |
| 182 | Ga0079104_1000014 | 3300006946 | Bacteria | 337362 |
| 183 | Ga0099826_10000297 | 3300006948 | Bacteria | 22278 |
| 184 | Ga0099826_10095024 | 3300006948 | Bacteria | 1813 |
| 185 | Ga0075435_100001211 | 3300007076 | Bacteria | 16537 |
| 186 | Ga0105240_10002521 | 3300009093 | Bacteria | 29396 |
| 187 | Ga0111539_10000565 | 3300009094 | Bacteria | 47399 |
| 188 | Ga0111539_10010599 | 3300009094 | Bacteria | 11607 |
| 189 | Ga0111539_10225523 | 3300009094 | Bacteria | 2183 |
| 190 | Ga0111539_10235929 | 3300009094 | Bacteria | 2129 |
| 191 | Ga0105245_10006247 | 3300009098 | Bacteria | 10481 |
| 192 | Ga0105245_10203045 | 3300009098 | Bacteria | 1904 |
| 193 | Ga0105245_10364746 | 3300009098 | Bacteria | 1434 |
| 194 | Ga0105247_10086689 | 3300009101 | Bacteria | 1982 |
| 195 | Ga0114129_10003182 | 3300009147 | Bacteria | 23025 |
| 196 | Ga0114129_10085173 | 3300009147 | Bacteria | 4385 |
| 197 | Ga0114129_10400906 | 3300009147 | Bacteria | 1808 |
| 198 | Ga0114129_10502866 | 3300009147 | Bacteria | 1583 |
| 199 | Ga0114129_10690294 | 3300009147 | Bacteria | 1313 |
| 200 | Ga0105243_10018705 | 3300009148 | Bacteria | 5248 |
| 201 | Ga0105243_10060918 | 3300009148 | Bacteria | 3016 |
| 202 | Ga0105248_10285149 | 3300009177 | Bacteria | 1859 |
| 203 | Ga0105248_10777425 | 3300009177 | Bacteria | 1081 |
| 204 | Ga0105237_10073940 | 3300009545 | Bacteria | 3400 |
| 205 | Ga0105237_10436622 | 3300009545 | Bacteria | 1315 |
| 206 | Ga0105238_10068422 | 3300009551 | Bacteria | 3552 |
| 207 | Ga0105238_10171507 | 3300009551 | Bacteria | 2146 |
| 208 | Ga0105249_10197633 | 3300009553 | Bacteria | 1966 |
| 209 | Ga0105249_10420514 | 3300009553 | Bacteria | 1370 |
| 210 | Ga0123341_1000019 | 3300009765 | Bacteria | 80932 |
| 211 | Ga0123342_1014594 | 3300009766 | Bacteria | 7436 |
| 212 | Ga0123342_1021209 | 3300009766 | Bacteria | 4598 |
| 213 | Ga0099796_10016009 | 3300010159 | Bacteria | 2205 |
| 214 | Ga0099796_10058057 | 3300010159 | Bacteria | 1363 |
| 215 | Ga0105246_10052627 | 3300011119 | Bacteria | 2799 |
| 216 | Ga0157373_10103869 | 3300013100 | Bacteria | 1998 |
| 217 | Ga0157373_10160983 | 3300013100 | Bacteria | 1579 |
| 218 | Ga0157371_10000304 | 3300013102 | Bacteria | 64521 |
| 219 | Ga0157370_10013708 | 3300013104 | Bacteria | 8334 |
| 220 | Ga0157370_10065483 | 3300013104 | Bacteria | 3438 |
| 221 | Ga0157374_10388413 | 3300013296 | Bacteria | 1391 |
| 222 | Ga0157375_10423927 | 3300013308 | Bacteria | 1496 |
| 223 | Ga0157376_10183948 | 3300014969 | Bacteria | 1912 |
| 224 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 225 | Ga0214542_1000037 | 3300021321 | Bacteria | 159256 |
| 226 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 227 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 228 | Ga0213872_10068402 | 3300021361 | Bacteria | 1602 |
| 229 | Ga0209435_100006 | 3300025206 | Bacteria | 542459 |
| 230 | Ga0209437_100023 | 3300025233 | Bacteria | 614195 |
| 231 | Ga0209437_100341 | 3300025233 | Bacteria | 56114 |
| 232 | Ga0207425_1000018 | 3300025245 | Bacteria | 411841 |
| 233 | Ga0207425_1006064 | 3300025245 | Bacteria | 3356 |
| 234 | Ga0209646_1000015 | 3300025246 | Bacteria | 542459 |
| 235 | Ga0209026_1000023 | 3300025250 | Bacteria | 357521 |
| 236 | Ga0209026_1000046 | 3300025250 | Bacteria | 262031 |
| 237 | Ga0209677_112928 | 3300025253 | Bacteria | 1212 |
| 238 | Ga0209148_1003099 | 3300025254 | Bacteria | 4863 |
| 239 | Ga0209759_1000005 | 3300025256 | Bacteria | 542459 |
| 240 | Ga0209759_1001309 | 3300025256 | Bacteria | 14669 |
| 241 | Ga0209759_1018812 | 3300025256 | Bacteria | 1660 |
| 242 | Ga0209129_1000026 | 3300025258 | Bacteria | 411839 |
| 243 | Ga0209129_1001183 | 3300025258 | Bacteria | 15019 |
| 244 | Ga0209129_1002648 | 3300025258 | Bacteria | 8493 |
| 245 | Ga0209129_1010344 | 3300025258 | Bacteria | 2338 |
| 246 | Ga0209233_1000062 | 3300025261 | Bacteria | 399685 |
| 247 | Ga0209233_1000970 | 3300025261 | Bacteria | 12354 |
| 248 | Ga0209233_1001664 | 3300025261 | Bacteria | 8655 |
| 249 | Ga0209233_1003296 | 3300025261 | Bacteria | 5727 |
| 250 | Ga0209233_1007903 | 3300025261 | Bacteria | 3332 |
| 251 | Ga0209673_1000005 | 3300025273 | Bacteria | 692788 |
| 252 | Ga0209673_1000310 | 3300025273 | Bacteria | 89821 |
| 253 | Ga0209673_1001376 | 3300025273 | Bacteria | 23910 |
| 254 | Ga0209673_1018003 | 3300025273 | Bacteria | 2584 |
| 255 | Ga0209673_1018699 | 3300025273 | Bacteria | 2510 |
| 256 | Ga0209673_1022555 | 3300025273 | Bacteria | 2169 |
| 257 | Ga0209673_1023198 | 3300025273 | Bacteria | 2120 |
| 258 | Ga0209130_1000709 | 3300025284 | Bacteria | 29714 |
| 259 | Ga0209675_1003671 | 3300025291 | Bacteria | 7172 |
| 260 | Ga0209675_1010802 | 3300025291 | Bacteria | 3081 |
| 261 | Ga0209675_1014261 | 3300025291 | Bacteria | 2429 |
| 262 | Ga0209675_1023374 | 3300025291 | Bacteria | 1602 |
| 263 | Ga0209025_1000035 | 3300025294 | Bacteria | 411841 |
| 264 | Ga0209025_1000053 | 3300025294 | Bacteria | 317600 |
| 265 | Ga0209025_1000397 | 3300025294 | Bacteria | 89703 |
| 266 | Ga0209025_1002007 | 3300025294 | Bacteria | 23295 |
| 267 | Ga0209025_1002687 | 3300025294 | Bacteria | 18144 |
| 268 | Ga0209025_1007209 | 3300025294 | Bacteria | 8376 |
| 269 | Ga0209025_1007433 | 3300025294 | Bacteria | 8170 |
| 270 | Ga0209025_1010571 | 3300025294 | Bacteria | 6236 |
| 271 | Ga0209564_1000137 | 3300025295 | Bacteria | 183874 |
| 272 | Ga0209564_1000150 | 3300025295 | Bacteria | 170318 |
| 273 | Ga0209564_1000191 | 3300025295 | Bacteria | 142504 |
| 274 | Ga0209564_1000511 | 3300025295 | Bacteria | 63773 |
| 275 | Ga0209564_1005137 | 3300025295 | Bacteria | 7603 |
| 276 | Ga0209564_1006466 | 3300025295 | Bacteria | 6311 |
| 277 | Ga0209564_1007023 | 3300025295 | Bacteria | 5905 |
| 278 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 279 | Ga0209758_1000040 | 3300025297 | Bacteria | 411841 |
| 280 | Ga0209758_1000477 | 3300025297 | Bacteria | 66111 |
| 281 | Ga0209758_1000585 | 3300025297 | Bacteria | 56861 |
| 282 | Ga0209758_1000662 | 3300025297 | Bacteria | 51542 |
| 283 | Ga0209758_1001274 | 3300025297 | Bacteria | 31178 |
| 284 | Ga0209758_1001596 | 3300025297 | Bacteria | 25926 |
| 285 | Ga0209758_1002622 | 3300025297 | Bacteria | 17886 |
| 286 | Ga0209758_1002716 | 3300025297 | Bacteria | 17425 |
| 287 | Ga0209758_1004840 | 3300025297 | Bacteria | 10864 |
| 288 | Ga0209758_1005670 | 3300025297 | Bacteria | 9445 |
| 289 | Ga0209758_1013489 | 3300025297 | Bacteria | 4449 |
| 290 | Ga0209758_1023161 | 3300025297 | Bacteria | 2818 |
| 291 | Ga0209050_1001525 | 3300025298 | Bacteria | 24412 |
| 292 | Ga0209256_1000108 | 3300025299 | Bacteria | 185884 |
| 293 | Ga0209256_1000243 | 3300025299 | Bacteria | 96714 |
| 294 | Ga0209256_1000740 | 3300025299 | Bacteria | 42806 |
| 295 | Ga0209256_1003072 | 3300025299 | Bacteria | 12269 |
| 296 | Ga0209256_1003322 | 3300025299 | Bacteria | 11411 |
| 297 | Ga0209256_1005504 | 3300025299 | Bacteria | 7245 |
| 298 | Ga0209256_1008896 | 3300025299 | Bacteria | 4532 |
| 299 | Ga0207426_1000198 | 3300025302 | Bacteria | 146241 |
| 300 | Ga0207426_1000292 | 3300025302 | Bacteria | 99342 |
| 301 | Ga0207426_1000355 | 3300025302 | Bacteria | 83450 |
| 302 | Ga0207426_1003205 | 3300025302 | Bacteria | 9213 |
| 303 | Ga0207426_1057592 | 3300025302 | Bacteria | 1130 |
| 304 | Ga0209051_1000038 | 3300025303 | Bacteria | 320926 |
| 305 | Ga0209051_1002277 | 3300025303 | Bacteria | 14058 |
| 306 | Ga0209051_1002823 | 3300025303 | Bacteria | 11969 |
| 307 | Ga0209051_1037393 | 3300025303 | Bacteria | 1780 |
| 308 | Ga0209257_1000654 | 3300025304 | Bacteria | 54783 |
| 309 | Ga0209257_1008917 | 3300025304 | Bacteria | 5523 |
| 310 | Ga0209257_1012956 | 3300025304 | Bacteria | 3772 |
| 311 | Ga0207655_1047574 | 3300025728 | Bacteria | 1769 |
| 312 | Ga0207713_1038563 | 3300025735 | Bacteria | 2026 |
| 313 | Ga0207710_10033864 | 3300025900 | Bacteria | 2242 |
| 314 | Ga0207710_10117633 | 3300025900 | Bacteria | 1267 |
| 315 | Ga0207680_10027354 | 3300025903 | Bacteria | 3174 |
| 316 | Ga0207647_10019881 | 3300025904 | Bacteria | 4509 |
| 317 | Ga0207645_10072761 | 3300025907 | Bacteria | 2201 |
| 318 | Ga0207705_10008204 | 3300025909 | Bacteria | 7641 |
| 319 | Ga0207705_10323885 | 3300025909 | Bacteria | 1184 |
| 320 | Ga0207707_10014526 | 3300025912 | Bacteria | 6857 |
| 321 | Ga0207695_10055812 | 3300025913 | Bacteria | 4114 |
| 322 | Ga0207671_10008285 | 3300025914 | Bacteria | 8839 |
| 323 | Ga0207693_10005998 | 3300025915 | Bacteria | 10074 |
| 324 | Ga0207693_10022689 | 3300025915 | Bacteria | 4987 |
| 325 | Ga0207693_10087797 | 3300025915 | Bacteria | 2437 |
| 326 | Ga0207663_10040021 | 3300025916 | Bacteria | 2846 |
| 327 | Ga0207662_10033751 | 3300025918 | Bacteria | 2985 |
| 328 | Ga0207652_10039117 | 3300025921 | Bacteria | 4024 |
| 329 | Ga0207681_10091151 | 3300025923 | Bacteria | 2177 |
| 330 | Ga0207694_10047057 | 3300025924 | Bacteria | 3336 |
| 331 | Ga0207650_10127444 | 3300025925 | Bacteria | 1988 |
| 332 | Ga0207687_10009010 | 3300025927 | Bacteria | 6523 |
| 333 | Ga0207687_10116915 | 3300025927 | Bacteria | 1988 |
| 334 | Ga0207700_10001358 | 3300025928 | Bacteria | 13877 |
| 335 | Ga0207644_10014803 | 3300025931 | Bacteria | 5228 |
| 336 | Ga0207644_10150474 | 3300025931 | Bacteria | 1800 |
| 337 | Ga0207686_10129469 | 3300025934 | Bacteria | 1729 |
| 338 | Ga0207709_10031822 | 3300025935 | Bacteria | 3084 |
| 339 | Ga0207670_10041485 | 3300025936 | Bacteria | 3027 |
| 340 | Ga0207665_10000837 | 3300025939 | Bacteria | 20779 |
| 341 | Ga0207711_10051640 | 3300025941 | Bacteria | 3522 |
| 342 | Ga0207711_10187050 | 3300025941 | Bacteria | 1886 |
| 343 | Ga0207689_10068552 | 3300025942 | Bacteria | 2915 |
| 344 | Ga0207689_10071966 | 3300025942 | Bacteria | 2840 |
| 345 | Ga0207689_10101561 | 3300025942 | Bacteria | 2362 |
| 346 | Ga0207667_10011494 | 3300025949 | Bacteria | 10284 |
| 347 | Ga0207712_10063367 | 3300025961 | Bacteria | 2632 |
| 348 | Ga0207668_10172844 | 3300025972 | Bacteria | 1696 |
| 349 | Ga0207658_10089841 | 3300025986 | Bacteria | 2379 |
| 350 | Ga0207703_10077531 | 3300026035 | Bacteria | 2759 |
| 351 | Ga0207703_10090163 | 3300026035 | Bacteria | 2576 |
| 352 | Ga0207639_10120702 | 3300026041 | Bacteria | 2153 |
| 353 | Ga0207639_10159169 | 3300026041 | Bacteria | 1901 |
| 354 | Ga0207678_10091910 | 3300026067 | Bacteria | 2594 |
| 355 | Ga0207678_10448528 | 3300026067 | Bacteria | 1121 |
| 356 | Ga0207708_10036315 | 3300026075 | Bacteria | 3752 |
| 357 | Ga0207702_10025869 | 3300026078 | Bacteria | 4872 |
| 358 | Ga0207702_10286621 | 3300026078 | Bacteria | 1559 |
| 359 | Ga0207674_10135330 | 3300026116 | Bacteria | 2426 |
| 360 | Ga0207683_10039324 | 3300026121 | Bacteria | 4126 |
| 361 | Ga0207698_10476688 | 3300026142 | Bacteria | 1210 |
| 362 | Ga0209281_1000032 | 3300027111 | Bacteria | 401727 |
| 363 | Ga0209389_1000014 | 3300027296 | Bacteria | 188621 |
| 364 | Ga0209389_1000077 | 3300027296 | Bacteria | 91273 |
| 365 | Ga0209371_1000035 | 3300027312 | Bacteria | 368979 |
| 366 | Ga0209371_1000135 | 3300027312 | Bacteria | 121718 |
| 367 | Ga0209371_1000703 | 3300027312 | Bacteria | 28337 |
| 368 | Ga0209371_1004170 | 3300027312 | Bacteria | 6449 |
| 369 | Ga0209589_1000011 | 3300027357 | Bacteria | 236981 |
| 370 | Ga0209589_1000020 | 3300027357 | Bacteria | 188617 |
| 371 | Ga0209489_100012 | 3300027361 | Bacteria | 236981 |
| 372 | Ga0209489_100251 | 3300027361 | Bacteria | 91273 |
| 373 | Ga0209489_102003 | 3300027361 | Bacteria | 41928 |
| 374 | Ga0209700_100019 | 3300027363 | Bacteria | 236981 |
| 375 | Ga0209700_100271 | 3300027363 | Bacteria | 91215 |
| 376 | Ga0209282_1001209 | 3300027666 | Bacteria | 13945 |
| 377 | Ga0209282_1076496 | 3300027666 | Bacteria | 1802 |
| 378 | Ga0209588_1017885 | 3300027671 | Bacteria | 2203 |
| 379 | Ga0209813_10003425 | 3300027866 | Bacteria | 3712 |
| 380 | Ga0209813_10005539 | 3300027866 | Bacteria | 3070 |
| 381 | Ga0207428_10000485 | 3300027907 | Bacteria | 47761 |
| 382 | Ga0207428_10078186 | 3300027907 | Bacteria | 2589 |
| 383 | Ga0207428_10128621 | 3300027907 | Bacteria | 1939 |
| 384 | Ga0268266_10013114 | 3300028379 | Bacteria | 7146 |
| 385 | Ga0268266_10023772 | 3300028379 | Bacteria | 5215 |
| 386 | Ga0268266_10125650 | 3300028379 | Bacteria | 2288 |
| 387 | Ga0268266_10130106 | 3300028379 | Bacteria | 2250 |
| 388 | Ga0268266_10131120 | 3300028379 | Bacteria | 2242 |
| 389 | Ga0268266_10454598 | 3300028379 | Bacteria | 1218 |
| 390 | Ga0268265_10157703 | 3300028380 | Bacteria | 1923 |
| 391 | Ga0307517_10000386 | 3300028786 | Bacteria | 75442 |
| 392 | Ga0307515_10001947 | 3300028794 | Bacteria | 45737 |
| 393 | Ga0307515_10025212 | 3300028794 | Bacteria | 10304 |
| 394 | Ga0307515_10068995 | 3300028794 | Bacteria | 4844 |
| 395 | Ga0307515_10190817 | 3300028794 | Bacteria | 1960 |
| 396 | Ga0268256_1000037 | 3300030500 | Bacteria | 367024 |
| 397 | Ga0268256_1000148 | 3300030500 | Bacteria | 94347 |
| 398 | Ga0268256_1003172 | 3300030500 | Bacteria | 7645 |
| 399 | Ga0268256_1004304 | 3300030500 | Bacteria | 5951 |
| 400 | Ga0316181_1153204 | 3300030744 | Bacteria | 1989 |
| 401 | Ga0307513_10066256 | 3300031456 | Bacteria | 3796 |
| 402 | Ga0307513_10131730 | 3300031456 | Bacteria | 2445 |
| 403 | Ga0307509_10433490 | 3300031507 | Bacteria | 1012 |
| 404 | Ga0307508_10093724 | 3300031616 | Bacteria | 2593 |
| 405 | Ga0307514_10216527 | 3300031649 | Bacteria | 1181 |
| 406 | Ga0265314_10002234 | 3300031711 | Bacteria | 20137 |
| 407 | Ga0265342_10035892 | 3300031712 | Bacteria | 3031 |
| 408 | Ga0307516_10091312 | 3300031730 | Bacteria | 2873 |
| 409 | Ga0307405_10002301 | 3300031731 | Bacteria | 8376 |
| 410 | Ga0307413_10064463 | 3300031824 | Bacteria | 2277 |
| 411 | Ga0307406_10078984 | 3300031901 | Bacteria | 2181 |
| 412 | Ga0307406_10285295 | 3300031901 | Bacteria | 1261 |
| 413 | Ga0307407_10109960 | 3300031903 | Bacteria | 1728 |
| 414 | Ga0307412_10311584 | 3300031911 | Bacteria | 1248 |
| 415 | Ga0307409_100119217 | 3300031995 | Bacteria | 2230 |
| 416 | Ga0307416_100082885 | 3300032002 | Bacteria | 2718 |
| 417 | Ga0307414_10044225 | 3300032004 | Bacteria | 3039 |
| 418 | Ga0307414_10087796 | 3300032004 | Bacteria | 2299 |
| 419 | Ga0307414_10095536 | 3300032004 | Bacteria | 2221 |
| 420 | Ga0307411_10093942 | 3300032005 | Bacteria | 2101 |
| 421 | Ga0307411_10118561 | 3300032005 | Bacteria | 1910 |
| 422 | Ga0307415_100068432 | 3300032126 | Bacteria | 2485 |
| 423 | Ga0307510_10045610 | 3300033180 | Bacteria | 4727 |
| 424 | Ga0315911_1000003 | 3300033442 | Bacteria | 502217 |
| 425 | Ga0373932_0038383 | 3300035112 | Bacteria | 1369 |
| 426 | Ga0373939_0002189 | 3300035114 | Bacteria | 4634 |
| 427 | Ga0373960_0003305 | 3300035121 | Bacteria | 3649 |
| 428 | Ga0373931_0002261 | 3300035691 | Bacteria | 8511 |
| 429 | Ga0373931_0010721 | 3300035691 | Bacteria | 4412 |
| 430 | Ga0373931_0038360 | 3300035691 | Bacteria | 2505 |
| 431 | Ga0373927_0109363 | 3300035695 | Bacteria | 1801 |
| 432 | Ga0373937_0148376 | 3300036401 | Bacteria | 2196 |
| 433 | Ga0373925_0152005 | 3300037068 | Bacteria | 1818 |
| 434 | Ga0395898_0483238 | 3300037466 | Bacteria | 1178 |
| 435 | Ga0395905_0002940 | 3300037471 | Bacteria | 18526 |
| 436 | Ga0395905_0010005 | 3300037471 | Bacteria | 9243 |
| 437 | Ga0436361_0285992 | 3300039447 | Bacteria | 2381 |
| 438 | Ga0439436_0017499 | 3300041404 | Bacteria | 2144 |
| 439 | Ga0451833_0340930 | 3300041491 | Bacteria | 2025 |
| 440 | Ga0451839_0143081 | 3300041496 | Bacteria | 1815 |
| 441 | Ga0451845_0454358 | 3300041501 | Bacteria | 1975 |
| 442 | Ga0451847_0186492 | 3300041503 | Bacteria | 2778 |
| 443 | Ga0451849_0091961 | 3300041505 | Bacteria | 1677 |
| 444 | Ga0451851_0082640 | 3300041507 | Bacteria | 2073 |
| 445 | Ga0451843_0039079 | 3300041509 | Bacteria | 2411 |
| 446 | Ga0451853_1011766 | 3300041512 | Bacteria | 1153 |
| 447 | Ga0439431_0035001 | 3300041997 | Bacteria | 1261 |
| 448 | Ga0439432_042969 | 3300042006 | Bacteria | 1428 |
| 449 | Ga0439452_027434 | 3300042010 | Bacteria | 1429 |
| 450 | Ga0439462_0027554 | 3300042015 | Bacteria | 1500 |
| 451 | Ga0439463_042250 | 3300042016 | Bacteria | 1159 |
| 452 | Ga0450906_022453 | 3300042145 | Bacteria | 1125 |
| 453 | Ga0439464_0005917 | 3300042439 | Bacteria | 3178 |
| 454 | Ga0439464_0011374 | 3300042439 | Bacteria | 2357 |
| 455 | Ga0466972_0000113 | 3300044658 | Bacteria | 69042 |
| 456 | Ga0466972_0022304 | 3300044658 | Bacteria | 3153 |
| 457 | Ga0466966_0274186 | 3300044684 | Bacteria | 1015 |
| 458 | Ga0466963_0008496 | 3300044694 | Bacteria | 6156 |
| 459 | Ga0466964_0016443 | 3300044706 | Bacteria | 2826 |
| 460 | Ga0466968_0000931 | 3300044735 | Bacteria | 10307 |
| 461 | Ga0466970_0000129 | 3300044765 | Bacteria | 34329 |
| 462 | Ga0466970_0187647 | 3300044765 | Bacteria | 1148 |
| 463 | Ga0466957_0081268 | 3300044842 | Bacteria | 2018 |
| 464 | Ga0466957_0140093 | 3300044842 | Bacteria | 1558 |
| 465 | Ga0466960_0026578 | 3300044901 | Bacteria | 2631 |
| 466 | Ga0466959_0113087 | 3300045049 | Bacteria | 1936 |
| 467 | Ga0466958_0047489 | 3300045836 | Bacteria | 2592 |
| 468 | Ga0466967_0116352 | 3300045976 | Bacteria | 2463 |
| 469 | Ga0495603_0009391 | 3300046455 | Bacteria | 5910 |
| 470 | Ga0495629_0004287 | 3300046459 | Bacteria | 10692 |
| 471 | Ga0495638_0002696 | 3300046460 | Bacteria | 14292 |
| 472 | Ga0495638_0059304 | 3300046460 | Bacteria | 2370 |
| 473 | Ga0495638_0061881 | 3300046460 | Bacteria | 2311 |
| 474 | Ga0495638_0179994 | 3300046460 | Bacteria | 1207 |
| 475 | Ga0495641_0039292 | 3300046461 | Bacteria | 2207 |
| 476 | Ga0495641_0084849 | 3300046461 | Bacteria | 1418 |
| 477 | Ga0495651_0017446 | 3300046462 | Bacteria | 5559 |
| 478 | Ga0495651_0138161 | 3300046462 | Bacteria | 1771 |
| 479 | Ga0495653_0012380 | 3300046463 | Bacteria | 6963 |
| 480 | Ga0495605_0016951 | 3300046474 | Bacteria | 3934 |
| 481 | Ga0495585_0019507 | 3300046492 | Bacteria | 3909 |
| 482 | Ga0495585_0024557 | 3300046492 | Bacteria | 3455 |
| 483 | Ga0495585_0089445 | 3300046492 | Bacteria | 1660 |
| 484 | Ga0495596_0027468 | 3300046500 | Bacteria | 2288 |
| 485 | Ga0495583_0024494 | 3300046506 | Bacteria | 3032 |
| 486 | Ga0495583_0079975 | 3300046506 | Bacteria | 1421 |
| 487 | Ga0495606_0000196 | 3300046507 | Bacteria | 105765 |
| 488 | Ga0495606_0001140 | 3300046507 | Bacteria | 37797 |
| 489 | Ga0495631_0011407 | 3300046518 | Bacteria | 4370 |
| 490 | Ga0495631_0063652 | 3300046518 | Bacteria | 1597 |
| 491 | Ga0495632_0016742 | 3300046519 | Bacteria | 4067 |
| 492 | Ga0495632_0032562 | 3300046519 | Bacteria | 2684 |
| 493 | Ga0495637_0130553 | 3300046520 | Bacteria | 960 |
| 494 | Ga0495643_0067174 | 3300046522 | Bacteria | 1890 |
| 495 | Ga0495648_0016438 | 3300046524 | Bacteria | 5337 |
| 496 | Ga0495648_0020584 | 3300046524 | Bacteria | 4595 |
| 497 | Ga0495648_0192713 | 3300046524 | Bacteria | 1027 |
| 498 | Ga0495654_0000063 | 3300046530 | Bacteria | 128630 |
| 499 | Ga0495609_0099290 | 3300046538 | Bacteria | 1262 |
| 500 | Ga0495622_0030645 | 3300046557 | Bacteria | 2513 |
| 501 | Ga0495667_0077911 | 3300046559 | Bacteria | 2155 |
| 502 | Ga0495656_0012565 | 3300046615 | Bacteria | 3129 |
| 503 | Ga0495656_0187407 | 3300046615 | Bacteria | 1020 |
| 504 | Ga0495668_0052938 | 3300046616 | Bacteria | 2245 |
| 505 | Ga0495668_0154984 | 3300046616 | Bacteria | 1254 |
| 506 | Ga0495611_0015229 | 3300046648 | Bacteria | 3288 |
| 507 | Ga0495625_0021115 | 3300046660 | Bacteria | 5018 |
| 508 | Ga0495635_0006167 | 3300046663 | Bacteria | 8355 |
| 509 | Ga0495659_0015392 | 3300046664 | Bacteria | 2514 |
| 510 | Ga0495659_0068205 | 3300046664 | Bacteria | 1328 |
| 511 | Ga0495661_0000030 | 3300046665 | Bacteria | 171980 |
| 512 | Ga0495661_0165995 | 3300046665 | Bacteria | 1181 |
| 513 | Ga0495588_0011793 | 3300046674 | Bacteria | 4112 |
| 514 | Ga0495657_0014577 | 3300046675 | Bacteria | 5768 |
| 515 | Ga0495657_0079707 | 3300046675 | Bacteria | 2120 |
| 516 | Ga0495646_0128852 | 3300046680 | Bacteria | 1426 |
| 517 | Ga0495624_0193715 | 3300046690 | Bacteria | 1236 |
| 518 | Ga0495670_0049448 | 3300046691 | Bacteria | 2104 |
| 519 | Ga0495671_0058046 | 3300046692 | Bacteria | 1915 |
| 520 | Ga0495671_0104843 | 3300046692 | Bacteria | 1381 |
| 521 | Ga0495649_0000288 | 3300046694 | Bacteria | 44617 |
| 522 | Ga0495600_0126975 | 3300046809 | Bacteria | 1659 |
| 523 | Ga0495581_0042551 | 3300047315 | Bacteria | 2629 |
| 524 | Ga0495604_0009755 | 3300047317 | Bacteria | 7595 |
| 525 | Ga0495604_0011995 | 3300047317 | Bacteria | 6890 |
| 526 | Ga0495674_0269825 | 3300047319 | Bacteria | 1396 |
| 527 | Ga0495672_0012863 | 3300047320 | Bacteria | 5808 |
| 528 | Ga0495672_0049801 | 3300047320 | Bacteria | 2477 |
| 529 | Ga0495672_0078158 | 3300047320 | Bacteria | 1852 |
| 530 | Ga0495676_0017023 | 3300047321 | Bacteria | 6435 |
| 531 | Ga0495676_0028770 | 3300047321 | Bacteria | 4741 |
| 532 | Ga0495683_0000018 | 3300047323 | Bacteria | 185871 |
| 533 | Ga0495673_0097508 | 3300047469 | Bacteria | 1193 |
| 534 | Ga0495686_0133206 | 3300047472 | Bacteria | 1472 |
| 535 | Ga0495602_0244103 | 3300048088 | Bacteria | 1342 |
| 536 | Ga0496100_0017973 | 3300048903 | Bacteria | 4185 |
| 537 | Ga0496100_0246446 | 3300048903 | Bacteria | 1320 |
| 538 | Ga0496101_0002506 | 3300048904 | Bacteria | 11287 |
| 539 | Ga0496101_0084746 | 3300048904 | Bacteria | 2347 |
| 540 | Ga0496101_0293806 | 3300048904 | Bacteria | 1272 |
| 541 | Ga0496102_0118582 | 3300048905 | Bacteria | 2470 |
| 542 | Ga0496102_0120234 | 3300048905 | Bacteria | 2453 |
| 543 | Ga0496102_0139154 | 3300048905 | Bacteria | 2275 |
| 544 | Ga0496104_0001254 | 3300048907 | Bacteria | 21878 |
| 545 | Ga0496104_0159198 | 3300048907 | Bacteria | 2166 |
| 546 | Ga0496104_0315146 | 3300048907 | Bacteria | 1477 |
| 547 | Ga0496105_0030374 | 3300048908 | Bacteria | 4428 |
| 548 | Ga0496105_0061087 | 3300048908 | Bacteria | 3109 |
| 549 | Ga0496105_0075113 | 3300048908 | Bacteria | 2791 |
| 550 | Ga0496105_0195109 | 3300048908 | Bacteria | 1654 |
| 551 | Ga0496106_0032006 | 3300048909 | Bacteria | 3920 |
| 552 | Ga0496106_0039230 | 3300048909 | Bacteria | 3547 |
| 553 | Ga0496106_0040480 | 3300048909 | Bacteria | 3490 |
| 554 | Ga0496106_0084026 | 3300048909 | Bacteria | 2449 |
| 555 | Ga0496107_0019239 | 3300048910 | Bacteria | 4817 |
| 556 | Ga0496108_0101013 | 3300048911 | Bacteria | 2460 |
| 557 | Ga0496108_0429083 | 3300048911 | Bacteria | 1154 |
| 558 | Ga0496109_0033706 | 3300048912 | Bacteria | 4608 |
| 559 | Ga0496109_0064980 | 3300048912 | Bacteria | 3340 |
| 560 | Ga0496109_0143700 | 3300048912 | Bacteria | 2231 |
| 561 | Ga0496109_0202435 | 3300048912 | Bacteria | 1867 |
| 562 | Ga0496110_0035179 | 3300048913 | Bacteria | 4344 |
| 563 | Ga0496110_0372551 | 3300048913 | Bacteria | 1301 |
| 564 | Ga0496112_0015338 | 3300048915 | Bacteria | 7145 |
| 565 | Ga0496112_0043464 | 3300048915 | Bacteria | 4399 |
| 566 | Ga0496112_0323276 | 3300048915 | Bacteria | 1487 |
| 567 | Ga0496112_0401976 | 3300048915 | Bacteria | 1309 |
| 568 | Ga0496113_0042834 | 3300048916 | Bacteria | 3346 |
| 569 | Ga0496113_0476842 | 3300048916 | Bacteria | 1002 |
| 570 | Ga0496114_0037868 | 3300048917 | Bacteria | 3990 |
| 571 | Ga0496114_0195087 | 3300048917 | Bacteria | 1772 |
| 572 | Ga0496114_0392131 | 3300048917 | Bacteria | 1230 |
| 573 | Ga0496114_0576165 | 3300048917 | Bacteria | 993 |
| 574 | Ga0496115_0005702 | 3300048918 | Bacteria | 9062 |
| 575 | Ga0496115_0098103 | 3300048918 | Bacteria | 2399 |
| 576 | Ga0496116_0000167 | 3300048919 | Bacteria | 132540 |
| 577 | Ga0496116_0009413 | 3300048919 | Bacteria | 8328 |
| 578 | Ga0496116_0011068 | 3300048919 | Bacteria | 7505 |
| 579 | Ga0496116_0012692 | 3300048919 | Bacteria | 6854 |
| 580 | Ga0496116_0047130 | 3300048919 | Bacteria | 2903 |
| 581 | Ga0496116_0107045 | 3300048919 | Bacteria | 1654 |
| 582 | Ga0496116_0149098 | 3300048919 | Bacteria | 1302 |
| 583 | Ga0496117_0000052 | 3300048920 | Bacteria | 280463 |
| 584 | Ga0496117_0008030 | 3300048920 | Bacteria | 10116 |
| 585 | Ga0496117_0009706 | 3300048920 | Bacteria | 8895 |
| 586 | Ga0496117_0068125 | 3300048920 | Bacteria | 2404 |
| 587 | Ga0496117_0074519 | 3300048920 | Bacteria | 2259 |
| 588 | Ga0496117_0185523 | 3300048920 | Bacteria | 1191 |
| 589 | Ga0496118_0018034 | 3300048921 | Bacteria | 6392 |
| 590 | Ga0496118_0094285 | 3300048921 | Bacteria | 2047 |
| 591 | Ga0496118_0190535 | 3300048921 | Bacteria | 1227 |
| 592 | Ga0496119_0000407 | 3300048922 | Bacteria | 59063 |
| 593 | Ga0496119_0009404 | 3300048922 | Bacteria | 8397 |
| 594 | Ga0496119_0017837 | 3300048922 | Bacteria | 5321 |
| 595 | Ga0496119_0020002 | 3300048922 | Bacteria | 4900 |
| 596 | Ga0496119_0037750 | 3300048922 | Bacteria | 3133 |
| 597 | Ga0496119_0042872 | 3300048922 | Bacteria | 2865 |
| 598 | Ga0496119_0055788 | 3300048922 | Bacteria | 2398 |
| 599 | Ga0496119_0112682 | 3300048922 | Bacteria | 1507 |
| 600 | Ga0496120_0000019 | 3300048923 | Bacteria | 260115 |
| 601 | Ga0496120_0169916 | 3300048923 | Bacteria | 1079 |
| 602 | Ga0496121_0000005 | 3300048924 | Bacteria | 1034486 |
| 603 | Ga0496121_0000230 | 3300048924 | Bacteria | 120616 |
| 604 | Ga0496121_0003624 | 3300048924 | Bacteria | 21750 |
| 605 | Ga0496121_0027118 | 3300048924 | Bacteria | 5370 |
| 606 | Ga0496121_0028245 | 3300048924 | Bacteria | 5227 |
| 607 | Ga0496121_0140568 | 3300048924 | Bacteria | 1792 |
| 608 | Ga0496121_0259512 | 3300048924 | Bacteria | 1200 |
| 609 | Ga0496122_0000053 | 3300048925 | Bacteria | 260120 |
| 610 | Ga0496122_0003439 | 3300048925 | Bacteria | 20818 |
| 611 | Ga0496122_0004580 | 3300048925 | Bacteria | 17027 |
| 612 | Ga0496122_0024574 | 3300048925 | Bacteria | 5268 |
| 613 | Ga0496122_0064306 | 3300048925 | Bacteria | 2670 |
| 614 | Ga0496122_0139424 | 3300048925 | Bacteria | 1520 |
| 615 | Ga0496122_0168519 | 3300048925 | Bacteria | 1324 |
| 616 | Ga0496123_0000038 | 3300048926 | Bacteria | 260120 |
| 617 | Ga0496123_0002783 | 3300048926 | Bacteria | 20818 |
| 618 | Ga0496123_0014707 | 3300048926 | Bacteria | 6468 |
| 619 | Ga0496123_0022880 | 3300048926 | Bacteria | 4801 |
| 620 | Ga0496123_0067145 | 3300048926 | Bacteria | 2266 |
| 621 | Ga0496123_0090192 | 3300048926 | Bacteria | 1823 |
| 622 | Ga0496124_0001723 | 3300048927 | Bacteria | 30828 |
| 623 | Ga0496124_0017334 | 3300048927 | Bacteria | 6790 |
| 624 | Ga0496124_0039011 | 3300048927 | Bacteria | 4119 |
| 625 | Ga0496124_0096255 | 3300048927 | Bacteria | 2405 |
| 626 | Ga0496124_0104449 | 3300048927 | Bacteria | 2291 |
| 627 | Ga0496124_0104925 | 3300048927 | Bacteria | 2284 |
| 628 | Ga0496125_0000159 | 3300048928 | Bacteria | 151205 |
| 629 | Ga0496125_0000763 | 3300048928 | Bacteria | 52688 |
| 630 | Ga0496125_0000796 | 3300048928 | Bacteria | 51436 |
| 631 | Ga0496125_0008276 | 3300048928 | Bacteria | 10921 |
| 632 | Ga0496125_0050643 | 3300048928 | Bacteria | 3436 |
| 633 | Ga0496125_0076051 | 3300048928 | Bacteria | 2594 |
| 634 | Ga0496125_0080691 | 3300048928 | Bacteria | 2488 |
| 635 | Ga0496125_0353606 | 3300048928 | Bacteria | 876 |
| 636 | Ga0496126_0000768 | 3300048929 | Bacteria | 58074 |
| 637 | Ga0496126_0003924 | 3300048929 | Bacteria | 18222 |
| 638 | Ga0496126_0018413 | 3300048929 | Bacteria | 6919 |
| 639 | Ga0496126_0372776 | 3300048929 | Bacteria | 1163 |
| 640 | Ga0496126_0470649 | 3300048929 | Bacteria | 1008 |
| 641 | Ga0495678_027086 | 3300049459 | Bacteria | 2436 |
| 642 | Ga0495678_031570 | 3300049459 | Bacteria | 2207 |
| 643 | Ga0495682_0038135 | 3300049460 | Bacteria | 1766 |
| 644 | Ga0501033_0201231 | 3300049570 | Bacteria | 1422 |
| 645 | Ga0501034_0328983 | 3300049571 | Bacteria | 1460 |
| 646 | Ga0501037_0165632 | 3300049573 | Bacteria | 1574 |
| 647 | Ga0501038_0215268 | 3300049574 | Bacteria | 1535 |
| 648 | Ga0501040_0463128 | 3300049576 | Bacteria | 913 |
| 649 | Ga0501042_0293844 | 3300049578 | Bacteria | 1174 |
| 650 | Ga0501046_0055698 | 3300049580 | Bacteria | 3106 |
| 651 | Ga0501047_0042993 | 3300049581 | Bacteria | 4365 |
| 652 | Ga0501047_0099757 | 3300049581 | Bacteria | 2783 |
| 653 | Ga0501069_0153000 | 3300049585 | Bacteria | 1326 |
| 654 | Ga0501073_0138282 | 3300049589 | Bacteria | 1688 |
| 655 | Ga0501075_0479701 | 3300049591 | Bacteria | 949 |
| 656 | Ga0501076_0016532 | 3300049592 | Bacteria | 5593 |
| 657 | Ga0501280_006997 | 3300049776 | Bacteria | 1584 |
| 658 | Ga0501035_0045861 | 3300049822 | Bacteria | 3932 |
| 659 | nmdc:mga03683_10325_c1 | 3300050489 | Bacteria | 3347 |
| 660 | nmdc:mga03683_26726_c1 | 3300050489 | Bacteria | 2279 |
| 661 | nmdc:mga03683_7842_c1 | 3300050489 | Bacteria | 3727 |
| 662 | nmdc:mga03n38_1718_c1 | 3300050490 | Bacteria | 6456 |
| 663 | nmdc:mga03n38_70090_c1 | 3300050490 | Bacteria | 1621 |
| 664 | nmdc:mga00v17_11_c1 | 3300050491 | Bacteria | 135478 |
| 665 | nmdc:mga00v17_21333_c1 | 3300050491 | Bacteria | 3723 |
| 666 | nmdc:mga00v17_31758_c1 | 3300050491 | Bacteria | 3116 |
| 667 | nmdc:mga00v17_67568_c1 | 3300050491 | Bacteria | 2208 |
| 668 | nmdc:mga00v17_88516_c1 | 3300050491 | Bacteria | 1942 |
| 669 | nmdc:mga0yw44_114571_c1 | 3300050492 | Bacteria | 1731 |
| 670 | nmdc:mga0yw44_1949_c1 | 3300050492 | Bacteria | 8548 |
| 671 | nmdc:mga0yw44_291285_c1 | 3300050492 | Bacteria | 1092 |
| 672 | nmdc:mga0yw44_32216_c1 | 3300050492 | Bacteria | 3053 |
| 673 | nmdc:mga0yw44_528_c1 | 3300050492 | Bacteria | 13715 |
| 674 | nmdc:mga0yw44_61812_c1 | 3300050492 | Bacteria | 2299 |
| 675 | nmdc:mga0yw44_76197_c1 | 3300050492 | Bacteria | 2093 |
| 676 | nmdc:mga0k408_110770_c1 | 3300050493 | Bacteria | 1623 |
| 677 | nmdc:mga0k408_171939_c1 | 3300050493 | Bacteria | 1292 |
| 678 | nmdc:mga0k408_21150_c1 | 3300050493 | Bacteria | 3652 |
| 679 | nmdc:mga0k408_61733_c1 | 3300050493 | Bacteria | 2179 |
| 680 | nmdc:mga06z11_72078_c1 | 3300050494 | Bacteria | 1831 |
| 681 | nmdc:mga06z11_76648_c1 | 3300050494 | Bacteria | 1783 |
| 682 | nmdc:mga04h51_48492_c1 | 3300050495 | Bacteria | 1416 |
| 683 | nmdc:mga07m45_18250_c1 | 3300050496 | Bacteria | 3783 |
| 684 | nmdc:mga07m45_207910_c1 | 3300050496 | Bacteria | 1139 |
| 685 | nmdc:mga07m45_31840_c1 | 3300050496 | Bacteria | 2923 |
| 686 | nmdc:mga07m45_6280_c1 | 3300050496 | Bacteria | 3722 |
| 687 | nmdc:mga05p37_195993_c1 | 3300050507 | Bacteria | 2449 |
| 688 | nmdc:mga05p37_219_c1 | 3300050507 | Bacteria | 57577 |
| 689 | nmdc:mga05p37_321350_c1 | 3300050507 | Bacteria | 1832 |
| 690 | nmdc:mga09592_232851_c1 | 3300050508 | Bacteria | 1596 |
| 691 | nmdc:mga09592_452_c1 | 3300050508 | Bacteria | 30462 |
| 692 | nmdc:mga0qj67_396_c1 | 3300050509 | Bacteria | 30122 |
| 693 | nmdc:mga0qj67_54201_c1 | 3300050509 | Bacteria | 3175 |
| 694 | nmdc:mga0qj67_57041_c1 | 3300050509 | Bacteria | 3096 |
| 695 | nmdc:mga06r32_190711_c1 | 3300050510 | Bacteria | 2037 |
| 696 | nmdc:mga06r32_220643_c1 | 3300050510 | Bacteria | 1884 |
| 697 | nmdc:mga06r32_274_c1 | 3300050510 | Bacteria | 42858 |
| 698 | nmdc:mga06r32_364722_c1 | 3300050510 | Bacteria | 1428 |
| 699 | nmdc:mga06r32_41092_c1 | 3300050510 | Bacteria | 4393 |
| 700 | nmdc:mga08y16_15638_c1 | 3300050511 | Bacteria | 7979 |
| 701 | nmdc:mga08y16_26695_c1 | 3300050511 | Bacteria | 6087 |
| 702 | nmdc:mga08y16_32934_c1 | 3300050511 | Bacteria | 5446 |
| 703 | nmdc:mga08y16_377326_c1 | 3300050511 | Bacteria | 1454 |
| 704 | nmdc:mga0n895_124_c1 | 3300050512 | Bacteria | 45833 |
| 705 | nmdc:mga0n895_328624_c1 | 3300050512 | Bacteria | 1549 |
| 706 | nmdc:mga0rr50_268356_c1 | 3300050513 | Bacteria | 1421 |
| 707 | nmdc:mga0rr50_4689_c1 | 3300050513 | Bacteria | 8056 |
| 708 | nmdc:mga0a205_97_c1 | 3300050515 | Bacteria | 49530 |
| 709 | nmdc:mga0sz30_18802_c1 | 3300050516 | Bacteria | 2769 |
| 710 | nmdc:mga0sz30_70141_c1 | 3300050516 | Bacteria | 1508 |
| 711 | nmdc:mga0sz30_8151_c1 | 3300050516 | Bacteria | 3948 |
| 712 | Ga0495601_0002483 | 3300053077 | Bacteria | 10493 |
| 713 | Ga0495595_0001110 | 3300053084 | Bacteria | 10438 |
| 714 | Ga0495619_0000145 | 3300053085 | Bacteria | 52248 |
| 715 | Ga0500643_000218 | 3300053087 | Bacteria | 53579 |
| 716 | Ga0500644_0001583 | 3300053088 | Bacteria | 5959 |
| 717 | Ga0500644_0056856 | 3300053088 | Bacteria | 1363 |
| 718 | Ga0500651_0001206 | 3300053093 | Bacteria | 12837 |
| 719 | Ga0500566_0000562 | 3300053094 | Bacteria | 20869 |
| 720 | Ga0500566_0042130 | 3300053094 | Bacteria | 2635 |
| 721 | Ga0500640_030487 | 3300053095 | Bacteria | 2362 |
| 722 | Ga0500641_0005846 | 3300053096 | Bacteria | 4355 |
| 723 | Ga0500641_0107573 | 3300053096 | Bacteria | 1199 |
| 724 | Ga0500555_008865 | 3300053103 | Bacteria | 2871 |
| 725 | Ga0500560_017881 | 3300053107 | Bacteria | 1966 |
| 726 | Ga0500569_009618 | 3300053109 | Bacteria | 2252 |
| 727 | Ga0500593_000025 | 3300053117 | Bacteria | 51890 |
| 728 | Ga0500595_000848 | 3300053119 | Bacteria | 17450 |
| 729 | Ga0500595_001223 | 3300053119 | Bacteria | 14197 |
| 730 | Ga0500595_001276 | 3300053119 | Bacteria | 13715 |
| 731 | Ga0500595_001896 | 3300053119 | Bacteria | 10770 |
| 732 | Ga0500595_020910 | 3300053119 | Bacteria | 2344 |
| 733 | Ga0500614_014399 | 3300053123 | Bacteria | 1750 |
| 734 | Ga0500618_000726 | 3300053125 | Bacteria | 18853 |
| 735 | Ga0500618_003240 | 3300053125 | Bacteria | 5665 |
| 736 | Ga0500642_0077637 | 3300053130 | Bacteria | 1520 |
| 737 | Ga0500568_0000005 | 3300053139 | Bacteria | 614296 |
| 738 | Ga0500568_0001438 | 3300053139 | Bacteria | 15421 |
| 739 | Ga0500568_0035067 | 3300053139 | Bacteria | 2049 |
| 740 | Ga0500573_0038452 | 3300053140 | Bacteria | 2764 |
| 741 | Ga0500577_0122988 | 3300053142 | Bacteria | 1081 |
| 742 | Ga0500579_081517 | 3300053143 | Bacteria | 1806 |
| 743 | Ga0500604_0001887 | 3300053151 | Bacteria | 5822 |
| 744 | Ga0500616_0000256 | 3300053153 | Bacteria | 82461 |
| 745 | Ga0500616_0000472 | 3300053153 | Bacteria | 52191 |
| 746 | Ga0500616_0004193 | 3300053153 | Bacteria | 10390 |
| 747 | Ga0500616_0009442 | 3300053153 | Bacteria | 5934 |
| 748 | Ga0500616_0034287 | 3300053153 | Bacteria | 2765 |
| 749 | Ga0500622_0009196 | 3300053156 | Bacteria | 5484 |
| 750 | Ga0500622_0013905 | 3300053156 | Bacteria | 4332 |
| 751 | Ga0500622_0092080 | 3300053156 | Bacteria | 1503 |
| 752 | Ga0500627_0004511 | 3300053158 | Bacteria | 4488 |
| 753 | Ga0500627_0018511 | 3300053158 | Bacteria | 2758 |
| 754 | Ga0500627_0050943 | 3300053158 | Bacteria | 1804 |
| 755 | Ga0500634_0000011 | 3300053161 | Bacteria | 133329 |
| 756 | Ga0500634_0012826 | 3300053161 | Bacteria | 4375 |
| 757 | Ga0500636_0000039 | 3300053177 | Bacteria | 69891 |
| 758 | Ga0500636_0001036 | 3300053177 | Bacteria | 14900 |
| 759 | Ga0500636_0053454 | 3300053177 | Bacteria | 2370 |
| 760 | Ga0500637_0000231 | 3300053178 | Bacteria | 20786 |
| 761 | Ga0500645_042682 | 3300053730 | Bacteria | 1337 |
| 762 | Ga0500609_002839 | 3300053731 | Bacteria | 2470 |
| 763 | Ga0500601_003054 | 3300053737 | Bacteria | 1805 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005937 | Ga0081455_10007920 | Ga0081455_100079207 | 260 |
| 2 | 3300048929 | Ga0496126_0018413 | Ga0496126_0018413_5562_6458 | 262 |
| 3 | 3300053119 | Ga0500595_000848 | Ga0500595_000848_10955_11866 | 262 |
| 4 | 3300005327 | Ga0070658_10245760 | Ga0070658_102457602 | 264 |
| 5 | 3300005334 | Ga0068869_100059708 | Ga0068869_1000597082 | 264 |
| 6 | 3300005548 | Ga0070665_100002095 | Ga0070665_10000209510 | 264 |
| 7 | 3300025909 | Ga0207705_10323885 | Ga0207705_103238852 | 264 |
| 8 | 3300025942 | Ga0207689_10071966 | Ga0207689_100719663 | 264 |
| 9 | 3300028379 | Ga0268266_10013114 | Ga0268266_100131146 | 264 |
| 10 | 3300031911 | Ga0307412_10311584 | Ga0307412_103115842 | 264 |
| 11 | 3300042016 | Ga0439463_042250 | Ga0439463_042250_31_945 | 264 |
| 12 | 3300002741 | JGI25157J39369_1000789 | JGI25157J39369_10007893 | 265 |
| 13 | 3300009094 | Ga0111539_10010599 | Ga0111539_100105994 | 265 |
| 14 | 3300025250 | Ga0209026_1000023 | Ga0209026_1000023117 | 265 |
| 15 | 3300025256 | Ga0209759_1001309 | Ga0209759_10013095 | 265 |
| 16 | 3300027907 | Ga0207428_10128621 | Ga0207428_101286211 | 265 |
| 17 | 3300033442 | Ga0315911_1000003 | Ga0315911_1000003493 | 265 |
| 18 | 3300046461 | Ga0495641_0039292 | Ga0495641_0039292_270_1163 | 265 |
| 19 | 3300046507 | Ga0495606_0000196 | Ga0495606_0000196_15187_16080 | 265 |
| 20 | 3300053161 | Ga0500634_0012826 | Ga0500634_0012826_1787_2584 | 265 |
| 21 | 3300003856 | Ga0058692_1006972 | Ga0058692_10069723 | 266 |
| 22 | 3300005466 | Ga0070685_10201166 | Ga0070685_102011662 | 266 |
| 23 | 3300009101 | Ga0105247_10086689 | Ga0105247_100866892 | 266 |
| 24 | 3300027312 | Ga0209371_1000135 | Ga0209371_100013543 | 266 |
| 25 | 3300030500 | Ga0268256_1000148 | Ga0268256_100014843 | 266 |
| 26 | 3300035695 | Ga0373927_0109363 | Ga0373927_0109363_133_1038 | 266 |
| 27 | 3300042006 | Ga0439432_042969 | Ga0439432_042969_219_1064 | 266 |
| 28 | 3300042010 | Ga0439452_027434 | Ga0439452_027434_292_1137 | 266 |
| 29 | 3300042439 | Ga0439464_0005917 | Ga0439464_0005917_503_1348 | 266 |
| 30 | 3300042439 | Ga0439464_0011374 | Ga0439464_0011374_486_1331 | 266 |
| 31 | 3300048913 | Ga0496110_0035179 | Ga0496110_0035179_841_1746 | 266 |
| 32 | 3300048915 | Ga0496112_0323276 | Ga0496112_0323276_403_1308 | 266 |
| 33 | 3300050513 | nmdc:mga0rr50_268356_c1 | nmdc:mga0rr50_268356_c1_489_1394 | 266 |
| 34 | 3300009147 | Ga0114129_10690294 | Ga0114129_106902942 | 267 |
| 35 | 3300047323 | Ga0495683_0000018 | Ga0495683_0000018_50599_51402 | 267 |
| 36 | 3300050511 | nmdc:mga08y16_32934_c1 | nmdc:mga08y16_32934_c1_4247_5170 | 267 |
| 37 | 3300005841 | Ga0068863_100210085 | Ga0068863_1002100852 | 268 |
| 38 | 3300005983 | Ga0081540_1000620 | Ga0081540_10006205 | 268 |
| 39 | 3300009094 | Ga0111539_10235929 | Ga0111539_102359292 | 268 |
| 40 | 3300048905 | Ga0496102_0118582 | Ga0496102_0118582_91_999 | 268 |
| 41 | 3300050510 | nmdc:mga06r32_220643_c1 | nmdc:mga06r32_220643_c1_281_1204 | 268 |
| 42 | 3300050511 | nmdc:mga08y16_377326_c1 | nmdc:mga08y16_377326_c1_130_942 | 268 |
| 43 | 3300047320 | Ga0495672_0049801 | Ga0495672_0049801_493_1392 | 269 |
| 44 | 3300025291 | Ga0209675_1010802 | Ga0209675_10108022 | 270 |
| 45 | 3300046492 | Ga0495585_0089445 | Ga0495585_0089445_410_1303 | 270 |
| 46 | 3300046520 | Ga0495637_0130553 | Ga0495637_0130553_21_842 | 270 |
| 47 | 3300046665 | Ga0495661_0165995 | Ga0495661_0165995_58_951 | 270 |
| 48 | iso_pu_bacteria | 2849076700 | 2849078263 | 270 |
| 49 | 3300048917 | Ga0496114_0195087 | Ga0496114_0195087_29_874 | 271 |
| 50 | 3300025728 | Ga0207655_1047574 | Ga0207655_10475741 | 272 |
| 51 | 3300025735 | Ga0207713_1038563 | Ga0207713_10385632 | 272 |
| 52 | 3300037068 | Ga0373925_0152005 | Ga0373925_0152005_18_842 | 272 |
| 53 | 3300046680 | Ga0495646_0128852 | Ga0495646_0128852_549_1373 | 272 |
| 54 | 3300048908 | Ga0496105_0195109 | Ga0496105_0195109_34_858 | 272 |
| 55 | 3300049574 | Ga0501038_0215268 | Ga0501038_0215268_92_916 | 272 |
| 56 | 3300049576 | Ga0501040_0463128 | Ga0501040_0463128_41_865 | 272 |
| 57 | 3300049581 | Ga0501047_0099757 | Ga0501047_0099757_1466_2290 | 272 |
| 58 | 3300049822 | Ga0501035_0045861 | Ga0501035_0045861_1565_2389 | 272 |
| 59 | iso_pu_bacteria | 2829745981 | 2829746898 | 272 |
| 60 | 3300003771 | Ga0055526_1001408 | Ga0055526_10014085 | 273 |
| 61 | 3300003775 | Ga0055524_1007981 | Ga0055524_10079812 | 273 |
| 62 | 3300003790 | Ga0055528_1000067 | Ga0055528_100006714 | 273 |
| 63 | 3300025273 | Ga0209673_1000310 | Ga0209673_100031027 | 273 |
| 64 | 3300025295 | Ga0209564_1000137 | Ga0209564_100013774 | 273 |
| 65 | 3300025299 | Ga0209256_1000243 | Ga0209256_1000243155 | 273 |
| 66 | 3300028794 | Ga0307515_10025212 | Ga0307515_100252126 | 273 |
| 67 | 3300031456 | Ga0307513_10066256 | Ga0307513_100662562 | 273 |
| 68 | 3300046461 | Ga0495641_0084849 | Ga0495641_0084849_12_839 | 273 |
| 69 | 3300046518 | Ga0495631_0063652 | Ga0495631_0063652_424_1332 | 273 |
| 70 | 3300048917 | Ga0496114_0576165 | Ga0496114_0576165_15_842 | 273 |
| 71 | 3300053161 | Ga0500634_0000011 | Ga0500634_0000011_111757_112644 | 273 |
| 72 | iso_pu_bacteria | 2510065055 | 2510292177 | 273 |
| 73 | iso_pu_bacteria | 2917832318 | 2917832497 | 273 |
| 74 | iso_pu_bacteria | 2919125081 | 2919125296 | 273 |
| 75 | iso_pu_bacteria | 2984504281 | 2984508503 | 273 |
| 76 | iso_pu_bacteria | 8016728285 | 8016729244 | 273 |
| 77 | 3300005356 | Ga0070674_100140987 | Ga0070674_1001409872 | 274 |
| 78 | 3300005548 | Ga0070665_100084443 | Ga0070665_1000844433 | 274 |
| 79 | 3300006175 | Ga0070712_100120014 | Ga0070712_1001200142 | 274 |
| 80 | 3300006177 | Ga0075362_10023553 | Ga0075362_100235532 | 274 |
| 81 | 3300006178 | Ga0075367_10163874 | Ga0075367_101638742 | 274 |
| 82 | 3300032004 | Ga0307414_10044225 | Ga0307414_100442252 | 274 |
| 83 | 3300048927 | Ga0496124_0104449 | Ga0496124_0104449_863_1780 | 274 |
| 84 | 3300050489 | nmdc:mga03683_26726_c1 | nmdc:mga03683_26726_c1_810_1694 | 274 |
| 85 | 3300032004 | Ga0307414_10087796 | Ga0307414_100877962 | 275 |
| 86 | 3300032004 | Ga0307414_10095536 | Ga0307414_100955362 | 275 |
| 87 | 3300032005 | Ga0307411_10118561 | Ga0307411_101185612 | 275 |
| 88 | 3300036401 | Ga0373937_0148376 | Ga0373937_0148376_1006_1914 | 275 |
| 89 | 3300046460 | Ga0495638_0179994 | Ga0495638_0179994_101_1024 | 275 |
| 90 | 3300046462 | Ga0495651_0138161 | Ga0495651_0138161_287_1195 | 275 |
| 91 | 3300046559 | Ga0495667_0077911 | Ga0495667_0077911_1179_2087 | 275 |
| 92 | 3300046675 | Ga0495657_0079707 | Ga0495657_0079707_75_983 | 275 |
| 93 | 3300046809 | Ga0495600_0126975 | Ga0495600_0126975_730_1638 | 275 |
| 94 | 3300047317 | Ga0495604_0011995 | Ga0495604_0011995_1941_2849 | 275 |
| 95 | 3300047319 | Ga0495674_0269825 | Ga0495674_0269825_434_1342 | 275 |
| 96 | 3300048908 | Ga0496105_0061087 | Ga0496105_0061087_17_850 | 275 |
| 97 | 3300048928 | Ga0496125_0353606 | Ga0496125_0353606_38_865 | 275 |
| 98 | 3300053077 | Ga0495601_0002483 | Ga0495601_0002483_8828_9736 | 275 |
| 99 | 3300053084 | Ga0495595_0001110 | Ga0495595_0001110_1572_2480 | 275 |
| 100 | 3300053085 | Ga0495619_0000145 | Ga0495619_0000145_28977_29885 | 275 |
| 101 | 3300053151 | Ga0500604_0001887 | Ga0500604_0001887_4326_5219 | 275 |
| 102 | 3300005347 | Ga0070668_100296586 | Ga0070668_1002965861 | 276 |
| 103 | 3300005445 | Ga0070708_100518268 | Ga0070708_1005182681 | 276 |
| 104 | 3300005617 | Ga0068859_100162981 | Ga0068859_1001629812 | 276 |
| 105 | 3300006042 | Ga0075368_10071757 | Ga0075368_100717572 | 276 |
| 106 | 3300006178 | Ga0075367_10029612 | Ga0075367_100296122 | 276 |
| 107 | 3300006353 | Ga0075370_10129962 | Ga0075370_101299622 | 276 |
| 108 | 3300006931 | Ga0097620_100162996 | Ga0097620_1001629962 | 276 |
| 109 | 3300013308 | Ga0157375_10423927 | Ga0157375_104239272 | 276 |
| 110 | 3300028786 | Ga0307517_10000386 | Ga0307517_1000038622 | 276 |
| 111 | 3300050490 | nmdc:mga03n38_70090_c1 | nmdc:mga03n38_70090_c1_579_1475 | 276 |
| 112 | 3300050492 | nmdc:mga0yw44_291285_c1 | nmdc:mga0yw44_291285_c1_71_961 | 276 |
| 113 | 3300050496 | nmdc:mga07m45_31840_c1 | nmdc:mga07m45_31840_c1_504_1400 | 276 |
| 114 | iso_pu_bacteria | 3007315729 | 3007317415 | 276 |
| 115 | 3300009098 | Ga0105245_10364746 | Ga0105245_103647462 | 277 |
| 116 | 3300026041 | Ga0207639_10159169 | Ga0207639_101591692 | 277 |
| 117 | iso_pu_bacteria | 2990196909 | 2990197571 | 277 |
| 118 | 3300005548 | Ga0070665_100005120 | Ga0070665_10000512011 | 278 |
| 119 | 3300009094 | Ga0111539_10225523 | Ga0111539_102255232 | 278 |
| 120 | 3300009147 | Ga0114129_10502866 | Ga0114129_105028662 | 278 |
| 121 | 3300027907 | Ga0207428_10078186 | Ga0207428_100781863 | 278 |
| 122 | 3300028379 | Ga0268266_10023772 | Ga0268266_100237725 | 278 |
| 123 | 3300046664 | Ga0495659_0068205 | Ga0495659_0068205_350_1240 | 278 |
| 124 | 3300050510 | nmdc:mga06r32_41092_c1 | nmdc:mga06r32_41092_c1_3165_4070 | 278 |
| 125 | 3300050511 | nmdc:mga08y16_15638_c1 | nmdc:mga08y16_15638_c1_3324_4229 | 278 |
| 126 | 3300005444 | Ga0070694_100046563 | Ga0070694_1000465633 | 279 |
| 127 | 3300005545 | Ga0070695_100014398 | Ga0070695_1000143982 | 279 |
| 128 | 3300005981 | Ga0081538_10009799 | Ga0081538_100097993 | 279 |
| 129 | 3300006844 | Ga0075428_100026013 | Ga0075428_1000260132 | 279 |
| 130 | 3300026075 | Ga0207708_10036315 | Ga0207708_100363152 | 279 |
| 131 | 3300035112 | Ga0373932_0038383 | Ga0373932_0038383_436_1332 | 279 |
| 132 | 3300035114 | Ga0373939_0002189 | Ga0373939_0002189_704_1600 | 279 |
| 133 | 3300035121 | Ga0373960_0003305 | Ga0373960_0003305_461_1357 | 279 |
| 134 | 3300035691 | Ga0373931_0038360 | Ga0373931_0038360_741_1637 | 279 |
| 135 | 3300050507 | nmdc:mga05p37_195993_c1 | nmdc:mga05p37_195993_c1_788_1684 | 279 |
| 136 | 3300053119 | Ga0500595_020910 | Ga0500595_020910_1164_2087 | 279 |
| 137 | 3300053153 | Ga0500616_0009442 | Ga0500616_0009442_2289_3185 | 279 |
| 138 | iso_pu_bacteria | 2545555834 | 2545674107 | 279 |
| 139 | iso_pu_bacteria | 2881101125 | 2881101603 | 279 |
| 140 | iso_pu_bacteria | 641522639 | 641643914 | 279 |
| 141 | 3300046538 | Ga0495609_0099290 | Ga0495609_0099290_14_877 | 280 |
| 142 | 3300048919 | Ga0496116_0000167 | Ga0496116_0000167_45590_46519 | 280 |
| 143 | 3300048922 | Ga0496119_0000407 | Ga0496119_0000407_39249_40154 | 280 |
| 144 | 3300048922 | Ga0496119_0055788 | Ga0496119_0055788_318_1247 | 280 |
| 145 | 3300048929 | Ga0496126_0000768 | Ga0496126_0000768_11943_12872 | 280 |
| 146 | iso_pu_bacteria | 2861691609 | 2861692517 | 280 |
| 147 | 3300042015 | Ga0439462_0027554 | Ga0439462_0027554_461_1315 | 281 |
| 148 | 3300044658 | Ga0466972_0000113 | Ga0466972_0000113_43400_44296 | 281 |
| 149 | 3300047315 | Ga0495581_0042551 | Ga0495581_0042551_963_1874 | 281 |
| 150 | 3300003187 | JGI25151J46595_10000166 | JGI25151J46595_1000016634 | 282 |
| 151 | 3300006844 | Ga0075428_100143877 | Ga0075428_1001438772 | 282 |
| 152 | 3300006847 | Ga0075431_100203657 | Ga0075431_1002036572 | 282 |
| 153 | 3300006847 | Ga0075431_100411232 | Ga0075431_1004112322 | 282 |
| 154 | 3300009545 | Ga0105237_10436622 | Ga0105237_104366222 | 282 |
| 155 | 3300009551 | Ga0105238_10171507 | Ga0105238_101715072 | 282 |
| 156 | 3300025294 | Ga0209025_1000053 | Ga0209025_1000053166 | 282 |
| 157 | 3300025297 | Ga0209758_1002716 | Ga0209758_100271611 | 282 |
| 158 | 3300031456 | Ga0307513_10131730 | Ga0307513_101317302 | 282 |
| 159 | 3300031616 | Ga0307508_10093724 | Ga0307508_100937243 | 282 |
| 160 | 3300041997 | Ga0439431_0035001 | Ga0439431_0035001_222_1121 | 282 |
| 161 | 3300048925 | Ga0496122_0168519 | Ga0496122_0168519_242_1138 | 282 |
| 162 | 3300048927 | Ga0496124_0104925 | Ga0496124_0104925_402_1298 | 282 |
| 163 | 3300050508 | nmdc:mga09592_232851_c1 | nmdc:mga09592_232851_c1_536_1435 | 282 |
| 164 | 3300050509 | nmdc:mga0qj67_54201_c1 | nmdc:mga0qj67_54201_c1_107_1006 | 282 |
| 165 | 3300050510 | nmdc:mga06r32_190711_c1 | nmdc:mga06r32_190711_c1_489_1397 | 282 |
| 166 | 3300050510 | nmdc:mga06r32_364722_c1 | nmdc:mga06r32_364722_c1_221_1120 | 282 |
| 167 | iso_pu_bacteria | 2869169390 | 2869176670 | 282 |
| 168 | iso_pu_bacteria | 2906363423 | 2906367760 | 282 |
| 169 | iso_pu_bacteria | 2929199973 | 2929203816 | 282 |
| 170 | iso_pu_bacteria | 8055909800 | 8055916465 | 282 |
| 171 | 3300009553 | Ga0105249_10197633 | Ga0105249_101976332 | 283 |
| 172 | 3300037471 | Ga0395905_0002940 | Ga0395905_0002940_9899_10759 | 283 |
| 173 | 3300047320 | Ga0495672_0078158 | Ga0495672_0078158_437_1336 | 283 |
| 174 | 3300002737 | JGI25162J39368_1002141 | JGI25162J39368_10021415 | 284 |
| 175 | 3300003214 | JGI25165J46597_1001164 | JGI25165J46597_100116412 | 284 |
| 176 | 3300005937 | Ga0081455_10034510 | Ga0081455_100345105 | 284 |
| 177 | 3300005981 | Ga0081538_10075112 | Ga0081538_100751122 | 284 |
| 178 | 3300005983 | Ga0081540_1019574 | Ga0081540_10195742 | 284 |
| 179 | 3300006038 | Ga0075365_10017754 | Ga0075365_100177542 | 284 |
| 180 | 3300006038 | Ga0075365_10018335 | Ga0075365_100183352 | 284 |
| 181 | 3300046500 | Ga0495596_0027468 | Ga0495596_0027468_880_1827 | 284 |
| 182 | 3300048927 | Ga0496124_0001723 | Ga0496124_0001723_2132_3028 | 284 |
| 183 | 3300050492 | nmdc:mga0yw44_32216_c1 | nmdc:mga0yw44_32216_c1_2119_3015 | 284 |
| 184 | 3300050492 | nmdc:mga0yw44_76197_c1 | nmdc:mga0yw44_76197_c1_752_1648 | 284 |
| 185 | 3300053158 | Ga0500627_0004511 | Ga0500627_0004511_2928_3824 | 284 |
| 186 | iso_pu_bacteria | 2919450847 | 2919455535 | 284 |
| 187 | iso_pu_bacteria | 2977898635 | 2977903553 | 284 |
| 188 | 3300005937 | Ga0081455_10009013 | Ga0081455_100090132 | 285 |
| 189 | 3300025261 | Ga0209233_1001664 | Ga0209233_10016645 | 285 |
| 190 | 3300025294 | Ga0209025_1002007 | Ga0209025_100200710 | 285 |
| 191 | 3300028794 | Ga0307515_10190817 | Ga0307515_101908172 | 285 |
| 192 | 3300031824 | Ga0307413_10064463 | Ga0307413_100644632 | 285 |
| 193 | 3300053119 | Ga0500595_001276 | Ga0500595_001276_5874_6785 | 285 |
| 194 | iso_pu_bacteria | 2821443989 | 2821444334 | 285 |
| 195 | iso_pu_bacteria | 2844533157 | 2844538186 | 285 |
| 196 | 3300006941 | Ga0099825_1021826 | Ga0099825_10218264 | 286 |
| 197 | 3300006943 | Ga0099822_1005398 | Ga0099822_100539813 | 286 |
| 198 | 3300025261 | Ga0209233_1007903 | Ga0209233_10079032 | 286 |
| 199 | 3300025299 | Ga0209256_1000740 | Ga0209256_100074027 | 286 |
| 200 | 3300027357 | Ga0209589_1000011 | Ga0209589_100001184 | 286 |
| 201 | 3300027361 | Ga0209489_100012 | Ga0209489_10001284 | 286 |
| 202 | 3300027363 | Ga0209700_100019 | Ga0209700_10001984 | 286 |
| 203 | 3300044706 | Ga0466964_0016443 | Ga0466964_0016443_1376_2266 | 286 |
| 204 | 3300044765 | Ga0466970_0187647 | Ga0466970_0187647_225_1115 | 286 |
| 205 | 3300053093 | Ga0500651_0001206 | Ga0500651_0001206_4792_5703 | 286 |
| 206 | 3300053156 | Ga0500622_0092080 | Ga0500622_0092080_52_963 | 286 |
| 207 | 3300053158 | Ga0500627_0018511 | Ga0500627_0018511_797_1708 | 286 |
| 208 | iso_pu_bacteria | 2894772417 | 2894777215 | 286 |
| 209 | 3300046455 | Ga0495603_0009391 | Ga0495603_0009391_3208_4083 | 287 |
| 210 | 3300046463 | Ga0495653_0012380 | Ga0495653_0012380_4451_5326 | 287 |
| 211 | 3300046492 | Ga0495585_0024557 | Ga0495585_0024557_279_1154 | 287 |
| 212 | 3300046507 | Ga0495606_0001140 | Ga0495606_0001140_2524_3399 | 287 |
| 213 | 3300046665 | Ga0495661_0000030 | Ga0495661_0000030_74443_75318 | 287 |
| 214 | 3300046692 | Ga0495671_0058046 | Ga0495671_0058046_973_1848 | 287 |
| 215 | 3300046694 | Ga0495649_0000288 | Ga0495649_0000288_15017_15892 | 287 |
| 216 | 3300047321 | Ga0495676_0028770 | Ga0495676_0028770_873_1748 | 287 |
| 217 | 3300048929 | Ga0496126_0003924 | Ga0496126_0003924_3800_4708 | 287 |
| 218 | 3300049459 | Ga0495678_027086 | Ga0495678_027086_737_1612 | 287 |
| 219 | 3300053125 | Ga0500618_003240 | Ga0500618_003240_1687_2562 | 287 |
| 220 | iso_pu_bacteria | 2904699407 | 2904701087 | 287 |
| 221 | iso_pu_bacteria | 2908756301 | 2908758685 | 287 |
| 222 | 3300003203 | JGI25406J46586_10023243 | JGI25406J46586_100232431 | 288 |
| 223 | 3300003771 | Ga0055526_1001712 | Ga0055526_10017123 | 288 |
| 224 | 3300005985 | Ga0081539_10000220 | Ga0081539_1000022099 | 288 |
| 225 | 3300025295 | Ga0209564_1000191 | Ga0209564_100019130 | 288 |
| 226 | 3300046615 | Ga0495656_0187407 | Ga0495656_0187407_111_1004 | 288 |
| 227 | 3300048920 | Ga0496117_0068125 | Ga0496117_0068125_1227_2120 | 288 |
| 228 | 3300053088 | Ga0500644_0001583 | Ga0500644_0001583_4036_4944 | 288 |
| 229 | 3300053130 | Ga0500642_0077637 | Ga0500642_0077637_553_1428 | 288 |
| 230 | 3300053139 | Ga0500568_0035067 | Ga0500568_0035067_20_895 | 288 |
| 231 | 3300053153 | Ga0500616_0000256 | Ga0500616_0000256_9401_10309 | 288 |
| 232 | 3300053156 | Ga0500622_0009196 | Ga0500622_0009196_2471_3346 | 288 |
| 233 | iso_pu_bacteria | 2513237087 | 2513592842 | 288 |
| 234 | iso_pu_bacteria | 2523231067 | 2523469964 | 288 |
| 235 | iso_pu_bacteria | 2738543031 | 2739350482 | 288 |
| 236 | iso_pu_bacteria | 3004239961 | 3004240577 | 288 |
| 237 | 3300006942 | Ga0099824_1029608 | Ga0099824_10296082 | 289 |
| 238 | 3300025284 | Ga0209130_1000709 | Ga0209130_100070924 | 289 |
| 239 | 3300025302 | Ga0207426_1000198 | Ga0207426_100019846 | 289 |
| 240 | 3300026041 | Ga0207639_10120702 | Ga0207639_101207022 | 289 |
| 241 | 3300048929 | Ga0496126_0470649 | Ga0496126_0470649_66_959 | 289 |
| 242 | iso_pu_bacteria | 2510917030 | 2511195644 | 289 |
| 243 | iso_pu_bacteria | 2582581298 | 2585222421 | 289 |
| 244 | iso_pu_bacteria | 2585427529 | 2585544627 | 289 |
| 245 | iso_pu_bacteria | 2919100787 | 2919103005 | 289 |
| 246 | iso_pu_bacteria | 2922368715 | 2922375857 | 289 |
| 247 | iso_pu_bacteria | 8001845381 | 8001847348 | 289 |
| 248 | 3300002773 | JGI25152J39213_1000256 | JGI25152J39213_10002563 | 290 |
| 249 | 3300002774 | JGI25150J39212_1000501 | JGI25150J39212_10005013 | 290 |
| 250 | 3300003187 | JGI25151J46595_10000007 | JGI25151J46595_1000000749 | 290 |
| 251 | 3300003215 | JGI25153J46596_10000313 | JGI25153J46596_1000031316 | 290 |
| 252 | 3300006946 | Ga0079104_1000014 | Ga0079104_100001446 | 290 |
| 253 | 3300025245 | Ga0207425_1000018 | Ga0207425_1000018281 | 290 |
| 254 | 3300025258 | Ga0209129_1000026 | Ga0209129_100002648 | 290 |
| 255 | 3300025273 | Ga0209673_1023198 | Ga0209673_10231983 | 290 |
| 256 | 3300025294 | Ga0209025_1000035 | Ga0209025_100003548 | 290 |
| 257 | 3300025297 | Ga0209758_1000040 | Ga0209758_100004048 | 290 |
| 258 | 3300027111 | Ga0209281_1000032 | Ga0209281_100003248 | 290 |
| 259 | 3300031731 | Ga0307405_10002301 | Ga0307405_100023015 | 290 |
| 260 | 3300031901 | Ga0307406_10078984 | Ga0307406_100789843 | 290 |
| 261 | 3300044694 | Ga0466963_0008496 | Ga0466963_0008496_1073_1966 | 290 |
| 262 | 3300044765 | Ga0466970_0000129 | Ga0466970_0000129_23290_24183 | 290 |
| 263 | 3300044842 | Ga0466957_0081268 | Ga0466957_0081268_753_1646 | 290 |
| 264 | 3300045836 | Ga0466958_0047489 | Ga0466958_0047489_1090_1983 | 290 |
| 265 | 3300045976 | Ga0466967_0116352 | Ga0466967_0116352_419_1312 | 290 |
| 266 | 3300046474 | Ga0495605_0016951 | Ga0495605_0016951_1214_2107 | 290 |
| 267 | 3300046506 | Ga0495583_0024494 | Ga0495583_0024494_436_1329 | 290 |
| 268 | 3300046518 | Ga0495631_0011407 | Ga0495631_0011407_2453_3346 | 290 |
| 269 | 3300046519 | Ga0495632_0032562 | Ga0495632_0032562_135_1028 | 290 |
| 270 | 3300046522 | Ga0495643_0067174 | Ga0495643_0067174_507_1400 | 290 |
| 271 | 3300046524 | Ga0495648_0192713 | Ga0495648_0192713_24_917 | 290 |
| 272 | 3300046616 | Ga0495668_0052938 | Ga0495668_0052938_429_1322 | 290 |
| 273 | 3300046648 | Ga0495611_0015229 | Ga0495611_0015229_2247_3140 | 290 |
| 274 | 3300046660 | Ga0495625_0021115 | Ga0495625_0021115_1672_2565 | 290 |
| 275 | 3300046691 | Ga0495670_0049448 | Ga0495670_0049448_112_1005 | 290 |
| 276 | 3300048919 | Ga0496116_0012692 | Ga0496116_0012692_426_1319 | 290 |
| 277 | 3300048920 | Ga0496117_0009706 | Ga0496117_0009706_678_1571 | 290 |
| 278 | 3300048920 | Ga0496117_0185523 | Ga0496117_0185523_112_1008 | 290 |
| 279 | 3300048922 | Ga0496119_0112682 | Ga0496119_0112682_255_1148 | 290 |
| 280 | 3300048924 | Ga0496121_0259512 | Ga0496121_0259512_197_1090 | 290 |
| 281 | 3300048926 | Ga0496123_0090192 | Ga0496123_0090192_734_1627 | 290 |
| 282 | 3300048928 | Ga0496125_0080691 | Ga0496125_0080691_1154_2047 | 290 |
| 283 | 3300049459 | Ga0495678_031570 | Ga0495678_031570_477_1370 | 290 |
| 284 | 3300053109 | Ga0500569_009618 | Ga0500569_009618_1298_2191 | 290 |
| 285 | 3300053139 | Ga0500568_0001438 | Ga0500568_0001438_2148_3041 | 290 |
| 286 | 3300053142 | Ga0500577_0122988 | Ga0500577_0122988_81_974 | 290 |
| 287 | 3300053153 | Ga0500616_0000472 | Ga0500616_0000472_5741_6634 | 290 |
| 288 | 3300053158 | Ga0500627_0050943 | Ga0500627_0050943_456_1349 | 290 |
| 289 | iso_pu_bacteria | 2602042107 | 2603860744 | 290 |
| 290 | 3300005327 | Ga0070658_10018138 | Ga0070658_100181383 | 291 |
| 291 | 3300005336 | Ga0070680_100000827 | Ga0070680_10000082717 | 291 |
| 292 | 3300005458 | Ga0070681_10000681 | Ga0070681_1000068117 | 291 |
| 293 | 3300005530 | Ga0070679_100008706 | Ga0070679_1000087063 | 291 |
| 294 | 3300006847 | Ga0075431_100372918 | Ga0075431_1003729182 | 291 |
| 295 | 3300009093 | Ga0105240_10002521 | Ga0105240_1000252119 | 291 |
| 296 | 3300025909 | Ga0207705_10008204 | Ga0207705_100082046 | 291 |
| 297 | 3300025912 | Ga0207707_10014526 | Ga0207707_100145266 | 291 |
| 298 | 3300025913 | Ga0207695_10055812 | Ga0207695_100558122 | 291 |
| 299 | 3300025921 | Ga0207652_10039117 | Ga0207652_100391173 | 291 |
| 300 | 3300025949 | Ga0207667_10011494 | Ga0207667_100114946 | 291 |
| 301 | 3300031711 | Ga0265314_10002234 | Ga0265314_100022342 | 291 |
| 302 | 3300044842 | Ga0466957_0140093 | Ga0466957_0140093_44_937 | 291 |
| 303 | 3300048908 | Ga0496105_0030374 | Ga0496105_0030374_657_1547 | 291 |
| 304 | 3300050509 | nmdc:mga0qj67_57041_c1 | nmdc:mga0qj67_57041_c1_1604_2500 | 291 |
| 305 | 3300053117 | Ga0500593_000025 | Ga0500593_000025_24673_25569 | 291 |
| 306 | 3300053139 | Ga0500568_0000005 | Ga0500568_0000005_454022_454918 | 291 |
| 307 | iso_pu_bacteria | 2503198000 | 2503200081 | 291 |
| 308 | iso_pu_bacteria | 2508501127 | 2509140121 | 291 |
| 309 | iso_pu_bacteria | 2509276018 | 2509371368 | 291 |
| 310 | iso_pu_bacteria | 2510065059 | 2510315970 | 291 |
| 311 | iso_pu_bacteria | 2512875016 | 2512932448 | 291 |
| 312 | iso_pu_bacteria | 2513237090 | 2513608832 | 291 |
| 313 | iso_pu_bacteria | 2513237092 | 2513621727 | 291 |
| 314 | iso_pu_bacteria | 2513237095 | 2513651223 | 291 |
| 315 | iso_pu_bacteria | 2513237104 | 2513720810 | 291 |
| 316 | iso_pu_bacteria | 2513237159 | 2514002361 | 291 |
| 317 | iso_pu_bacteria | 2513237164 | 2514036457 | 291 |
| 318 | iso_pu_bacteria | 2513237305 | 2514422514 | 291 |
| 319 | iso_pu_bacteria | 2524023205 | 2524436144 | 291 |
| 320 | iso_pu_bacteria | 2524023210 | 2524468788 | 291 |
| 321 | iso_pu_bacteria | 2528768022 | 2528848841 | 291 |
| 322 | iso_pu_bacteria | 2582581306 | 2585266760 | 291 |
| 323 | iso_pu_bacteria | 2582581865 | 2585387801 | 291 |
| 324 | iso_pu_bacteria | 2617270735 | 2617352794 | 291 |
| 325 | iso_pu_bacteria | 2617270741 | 2617372864 | 291 |
| 326 | iso_pu_bacteria | 2643221607 | 2644048165 | 291 |
| 327 | iso_pu_bacteria | 2643221636 | 2644201891 | 291 |
| 328 | iso_pu_bacteria | 2643221686 | 2644480958 | 291 |
| 329 | iso_pu_bacteria | 2687453392 | 2688597973 | 291 |
| 330 | iso_pu_bacteria | 2721755686 | 2723576685 | 291 |
| 331 | iso_pu_bacteria | 2721755755 | 2723843557 | 291 |
| 332 | iso_pu_bacteria | 2744054633 | 2745080900 | 291 |
| 333 | iso_pu_bacteria | 2756170246 | 2756672037 | 291 |
| 334 | iso_pu_bacteria | 2791355196 | 2793061009 | 291 |
| 335 | iso_pu_bacteria | 2791355199 | 2793083914 | 291 |
| 336 | iso_pu_bacteria | 2816332527 | 2818236698 | 291 |
| 337 | iso_pu_bacteria | 2824600985 | 2824602916 | 291 |
| 338 | iso_pu_bacteria | 2824609381 | 2824611861 | 291 |
| 339 | iso_pu_bacteria | 2824653114 | 2824655092 | 291 |
| 340 | iso_pu_bacteria | 2824671348 | 2824672242 | 291 |
| 341 | iso_pu_bacteria | 2824679649 | 2824682187 | 291 |
| 342 | iso_pu_bacteria | 2824687955 | 2824688875 | 291 |
| 343 | iso_pu_bacteria | 2824704595 | 2824708447 | 291 |
| 344 | iso_pu_bacteria | 2824732956 | 2824733948 | 291 |
| 345 | iso_pu_bacteria | 2824746037 | 2824748380 | 291 |
| 346 | iso_pu_bacteria | 2824753945 | 2824757988 | 291 |
| 347 | iso_pu_bacteria | 2824763712 | 2824766477 | 291 |
| 348 | iso_pu_bacteria | 2828305725 | 2828306949 | 291 |
| 349 | iso_pu_bacteria | 2838122688 | 2838129354 | 291 |
| 350 | iso_pu_bacteria | 2841734538 | 2841736037 | 291 |
| 351 | iso_pu_bacteria | 2841941048 | 2841948966 | 291 |
| 352 | iso_pu_bacteria | 2841966195 | 2841972983 | 291 |
| 353 | iso_pu_bacteria | 2841974524 | 2841978346 | 291 |
| 354 | iso_pu_bacteria | 2841983080 | 2841990559 | 291 |
| 355 | iso_pu_bacteria | 2842521101 | 2842524331 | 291 |
| 356 | iso_pu_bacteria | 2844002411 | 2844008015 | 291 |
| 357 | iso_pu_bacteria | 2844009547 | 2844013191 | 291 |
| 358 | iso_pu_bacteria | 2847930680 | 2847937458 | 291 |
| 359 | iso_pu_bacteria | 2856320880 | 2856323182 | 291 |
| 360 | iso_pu_bacteria | 2856328259 | 2856333682 | 291 |
| 361 | iso_pu_bacteria | 2856334872 | 2856338071 | 291 |
| 362 | iso_pu_bacteria | 2856342000 | 2856345789 | 291 |
| 363 | iso_pu_bacteria | 2856349417 | 2856355303 | 291 |
| 364 | iso_pu_bacteria | 2856356410 | 2856362539 | 291 |
| 365 | iso_pu_bacteria | 2857367948 | 2857370316 | 291 |
| 366 | iso_pu_bacteria | 2869242130 | 2869243431 | 291 |
| 367 | iso_pu_bacteria | 2869249662 | 2869250983 | 291 |
| 368 | iso_pu_bacteria | 2869256925 | 2869261233 | 291 |
| 369 | iso_pu_bacteria | 2869264136 | 2869264301 | 291 |
| 370 | iso_pu_bacteria | 2869271264 | 2869275052 | 291 |
| 371 | iso_pu_bacteria | 2869278585 | 2869282732 | 291 |
| 372 | iso_pu_bacteria | 2871451962 | 2871455929 | 291 |
| 373 | iso_pu_bacteria | 2871459585 | 2871460280 | 291 |
| 374 | iso_pu_bacteria | 2871474448 | 2871480063 | 291 |
| 375 | iso_pu_bacteria | 2871481445 | 2871483600 | 291 |
| 376 | iso_pu_bacteria | 2871488783 | 2871488858 | 291 |
| 377 | iso_pu_bacteria | 2871495908 | 2871496655 | 291 |
| 378 | iso_pu_bacteria | 2874116593 | 2874119895 | 291 |
| 379 | iso_pu_bacteria | 2874123672 | 2874131100 | 291 |
| 380 | iso_pu_bacteria | 2874131515 | 2874138248 | 291 |
| 381 | iso_pu_bacteria | 2874139085 | 2874142390 | 291 |
| 382 | iso_pu_bacteria | 2874162495 | 2874165064 | 291 |
| 383 | iso_pu_bacteria | 2874168670 | 2874169266 | 291 |
| 384 | iso_pu_bacteria | 2874620515 | 2874628210 | 291 |
| 385 | iso_pu_bacteria | 2874628541 | 2874630186 | 291 |
| 386 | iso_pu_bacteria | 2876363079 | 2876367518 | 291 |
| 387 | iso_pu_bacteria | 2876386047 | 2876386602 | 291 |
| 388 | iso_pu_bacteria | 2876392853 | 2876398304 | 291 |
| 389 | iso_pu_bacteria | 2876399893 | 2876404995 | 291 |
| 390 | iso_pu_bacteria | 2876420981 | 2876421538 | 291 |
| 391 | iso_pu_bacteria | 2876761206 | 2876768229 | 291 |
| 392 | iso_pu_bacteria | 2878738818 | 2878744425 | 291 |
| 393 | iso_pu_bacteria | 2878753008 | 2878753621 | 291 |
| 394 | iso_pu_bacteria | 2878760144 | 2878760882 | 291 |
| 395 | iso_pu_bacteria | 2878767105 | 2878767845 | 291 |
| 396 | iso_pu_bacteria | 2878774303 | 2878779778 | 291 |
| 397 | iso_pu_bacteria | 2878781027 | 2878785102 | 291 |
| 398 | iso_pu_bacteria | 2879083081 | 2879084871 | 291 |
| 399 | iso_pu_bacteria | 2879099564 | 2879107851 | 291 |
| 400 | iso_pu_bacteria | 2881147464 | 2881151187 | 291 |
| 401 | iso_pu_bacteria | 2881155292 | 2881156640 | 291 |
| 402 | iso_pu_bacteria | 2881161766 | 2881167391 | 291 |
| 403 | iso_pu_bacteria | 2881665667 | 2881670066 | 291 |
| 404 | iso_pu_bacteria | 2881845957 | 2881852506 | 291 |
| 405 | iso_pu_bacteria | 2881853255 | 2881857559 | 291 |
| 406 | iso_pu_bacteria | 2881861095 | 2881866910 | 291 |
| 407 | iso_pu_bacteria | 2882632389 | 2882633538 | 291 |
| 408 | iso_pu_bacteria | 2882912400 | 2882918140 | 291 |
| 409 | iso_pu_bacteria | 2885305155 | 2885309293 | 291 |
| 410 | iso_pu_bacteria | 2885312484 | 2885314507 | 291 |
| 411 | iso_pu_bacteria | 2885318864 | 2885323789 | 291 |
| 412 | iso_pu_bacteria | 2885326080 | 2885330337 | 291 |
| 413 | iso_pu_bacteria | 2885334103 | 2885339538 | 291 |
| 414 | iso_pu_bacteria | 2885342637 | 2885349012 | 291 |
| 415 | iso_pu_bacteria | 2885350715 | 2885354520 | 291 |
| 416 | iso_pu_bacteria | 2885383462 | 2885387781 | 291 |
| 417 | iso_pu_bacteria | 2885409591 | 2885413820 | 291 |
| 418 | iso_pu_bacteria | 2888337043 | 2888338400 | 291 |
| 419 | iso_pu_bacteria | 2888343758 | 2888344007 | 291 |
| 420 | iso_pu_bacteria | 2888378607 | 2888385600 | 291 |
| 421 | iso_pu_bacteria | 2888388044 | 2888392651 | 291 |
| 422 | iso_pu_bacteria | 2888419890 | 2888425728 | 291 |
| 423 | iso_pu_bacteria | 2889033259 | 2889037862 | 291 |
| 424 | iso_pu_bacteria | 2903448605 | 2903450298 | 291 |
| 425 | iso_pu_bacteria | 2903492973 | 2903495517 | 291 |
| 426 | iso_pu_bacteria | 2903513507 | 2903518072 | 291 |
| 427 | iso_pu_bacteria | 2903521522 | 2903521965 | 291 |
| 428 | iso_pu_bacteria | 2903528002 | 2903528342 | 291 |
| 429 | iso_pu_bacteria | 2903540706 | 2903541453 | 291 |
| 430 | iso_pu_bacteria | 2904659560 | 2904664859 | 291 |
| 431 | iso_pu_bacteria | 2904666416 | 2904674172 | 291 |
| 432 | iso_pu_bacteria | 2904711408 | 2904711825 | 291 |
| 433 | iso_pu_bacteria | 2906378014 | 2906381556 | 291 |
| 434 | iso_pu_bacteria | 2906393657 | 2906397940 | 291 |
| 435 | iso_pu_bacteria | 2906401398 | 2906407034 | 291 |
| 436 | iso_pu_bacteria | 2906408224 | 2906413671 | 291 |
| 437 | iso_pu_bacteria | 2906427513 | 2906427631 | 291 |
| 438 | iso_pu_bacteria | 2906626472 | 2906627736 | 291 |
| 439 | iso_pu_bacteria | 2908775508 | 2908781313 | 291 |
| 440 | iso_pu_bacteria | 2922151315 | 2922156727 | 291 |
| 441 | iso_pu_bacteria | 2922172374 | 2922172679 | 291 |
| 442 | iso_pu_bacteria | 2922361189 | 2922361810 | 291 |
| 443 | iso_pu_bacteria | 2922393267 | 2922396937 | 291 |
| 444 | iso_pu_bacteria | 2924718760 | 2924722549 | 291 |
| 445 | iso_pu_bacteria | 2924733363 | 2924734867 | 291 |
| 446 | iso_pu_bacteria | 2924741084 | 2924741643 | 291 |
| 447 | iso_pu_bacteria | 2924748358 | 2924750009 | 291 |
| 448 | iso_pu_bacteria | 2924754689 | 2924759774 | 291 |
| 449 | iso_pu_bacteria | 2924762789 | 2924769036 | 291 |
| 450 | iso_pu_bacteria | 2924776078 | 2924782455 | 291 |
| 451 | iso_pu_bacteria | 2924784321 | 2924790059 | 291 |
| 452 | iso_pu_bacteria | 2929615660 | 2929621169 | 291 |
| 453 | iso_pu_bacteria | 2929624759 | 2929626000 | 291 |
| 454 | iso_pu_bacteria | 2932784394 | 2932785122 | 291 |
| 455 | iso_pu_bacteria | 2932809354 | 2932810150 | 291 |
| 456 | iso_pu_bacteria | 2932818245 | 2932821723 | 291 |
| 457 | iso_pu_bacteria | 2932828146 | 2932828959 | 291 |
| 458 | iso_pu_bacteria | 2933577622 | 2933582962 | 291 |
| 459 | iso_pu_bacteria | 2935616580 | 2935619622 | 291 |
| 460 | iso_pu_bacteria | 2935638405 | 2935638602 | 291 |
| 461 | iso_pu_bacteria | 2935665750 | 2935666546 | 291 |
| 462 | iso_pu_bacteria | 2935675223 | 2935676411 | 291 |
| 463 | iso_pu_bacteria | 2935684952 | 2935691073 | 291 |
| 464 | iso_pu_bacteria | 2935694250 | 2935694493 | 291 |
| 465 | iso_pu_bacteria | 2935703347 | 2935703608 | 291 |
| 466 | iso_pu_bacteria | 2935713505 | 2935718454 | 291 |
| 467 | iso_pu_bacteria | 2935722832 | 2935727566 | 291 |
| 468 | iso_pu_bacteria | 2935732158 | 2935736269 | 291 |
| 469 | iso_pu_bacteria | 2935741537 | 2935745649 | 291 |
| 470 | iso_pu_bacteria | 2935750917 | 2935756030 | 291 |
| 471 | iso_pu_bacteria | 2935760218 | 2935760710 | 291 |
| 472 | iso_pu_bacteria | 2935769743 | 2935777121 | 291 |
| 473 | iso_pu_bacteria | 2935785616 | 2935793003 | 291 |
| 474 | iso_pu_bacteria | 2935793552 | 2935801032 | 291 |
| 475 | iso_pu_bacteria | 2935801545 | 2935801745 | 291 |
| 476 | iso_pu_bacteria | 2935810662 | 2935814839 | 291 |
| 477 | iso_pu_bacteria | 2935827899 | 2935828096 | 291 |
| 478 | iso_pu_bacteria | 2935837841 | 2935842301 | 291 |
| 479 | iso_pu_bacteria | 2935855204 | 2935858063 | 291 |
| 480 | iso_pu_bacteria | 2935864058 | 2935867967 | 291 |
| 481 | iso_pu_bacteria | 2935873716 | 2935874009 | 291 |
| 482 | iso_pu_bacteria | 2935992306 | 2935993066 | 291 |
| 483 | iso_pu_bacteria | 2936002035 | 2936002978 | 291 |
| 484 | iso_pu_bacteria | 2936037263 | 2936040518 | 291 |
| 485 | iso_pu_bacteria | 2937822353 | 2937822856 | 291 |
| 486 | iso_pu_bacteria | 2937836603 | 2937836730 | 291 |
| 487 | iso_pu_bacteria | 2937861824 | 2937868811 | 291 |
| 488 | iso_pu_bacteria | 2937868953 | 2937870464 | 291 |
| 489 | iso_pu_bacteria | 2937877337 | 2937881096 | 291 |
| 490 | iso_pu_bacteria | 2937972304 | 2937977190 | 291 |
| 491 | iso_pu_bacteria | 2937980651 | 2937987072 | 291 |
| 492 | iso_pu_bacteria | 2937994558 | 2937995309 | 291 |
| 493 | iso_pu_bacteria | 2940556831 | 2940561995 | 291 |
| 494 | iso_pu_bacteria | 2941538514 | 2941542350 | 291 |
| 495 | iso_pu_bacteria | 2958034702 | 2958039515 | 291 |
| 496 | iso_pu_bacteria | 2958041894 | 2958052856 | 291 |
| 497 | iso_pu_bacteria | 2958071322 | 2958076097 | 291 |
| 498 | iso_pu_bacteria | 2958084443 | 2958088347 | 291 |
| 499 | iso_pu_bacteria | 2958092219 | 2958094076 | 291 |
| 500 | iso_pu_bacteria | 2958122699 | 2958128690 | 291 |
| 501 | iso_pu_bacteria | 2958137437 | 2958141941 | 291 |
| 502 | iso_pu_bacteria | 2958144490 | 2958145497 | 291 |
| 503 | iso_pu_bacteria | 2958158011 | 2958158580 | 291 |
| 504 | iso_pu_bacteria | 2958165035 | 2958165785 | 291 |
| 505 | iso_pu_bacteria | 2961114664 | 2961119858 | 291 |
| 506 | iso_pu_bacteria | 2961163497 | 2961164244 | 291 |
| 507 | iso_pu_bacteria | 2961170736 | 2961170811 | 291 |
| 508 | iso_pu_bacteria | 2961183825 | 2961189011 | 291 |
| 509 | iso_pu_bacteria | 2963644680 | 2963646755 | 291 |
| 510 | iso_pu_bacteria | 2965018300 | 2965019233 | 291 |
| 511 | iso_pu_bacteria | 2965025482 | 2965025975 | 291 |
| 512 | iso_pu_bacteria | 2965032056 | 2965034083 | 291 |
| 513 | iso_pu_bacteria | 2965040258 | 2965047021 | 291 |
| 514 | iso_pu_bacteria | 2965047637 | 2965053131 | 291 |
| 515 | iso_pu_bacteria | 2965110997 | 2965114709 | 291 |
| 516 | iso_pu_bacteria | 2967996073 | 2968003390 | 291 |
| 517 | iso_pu_bacteria | 2968003550 | 2968004157 | 291 |
| 518 | iso_pu_bacteria | 2968016561 | 2968020842 | 291 |
| 519 | iso_pu_bacteria | 2968083720 | 2968090454 | 291 |
| 520 | iso_pu_bacteria | 2968110612 | 2968116215 | 291 |
| 521 | iso_pu_bacteria | 2968138860 | 2968142174 | 291 |
| 522 | iso_pu_bacteria | 2968171901 | 2968172644 | 291 |
| 523 | iso_pu_bacteria | 2970469710 | 2970474139 | 291 |
| 524 | iso_pu_bacteria | 2970489779 | 2970493348 | 291 |
| 525 | iso_pu_bacteria | 2970503327 | 2970503401 | 291 |
| 526 | iso_pu_bacteria | 2970510686 | 2970512774 | 291 |
| 527 | iso_pu_bacteria | 2970524798 | 2970525711 | 291 |
| 528 | iso_pu_bacteria | 2970532167 | 2970532946 | 291 |
| 529 | iso_pu_bacteria | 2970540015 | 2970542497 | 291 |
| 530 | iso_pu_bacteria | 2970547951 | 2970551669 | 291 |
| 531 | iso_pu_bacteria | 2970554993 | 2970555737 | 291 |
| 532 | iso_pu_bacteria | 2970593180 | 2970597341 | 291 |
| 533 | iso_pu_bacteria | 2970619444 | 2970622660 | 291 |
| 534 | iso_pu_bacteria | 2970627176 | 2970630056 | 291 |
| 535 | iso_pu_bacteria | 2977821940 | 2977822838 | 291 |
| 536 | iso_pu_bacteria | 2977828996 | 2977833448 | 291 |
| 537 | iso_pu_bacteria | 2977851361 | 2977856524 | 291 |
| 538 | iso_pu_bacteria | 2977864932 | 2977870735 | 291 |
| 539 | iso_pu_bacteria | 2977872689 | 2977873195 | 291 |
| 540 | iso_pu_bacteria | 2977915119 | 2977916569 | 291 |
| 541 | iso_pu_bacteria | 2977935797 | 2977942065 | 291 |
| 542 | iso_pu_bacteria | 2977950692 | 2977954215 | 291 |
| 543 | iso_pu_bacteria | 2977957713 | 2977962971 | 291 |
| 544 | iso_pu_bacteria | 2979772303 | 2979774629 | 291 |
| 545 | iso_pu_bacteria | 2979793036 | 2979798065 | 291 |
| 546 | iso_pu_bacteria | 2979808191 | 2979815630 | 291 |
| 547 | iso_pu_bacteria | 2987659509 | 2987660250 | 291 |
| 548 | iso_pu_bacteria | 2987666974 | 2987672889 | 291 |
| 549 | iso_pu_bacteria | 2987673487 | 2987678258 | 291 |
| 550 | iso_pu_bacteria | 2996348954 | 2996352540 | 291 |
| 551 | iso_pu_bacteria | 2996386984 | 2996388848 | 291 |
| 552 | iso_pu_bacteria | 3004167301 | 3004168247 | 291 |
| 553 | iso_pu_bacteria | 3004188549 | 3004189299 | 291 |
| 554 | iso_pu_bacteria | 3004248173 | 3004251337 | 291 |
| 555 | iso_pu_bacteria | 3004268573 | 3004268745 | 291 |
| 556 | iso_pu_bacteria | 3004275668 | 3004279222 | 291 |
| 557 | iso_pu_bacteria | 3004334049 | 3004335632 | 291 |
| 558 | iso_pu_bacteria | 3005474847 | 3005481415 | 291 |
| 559 | iso_pu_bacteria | 3005483717 | 3005485534 | 291 |
| 560 | iso_pu_bacteria | 3005587118 | 3005588197 | 291 |
| 561 | iso_pu_bacteria | 637000159 | 637075546 | 291 |
| 562 | iso_pu_bacteria | 649633066 | 649872505 | 291 |
| 563 | iso_pu_bacteria | 8004300914 | 8004302941 | 291 |
| 564 | iso_pu_bacteria | 8004361976 | 8004366607 | 291 |
| 565 | iso_pu_bacteria | 8004374579 | 8004375194 | 291 |
| 566 | iso_pu_bacteria | 8004633249 | 8004634030 | 291 |
| 567 | iso_pu_bacteria | 8004695233 | 8004702349 | 291 |
| 568 | iso_pu_bacteria | 8004727605 | 8004728785 | 291 |
| 569 | iso_pu_bacteria | 8006984368 | 8006984574 | 291 |
| 570 | iso_pu_bacteria | 8016511872 | 8016520503 | 291 |
| 571 | iso_pu_bacteria | 8016530956 | 8016533719 | 291 |
| 572 | iso_pu_bacteria | 8016548790 | 8016555179 | 291 |
| 573 | iso_pu_bacteria | 8016557553 | 8016563548 | 291 |
| 574 | iso_pu_bacteria | 8016575299 | 8016576248 | 291 |
| 575 | iso_pu_bacteria | 8016583857 | 8016594518 | 291 |
| 576 | iso_pu_bacteria | 8016595262 | 8016601284 | 291 |
| 577 | iso_pu_bacteria | 8017057580 | 8017065072 | 291 |
| 578 | iso_pu_bacteria | 8019530166 | 8019533495 | 291 |
| 579 | iso_pu_bacteria | 8019576017 | 8019584455 | 291 |
| 580 | iso_pu_bacteria | 8019586578 | 8019592229 | 291 |
| 581 | iso_pu_bacteria | 8019608314 | 8019609309 | 291 |
| 582 | iso_pu_bacteria | 8055617313 | 8055617524 | 291 |
| 583 | iso_pu_bacteria | 8055742211 | 8055744969 | 291 |
| 584 | iso_pu_bacteria | 8056673599 | 8056680966 | 291 |
| 585 | 3300005467 | Ga0070706_100131498 | Ga0070706_1001314981 | 292 |
| 586 | 3300005518 | Ga0070699_100130139 | Ga0070699_1001301392 | 292 |
| 587 | 3300021361 | Ga0213872_10068402 | Ga0213872_100684022 | 292 |
| 588 | 3300031730 | Ga0307516_10091312 | Ga0307516_100913125 | 292 |
| 589 | 3300039447 | Ga0436361_0285992 | Ga0436361_0285992_912_1814 | 292 |
| 590 | 3300048924 | Ga0496121_0000230 | Ga0496121_0000230_21784_22674 | 292 |
| 591 | iso_pu_bacteria | 2510461069 | 2510839697 | 292 |
| 592 | iso_pu_bacteria | 2513237096 | 2513661771 | 292 |
| 593 | iso_pu_bacteria | 2513237144 | 2513910753 | 292 |
| 594 | iso_pu_bacteria | 2513237145 | 2513923418 | 292 |
| 595 | iso_pu_bacteria | 2513237146 | 2513927271 | 292 |
| 596 | iso_pu_bacteria | 2517572143 | 2517891200 | 292 |
| 597 | iso_pu_bacteria | 2558860983 | 2561467420 | 292 |
| 598 | iso_pu_bacteria | 2599185170 | 2599415288 | 292 |
| 599 | iso_pu_bacteria | 2600254933 | 2600376363 | 292 |
| 600 | iso_pu_bacteria | 2643221653 | 2644297578 | 292 |
| 601 | iso_pu_bacteria | 2643221719 | 2644655831 | 292 |
| 602 | iso_pu_bacteria | 2643221734 | 2644734624 | 292 |
| 603 | iso_pu_bacteria | 2667528175 | 2671123193 | 292 |
| 604 | iso_pu_bacteria | 2775507049 | 2776910522 | 292 |
| 605 | iso_pu_bacteria | 2838035591 | 2838038987 | 292 |
| 606 | iso_pu_bacteria | 2838661181 | 2838664421 | 292 |
| 607 | iso_pu_bacteria | 2851182111 | 2851186955 | 292 |
| 608 | iso_pu_bacteria | 2885374607 | 2885382931 | 292 |
| 609 | iso_pu_bacteria | 2903748898 | 2903749678 | 292 |
| 610 | iso_pu_bacteria | 2904690495 | 2904698889 | 292 |
| 611 | iso_pu_bacteria | 2906635258 | 2906638162 | 292 |
| 612 | iso_pu_bacteria | 2906660503 | 2906662837 | 292 |
| 613 | iso_pu_bacteria | 2908739725 | 2908741520 | 292 |
| 614 | iso_pu_bacteria | 2917699015 | 2917704073 | 292 |
| 615 | iso_pu_bacteria | 2933016740 | 2933017889 | 292 |
| 616 | iso_pu_bacteria | 2935630451 | 2935635825 | 292 |
| 617 | iso_pu_bacteria | 2937848649 | 2937851905 | 292 |
| 618 | iso_pu_bacteria | 2941507105 | 2941512338 | 292 |
| 619 | iso_pu_bacteria | 2941515067 | 2941520157 | 292 |
| 620 | iso_pu_bacteria | 2941523033 | 2941528306 | 292 |
| 621 | iso_pu_bacteria | 2977922695 | 2977925049 | 292 |
| 622 | iso_pu_bacteria | 2977986579 | 2977988206 | 292 |
| 623 | iso_pu_bacteria | 2989776772 | 2989777481 | 292 |
| 624 | iso_pu_bacteria | 3004211236 | 3004218160 | 292 |
| 625 | iso_pu_bacteria | 3004218560 | 3004220793 | 292 |
| 626 | iso_pu_bacteria | 3005445848 | 3005450913 | 292 |
| 627 | iso_pu_bacteria | 8005246636 | 8005250049 | 292 |
| 628 | iso_pu_bacteria | 8006933436 | 8006939297 | 292 |
| 629 | iso_pu_bacteria | 8006973647 | 8006978954 | 292 |
| 630 | iso_pu_bacteria | 8056689827 | 8056690654 | 292 |
| 631 | 3300003215 | JGI25153J46596_10014527 | JGI25153J46596_100145272 | 293 |
| 632 | 3300003794 | Ga0055531_10010658 | Ga0055531_100106583 | 293 |
| 633 | 3300005262 | Ga0065165_1010313 | Ga0065165_10103132 | 293 |
| 634 | 3300005365 | Ga0070688_100111268 | Ga0070688_1001112682 | 293 |
| 635 | 3300005367 | Ga0070667_100377141 | Ga0070667_1003771411 | 293 |
| 636 | 3300005539 | Ga0068853_100195167 | Ga0068853_1001951672 | 293 |
| 637 | 3300005563 | Ga0068855_100381886 | Ga0068855_1003818862 | 293 |
| 638 | 3300005618 | Ga0068864_100519544 | Ga0068864_1005195442 | 293 |
| 639 | 3300005937 | Ga0081455_10048637 | Ga0081455_100486374 | 293 |
| 640 | 3300006028 | Ga0070717_10381551 | Ga0070717_103815511 | 293 |
| 641 | 3300006173 | Ga0070716_100220925 | Ga0070716_1002209252 | 293 |
| 642 | 3300006186 | Ga0075369_10121883 | Ga0075369_101218831 | 293 |
| 643 | 3300009098 | Ga0105245_10006247 | Ga0105245_1000624711 | 293 |
| 644 | 3300009545 | Ga0105237_10073940 | Ga0105237_100739405 | 293 |
| 645 | 3300009551 | Ga0105238_10068422 | Ga0105238_100684223 | 293 |
| 646 | 3300010159 | Ga0099796_10016009 | Ga0099796_100160092 | 293 |
| 647 | 3300011119 | Ga0105246_10052627 | Ga0105246_100526272 | 293 |
| 648 | 3300025291 | Ga0209675_1023374 | Ga0209675_10233742 | 293 |
| 649 | 3300025295 | Ga0209564_1005137 | Ga0209564_10051372 | 293 |
| 650 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011457 | 293 |
| 651 | 3300025299 | Ga0209256_1005504 | Ga0209256_10055046 | 293 |
| 652 | 3300025303 | Ga0209051_1037393 | Ga0209051_10373932 | 293 |
| 653 | 3300025304 | Ga0209257_1000654 | Ga0209257_100065428 | 293 |
| 654 | 3300025900 | Ga0207710_10117633 | Ga0207710_101176332 | 293 |
| 655 | 3300025914 | Ga0207671_10008285 | Ga0207671_100082855 | 293 |
| 656 | 3300025915 | Ga0207693_10087797 | Ga0207693_100877972 | 293 |
| 657 | 3300025924 | Ga0207694_10047057 | Ga0207694_100470572 | 293 |
| 658 | 3300025927 | Ga0207687_10009010 | Ga0207687_100090104 | 293 |
| 659 | 3300025934 | Ga0207686_10129469 | Ga0207686_101294692 | 293 |
| 660 | 3300025941 | Ga0207711_10187050 | Ga0207711_101870502 | 293 |
| 661 | 3300037471 | Ga0395905_0010005 | Ga0395905_0010005_7827_8717 | 293 |
| 662 | 3300048903 | Ga0496100_0246446 | Ga0496100_0246446_350_1240 | 293 |
| 663 | 3300048904 | Ga0496101_0293806 | Ga0496101_0293806_204_1094 | 293 |
| 664 | 3300048924 | Ga0496121_0028245 | Ga0496121_0028245_851_1732 | 293 |
| 665 | 3300048928 | Ga0496125_0050643 | Ga0496125_0050643_468_1349 | 293 |
| 666 | 3300049573 | Ga0501037_0165632 | Ga0501037_0165632_571_1461 | 293 |
| 667 | 3300053156 | Ga0500622_0013905 | Ga0500622_0013905_2759_3640 | 293 |
| 668 | iso_pu_bacteria | 2509276021 | 2509390913 | 293 |
| 669 | iso_pu_bacteria | 2509276033 | 2509445345 | 293 |
| 670 | iso_pu_bacteria | 2510065019 | 2510137532 | 293 |
| 671 | iso_pu_bacteria | 2510461076 | 2510893428 | 293 |
| 672 | iso_pu_bacteria | 2510917022 | 2511133404 | 293 |
| 673 | iso_pu_bacteria | 2510917026 | 2511170525 | 293 |
| 674 | iso_pu_bacteria | 2510917028 | 2511184971 | 293 |
| 675 | iso_pu_bacteria | 2513237084 | 2513573914 | 293 |
| 676 | iso_pu_bacteria | 2513237085 | 2513575910 | 293 |
| 677 | iso_pu_bacteria | 2513237093 | 2513633657 | 293 |
| 678 | iso_pu_bacteria | 2513237103 | 2513712246 | 293 |
| 679 | iso_pu_bacteria | 2513237162 | 2514019120 | 293 |
| 680 | iso_pu_bacteria | 2515075009 | 2515109603 | 293 |
| 681 | iso_pu_bacteria | 2515154113 | 2515634368 | 293 |
| 682 | iso_pu_bacteria | 2515154114 | 2515641753 | 293 |
| 683 | iso_pu_bacteria | 2515154116 | 2515658979 | 293 |
| 684 | iso_pu_bacteria | 2515154134 | 2515742678 | 293 |
| 685 | iso_pu_bacteria | 2516653077 | 2517042670 | 293 |
| 686 | iso_pu_bacteria | 2516653085 | 2517081367 | 293 |
| 687 | iso_pu_bacteria | 2517093000 | 2517100250 | 293 |
| 688 | iso_pu_bacteria | 2517287029 | 2517411139 | 293 |
| 689 | iso_pu_bacteria | 2519899620 | 2520377525 | 293 |
| 690 | iso_pu_bacteria | 2529292951 | 2530648676 | 293 |
| 691 | iso_pu_bacteria | 2537561587 | 2537873084 | 293 |
| 692 | iso_pu_bacteria | 2554235003 | 2554245068 | 293 |
| 693 | iso_pu_bacteria | 2558860242 | 2559297101 | 293 |
| 694 | iso_pu_bacteria | 2582581283 | 2585167114 | 293 |
| 695 | iso_pu_bacteria | 2582581299 | 2585227740 | 293 |
| 696 | iso_pu_bacteria | 2582581304 | 2585255594 | 293 |
| 697 | iso_pu_bacteria | 2582581307 | 2585276726 | 293 |
| 698 | iso_pu_bacteria | 2582581316 | 2585332855 | 293 |
| 699 | iso_pu_bacteria | 2582581867 | 2585402541 | 293 |
| 700 | iso_pu_bacteria | 2585427526 | 2585526454 | 293 |
| 701 | iso_pu_bacteria | 2585427528 | 2585538708 | 293 |
| 702 | iso_pu_bacteria | 2585427531 | 2585562700 | 293 |
| 703 | iso_pu_bacteria | 2585427590 | 2585820535 | 293 |
| 704 | iso_pu_bacteria | 2585427593 | 2585836661 | 293 |
| 705 | iso_pu_bacteria | 2585427594 | 2585847677 | 293 |
| 706 | iso_pu_bacteria | 2585427608 | 2585899340 | 293 |
| 707 | iso_pu_bacteria | 2585427609 | 2585908743 | 293 |
| 708 | iso_pu_bacteria | 2585427633 | 2585997436 | 293 |
| 709 | iso_pu_bacteria | 2585427634 | 2586002042 | 293 |
| 710 | iso_pu_bacteria | 2585428125 | 2587984160 | 293 |
| 711 | iso_pu_bacteria | 2599185210 | 2599604934 | 293 |
| 712 | iso_pu_bacteria | 2600255279 | 2601611058 | 293 |
| 713 | iso_pu_bacteria | 2600255308 | 2601747831 | 293 |
| 714 | iso_pu_bacteria | 2615840624 | 2616294900 | 293 |
| 715 | iso_pu_bacteria | 2615840698 | 2616552205 | 293 |
| 716 | iso_pu_bacteria | 2643221568 | 2643858014 | 293 |
| 717 | iso_pu_bacteria | 2643221582 | 2643916736 | 293 |
| 718 | iso_pu_bacteria | 2643221634 | 2644195811 | 293 |
| 719 | iso_pu_bacteria | 2643221643 | 2644241020 | 293 |
| 720 | iso_pu_bacteria | 2643221689 | 2644497448 | 293 |
| 721 | iso_pu_bacteria | 2643221693 | 2644521344 | 293 |
| 722 | iso_pu_bacteria | 2667528174 | 2671116744 | 293 |
| 723 | iso_pu_bacteria | 2718217882 | 2719184933 | 293 |
| 724 | iso_pu_bacteria | 2718217927 | 2719389884 | 293 |
| 725 | iso_pu_bacteria | 2718217997 | 2719668934 | 293 |
| 726 | iso_pu_bacteria | 2718218009 | 2719728953 | 293 |
| 727 | iso_pu_bacteria | 2718218199 | 2720489627 | 293 |
| 728 | iso_pu_bacteria | 2718218232 | 2720610347 | 293 |
| 729 | iso_pu_bacteria | 2718218233 | 2720617766 | 293 |
| 730 | iso_pu_bacteria | 2718218235 | 2720628908 | 293 |
| 731 | iso_pu_bacteria | 2718218269 | 2720772857 | 293 |
| 732 | iso_pu_bacteria | 2718218363 | 2721144644 | 293 |
| 733 | iso_pu_bacteria | 2718218365 | 2721156149 | 293 |
| 734 | iso_pu_bacteria | 2718218366 | 2721162014 | 293 |
| 735 | iso_pu_bacteria | 2718218423 | 2721403523 | 293 |
| 736 | iso_pu_bacteria | 2721755514 | 2722843159 | 293 |
| 737 | iso_pu_bacteria | 2721755556 | 2723030301 | 293 |
| 738 | iso_pu_bacteria | 2721755684 | 2723564662 | 293 |
| 739 | iso_pu_bacteria | 2721755685 | 2723569652 | 293 |
| 740 | iso_pu_bacteria | 2721755809 | 2724035099 | 293 |
| 741 | iso_pu_bacteria | 2721755810 | 2724041978 | 293 |
| 742 | iso_pu_bacteria | 2721755819 | 2724092886 | 293 |
| 743 | iso_pu_bacteria | 2721755822 | 2724101199 | 293 |
| 744 | iso_pu_bacteria | 2721755823 | 2724113274 | 293 |
| 745 | iso_pu_bacteria | 2724679232 | 2725950896 | 293 |
| 746 | iso_pu_bacteria | 2728369352 | 2730110834 | 293 |
| 747 | iso_pu_bacteria | 2728369365 | 2730161048 | 293 |
| 748 | iso_pu_bacteria | 2728369397 | 2730295682 | 293 |
| 749 | iso_pu_bacteria | 2738541293 | 2738799935 | 293 |
| 750 | iso_pu_bacteria | 2738541333 | 2739034131 | 293 |
| 751 | iso_pu_bacteria | 2765235942 | 2766068203 | 293 |
| 752 | iso_pu_bacteria | 2775507266 | 2778178917 | 293 |
| 753 | iso_pu_bacteria | 2791355256 | 2793297345 | 293 |
| 754 | iso_pu_bacteria | 2791355259 | 2793317758 | 293 |
| 755 | iso_pu_bacteria | 2791355260 | 2793324435 | 293 |
| 756 | iso_pu_bacteria | 2791355261 | 2793328028 | 293 |
| 757 | iso_pu_bacteria | 2791355262 | 2793334151 | 293 |
| 758 | iso_pu_bacteria | 2791355263 | 2793340752 | 293 |
| 759 | iso_pu_bacteria | 2791355264 | 2793345821 | 293 |
| 760 | iso_pu_bacteria | 2791355265 | 2793354546 | 293 |
| 761 | iso_pu_bacteria | 2791355266 | 2793361840 | 293 |
| 762 | iso_pu_bacteria | 2791355267 | 2793367363 | 293 |
| 763 | iso_pu_bacteria | 2802429605 | 2805930196 | 293 |
| 764 | iso_pu_bacteria | 2802429606 | 2805934779 | 293 |
| 765 | iso_pu_bacteria | 2802429633 | 2806042928 | 293 |
| 766 | iso_pu_bacteria | 2802429634 | 2806050881 | 293 |
| 767 | iso_pu_bacteria | 2802429635 | 2806057951 | 293 |
| 768 | iso_pu_bacteria | 2802429636 | 2806065336 | 293 |
| 769 | iso_pu_bacteria | 2802429637 | 2806076819 | 293 |
| 770 | iso_pu_bacteria | 2808606387 | 2808988938 | 293 |
| 771 | iso_pu_bacteria | 2818991272 | 2819243340 | 293 |
| 772 | iso_pu_bacteria | 2818991439 | 2819561180 | 293 |
| 773 | iso_pu_bacteria | 2818991448 | 2819610119 | 293 |
| 774 | iso_pu_bacteria | 2821123053 | 2821128962 | 293 |
| 775 | iso_pu_bacteria | 2838016132 | 2838016982 | 293 |
| 776 | iso_pu_bacteria | 2838022645 | 2838027467 | 293 |
| 777 | iso_pu_bacteria | 2838029111 | 2838030641 | 293 |
| 778 | iso_pu_bacteria | 2838048938 | 2838050197 | 293 |
| 779 | iso_pu_bacteria | 2838061910 | 2838062309 | 293 |
| 780 | iso_pu_bacteria | 2838068647 | 2838069318 | 293 |
| 781 | iso_pu_bacteria | 2838668709 | 2838673087 | 293 |
| 782 | iso_pu_bacteria | 2838675328 | 2838678449 | 293 |
| 783 | iso_pu_bacteria | 2838680041 | 2838686140 | 293 |
| 784 | iso_pu_bacteria | 2838686498 | 2838688384 | 293 |
| 785 | iso_pu_bacteria | 2838694306 | 2838700489 | 293 |
| 786 | iso_pu_bacteria | 2838701080 | 2838705709 | 293 |
| 787 | iso_pu_bacteria | 2838707686 | 2838713768 | 293 |
| 788 | iso_pu_bacteria | 2838714209 | 2838716643 | 293 |
| 789 | iso_pu_bacteria | 2838719591 | 2838722745 | 293 |
| 790 | iso_pu_bacteria | 2838724970 | 2838727394 | 293 |
| 791 | iso_pu_bacteria | 2838729681 | 2838734481 | 293 |
| 792 | iso_pu_bacteria | 2838736955 | 2838742277 | 293 |
| 793 | iso_pu_bacteria | 2838742623 | 2838746940 | 293 |
| 794 | iso_pu_bacteria | 2841840854 | 2841846133 | 293 |
| 795 | iso_pu_bacteria | 2841846520 | 2841849012 | 293 |
| 796 | iso_pu_bacteria | 2841851746 | 2841852125 | 293 |
| 797 | iso_pu_bacteria | 2841859092 | 2841861967 | 293 |
| 798 | iso_pu_bacteria | 2841864319 | 2841865753 | 293 |
| 799 | iso_pu_bacteria | 2842077413 | 2842083079 | 293 |
| 800 | iso_pu_bacteria | 2842110456 | 2842111597 | 293 |
| 801 | iso_pu_bacteria | 2842118031 | 2842124113 | 293 |
| 802 | iso_pu_bacteria | 2842124991 | 2842128239 | 293 |
| 803 | iso_pu_bacteria | 2842130223 | 2842133342 | 293 |
| 804 | iso_pu_bacteria | 2842140634 | 2842145837 | 293 |
| 805 | iso_pu_bacteria | 2842152218 | 2842155335 | 293 |
| 806 | iso_pu_bacteria | 2842156927 | 2842158800 | 293 |
| 807 | iso_pu_bacteria | 2842163707 | 2842166229 | 293 |
| 808 | iso_pu_bacteria | 2842170452 | 2842173835 | 293 |
| 809 | iso_pu_bacteria | 2842175837 | 2842178956 | 293 |
| 810 | iso_pu_bacteria | 2842180545 | 2842182414 | 293 |
| 811 | iso_pu_bacteria | 2842187318 | 2842189751 | 293 |
| 812 | iso_pu_bacteria | 2842192696 | 2842196662 | 293 |
| 813 | iso_pu_bacteria | 2842198810 | 2842203007 | 293 |
| 814 | iso_pu_bacteria | 2842205361 | 2842209198 | 293 |
| 815 | iso_pu_bacteria | 2842211629 | 2842214065 | 293 |
| 816 | iso_pu_bacteria | 2842217011 | 2842222447 | 293 |
| 817 | iso_pu_bacteria | 2842224351 | 2842226785 | 293 |
| 818 | iso_pu_bacteria | 2842229732 | 2842234573 | 293 |
| 819 | iso_pu_bacteria | 2842237096 | 2842243181 | 293 |
| 820 | iso_pu_bacteria | 2842243621 | 2842248306 | 293 |
| 821 | iso_pu_bacteria | 2842250916 | 2842255389 | 293 |
| 822 | iso_pu_bacteria | 2842257432 | 2842262521 | 293 |
| 823 | iso_pu_bacteria | 2842264693 | 2842268568 | 293 |
| 824 | iso_pu_bacteria | 2842271015 | 2842272666 | 293 |
| 825 | iso_pu_bacteria | 2842278818 | 2842282756 | 293 |
| 826 | iso_pu_bacteria | 2842291075 | 2842297338 | 293 |
| 827 | iso_pu_bacteria | 2842304105 | 2842307893 | 293 |
| 828 | iso_pu_bacteria | 2842311132 | 2842312855 | 293 |
| 829 | iso_pu_bacteria | 2842317721 | 2842320437 | 293 |
| 830 | iso_pu_bacteria | 2842341865 | 2842345703 | 293 |
| 831 | iso_pu_bacteria | 2842363717 | 2842363999 | 293 |
| 832 | iso_pu_bacteria | 2842370503 | 2842376241 | 293 |
| 833 | iso_pu_bacteria | 2842377471 | 2842383732 | 293 |
| 834 | iso_pu_bacteria | 2842384541 | 2842390871 | 293 |
| 835 | iso_pu_bacteria | 2842402390 | 2842405590 | 293 |
| 836 | iso_pu_bacteria | 2842409023 | 2842412174 | 293 |
| 837 | iso_pu_bacteria | 2842415677 | 2842418820 | 293 |
| 838 | iso_pu_bacteria | 2842422224 | 2842422509 | 293 |
| 839 | iso_pu_bacteria | 2842428310 | 2842432540 | 293 |
| 840 | iso_pu_bacteria | 2842434925 | 2842438844 | 293 |
| 841 | iso_pu_bacteria | 2842441272 | 2842445319 | 293 |
| 842 | iso_pu_bacteria | 2842447887 | 2842449671 | 293 |
| 843 | iso_pu_bacteria | 2842462802 | 2842466483 | 293 |
| 844 | iso_pu_bacteria | 2842469257 | 2842473459 | 293 |
| 845 | iso_pu_bacteria | 2842475841 | 2842477078 | 293 |
| 846 | iso_pu_bacteria | 2842482326 | 2842485689 | 293 |
| 847 | iso_pu_bacteria | 2842489311 | 2842489397 | 293 |
| 848 | iso_pu_bacteria | 2842495871 | 2842497944 | 293 |
| 849 | iso_pu_bacteria | 2842502639 | 2842503875 | 293 |
| 850 | iso_pu_bacteria | 2842515876 | 2842517767 | 293 |
| 851 | iso_pu_bacteria | 2844454524 | 2844461564 | 293 |
| 852 | iso_pu_bacteria | 2854896431 | 2854901513 | 293 |
| 853 | iso_pu_bacteria | 2854916844 | 2854921310 | 293 |
| 854 | iso_pu_bacteria | 2857516855 | 2857520614 | 293 |
| 855 | iso_pu_bacteria | 2857531043 | 2857536381 | 293 |
| 856 | iso_pu_bacteria | 2899792073 | 2899794750 | 293 |
| 857 | iso_pu_bacteria | 2899803654 | 2899804370 | 293 |
| 858 | iso_pu_bacteria | 2899845264 | 2899845297 | 293 |
| 859 | iso_pu_bacteria | 2919114240 | 2919116860 | 293 |
| 860 | iso_pu_bacteria | 2919166419 | 2919171022 | 293 |
| 861 | iso_pu_bacteria | 2919171160 | 2919173732 | 293 |
| 862 | iso_pu_bacteria | 2919408235 | 2919413889 | 293 |
| 863 | iso_pu_bacteria | 2923556063 | 2923562006 | 293 |
| 864 | iso_pu_bacteria | 2926754445 | 2926758373 | 293 |
| 865 | iso_pu_bacteria | 2926760298 | 2926764068 | 293 |
| 866 | iso_pu_bacteria | 2929138655 | 2929142991 | 293 |
| 867 | iso_pu_bacteria | 2933006813 | 2933009286 | 293 |
| 868 | iso_pu_bacteria | 2933011516 | 2933013396 | 293 |
| 869 | iso_pu_bacteria | 2933570622 | 2933574344 | 293 |
| 870 | iso_pu_bacteria | 2933586486 | 2933590803 | 293 |
| 871 | iso_pu_bacteria | 2933594066 | 2933598267 | 293 |
| 872 | iso_pu_bacteria | 2933599457 | 2933599982 | 293 |
| 873 | iso_pu_bacteria | 2935894831 | 2935900806 | 293 |
| 874 | iso_pu_bacteria | 2935901341 | 2935907911 | 293 |
| 875 | iso_pu_bacteria | 2936367885 | 2936370773 | 293 |
| 876 | iso_pu_bacteria | 2936381700 | 2936382455 | 293 |
| 877 | iso_pu_bacteria | 2978969890 | 2978970453 | 293 |
| 878 | iso_pu_bacteria | 2979089926 | 2979090834 | 293 |
| 879 | iso_pu_bacteria | 2979095461 | 2979096359 | 293 |
| 880 | iso_pu_bacteria | 2979100975 | 2979101924 | 293 |
| 881 | iso_pu_bacteria | 2984509177 | 2984510138 | 293 |
| 882 | iso_pu_bacteria | 2984518228 | 2984519159 | 293 |
| 883 | iso_pu_bacteria | 2984537506 | 2984538479 | 293 |
| 884 | iso_pu_bacteria | 2984587000 | 2984587484 | 293 |
| 885 | iso_pu_bacteria | 2984601300 | 2984605201 | 293 |
| 886 | iso_pu_bacteria | 2996887358 | 2996887806 | 293 |
| 887 | iso_pu_bacteria | 2996893221 | 2996897260 | 293 |
| 888 | iso_pu_bacteria | 3003930520 | 3003933859 | 293 |
| 889 | iso_pu_bacteria | 3005416602 | 3005417232 | 293 |
| 890 | iso_pu_bacteria | 639633055 | 639650936 | 293 |
| 891 | iso_pu_bacteria | 650716007 | 650843528 | 293 |
| 892 | iso_pu_bacteria | 8003570095 | 8003573203 | 293 |
| 893 | iso_pu_bacteria | 8005258706 | 8005259152 | 293 |
| 894 | iso_pu_bacteria | 8005275841 | 8005276007 | 293 |
| 895 | iso_pu_bacteria | 8005282627 | 8005285919 | 293 |
| 896 | iso_pu_bacteria | 8005289223 | 8005295349 | 293 |
| 897 | iso_pu_bacteria | 8005301065 | 8005307289 | 293 |
| 898 | iso_pu_bacteria | 8005307578 | 8005311967 | 293 |
| 899 | iso_pu_bacteria | 8005314921 | 8005320519 | 293 |
| 900 | iso_pu_bacteria | 8005321885 | 8005322333 | 293 |
| 901 | iso_pu_bacteria | 8005382845 | 8005382962 | 293 |
| 902 | iso_pu_bacteria | 8005395548 | 8005398561 | 293 |
| 903 | iso_pu_bacteria | 8005430974 | 8005433501 | 293 |
| 904 | iso_pu_bacteria | 8005460587 | 8005466129 | 293 |
| 905 | iso_pu_bacteria | 8005484373 | 8005487488 | 293 |
| 906 | iso_pu_bacteria | 8005497431 | 8005502074 | 293 |
| 907 | iso_pu_bacteria | 8005556819 | 8005563077 | 293 |
| 908 | iso_pu_bacteria | 8005563573 | 8005564925 | 293 |
| 909 | iso_pu_bacteria | 8005570704 | 8005575781 | 293 |
| 910 | iso_pu_bacteria | 8005619151 | 8005624367 | 293 |
| 911 | iso_pu_bacteria | 8005626139 | 8005629629 | 293 |
| 912 | iso_pu_bacteria | 8005645114 | 8005647892 | 293 |
| 913 | iso_pu_bacteria | 8005668836 | 8005673497 | 293 |
| 914 | iso_pu_bacteria | 8005682033 | 8005684258 | 293 |
| 915 | iso_pu_bacteria | 8005688590 | 8005688850 | 293 |
| 916 | iso_pu_bacteria | 8005695170 | 8005695412 | 293 |
| 917 | iso_pu_bacteria | 8018127388 | 8018129247 | 293 |
| 918 | iso_pu_bacteria | 8018163183 | 8018169952 | 293 |
| 919 | iso_pu_bacteria | 8018176218 | 8018180891 | 293 |
| 920 | iso_pu_bacteria | 8023680758 | 8023685957 | 293 |
| 921 | iso_pu_bacteria | 8024479707 | 8024485425 | 293 |
| 922 | iso_pu_bacteria | 8024486573 | 8024486655 | 293 |
| 923 | iso_pu_bacteria | 8024501048 | 8024502925 | 293 |
| 924 | iso_pu_bacteria | 8054460903 | 8054463614 | 293 |
| 925 | iso_pu_bacteria | 8055431914 | 8055432596 | 293 |
| 926 | iso_pu_bacteria | 8056375014 | 8056381827 | 293 |
| 927 | iso_pu_bacteria | 8056382006 | 8056382289 | 293 |
| 928 | iso_pu_bacteria | 8057874678 | 8057876229 | 293 |
| 929 | 3300005328 | Ga0070676_10082362 | Ga0070676_100823622 | 294 |
| 930 | 3300005355 | Ga0070671_100073928 | Ga0070671_1000739283 | 294 |
| 931 | 3300005355 | Ga0070671_100253244 | Ga0070671_1002532442 | 294 |
| 932 | 3300005356 | Ga0070674_100097276 | Ga0070674_1000972762 | 294 |
| 933 | 3300005544 | Ga0070686_100088230 | Ga0070686_1000882302 | 294 |
| 934 | 3300005548 | Ga0070665_100341725 | Ga0070665_1003417252 | 294 |
| 935 | 3300006038 | Ga0075365_10011946 | Ga0075365_100119464 | 294 |
| 936 | 3300006048 | Ga0075363_100135547 | Ga0075363_1001355472 | 294 |
| 937 | 3300006051 | Ga0075364_10026122 | Ga0075364_100261222 | 294 |
| 938 | 3300006051 | Ga0075364_10106883 | Ga0075364_101068832 | 294 |
| 939 | 3300006177 | Ga0075362_10012384 | Ga0075362_100123842 | 294 |
| 940 | 3300006178 | Ga0075367_10035948 | Ga0075367_100359482 | 294 |
| 941 | 3300006195 | Ga0075366_10011331 | Ga0075366_100113313 | 294 |
| 942 | 3300006353 | Ga0075370_10024134 | Ga0075370_100241342 | 294 |
| 943 | 3300009177 | Ga0105248_10777425 | Ga0105248_107774251 | 294 |
| 944 | 3300010159 | Ga0099796_10058057 | Ga0099796_100580571 | 294 |
| 945 | 3300014969 | Ga0157376_10183948 | Ga0157376_101839482 | 294 |
| 946 | 3300025295 | Ga0209564_1006466 | Ga0209564_10064664 | 294 |
| 947 | 3300025907 | Ga0207645_10072761 | Ga0207645_100727612 | 294 |
| 948 | 3300025941 | Ga0207711_10051640 | Ga0207711_100516403 | 294 |
| 949 | 3300026121 | Ga0207683_10039324 | Ga0207683_100393244 | 294 |
| 950 | 3300027671 | Ga0209588_1017885 | Ga0209588_10178852 | 294 |
| 951 | 3300028379 | Ga0268266_10454598 | Ga0268266_104545981 | 294 |
| 952 | 3300035691 | Ga0373931_0002261 | Ga0373931_0002261_980_1879 | 294 |
| 953 | 3300035691 | Ga0373931_0010721 | Ga0373931_0010721_2407_3300 | 294 |
| 954 | 3300037466 | Ga0395898_0483238 | Ga0395898_0483238_93_986 | 294 |
| 955 | 3300044684 | Ga0466966_0274186 | Ga0466966_0274186_25_918 | 294 |
| 956 | 3300045049 | Ga0466959_0113087 | Ga0466959_0113087_1000_1893 | 294 |
| 957 | 3300046524 | Ga0495648_0016438 | Ga0495648_0016438_2318_3211 | 294 |
| 958 | 3300047320 | Ga0495672_0012863 | Ga0495672_0012863_3856_4752 | 294 |
| 959 | 3300048904 | Ga0496101_0084746 | Ga0496101_0084746_663_1556 | 294 |
| 960 | 3300048905 | Ga0496102_0120234 | Ga0496102_0120234_680_1573 | 294 |
| 961 | 3300048907 | Ga0496104_0315146 | Ga0496104_0315146_102_1001 | 294 |
| 962 | 3300048909 | Ga0496106_0039230 | Ga0496106_0039230_508_1401 | 294 |
| 963 | 3300048911 | Ga0496108_0429083 | Ga0496108_0429083_126_1019 | 294 |
| 964 | 3300048912 | Ga0496109_0033706 | Ga0496109_0033706_82_975 | 294 |
| 965 | 3300048912 | Ga0496109_0202435 | Ga0496109_0202435_302_1195 | 294 |
| 966 | 3300048913 | Ga0496110_0372551 | Ga0496110_0372551_53_952 | 294 |
| 967 | 3300048915 | Ga0496112_0401976 | Ga0496112_0401976_63_956 | 294 |
| 968 | 3300048916 | Ga0496113_0476842 | Ga0496113_0476842_41_934 | 294 |
| 969 | 3300048917 | Ga0496114_0392131 | Ga0496114_0392131_273_1166 | 294 |
| 970 | 3300048918 | Ga0496115_0005702 | Ga0496115_0005702_3415_4308 | 294 |
| 971 | 3300048919 | Ga0496116_0009413 | Ga0496116_0009413_6948_7859 | 294 |
| 972 | 3300048921 | Ga0496118_0094285 | Ga0496118_0094285_257_1168 | 294 |
| 973 | 3300048925 | Ga0496122_0064306 | Ga0496122_0064306_552_1463 | 294 |
| 974 | 3300048928 | Ga0496125_0000763 | Ga0496125_0000763_31130_32023 | 294 |
| 975 | 3300048928 | Ga0496125_0000796 | Ga0496125_0000796_41693_42586 | 294 |
| 976 | 3300048928 | Ga0496125_0008276 | Ga0496125_0008276_8247_9158 | 294 |
| 977 | 3300049571 | Ga0501034_0328983 | Ga0501034_0328983_146_1060 | 294 |
| 978 | 3300049591 | Ga0501075_0479701 | Ga0501075_0479701_27_920 | 294 |
| 979 | 3300050489 | nmdc:mga03683_10325_c1 | nmdc:mga03683_10325_c1_2128_3015 | 294 |
| 980 | 3300050491 | nmdc:mga00v17_21333_c1 | nmdc:mga00v17_21333_c1_2121_3032 | 294 |
| 981 | 3300050492 | nmdc:mga0yw44_1949_c1 | nmdc:mga0yw44_1949_c1_5797_6708 | 294 |
| 982 | 3300050493 | nmdc:mga0k408_171939_c1 | nmdc:mga0k408_171939_c1_362_1249 | 294 |
| 983 | 3300050496 | nmdc:mga07m45_18250_c1 | nmdc:mga07m45_18250_c1_2270_3157 | 294 |
| 984 | 3300050496 | nmdc:mga07m45_6280_c1 | nmdc:mga07m45_6280_c1_2671_3564 | 294 |
| 985 | 3300050516 | nmdc:mga0sz30_18802_c1 | nmdc:mga0sz30_18802_c1_1562_2473 | 294 |
| 986 | 3300053119 | Ga0500595_001896 | Ga0500595_001896_6761_7657 | 294 |
| 987 | 3300053730 | Ga0500645_042682 | Ga0500645_042682_368_1306 | 294 |
| 988 | iso_pu_bacteria | 2906370794 | 2906376784 | 294 |
| 989 | 3300003215 | JGI25153J46596_10007051 | JGI25153J46596_100070513 | 295 |
| 990 | 3300003215 | JGI25153J46596_10018377 | JGI25153J46596_100183772 | 295 |
| 991 | 3300003354 | JGI25160J50197_1010224 | JGI25160J50197_10102244 | 295 |
| 992 | 3300003659 | JGI25404J52841_10001894 | JGI25404J52841_100018943 | 295 |
| 993 | 3300003771 | Ga0055526_1001232 | Ga0055526_10012324 | 295 |
| 994 | 3300003775 | Ga0055524_1000518 | Ga0055524_10005187 | 295 |
| 995 | 3300005262 | Ga0065165_1000853 | Ga0065165_100085319 | 295 |
| 996 | 3300005262 | Ga0065165_1001807 | Ga0065165_100180715 | 295 |
| 997 | 3300005262 | Ga0065165_1012631 | Ga0065165_10126312 | 295 |
| 998 | 3300005262 | Ga0065165_1040556 | Ga0065165_10405561 | 295 |
| 999 | 3300005335 | Ga0070666_10039936 | Ga0070666_100399365 | 295 |
| 1000 | 3300005344 | Ga0070661_100162391 | Ga0070661_1001623911 | 295 |
| 1001 | 3300005354 | Ga0070675_100356182 | Ga0070675_1003561822 | 295 |
| 1002 | 3300005355 | Ga0070671_100024365 | Ga0070671_1000243652 | 295 |
| 1003 | 3300005436 | Ga0070713_100000526 | Ga0070713_1000005262 | 295 |
| 1004 | 3300005439 | Ga0070711_100027954 | Ga0070711_1000279543 | 295 |
| 1005 | 3300005439 | Ga0070711_100122903 | Ga0070711_1001229032 | 295 |
| 1006 | 3300005548 | Ga0070665_100087923 | Ga0070665_1000879232 | 295 |
| 1007 | 3300005577 | Ga0068857_100112605 | Ga0068857_1001126052 | 295 |
| 1008 | 3300005614 | Ga0068856_100159392 | Ga0068856_1001593921 | 295 |
| 1009 | 3300005617 | Ga0068859_100073860 | Ga0068859_1000738603 | 295 |
| 1010 | 3300005937 | Ga0081455_10007852 | Ga0081455_100078527 | 295 |
| 1011 | 3300005983 | Ga0081540_1014865 | Ga0081540_10148652 | 295 |
| 1012 | 3300005985 | Ga0081539_10008096 | Ga0081539_100080964 | 295 |
| 1013 | 3300006028 | Ga0070717_10000425 | Ga0070717_1000042521 | 295 |
| 1014 | 3300006038 | Ga0075365_10022109 | Ga0075365_100221094 | 295 |
| 1015 | 3300006038 | Ga0075365_10057514 | Ga0075365_100575143 | 295 |
| 1016 | 3300006038 | Ga0075365_10154006 | Ga0075365_101540062 | 295 |
| 1017 | 3300006042 | Ga0075368_10018661 | Ga0075368_100186612 | 295 |
| 1018 | 3300006042 | Ga0075368_10023143 | Ga0075368_100231432 | 295 |
| 1019 | 3300006173 | Ga0070716_100002328 | Ga0070716_1000023282 | 295 |
| 1020 | 3300006175 | Ga0070712_100077880 | Ga0070712_1000778802 | 295 |
| 1021 | 3300006178 | Ga0075367_10002330 | Ga0075367_100023305 | 295 |
| 1022 | 3300006178 | Ga0075367_10043320 | Ga0075367_100433203 | 295 |
| 1023 | 3300006194 | Ga0075427_10001903 | Ga0075427_100019032 | 295 |
| 1024 | 3300006195 | Ga0075366_10072866 | Ga0075366_100728662 | 295 |
| 1025 | 3300006353 | Ga0075370_10020067 | Ga0075370_100200672 | 295 |
| 1026 | 3300006844 | Ga0075428_100005390 | Ga0075428_1000053903 | 295 |
| 1027 | 3300006844 | Ga0075428_100030504 | Ga0075428_1000305045 | 295 |
| 1028 | 3300006844 | Ga0075428_100115849 | Ga0075428_1001158492 | 295 |
| 1029 | 3300006846 | Ga0075430_100000140 | Ga0075430_10000014022 | 295 |
| 1030 | 3300006846 | Ga0075430_100166447 | Ga0075430_1001664472 | 295 |
| 1031 | 3300006847 | Ga0075431_100001318 | Ga0075431_1000013183 | 295 |
| 1032 | 3300006847 | Ga0075431_100158117 | Ga0075431_1001581172 | 295 |
| 1033 | 3300006852 | Ga0075433_10000050 | Ga0075433_1000005025 | 295 |
| 1034 | 3300006871 | Ga0075434_100000179 | Ga0075434_10000017914 | 295 |
| 1035 | 3300006880 | Ga0075429_100001170 | Ga0075429_1000011709 | 295 |
| 1036 | 3300006880 | Ga0075429_100116506 | Ga0075429_1001165062 | 295 |
| 1037 | 3300006931 | Ga0097620_100073871 | Ga0097620_1000738713 | 295 |
| 1038 | 3300006944 | Ga0099823_1024510 | Ga0099823_10245102 | 295 |
| 1039 | 3300007076 | Ga0075435_100001211 | Ga0075435_1000012115 | 295 |
| 1040 | 3300009094 | Ga0111539_10000565 | Ga0111539_1000056522 | 295 |
| 1041 | 3300009098 | Ga0105245_10203045 | Ga0105245_102030452 | 295 |
| 1042 | 3300009147 | Ga0114129_10003182 | Ga0114129_100031829 | 295 |
| 1043 | 3300009147 | Ga0114129_10085173 | Ga0114129_100851732 | 295 |
| 1044 | 3300009147 | Ga0114129_10400906 | Ga0114129_104009062 | 295 |
| 1045 | 3300009148 | Ga0105243_10060918 | Ga0105243_100609182 | 295 |
| 1046 | 3300009177 | Ga0105248_10285149 | Ga0105248_102851492 | 295 |
| 1047 | 3300009553 | Ga0105249_10420514 | Ga0105249_104205142 | 295 |
| 1048 | 3300013296 | Ga0157374_10388413 | Ga0157374_103884132 | 295 |
| 1049 | 3300021320 | Ga0214544_1000001 | Ga0214544_1000001624 | 295 |
| 1050 | 3300021321 | Ga0214542_1000037 | Ga0214542_10000379 | 295 |
| 1051 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003136 | 295 |
| 1052 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002629 | 295 |
| 1053 | 3300025253 | Ga0209677_112928 | Ga0209677_1129281 | 295 |
| 1054 | 3300025261 | Ga0209233_1003296 | Ga0209233_10032962 | 295 |
| 1055 | 3300025273 | Ga0209673_1022555 | Ga0209673_10225552 | 295 |
| 1056 | 3300025291 | Ga0209675_1003671 | Ga0209675_10036712 | 295 |
| 1057 | 3300025295 | Ga0209564_1000150 | Ga0209564_100015020 | 295 |
| 1058 | 3300025297 | Ga0209758_1000477 | Ga0209758_100047745 | 295 |
| 1059 | 3300025297 | Ga0209758_1002622 | Ga0209758_100262212 | 295 |
| 1060 | 3300025297 | Ga0209758_1005670 | Ga0209758_10056707 | 295 |
| 1061 | 3300025297 | Ga0209758_1013489 | Ga0209758_10134893 | 295 |
| 1062 | 3300025299 | Ga0209256_1000108 | Ga0209256_100010820 | 295 |
| 1063 | 3300025302 | Ga0207426_1000292 | Ga0207426_100029234 | 295 |
| 1064 | 3300025302 | Ga0207426_1003205 | Ga0207426_10032055 | 295 |
| 1065 | 3300025302 | Ga0207426_1057592 | Ga0207426_10575921 | 295 |
| 1066 | 3300025900 | Ga0207710_10033864 | Ga0207710_100338642 | 295 |
| 1067 | 3300025903 | Ga0207680_10027354 | Ga0207680_100273542 | 295 |
| 1068 | 3300025904 | Ga0207647_10019881 | Ga0207647_100198815 | 295 |
| 1069 | 3300025915 | Ga0207693_10005998 | Ga0207693_100059987 | 295 |
| 1070 | 3300025915 | Ga0207693_10022689 | Ga0207693_100226894 | 295 |
| 1071 | 3300025916 | Ga0207663_10040021 | Ga0207663_100400211 | 295 |
| 1072 | 3300025918 | Ga0207662_10033751 | Ga0207662_100337513 | 295 |
| 1073 | 3300025925 | Ga0207650_10127444 | Ga0207650_101274442 | 295 |
| 1074 | 3300025927 | Ga0207687_10116915 | Ga0207687_101169152 | 295 |
| 1075 | 3300025928 | Ga0207700_10001358 | Ga0207700_100013589 | 295 |
| 1076 | 3300025931 | Ga0207644_10014803 | Ga0207644_100148033 | 295 |
| 1077 | 3300025931 | Ga0207644_10150474 | Ga0207644_101504742 | 295 |
| 1078 | 3300025936 | Ga0207670_10041485 | Ga0207670_100414853 | 295 |
| 1079 | 3300025939 | Ga0207665_10000837 | Ga0207665_1000083716 | 295 |
| 1080 | 3300025942 | Ga0207689_10068552 | Ga0207689_100685522 | 295 |
| 1081 | 3300025942 | Ga0207689_10101561 | Ga0207689_101015612 | 295 |
| 1082 | 3300025961 | Ga0207712_10063367 | Ga0207712_100633672 | 295 |
| 1083 | 3300025972 | Ga0207668_10172844 | Ga0207668_101728442 | 295 |
| 1084 | 3300026035 | Ga0207703_10077531 | Ga0207703_100775314 | 295 |
| 1085 | 3300026035 | Ga0207703_10090163 | Ga0207703_100901632 | 295 |
| 1086 | 3300026067 | Ga0207678_10091910 | Ga0207678_100919102 | 295 |
| 1087 | 3300026067 | Ga0207678_10448528 | Ga0207678_104485281 | 295 |
| 1088 | 3300026078 | Ga0207702_10286621 | Ga0207702_102866212 | 295 |
| 1089 | 3300026116 | Ga0207674_10135330 | Ga0207674_101353302 | 295 |
| 1090 | 3300026142 | Ga0207698_10476688 | Ga0207698_104766882 | 295 |
| 1091 | 3300027296 | Ga0209389_1000014 | Ga0209389_100001437 | 295 |
| 1092 | 3300027296 | Ga0209389_1000077 | Ga0209389_10000777 | 295 |
| 1093 | 3300027357 | Ga0209589_1000020 | Ga0209589_100002037 | 295 |
| 1094 | 3300027361 | Ga0209489_100251 | Ga0209489_1002517 | 295 |
| 1095 | 3300027361 | Ga0209489_102003 | Ga0209489_1020037 | 295 |
| 1096 | 3300027363 | Ga0209700_100271 | Ga0209700_1002716 | 295 |
| 1097 | 3300027907 | Ga0207428_10000485 | Ga0207428_1000048522 | 295 |
| 1098 | 3300028379 | Ga0268266_10125650 | Ga0268266_101256502 | 295 |
| 1099 | 3300028379 | Ga0268266_10130106 | Ga0268266_101301063 | 295 |
| 1100 | 3300028380 | Ga0268265_10157703 | Ga0268265_101577031 | 295 |
| 1101 | 3300028794 | Ga0307515_10001947 | Ga0307515_1000194725 | 295 |
| 1102 | 3300031507 | Ga0307509_10433490 | Ga0307509_104334901 | 295 |
| 1103 | 3300031649 | Ga0307514_10216527 | Ga0307514_102165272 | 295 |
| 1104 | 3300031712 | Ga0265342_10035892 | Ga0265342_100358922 | 295 |
| 1105 | 3300031901 | Ga0307406_10285295 | Ga0307406_102852951 | 295 |
| 1106 | 3300031903 | Ga0307407_10109960 | Ga0307407_101099602 | 295 |
| 1107 | 3300031995 | Ga0307409_100119217 | Ga0307409_1001192172 | 295 |
| 1108 | 3300032002 | Ga0307416_100082885 | Ga0307416_1000828852 | 295 |
| 1109 | 3300032005 | Ga0307411_10093942 | Ga0307411_100939422 | 295 |
| 1110 | 3300032126 | Ga0307415_100068432 | Ga0307415_1000684322 | 295 |
| 1111 | 3300033180 | Ga0307510_10045610 | Ga0307510_100456103 | 295 |
| 1112 | 3300041404 | Ga0439436_0017499 | Ga0439436_0017499_704_1597 | 295 |
| 1113 | 3300042145 | Ga0450906_022453 | Ga0450906_022453_120_1013 | 295 |
| 1114 | 3300044658 | Ga0466972_0022304 | Ga0466972_0022304_1639_2535 | 295 |
| 1115 | 3300044735 | Ga0466968_0000931 | Ga0466968_0000931_3789_4685 | 295 |
| 1116 | 3300044901 | Ga0466960_0026578 | Ga0466960_0026578_263_1159 | 295 |
| 1117 | 3300046459 | Ga0495629_0004287 | Ga0495629_0004287_5961_6857 | 295 |
| 1118 | 3300046460 | Ga0495638_0002696 | Ga0495638_0002696_586_1482 | 295 |
| 1119 | 3300046460 | Ga0495638_0059304 | Ga0495638_0059304_553_1446 | 295 |
| 1120 | 3300046462 | Ga0495651_0017446 | Ga0495651_0017446_184_1080 | 295 |
| 1121 | 3300046492 | Ga0495585_0019507 | Ga0495585_0019507_1184_2104 | 295 |
| 1122 | 3300046506 | Ga0495583_0079975 | Ga0495583_0079975_192_1088 | 295 |
| 1123 | 3300046524 | Ga0495648_0020584 | Ga0495648_0020584_582_1478 | 295 |
| 1124 | 3300046530 | Ga0495654_0000063 | Ga0495654_0000063_125577_126494 | 295 |
| 1125 | 3300046557 | Ga0495622_0030645 | Ga0495622_0030645_1574_2470 | 295 |
| 1126 | 3300046615 | Ga0495656_0012565 | Ga0495656_0012565_298_1218 | 295 |
| 1127 | 3300046616 | Ga0495668_0154984 | Ga0495668_0154984_224_1132 | 295 |
| 1128 | 3300046663 | Ga0495635_0006167 | Ga0495635_0006167_4864_5760 | 295 |
| 1129 | 3300046664 | Ga0495659_0015392 | Ga0495659_0015392_152_1072 | 295 |
| 1130 | 3300046675 | Ga0495657_0014577 | Ga0495657_0014577_325_1221 | 295 |
| 1131 | 3300046690 | Ga0495624_0193715 | Ga0495624_0193715_28_924 | 295 |
| 1132 | 3300047317 | Ga0495604_0009755 | Ga0495604_0009755_56_952 | 295 |
| 1133 | 3300047321 | Ga0495676_0017023 | Ga0495676_0017023_18_914 | 295 |
| 1134 | 3300047469 | Ga0495673_0097508 | Ga0495673_0097508_35_931 | 295 |
| 1135 | 3300048088 | Ga0495602_0244103 | Ga0495602_0244103_10_906 | 295 |
| 1136 | 3300048903 | Ga0496100_0017973 | Ga0496100_0017973_2384_3292 | 295 |
| 1137 | 3300048904 | Ga0496101_0002506 | Ga0496101_0002506_4032_4940 | 295 |
| 1138 | 3300048905 | Ga0496102_0139154 | Ga0496102_0139154_172_1080 | 295 |
| 1139 | 3300048907 | Ga0496104_0001254 | Ga0496104_0001254_13877_14773 | 295 |
| 1140 | 3300048908 | Ga0496105_0075113 | Ga0496105_0075113_1303_2211 | 295 |
| 1141 | 3300048909 | Ga0496106_0032006 | Ga0496106_0032006_2530_3426 | 295 |
| 1142 | 3300048909 | Ga0496106_0040480 | Ga0496106_0040480_581_1489 | 295 |
| 1143 | 3300048909 | Ga0496106_0084026 | Ga0496106_0084026_1419_2327 | 295 |
| 1144 | 3300048910 | Ga0496107_0019239 | Ga0496107_0019239_1991_2899 | 295 |
| 1145 | 3300048911 | Ga0496108_0101013 | Ga0496108_0101013_172_1080 | 295 |
| 1146 | 3300048912 | Ga0496109_0064980 | Ga0496109_0064980_1135_2031 | 295 |
| 1147 | 3300048912 | Ga0496109_0143700 | Ga0496109_0143700_124_1032 | 295 |
| 1148 | 3300048915 | Ga0496112_0015338 | Ga0496112_0015338_6066_6974 | 295 |
| 1149 | 3300048915 | Ga0496112_0043464 | Ga0496112_0043464_1195_2091 | 295 |
| 1150 | 3300048916 | Ga0496113_0042834 | Ga0496113_0042834_893_1801 | 295 |
| 1151 | 3300048917 | Ga0496114_0037868 | Ga0496114_0037868_611_1507 | 295 |
| 1152 | 3300048918 | Ga0496115_0098103 | Ga0496115_0098103_911_1819 | 295 |
| 1153 | 3300048919 | Ga0496116_0011068 | Ga0496116_0011068_1946_2842 | 295 |
| 1154 | 3300048922 | Ga0496119_0017837 | Ga0496119_0017837_3981_4877 | 295 |
| 1155 | 3300048923 | Ga0496120_0169916 | Ga0496120_0169916_22_918 | 295 |
| 1156 | 3300048924 | Ga0496121_0003624 | Ga0496121_0003624_946_1842 | 295 |
| 1157 | 3300048924 | Ga0496121_0027118 | Ga0496121_0027118_1944_2840 | 295 |
| 1158 | 3300048925 | Ga0496122_0139424 | Ga0496122_0139424_516_1403 | 295 |
| 1159 | 3300048927 | Ga0496124_0096255 | Ga0496124_0096255_1382_2278 | 295 |
| 1160 | 3300049460 | Ga0495682_0038135 | Ga0495682_0038135_845_1741 | 295 |
| 1161 | 3300049570 | Ga0501033_0201231 | Ga0501033_0201231_482_1381 | 295 |
| 1162 | 3300049578 | Ga0501042_0293844 | Ga0501042_0293844_92_1003 | 295 |
| 1163 | 3300049580 | Ga0501046_0055698 | Ga0501046_0055698_270_1169 | 295 |
| 1164 | 3300049581 | Ga0501047_0042993 | Ga0501047_0042993_320_1219 | 295 |
| 1165 | 3300049585 | Ga0501069_0153000 | Ga0501069_0153000_315_1223 | 295 |
| 1166 | 3300049589 | Ga0501073_0138282 | Ga0501073_0138282_593_1495 | 295 |
| 1167 | 3300049592 | Ga0501076_0016532 | Ga0501076_0016532_3960_4871 | 295 |
| 1168 | 3300050491 | nmdc:mga00v17_31758_c1 | nmdc:mga00v17_31758_c1_1352_2248 | 295 |
| 1169 | 3300050492 | nmdc:mga0yw44_114571_c1 | nmdc:mga0yw44_114571_c1_710_1606 | 295 |
| 1170 | 3300050492 | nmdc:mga0yw44_61812_c1 | nmdc:mga0yw44_61812_c1_950_1846 | 295 |
| 1171 | 3300050493 | nmdc:mga0k408_21150_c1 | nmdc:mga0k408_21150_c1_1130_2026 | 295 |
| 1172 | 3300050493 | nmdc:mga0k408_61733_c1 | nmdc:mga0k408_61733_c1_742_1653 | 295 |
| 1173 | 3300050507 | nmdc:mga05p37_219_c1 | nmdc:mga05p37_219_c1_27635_28543 | 295 |
| 1174 | 3300050507 | nmdc:mga05p37_321350_c1 | nmdc:mga05p37_321350_c1_178_1098 | 295 |
| 1175 | 3300050508 | nmdc:mga09592_452_c1 | nmdc:mga09592_452_c1_3422_4330 | 295 |
| 1176 | 3300050509 | nmdc:mga0qj67_396_c1 | nmdc:mga0qj67_396_c1_3422_4330 | 295 |
| 1177 | 3300050510 | nmdc:mga06r32_274_c1 | nmdc:mga06r32_274_c1_19434_20342 | 295 |
| 1178 | 3300050511 | nmdc:mga08y16_26695_c1 | nmdc:mga08y16_26695_c1_1758_2666 | 295 |
| 1179 | 3300050512 | nmdc:mga0n895_124_c1 | nmdc:mga0n895_124_c1_25728_26636 | 295 |
| 1180 | 3300050512 | nmdc:mga0n895_328624_c1 | nmdc:mga0n895_328624_c1_243_1151 | 295 |
| 1181 | 3300050513 | nmdc:mga0rr50_4689_c1 | nmdc:mga0rr50_4689_c1_5183_6091 | 295 |
| 1182 | 3300050515 | nmdc:mga0a205_97_c1 | nmdc:mga0a205_97_c1_25779_26687 | 295 |
| 1183 | 3300050516 | nmdc:mga0sz30_8151_c1 | nmdc:mga0sz30_8151_c1_1619_2518 | 295 |
| 1184 | 3300053087 | Ga0500643_000218 | Ga0500643_000218_33978_34874 | 295 |
| 1185 | 3300053088 | Ga0500644_0056856 | Ga0500644_0056856_144_1061 | 295 |
| 1186 | 3300053094 | Ga0500566_0000562 | Ga0500566_0000562_19593_20489 | 295 |
| 1187 | 3300053094 | Ga0500566_0042130 | Ga0500566_0042130_1369_2274 | 295 |
| 1188 | 3300053095 | Ga0500640_030487 | Ga0500640_030487_33_929 | 295 |
| 1189 | 3300053096 | Ga0500641_0005846 | Ga0500641_0005846_986_1885 | 295 |
| 1190 | 3300053096 | Ga0500641_0107573 | Ga0500641_0107573_82_978 | 295 |
| 1191 | 3300053103 | Ga0500555_008865 | Ga0500555_008865_206_1102 | 295 |
| 1192 | 3300053119 | Ga0500595_001223 | Ga0500595_001223_7964_8869 | 295 |
| 1193 | 3300053123 | Ga0500614_014399 | Ga0500614_014399_639_1535 | 295 |
| 1194 | 3300053125 | Ga0500618_000726 | Ga0500618_000726_12718_13611 | 295 |
| 1195 | 3300053140 | Ga0500573_0038452 | Ga0500573_0038452_1704_2597 | 295 |
| 1196 | 3300053143 | Ga0500579_081517 | Ga0500579_081517_45_941 | 295 |
| 1197 | 3300053153 | Ga0500616_0034287 | Ga0500616_0034287_44_940 | 295 |
| 1198 | 3300053177 | Ga0500636_0001036 | Ga0500636_0001036_4524_5420 | 295 |
| 1199 | 3300053178 | Ga0500637_0000231 | Ga0500637_0000231_8905_9810 | 295 |
| 1200 | 3300053731 | Ga0500609_002839 | Ga0500609_002839_946_1842 | 295 |
| 1201 | 3300053737 | Ga0500601_003054 | Ga0500601_003054_876_1772 | 295 |
| 1202 | 3300002773 | JGI25152J39213_1002687 | JGI25152J39213_10026873 | 296 |
| 1203 | 3300003203 | JGI25406J46586_10002619 | JGI25406J46586_100026195 | 296 |
| 1204 | 3300003215 | JGI25153J46596_10005646 | JGI25153J46596_100056464 | 296 |
| 1205 | 3300005347 | Ga0070668_100007882 | Ga0070668_1000078823 | 296 |
| 1206 | 3300005367 | Ga0070667_100009165 | Ga0070667_1000091653 | 296 |
| 1207 | 3300005455 | Ga0070663_100398778 | Ga0070663_1003987781 | 296 |
| 1208 | 3300005844 | Ga0068862_100334261 | Ga0068862_1003342612 | 296 |
| 1209 | 3300005983 | Ga0081540_1009656 | Ga0081540_10096562 | 296 |
| 1210 | 3300005985 | Ga0081539_10002437 | Ga0081539_100024378 | 296 |
| 1211 | 3300006042 | Ga0075368_10008690 | Ga0075368_100086902 | 296 |
| 1212 | 3300006353 | Ga0075370_10080226 | Ga0075370_100802262 | 296 |
| 1213 | 3300013104 | Ga0157370_10065483 | Ga0157370_100654832 | 296 |
| 1214 | 3300025245 | Ga0207425_1006064 | Ga0207425_10060643 | 296 |
| 1215 | 3300025258 | Ga0209129_1001183 | Ga0209129_10011839 | 296 |
| 1216 | 3300025294 | Ga0209025_1007433 | Ga0209025_10074334 | 296 |
| 1217 | 3300025297 | Ga0209758_1000662 | Ga0209758_10006629 | 296 |
| 1218 | 3300025297 | Ga0209758_1023161 | Ga0209758_10231612 | 296 |
| 1219 | 3300025923 | Ga0207681_10091151 | Ga0207681_100911512 | 296 |
| 1220 | 3300025935 | Ga0207709_10031822 | Ga0207709_100318223 | 296 |
| 1221 | 3300025986 | Ga0207658_10089841 | Ga0207658_100898412 | 296 |
| 1222 | 3300027866 | Ga0209813_10005539 | Ga0209813_100055392 | 296 |
| 1223 | 3300028379 | Ga0268266_10131120 | Ga0268266_101311203 | 296 |
| 1224 | 3300048920 | Ga0496117_0074519 | Ga0496117_0074519_872_1792 | 296 |
| 1225 | 3300048925 | Ga0496122_0024574 | Ga0496122_0024574_3780_4700 | 296 |
| 1226 | 3300048926 | Ga0496123_0022880 | Ga0496123_0022880_1290_2210 | 296 |
| 1227 | 3300049776 | Ga0501280_006997 | Ga0501280_006997_464_1360 | 296 |
| 1228 | 3300050494 | nmdc:mga06z11_72078_c1 | nmdc:mga06z11_72078_c1_913_1821 | 296 |
| 1229 | 3300050495 | nmdc:mga04h51_48492_c1 | nmdc:mga04h51_48492_c1_498_1406 | 296 |
| 1230 | iso_pu_bacteria | 2791355197 | 2793066543 | 296 |
| 1231 | iso_pu_bacteria | 2961136820 | 2961140192 | 296 |
| 1232 | iso_pu_bacteria | 2979764755 | 2979769581 | 296 |
| 1233 | iso_pu_bacteria | 3000135777 | 3000139708 | 296 |
| 1234 | 3300001979 | JGI24740J21852_10000538 | JGI24740J21852_100005387 | 297 |
| 1235 | 3300002704 | JGI25155J39150_1000056 | JGI25155J39150_100005674 | 297 |
| 1236 | 3300002705 | JGI25156J39149_1000007 | JGI25156J39149_1000007244 | 297 |
| 1237 | 3300002737 | JGI25162J39368_1001472 | JGI25162J39368_10014724 | 297 |
| 1238 | 3300002738 | JGI25154J39366_1000013 | JGI25154J39366_100001374 | 297 |
| 1239 | 3300002741 | JGI25157J39369_1000099 | JGI25157J39369_100009974 | 297 |
| 1240 | 3300003187 | JGI25151J46595_10001633 | JGI25151J46595_100016337 | 297 |
| 1241 | 3300003187 | JGI25151J46595_10034603 | JGI25151J46595_100346032 | 297 |
| 1242 | 3300003214 | JGI25165J46597_1001468 | JGI25165J46597_10014686 | 297 |
| 1243 | 3300003316 | rootH1_10020516 | rootH1_100205162 | 297 |
| 1244 | 3300003374 | JGI25161J50226_1001176 | JGI25161J50226_10011767 | 297 |
| 1245 | 3300003771 | Ga0055526_1003004 | Ga0055526_10030043 | 297 |
| 1246 | 3300003771 | Ga0055526_1010710 | Ga0055526_10107106 | 297 |
| 1247 | 3300003775 | Ga0055524_1004966 | Ga0055524_10049666 | 297 |
| 1248 | 3300003775 | Ga0055524_1011428 | Ga0055524_10114282 | 297 |
| 1249 | 3300003781 | Ga0055536_1015097 | Ga0055536_10150972 | 297 |
| 1250 | 3300003790 | Ga0055528_1000515 | Ga0055528_100051517 | 297 |
| 1251 | 3300003792 | Ga0055540_1000131 | Ga0055540_100013167 | 297 |
| 1252 | 3300003792 | Ga0055540_1012983 | Ga0055540_10129832 | 297 |
| 1253 | 3300003794 | Ga0055531_10008117 | Ga0055531_100081173 | 297 |
| 1254 | 3300004625 | Ga0055543_1001269 | Ga0055543_10012697 | 297 |
| 1255 | 3300005347 | Ga0070668_100235246 | Ga0070668_1002352462 | 297 |
| 1256 | 3300005548 | Ga0070665_100076453 | Ga0070665_1000764533 | 297 |
| 1257 | 3300005614 | Ga0068856_100036031 | Ga0068856_1000360312 | 297 |
| 1258 | 3300006038 | Ga0075365_10011544 | Ga0075365_100115442 | 297 |
| 1259 | 3300006042 | Ga0075368_10071327 | Ga0075368_100713271 | 297 |
| 1260 | 3300006048 | Ga0075363_100004037 | Ga0075363_1000040373 | 297 |
| 1261 | 3300006051 | Ga0075364_10047814 | Ga0075364_100478142 | 297 |
| 1262 | 3300006051 | Ga0075364_10140011 | Ga0075364_101400112 | 297 |
| 1263 | 3300006178 | Ga0075367_10002198 | Ga0075367_100021983 | 297 |
| 1264 | 3300006178 | Ga0075367_10036519 | Ga0075367_100365192 | 297 |
| 1265 | 3300006178 | Ga0075367_10150714 | Ga0075367_101507142 | 297 |
| 1266 | 3300006186 | Ga0075369_10013828 | Ga0075369_100138283 | 297 |
| 1267 | 3300006195 | Ga0075366_10009512 | Ga0075366_100095124 | 297 |
| 1268 | 3300006353 | Ga0075370_10003168 | Ga0075370_100031687 | 297 |
| 1269 | 3300006353 | Ga0075370_10123501 | Ga0075370_101235012 | 297 |
| 1270 | 3300006948 | Ga0099826_10000297 | Ga0099826_100002976 | 297 |
| 1271 | 3300006948 | Ga0099826_10095024 | Ga0099826_100950242 | 297 |
| 1272 | 3300009148 | Ga0105243_10018705 | Ga0105243_100187053 | 297 |
| 1273 | 3300009765 | Ga0123341_1000019 | Ga0123341_100001923 | 297 |
| 1274 | 3300009766 | Ga0123342_1014594 | Ga0123342_10145945 | 297 |
| 1275 | 3300009766 | Ga0123342_1021209 | Ga0123342_10212093 | 297 |
| 1276 | 3300013100 | Ga0157373_10103869 | Ga0157373_101038692 | 297 |
| 1277 | 3300013100 | Ga0157373_10160983 | Ga0157373_101609832 | 297 |
| 1278 | 3300013102 | Ga0157371_10000304 | Ga0157371_1000030425 | 297 |
| 1279 | 3300013104 | Ga0157370_10013708 | Ga0157370_100137082 | 297 |
| 1280 | 3300025206 | Ga0209435_100006 | Ga0209435_100006282 | 297 |
| 1281 | 3300025233 | Ga0209437_100023 | Ga0209437_100023382 | 297 |
| 1282 | 3300025233 | Ga0209437_100341 | Ga0209437_10034150 | 297 |
| 1283 | 3300025246 | Ga0209646_1000015 | Ga0209646_1000015253 | 297 |
| 1284 | 3300025250 | Ga0209026_1000046 | Ga0209026_1000046253 | 297 |
| 1285 | 3300025254 | Ga0209148_1003099 | Ga0209148_10030993 | 297 |
| 1286 | 3300025256 | Ga0209759_1000005 | Ga0209759_1000005282 | 297 |
| 1287 | 3300025256 | Ga0209759_1018812 | Ga0209759_10188122 | 297 |
| 1288 | 3300025258 | Ga0209129_1002648 | Ga0209129_10026488 | 297 |
| 1289 | 3300025258 | Ga0209129_1010344 | Ga0209129_10103442 | 297 |
| 1290 | 3300025261 | Ga0209233_1000062 | Ga0209233_100006293 | 297 |
| 1291 | 3300025261 | Ga0209233_1000970 | Ga0209233_10009704 | 297 |
| 1292 | 3300025273 | Ga0209673_1000005 | Ga0209673_1000005123 | 297 |
| 1293 | 3300025273 | Ga0209673_1001376 | Ga0209673_10013765 | 297 |
| 1294 | 3300025273 | Ga0209673_1018003 | Ga0209673_10180033 | 297 |
| 1295 | 3300025273 | Ga0209673_1018699 | Ga0209673_10186993 | 297 |
| 1296 | 3300025291 | Ga0209675_1014261 | Ga0209675_10142612 | 297 |
| 1297 | 3300025294 | Ga0209025_1000397 | Ga0209025_100039755 | 297 |
| 1298 | 3300025294 | Ga0209025_1002687 | Ga0209025_10026873 | 297 |
| 1299 | 3300025294 | Ga0209025_1007209 | Ga0209025_10072092 | 297 |
| 1300 | 3300025294 | Ga0209025_1010571 | Ga0209025_10105715 | 297 |
| 1301 | 3300025295 | Ga0209564_1000511 | Ga0209564_100051126 | 297 |
| 1302 | 3300025295 | Ga0209564_1007023 | Ga0209564_10070234 | 297 |
| 1303 | 3300025297 | Ga0209758_1000585 | Ga0209758_100058530 | 297 |
| 1304 | 3300025297 | Ga0209758_1001274 | Ga0209758_100127424 | 297 |
| 1305 | 3300025297 | Ga0209758_1001596 | Ga0209758_100159610 | 297 |
| 1306 | 3300025297 | Ga0209758_1004840 | Ga0209758_100484010 | 297 |
| 1307 | 3300025298 | Ga0209050_1001525 | Ga0209050_10015256 | 297 |
| 1308 | 3300025299 | Ga0209256_1003072 | Ga0209256_10030726 | 297 |
| 1309 | 3300025299 | Ga0209256_1003322 | Ga0209256_10033229 | 297 |
| 1310 | 3300025299 | Ga0209256_1008896 | Ga0209256_10088962 | 297 |
| 1311 | 3300025302 | Ga0207426_1000355 | Ga0207426_100035546 | 297 |
| 1312 | 3300025303 | Ga0209051_1000038 | Ga0209051_1000038296 | 297 |
| 1313 | 3300025303 | Ga0209051_1002277 | Ga0209051_10022775 | 297 |
| 1314 | 3300025303 | Ga0209051_1002823 | Ga0209051_10028233 | 297 |
| 1315 | 3300025304 | Ga0209257_1008917 | Ga0209257_10089172 | 297 |
| 1316 | 3300025304 | Ga0209257_1012956 | Ga0209257_10129562 | 297 |
| 1317 | 3300026078 | Ga0207702_10025869 | Ga0207702_100258692 | 297 |
| 1318 | 3300027312 | Ga0209371_1000035 | Ga0209371_1000035303 | 297 |
| 1319 | 3300027312 | Ga0209371_1000703 | Ga0209371_10007033 | 297 |
| 1320 | 3300027312 | Ga0209371_1004170 | Ga0209371_10041703 | 297 |
| 1321 | 3300027666 | Ga0209282_1001209 | Ga0209282_10012093 | 297 |
| 1322 | 3300027666 | Ga0209282_1076496 | Ga0209282_10764962 | 297 |
| 1323 | 3300027866 | Ga0209813_10003425 | Ga0209813_100034253 | 297 |
| 1324 | 3300028794 | Ga0307515_10068995 | Ga0307515_100689953 | 297 |
| 1325 | 3300030500 | Ga0268256_1000037 | Ga0268256_1000037302 | 297 |
| 1326 | 3300030500 | Ga0268256_1003172 | Ga0268256_10031723 | 297 |
| 1327 | 3300030500 | Ga0268256_1004304 | Ga0268256_10043044 | 297 |
| 1328 | 3300030744 | Ga0316181_1153204 | Ga0316181_11532042 | 297 |
| 1329 | 3300041491 | Ga0451833_0340930 | Ga0451833_0340930_936_1829 | 297 |
| 1330 | 3300041496 | Ga0451839_0143081 | Ga0451839_0143081_123_1016 | 297 |
| 1331 | 3300041501 | Ga0451845_0454358 | Ga0451845_0454358_207_1100 | 297 |
| 1332 | 3300041503 | Ga0451847_0186492 | Ga0451847_0186492_618_1511 | 297 |
| 1333 | 3300041505 | Ga0451849_0091961 | Ga0451849_0091961_426_1319 | 297 |
| 1334 | 3300041507 | Ga0451851_0082640 | Ga0451851_0082640_756_1649 | 297 |
| 1335 | 3300041509 | Ga0451843_0039079 | Ga0451843_0039079_791_1684 | 297 |
| 1336 | 3300041512 | Ga0451853_1011766 | Ga0451853_1011766_139_1032 | 297 |
| 1337 | 3300046460 | Ga0495638_0061881 | Ga0495638_0061881_375_1271 | 297 |
| 1338 | 3300046519 | Ga0495632_0016742 | Ga0495632_0016742_2671_3564 | 297 |
| 1339 | 3300046674 | Ga0495588_0011793 | Ga0495588_0011793_3001_3894 | 297 |
| 1340 | 3300046692 | Ga0495671_0104843 | Ga0495671_0104843_392_1285 | 297 |
| 1341 | 3300047472 | Ga0495686_0133206 | Ga0495686_0133206_495_1388 | 297 |
| 1342 | 3300048907 | Ga0496104_0159198 | Ga0496104_0159198_648_1541 | 297 |
| 1343 | 3300048919 | Ga0496116_0047130 | Ga0496116_0047130_231_1124 | 297 |
| 1344 | 3300048919 | Ga0496116_0107045 | Ga0496116_0107045_432_1325 | 297 |
| 1345 | 3300048919 | Ga0496116_0149098 | Ga0496116_0149098_180_1073 | 297 |
| 1346 | 3300048920 | Ga0496117_0000052 | Ga0496117_0000052_241752_242645 | 297 |
| 1347 | 3300048920 | Ga0496117_0008030 | Ga0496117_0008030_807_1700 | 297 |
| 1348 | 3300048921 | Ga0496118_0018034 | Ga0496118_0018034_1193_2086 | 297 |
| 1349 | 3300048921 | Ga0496118_0190535 | Ga0496118_0190535_246_1142 | 297 |
| 1350 | 3300048922 | Ga0496119_0009404 | Ga0496119_0009404_6450_7343 | 297 |
| 1351 | 3300048922 | Ga0496119_0020002 | Ga0496119_0020002_2934_3827 | 297 |
| 1352 | 3300048922 | Ga0496119_0037750 | Ga0496119_0037750_815_1708 | 297 |
| 1353 | 3300048922 | Ga0496119_0042872 | Ga0496119_0042872_1079_1972 | 297 |
| 1354 | 3300048923 | Ga0496120_0000019 | Ga0496120_0000019_221487_222380 | 297 |
| 1355 | 3300048924 | Ga0496121_0000005 | Ga0496121_0000005_882816_883709 | 297 |
| 1356 | 3300048924 | Ga0496121_0140568 | Ga0496121_0140568_847_1740 | 297 |
| 1357 | 3300048925 | Ga0496122_0000053 | Ga0496122_0000053_221487_222380 | 297 |
| 1358 | 3300048925 | Ga0496122_0003439 | Ga0496122_0003439_13238_14131 | 297 |
| 1359 | 3300048925 | Ga0496122_0004580 | Ga0496122_0004580_1142_2038 | 297 |
| 1360 | 3300048926 | Ga0496123_0000038 | Ga0496123_0000038_221487_222380 | 297 |
| 1361 | 3300048926 | Ga0496123_0002783 | Ga0496123_0002783_6688_7581 | 297 |
| 1362 | 3300048926 | Ga0496123_0014707 | Ga0496123_0014707_140_1033 | 297 |
| 1363 | 3300048926 | Ga0496123_0067145 | Ga0496123_0067145_729_1622 | 297 |
| 1364 | 3300048927 | Ga0496124_0017334 | Ga0496124_0017334_2001_2894 | 297 |
| 1365 | 3300048927 | Ga0496124_0039011 | Ga0496124_0039011_2233_3126 | 297 |
| 1366 | 3300048928 | Ga0496125_0000159 | Ga0496125_0000159_6914_7807 | 297 |
| 1367 | 3300048928 | Ga0496125_0076051 | Ga0496125_0076051_667_1560 | 297 |
| 1368 | 3300048929 | Ga0496126_0372776 | Ga0496126_0372776_70_963 | 297 |
| 1369 | 3300050489 | nmdc:mga03683_7842_c1 | nmdc:mga03683_7842_c1_610_1503 | 297 |
| 1370 | 3300050490 | nmdc:mga03n38_1718_c1 | nmdc:mga03n38_1718_c1_2610_3503 | 297 |
| 1371 | 3300050491 | nmdc:mga00v17_11_c1 | nmdc:mga00v17_11_c1_107410_108303 | 297 |
| 1372 | 3300050491 | nmdc:mga00v17_67568_c1 | nmdc:mga00v17_67568_c1_238_1131 | 297 |
| 1373 | 3300050491 | nmdc:mga00v17_88516_c1 | nmdc:mga00v17_88516_c1_497_1390 | 297 |
| 1374 | 3300050492 | nmdc:mga0yw44_528_c1 | nmdc:mga0yw44_528_c1_12052_12945 | 297 |
| 1375 | 3300050493 | nmdc:mga0k408_110770_c1 | nmdc:mga0k408_110770_c1_255_1148 | 297 |
| 1376 | 3300050494 | nmdc:mga06z11_76648_c1 | nmdc:mga06z11_76648_c1_421_1314 | 297 |
| 1377 | 3300050496 | nmdc:mga07m45_207910_c1 | nmdc:mga07m45_207910_c1_120_1013 | 297 |
| 1378 | 3300050516 | nmdc:mga0sz30_70141_c1 | nmdc:mga0sz30_70141_c1_532_1425 | 297 |
| 1379 | 3300053107 | Ga0500560_017881 | Ga0500560_017881_412_1305 | 297 |
| 1380 | 3300053153 | Ga0500616_0004193 | Ga0500616_0004193_8392_9285 | 297 |
| 1381 | 3300053177 | Ga0500636_0000039 | Ga0500636_0000039_59319_60215 | 297 |
| 1382 | 3300053177 | Ga0500636_0053454 | Ga0500636_0053454_451_1347 | 297 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
150
321
0.94
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ahd-assembly1.cif.gz_A | opua (e190q) occluded | 0.8947 | 99 | 289 |
| 3dhw-assembly1.cif.gz_A | crystal structure of methionine importer metni | 0.8178 | 99 | 282 |
| 7ahd-assembly1.cif.gz_B | opua (e190q) occluded | 0.7924 | 53 | 289 |
| 3dhw-assembly1.cif.gz_B | crystal structure of methionine importer metni | 0.7909 | 99 | 282 |
| 3dhw-assembly2.cif.gz_E | crystal structure of methionine importer metni | 0.7842 | 99 | 280 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1I4_54_251_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9616 | 102 | 292 | 1.10.3720.10 |
| af_Q2G088_14_207_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9371 | 99 | 287 | 1.10.3720.10 |
| af_Q47539_71_268_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9363 | 96 | 291 | 1.10.3720.10 |
| af_Q57856_64_258_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9335 | 96 | 287 | 1.10.3720.10 |
| af_O69722_23_210_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9321 | 99 | 284 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A530M5U9-F1-model_v4 | deleted | 0.98 | 114 | 258 |
|
| AF-A0A530M5U9-F1-model_v4 | deleted | 0.9604 | 114 | 258 |
|
| AF-A0A7W8LYU9-F1-model_v4 | Nitrate/nitrite transport system permease protein | 0.9508 | 14 | 293 |
GO:0005886
GO:0006811 GO:0015112 |
| AF-A0A3N5GYZ6-F1-model_v4 | ABC transporter permease subunit | 0.9488 | 147 | 292 |
GO:0005886
GO:0055085 |
| AF-S4M7U5-F1-model_v4 | Putative Glycine betaine/carnitine transport permease protein GbuB | 0.9432 | 106 | 290 |
GO:0005275
GO:0015226 GO:0015871 GO:0031460 GO:0043190 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar