F493516

General Info

Members Datasets Scaffolds Average Seq Length
1381 390 1381 253

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10114807|Ga0157370_101148075
Length 289
Sequence MGQGELDYNGDTGQFSSLSRPPVRSRQNETARAMIIRKSPAELEKMRRSGLLVWKILQDLAGMVQEGVSTQDLEAAAEKMVRDAGARPAFKGYYVQSAGAKFPYVLCTSVNEEIVHGMPSPKRKLKKGDILSIDTGVELDGYFGDSALTVPIGEISDSTKRLLKVTRESLEMAIEKVRPGNRLFDVCGTVQKHVESNGFSVVREMVGHGIGTKLHEEPQIPNYIDRRNENPRLKEGMVLAIEPMVNEGGPEMRVKSDKWTAVTKDGRYSAHFEHCVAVTSNGPWVLTRP

Samples

Sample ID Description Type Environment
1 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
137 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
141 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
142 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
143 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
146 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
217 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
218 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
219 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
221 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
222 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
223 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
224 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
225 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
226 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
227 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
228 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
229 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
230 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
231 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
232 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
233 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
234 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
235 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
236 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
237 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
238 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
239 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
240 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
241 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
242 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
244 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
245 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
246 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
247 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
248 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
249 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
250 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
251 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
252 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
253 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
255 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
256 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
257 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
258 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
259 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
260 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
261 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
262 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
264 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
265 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
266 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
267 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
268 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
269 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
270 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
271 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
272 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
273 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
274 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
275 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
276 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
277 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
278 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
279 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
280 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
281 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
282 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
283 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
284 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
285 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
286 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
287 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
288 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
289 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
290 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
291 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
292 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
293 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
294 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
295 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
296 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
297 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
298 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
299 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
300 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
301 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
302 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
303 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
304 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
305 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
306 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
307 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
308 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
309 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
310 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
311 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
312 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
313 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
314 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
315 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
316 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
317 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
318 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
319 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
320 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
321 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
322 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
323 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
324 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
325 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
326 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
327 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
328 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
329 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
330 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
331 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
332 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
333 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
334 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
335 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
336 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
337 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
338 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
339 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
340 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
341 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
342 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
343 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
358 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
359 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
360 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
361 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
362 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
363 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
364 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
365 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
366 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
367 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
368 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
369 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
370 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
371 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
374 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
375 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
376 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
377 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
378 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
379 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
380 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
381 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
382 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
383 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
384 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
385 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
386 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
387 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
388 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
389 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
390 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 1.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 2.75
Rhizosphere 96.23
Stem 0
Stem Tuber 0
Unclassified 0.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000052 3300000545 Bacteria 22151
2 JGI24752J21851_1000767 3300001976 Bacteria 4313
3 JGI24747J21853_1009156 3300001978 Bacteria 976
4 JGI24743J22301_10002084 3300001991 Bacteria 2947
5 JGI24749J21850_1007909 3300002076 Bacteria 1479
6 JGI24744J21845_10020986 3300002077 Unclassified 1286
7 JGI24751J29686_10002130 3300002459 Bacteria 4020
8 JGI25406J46586_10027721 3300003203 Unclassified 2167
9 Ga0058859_11505369 3300004798 Bacteria 1183
10 Ga0058860_11998827 3300004801 Bacteria 2204
11 Ga0058862_12584123 3300004803 Bacteria 1569
12 Ga0065712_10004601 3300005290 Bacteria 3170
13 Ga0065715_10090524 3300005293 Bacteria 6854
14 Ga0065715_10104408 3300005293 Bacteria 2965
15 Ga0065715_10123342 3300005293 Bacteria 2180
16 Ga0065715_10170240 3300005293 Bacteria 1553
17 Ga0065715_10289801 3300005293 Bacteria 1066
18 Ga0065707_10087316 3300005295 Bacteria 5079
19 Ga0070658_10004794 3300005327 Bacteria 11007
20 Ga0070658_10132457 3300005327 Bacteria 2078
21 Ga0070676_10002984 3300005328 Bacteria 8748
22 Ga0070676_10011483 3300005328 Bacteria 4814
23 Ga0070676_10017267 3300005328 Bacteria 3994
24 Ga0070676_10027020 3300005328 Bacteria 3252
25 Ga0070683_100000047 3300005329 Bacteria 94142
26 Ga0070683_100129722 3300005329 Bacteria 2385
27 Ga0070683_100191401 3300005329 Bacteria 1942
28 Ga0070683_100602272 3300005329 Bacteria 1052
29 Ga0070690_100000550 3300005330 Bacteria 18744
30 Ga0070690_100051861 3300005330 Bacteria 2620
31 Ga0070690_100068053 3300005330 Bacteria 2309
32 Ga0070690_100184741 3300005330 Bacteria 1442
33 Ga0070690_100214180 3300005330 Unclassified 1346
34 Ga0070690_100218595 3300005330 Bacteria 1334
35 Ga0070690_100435090 3300005330 Bacteria 970
36 Ga0070690_100458095 3300005330 Bacteria 947
37 Ga0070670_100000833 3300005331 Bacteria 24086
38 Ga0070670_100003742 3300005331 Bacteria 12666
39 Ga0070670_100103499 3300005331 Bacteria 2452
40 Ga0070670_100197847 3300005331 Bacteria 1746
41 Ga0070670_100333600 3300005331 Bacteria 1330
42 Ga0068869_100049372 3300005334 Bacteria 3045
43 Ga0068869_100132255 3300005334 Bacteria 1919
44 Ga0070666_10001876 3300005335 Bacteria 12791
45 Ga0070666_10002056 3300005335 Bacteria 12212
46 Ga0070666_10009254 3300005335 Bacteria 6139
47 Ga0070666_10080569 3300005335 Bacteria 2225
48 Ga0070666_10118575 3300005335 Bacteria 1834
49 Ga0070680_100002147 3300005336 Bacteria 14571
50 Ga0070680_100040402 3300005336 Bacteria 3777
51 Ga0070680_100411338 3300005336 Bacteria 1154
52 Ga0070682_100085550 3300005337 Bacteria 2051
53 Ga0070682_100106509 3300005337 Bacteria 1860
54 Ga0068868_100011852 3300005338 Bacteria 6357
55 Ga0068868_100107994 3300005338 Bacteria 2258
56 Ga0068868_100128168 3300005338 Bacteria 2074
57 Ga0070660_100002901 3300005339 Bacteria 11803
58 Ga0070660_100006419 3300005339 Bacteria 8149
59 Ga0070660_100026381 3300005339 Bacteria 4325
60 Ga0070689_100026249 3300005340 Bacteria 4385
61 Ga0070689_100036381 3300005340 Bacteria 3765
62 Ga0070689_100043310 3300005340 Bacteria 3459
63 Ga0070689_100047018 3300005340 Bacteria 3327
64 Ga0070689_100048981 3300005340 Bacteria 3260
65 Ga0070689_100111961 3300005340 Bacteria 2172
66 Ga0070689_100114914 3300005340 Bacteria 2145
67 Ga0070691_10009940 3300005341 Bacteria 4335
68 Ga0070687_100000493 3300005343 Bacteria 13161
69 Ga0070687_100113613 3300005343 Bacteria 1537
70 Ga0070661_100012073 3300005344 Bacteria 6037
71 Ga0070661_100095814 3300005344 Bacteria 2201
72 Ga0070668_100000403 3300005347 Bacteria 28684
73 Ga0070668_100014649 3300005347 Bacteria 5860
74 Ga0070668_100025979 3300005347 Bacteria 4440
75 Ga0070668_100260285 3300005347 Bacteria 1442
76 Ga0070668_100470568 3300005347 Bacteria 1084
77 Ga0070669_100002011 3300005353 Bacteria 14710
78 Ga0070669_100006097 3300005353 Bacteria 8698
79 Ga0070669_100007500 3300005353 Bacteria 7813
80 Ga0070669_100125216 3300005353 Bacteria 1966
81 Ga0070669_100222360 3300005353 Bacteria 1493
82 Ga0070675_100001318 3300005354 Bacteria 18141
83 Ga0070675_100004678 3300005354 Bacteria 10447
84 Ga0070675_100004817 3300005354 Bacteria 10298
85 Ga0070675_100216456 3300005354 Bacteria 1667
86 Ga0070675_100612724 3300005354 Bacteria 988
87 Ga0070671_100000283 3300005355 Bacteria 34469
88 Ga0070671_100001873 3300005355 Bacteria 16076
89 Ga0070671_100011134 3300005355 Bacteria 7224
90 Ga0070671_100064488 3300005355 Bacteria 3051
91 Ga0070671_100478534 3300005355 Unclassified 1070
92 Ga0070674_100010705 3300005356 Bacteria 5557
93 Ga0070674_100013617 3300005356 Bacteria 5033
94 Ga0070673_100030438 3300005364 Bacteria 4039
95 Ga0070673_100042360 3300005364 Bacteria 3510
96 Ga0070673_100050251 3300005364 Bacteria 3260
97 Ga0070673_100178734 3300005364 Bacteria 1815
98 Ga0070688_100009439 3300005365 Bacteria 5337
99 Ga0070688_100044002 3300005365 Bacteria 2754
100 Ga0070688_100049229 3300005365 Bacteria 2621
101 Ga0070688_100055152 3300005365 Bacteria 2492
102 Ga0070688_100122162 3300005365 Bacteria 1746
103 Ga0070688_100154947 3300005365 Bacteria 1569
104 Ga0070688_100221371 3300005365 Bacteria 1334
105 Ga0070688_100281587 3300005365 Bacteria 1195
106 Ga0070659_100023459 3300005366 Bacteria 4721
107 Ga0070659_100063774 3300005366 Bacteria 2915
108 Ga0070667_100010004 3300005367 Bacteria 7858
109 Ga0070667_100021024 3300005367 Bacteria 5422
110 Ga0070667_100144062 3300005367 Bacteria 2089
111 Ga0070667_100167166 3300005367 Bacteria 1940
112 Ga0070667_100320419 3300005367 Unclassified 1399
113 Ga0070667_100375971 3300005367 Bacteria 1290
114 Ga0070709_10010621 3300005434 Bacteria 5106
115 Ga0070709_10054134 3300005434 Bacteria 2528
116 Ga0070709_10058930 3300005434 Bacteria 2436
117 Ga0070709_10084037 3300005434 Bacteria 2084
118 Ga0070709_10095295 3300005434 Bacteria 1971
119 Ga0070709_10100025 3300005434 Bacteria 1930
120 Ga0070709_10313544 3300005434 Bacteria 1149
121 Ga0070709_10325643 3300005434 Bacteria 1129
122 Ga0070709_10407690 3300005434 Unclassified 1016
123 Ga0070714_100000519 3300005435 Bacteria 27946
124 Ga0070714_100005407 3300005435 Bacteria 9747
125 Ga0070714_100016574 3300005435 Bacteria 5955
126 Ga0070714_100024289 3300005435 Bacteria 4987
127 Ga0070714_100066679 3300005435 Bacteria 3102
128 Ga0070714_100074032 3300005435 Bacteria 2952
129 Ga0070714_100149549 3300005435 Bacteria 2103
130 Ga0070714_100189302 3300005435 Bacteria 1877
131 Ga0070714_100210781 3300005435 Bacteria 1781
132 Ga0070714_100429656 3300005435 Unclassified 1252
133 Ga0070713_100001320 3300005436 Bacteria 15863
134 Ga0070713_100043833 3300005436 Bacteria 3660
135 Ga0070713_100050575 3300005436 Bacteria 3434
136 Ga0070713_100109308 3300005436 Bacteria 2409
137 Ga0070713_100120642 3300005436 Bacteria 2299
138 Ga0070713_100126690 3300005436 Bacteria 2247
139 Ga0070713_100289204 3300005436 Bacteria 1506
140 Ga0070713_100879812 3300005436 Unclassified 861
141 Ga0070710_10049023 3300005437 Bacteria 2361
142 Ga0070710_10059524 3300005437 Bacteria 2170
143 Ga0070710_10102068 3300005437 Unclassified 1710
144 Ga0070701_10065687 3300005438 Unclassified 1926
145 Ga0070701_10148349 3300005438 Bacteria 1348
146 Ga0070711_100009101 3300005439 Bacteria 6104
147 Ga0070711_100020289 3300005439 Bacteria 4281
148 Ga0070711_100052373 3300005439 Bacteria 2808
149 Ga0070711_100059847 3300005439 Bacteria 2646
150 Ga0070711_100073974 3300005439 Bacteria 2409
151 Ga0070711_100272977 3300005439 Bacteria 1335
152 Ga0070705_100142961 3300005440 Bacteria 1577
153 Ga0070705_100209612 3300005440 Unclassified 1342
154 Ga0070708_100012981 3300005445 Bacteria 6806
155 Ga0070708_100016263 3300005445 Bacteria 6169
156 Ga0070708_100093006 3300005445 Bacteria 2748
157 Ga0070708_100114653 3300005445 Bacteria 2480
158 Ga0070708_100149752 3300005445 Unclassified 2169
159 Ga0070708_100397893 3300005445 Bacteria 1299
160 Ga0070708_100560249 3300005445 Bacteria 1078
161 Ga0070708_100571817 3300005445 Unclassified 1066
162 Ga0070663_100054849 3300005455 Bacteria 2851
163 Ga0070663_100058366 3300005455 Bacteria 2771
164 Ga0070663_100175994 3300005455 Unclassified 1657
165 Ga0070663_100274827 3300005455 Bacteria 1341
166 Ga0070663_100475845 3300005455 Bacteria 1033
167 Ga0070678_100001511 3300005456 Bacteria 12415
168 Ga0070678_100081424 3300005456 Bacteria 2454
169 Ga0070678_100244042 3300005456 Bacteria 1503
170 Ga0070678_100386453 3300005456 Unclassified 1212
171 Ga0070678_100467434 3300005456 Bacteria 1107
172 Ga0070662_100004281 3300005457 Bacteria 9009
173 Ga0070662_100020616 3300005457 Bacteria 4493
174 Ga0070662_100122247 3300005457 Bacteria 1997
175 Ga0070662_100136066 3300005457 Bacteria 1900
176 Ga0070662_100513572 3300005457 Bacteria 1000
177 Ga0070662_100653478 3300005457 Unclassified 887
178 Ga0070681_10008798 3300005458 Bacteria 9910
179 Ga0070681_10024791 3300005458 Bacteria 6034
180 Ga0070681_10053126 3300005458 Bacteria 4037
181 Ga0070681_10108514 3300005458 Bacteria 2716
182 Ga0070681_10133261 3300005458 Bacteria 2416
183 Ga0070681_10208287 3300005458 Bacteria 1872
184 Ga0070681_10265321 3300005458 Bacteria 1629
185 Ga0070681_10334608 3300005458 Bacteria 1423
186 Ga0070681_10347694 3300005458 Bacteria 1393
187 Ga0068867_100009379 3300005459 Bacteria 6907
188 Ga0068867_100009657 3300005459 Bacteria 6801
189 Ga0068867_100024489 3300005459 Bacteria 4325
190 Ga0068867_100140153 3300005459 Bacteria 1889
191 Ga0068867_100365336 3300005459 Bacteria 1208
192 Ga0070685_10001292 3300005466 Bacteria 13193
193 Ga0070685_10049290 3300005466 Bacteria 2429
194 Ga0070706_100000210 3300005467 Bacteria 71893
195 Ga0070706_100006435 3300005467 Bacteria 11091
196 Ga0070706_100006577 3300005467 Bacteria 10965
197 Ga0070706_100030278 3300005467 Bacteria 4986
198 Ga0070706_100105963 3300005467 Bacteria 2616
199 Ga0070706_100129399 3300005467 Bacteria 2355
200 Ga0070706_100232835 3300005467 Bacteria 1720
201 Ga0070706_100387582 3300005467 Bacteria 1301
202 Ga0070707_100000292 3300005468 Bacteria 49172
203 Ga0070707_100003721 3300005468 Bacteria 14386
204 Ga0070707_100040915 3300005468 Bacteria 4434
205 Ga0070707_100048002 3300005468 Bacteria 4089
206 Ga0070707_100055022 3300005468 Bacteria 3814
207 Ga0070707_100059000 3300005468 Bacteria 3681
208 Ga0070707_100097107 3300005468 Bacteria 2854
209 Ga0070707_100540769 3300005468 Bacteria 1127
210 Ga0070698_100001836 3300005471 Bacteria 23657
211 Ga0070698_100191656 3300005471 Bacteria 1982
212 Ga0070698_100240349 3300005471 Bacteria 1744
213 Ga0070699_100021584 3300005518 Bacteria 5553
214 Ga0070679_100002074 3300005530 Bacteria 18031
215 Ga0070679_100040259 3300005530 Bacteria 4649
216 Ga0070679_100080351 3300005530 Bacteria 3250
217 Ga0070679_100196450 3300005530 Unclassified 1985
218 Ga0070684_100000137 3300005535 Bacteria 48587
219 Ga0070684_100001423 3300005535 Bacteria 17232
220 Ga0070684_100002839 3300005535 Bacteria 12871
221 Ga0070684_100119308 3300005535 Bacteria 2372
222 Ga0070684_100170382 3300005535 Bacteria 1977
223 Ga0070684_100211723 3300005535 Bacteria 1766
224 Ga0070684_100375899 3300005535 Bacteria 1308
225 Ga0070684_100416035 3300005535 Bacteria 1241
226 Ga0070684_100540894 3300005535 Bacteria 1080
227 Ga0070697_100000826 3300005536 Bacteria 23247
228 Ga0070697_100003773 3300005536 Bacteria 11628
229 Ga0070697_100016162 3300005536 Bacteria 5868
230 Ga0070697_100050516 3300005536 Bacteria 3375
231 Ga0070697_100078461 3300005536 Bacteria 2717
232 Ga0070697_100174796 3300005536 Bacteria 1819
233 Ga0070697_100196704 3300005536 Bacteria 1713
234 Ga0070697_100272563 3300005536 Bacteria 1451
235 Ga0070697_100414151 3300005536 Unclassified 1171
236 Ga0068853_100008308 3300005539 Bacteria 8336
237 Ga0068853_100036717 3300005539 Bacteria 4168
238 Ga0068853_100064371 3300005539 Bacteria 3179
239 Ga0068853_100095321 3300005539 Bacteria 2624
240 Ga0068853_100119967 3300005539 Bacteria 2345
241 Ga0068853_100193688 3300005539 Bacteria 1848
242 Ga0068853_100485340 3300005539 Bacteria 1165
243 Ga0070672_100000353 3300005543 Bacteria 26400
244 Ga0070672_100004247 3300005543 Bacteria 9368
245 Ga0070672_100128304 3300005543 Bacteria 2082
246 Ga0070686_100005280 3300005544 Bacteria 7141
247 Ga0070686_100066137 3300005544 Bacteria 2350
248 Ga0070686_100146526 3300005544 Bacteria 1649
249 Ga0070695_100001197 3300005545 Bacteria 14284
250 Ga0070695_100142211 3300005545 Bacteria 1665
251 Ga0070696_100001670 3300005546 Bacteria 14549
252 Ga0070696_100082401 3300005546 Bacteria 2280
253 Ga0070696_100357681 3300005546 Bacteria 1132
254 Ga0070693_100312613 3300005547 Bacteria 1063
255 Ga0070665_100013901 3300005548 Bacteria 8098
256 Ga0070665_100024919 3300005548 Bacteria 6029
257 Ga0070665_100067248 3300005548 Bacteria 3594
258 Ga0070665_100076888 3300005548 Bacteria 3344
259 Ga0070665_100120258 3300005548 Bacteria 2628
260 Ga0070665_100177238 3300005548 Bacteria 2132
261 Ga0070665_100399655 3300005548 Bacteria 1382
262 Ga0070704_100159839 3300005549 Bacteria 1781
263 Ga0070704_100211736 3300005549 Bacteria 1571
264 Ga0068855_100005394 3300005563 Bacteria 15600
265 Ga0068855_100007676 3300005563 Bacteria 13033
266 Ga0068855_100025048 3300005563 Bacteria 7141
267 Ga0068855_100037209 3300005563 Bacteria 5789
268 Ga0068855_100089630 3300005563 Bacteria 3551
269 Ga0068855_100113772 3300005563 Bacteria 3104
270 Ga0068855_100116695 3300005563 Bacteria 3059
271 Ga0068855_100123182 3300005563 Bacteria 2966
272 Ga0068855_100134644 3300005563 Bacteria 2819
273 Ga0068855_100476329 3300005563 Unclassified 1359
274 Ga0068855_100597836 3300005563 Bacteria 1190
275 Ga0068855_100721609 3300005563 Unclassified 1065
276 Ga0068855_100918952 3300005563 Bacteria 923
277 Ga0070664_100017663 3300005564 Bacteria 5858
278 Ga0070664_100078302 3300005564 Bacteria 2844
279 Ga0070664_100237416 3300005564 Bacteria 1635
280 Ga0068857_100000617 3300005577 Bacteria 26156
281 Ga0068857_100001133 3300005577 Bacteria 20806
282 Ga0068857_100001770 3300005577 Bacteria 17362
283 Ga0068857_100010318 3300005577 Bacteria 8114
284 Ga0068857_100023624 3300005577 Bacteria 5412
285 Ga0068857_100280766 3300005577 Bacteria 1532
286 Ga0068857_100772085 3300005577 Bacteria 916
287 Ga0068854_100037159 3300005578 Bacteria 3416
288 Ga0068854_100315041 3300005578 Bacteria 1270
289 Ga0068854_100442001 3300005578 Bacteria 1084
290 Ga0068856_100005788 3300005614 Bacteria 12182
291 Ga0068856_100012325 3300005614 Bacteria 8278
292 Ga0068856_100020373 3300005614 Bacteria 6441
293 Ga0068856_100020993 3300005614 Bacteria 6346
294 Ga0068856_100023713 3300005614 Bacteria 5967
295 Ga0068856_100033324 3300005614 Bacteria 5043
296 Ga0068856_100046027 3300005614 Bacteria 4297
297 Ga0068856_100067056 3300005614 Bacteria 3546
298 Ga0068856_100170654 3300005614 Bacteria 2187
299 Ga0068856_100179201 3300005614 Bacteria 2132
300 Ga0070702_100034390 3300005615 Bacteria 2793
301 Ga0068852_100001223 3300005616 Bacteria 17089
302 Ga0068852_100036119 3300005616 Bacteria 4131
303 Ga0068852_100047160 3300005616 Bacteria 3674
304 Ga0068852_100060159 3300005616 Bacteria 3297
305 Ga0068859_100088488 3300005617 Bacteria 3146
306 Ga0068859_100127003 3300005617 Bacteria 2620
307 Ga0068859_100163092 3300005617 Bacteria 2308
308 Ga0068859_100218277 3300005617 Bacteria 1994
309 Ga0068859_100229921 3300005617 Bacteria 1942
310 Ga0068859_100542893 3300005617 Bacteria 1257
311 Ga0068859_100663175 3300005617 Bacteria 1135
312 Ga0068864_100082569 3300005618 Bacteria 2820
313 Ga0068864_100120162 3300005618 Bacteria 2349
314 Ga0068864_100178050 3300005618 Bacteria 1942
315 Ga0068864_100181131 3300005618 Unclassified 1926
316 Ga0068864_100485200 3300005618 Bacteria 1187
317 Ga0068866_10001380 3300005718 Bacteria 10468
318 Ga0068866_10078124 3300005718 Unclassified 1770
319 Ga0068866_10264386 3300005718 Bacteria 1059
320 Ga0068851_10001352 3300005834 Bacteria 10700
321 Ga0068851_10153097 3300005834 Bacteria 1262
322 Ga0068870_10007394 3300005840 Bacteria 4892
323 Ga0068863_100020550 3300005841 Bacteria 6312
324 Ga0068863_100050282 3300005841 Bacteria 3952
325 Ga0068863_100076165 3300005841 Bacteria 3174
326 Ga0068863_100118116 3300005841 Bacteria 2527
327 Ga0068858_100023794 3300005842 Bacteria 5707
328 Ga0068858_100030549 3300005842 Bacteria 5003
329 Ga0068858_100107866 3300005842 Bacteria 2600
330 Ga0068858_100192996 3300005842 Bacteria 1924
331 Ga0068858_100778034 3300005842 Bacteria 933
332 Ga0068860_100026105 3300005843 Bacteria 5634
333 Ga0068860_100036537 3300005843 Bacteria 4706
334 Ga0068860_100039390 3300005843 Bacteria 4520
335 Ga0068860_100128494 3300005843 Bacteria 2430
336 Ga0068862_100010568 3300005844 Bacteria 7629
337 Ga0068862_100036020 3300005844 Bacteria 4192
338 Ga0068862_100037943 3300005844 Bacteria 4085
339 Ga0081455_10000328 3300005937 Bacteria 62204
340 Ga0081455_10021886 3300005937 Bacteria 5988
341 Ga0081455_10106882 3300005937 Bacteria 2232
342 Ga0081540_1000036 3300005983 Bacteria 140805
343 Ga0081540_1041605 3300005983 Bacteria 2380
344 Ga0081539_10001730 3300005985 Bacteria 34868
345 Ga0070717_10012892 3300006028 Bacteria 6384
346 Ga0070717_10030474 3300006028 Bacteria 4334
347 Ga0070717_10056623 3300006028 Bacteria 3240
348 Ga0070717_10107859 3300006028 Bacteria 2372
349 Ga0070717_10125539 3300006028 Bacteria 2203
350 Ga0070717_10155083 3300006028 Bacteria 1983
351 Ga0070717_10174034 3300006028 Bacteria 1873
352 Ga0070717_10207610 3300006028 Unclassified 1718
353 Ga0070717_10513284 3300006028 Bacteria 1084
354 Ga0070715_10066541 3300006163 Bacteria 1598
355 Ga0070716_100007139 3300006173 Bacteria 5488
356 Ga0070716_100030312 3300006173 Bacteria 2933
357 Ga0070716_100065879 3300006173 Bacteria 2111
358 Ga0070712_100008275 3300006175 Bacteria 6534
359 Ga0070712_100238869 3300006175 Bacteria 1447
360 Ga0070712_100344784 3300006175 Bacteria 1217
361 Ga0070712_100498850 3300006175 Bacteria 1020
362 Ga0070712_100722372 3300006175 Unclassified 851
363 Ga0097621_100007340 3300006237 Bacteria 7880
364 Ga0097621_100037109 3300006237 Bacteria 3902
365 Ga0097621_100053862 3300006237 Bacteria 3279
366 Ga0097621_100056116 3300006237 Bacteria 3217
367 Ga0097621_100056199 3300006237 Bacteria 3215
368 Ga0097621_100122038 3300006237 Bacteria 2211
369 Ga0097621_100150971 3300006237 Bacteria 1992
370 Ga0097621_100379383 3300006237 Bacteria 1262
371 Ga0097621_100484670 3300006237 Bacteria 1118
372 Ga0068871_100010917 3300006358 Bacteria 6651
373 Ga0068871_100020136 3300006358 Bacteria 5106
374 Ga0068871_100044434 3300006358 Bacteria 3573
375 Ga0068871_100048431 3300006358 Bacteria 3431
376 Ga0068871_100055094 3300006358 Bacteria 3227
377 Ga0068871_100058198 3300006358 Bacteria 3146
378 Ga0068871_100100538 3300006358 Bacteria 2422
379 Ga0068871_100119210 3300006358 Bacteria 2227
380 Ga0068871_100168449 3300006358 Bacteria 1876
381 Ga0068871_100206948 3300006358 Bacteria 1696
382 Ga0068871_100405951 3300006358 Bacteria 1214
383 Ga0075428_100006341 3300006844 Bacteria 13159
384 Ga0075428_100069972 3300006844 Bacteria 3836
385 Ga0075430_100160196 3300006846 Bacteria 1873
386 Ga0075431_100026517 3300006847 Bacteria 5945
387 Ga0075433_10202842 3300006852 Bacteria 1763
388 Ga0075434_100046000 3300006871 Bacteria 4331
389 Ga0075434_100098816 3300006871 Bacteria 2924
390 Ga0075434_100788829 3300006871 Unclassified 966
391 Ga0075434_100994532 3300006871 Bacteria 853
392 Ga0068865_100030105 3300006881 Bacteria 3608
393 Ga0068865_100036218 3300006881 Bacteria 3325
394 Ga0068865_100094879 3300006881 Bacteria 2172
395 Ga0068865_100172116 3300006881 Bacteria 1661
396 Ga0075436_100001836 3300006914 Bacteria 14551
397 Ga0075436_100024075 3300006914 Bacteria 4186
398 Ga0075436_100089955 3300006914 Bacteria 2133
399 Ga0075436_100090249 3300006914 Bacteria 2130
400 Ga0075436_100124009 3300006914 Bacteria 1809
401 Ga0097620_100088488 3300006931 Bacteria 3146
402 Ga0097620_100127005 3300006931 Bacteria 2620
403 Ga0097620_100163094 3300006931 Bacteria 2308
404 Ga0097620_100218300 3300006931 Bacteria 1994
405 Ga0097620_100229950 3300006931 Bacteria 1942
406 Ga0097620_100542852 3300006931 Bacteria 1257
407 Ga0097620_100663120 3300006931 Bacteria 1135
408 Ga0097620_100997502 3300006931 Bacteria 920
409 Ga0075435_100084472 3300007076 Bacteria 2612
410 Ga0105250_10021050 3300009092 Bacteria 2633
411 Ga0105240_10000499 3300009093 Bacteria 72315
412 Ga0105240_10026374 3300009093 Bacteria 7622
413 Ga0105240_10027786 3300009093 Bacteria 7403
414 Ga0105240_10110027 3300009093 Bacteria 3335
415 Ga0105240_10113316 3300009093 Bacteria 3277
416 Ga0105240_10124650 3300009093 Bacteria 3098
417 Ga0105240_10154296 3300009093 Bacteria 2733
418 Ga0105240_10191688 3300009093 Bacteria 2403
419 Ga0105240_10227623 3300009093 Bacteria 2169
420 Ga0111539_10078011 3300009094 Bacteria 3898
421 Ga0111539_10140824 3300009094 Bacteria 2824
422 Ga0111539_10221706 3300009094 Bacteria 2202
423 Ga0111539_10261293 3300009094 Bacteria 2015
424 Ga0111539_10356638 3300009094 Bacteria 1702
425 Ga0111539_10385588 3300009094 Bacteria 1632
426 Ga0111539_10397291 3300009094 Bacteria 1606
427 Ga0111539_10597479 3300009094 Bacteria 1285
428 Ga0105245_10005029 3300009098 Bacteria 11625
429 Ga0105245_10006614 3300009098 Bacteria 10180
430 Ga0105245_10029959 3300009098 Bacteria 4812
431 Ga0105245_10095289 3300009098 Bacteria 2746
432 Ga0105245_10141508 3300009098 Bacteria 2266
433 Ga0105245_10232602 3300009098 Bacteria 1783
434 Ga0105245_10261081 3300009098 Bacteria 1686
435 Ga0105245_10339884 3300009098 Bacteria 1484
436 Ga0105245_10568245 3300009098 Unclassified 1157
437 Ga0114129_10000347 3300009147 Bacteria 53984
438 Ga0114129_10038066 3300009147 Bacteria 6786
439 Ga0114129_10257011 3300009147 Bacteria 2343
440 Ga0114129_10476023 3300009147 Bacteria 1635
441 Ga0114129_11045903 3300009147 Bacteria 1025
442 Ga0105243_10028508 3300009148 Bacteria 4287
443 Ga0105243_10103786 3300009148 Bacteria 2365
444 Ga0105243_10643013 3300009148 Bacteria 1027
445 Ga0105241_10002253 3300009174 Bacteria 14494
446 Ga0105241_10008790 3300009174 Bacteria 7421
447 Ga0105241_10014226 3300009174 Bacteria 5829
448 Ga0105241_10038464 3300009174 Bacteria 3606
449 Ga0105241_10064205 3300009174 Bacteria 2834
450 Ga0105242_10054413 3300009176 Bacteria 3271
451 Ga0105242_10253760 3300009176 Bacteria 1586
452 Ga0105242_10382542 3300009176 Bacteria 1309
453 Ga0105242_10402421 3300009176 Bacteria 1278
454 Ga0105248_10050861 3300009177 Bacteria 4649
455 Ga0105248_10094925 3300009177 Bacteria 3358
456 Ga0105248_10147066 3300009177 Bacteria 2659
457 Ga0105248_10160395 3300009177 Bacteria 2537
458 Ga0105248_10163907 3300009177 Bacteria 2506
459 Ga0105248_10178339 3300009177 Bacteria 2394
460 Ga0105248_10178671 3300009177 Bacteria 2392
461 Ga0105248_10222548 3300009177 Bacteria 2125
462 Ga0105248_10302396 3300009177 Bacteria 1801
463 Ga0105248_10591203 3300009177 Bacteria 1252
464 Ga0105248_10718584 3300009177 Bacteria 1127
465 Ga0105248_10756710 3300009177 Bacteria 1096
466 Ga0105237_10007763 3300009545 Bacteria 11701
467 Ga0105237_10019899 3300009545 Bacteria 6928
468 Ga0105237_10022289 3300009545 Bacteria 6498
469 Ga0105237_10026113 3300009545 Bacteria 5968
470 Ga0105237_10059671 3300009545 Bacteria 3816
471 Ga0105237_10082754 3300009545 Bacteria 3200
472 Ga0105237_10105001 3300009545 Bacteria 2817
473 Ga0105237_10133950 3300009545 Bacteria 2472
474 Ga0105237_10245483 3300009545 Bacteria 1792
475 Ga0105237_10518779 3300009545 Bacteria 1198
476 Ga0105238_10002481 3300009551 Bacteria 18468
477 Ga0105238_10030357 3300009551 Bacteria 5501
478 Ga0105238_10041345 3300009551 Bacteria 4668
479 Ga0105238_10059077 3300009551 Bacteria 3842
480 Ga0105238_10085794 3300009551 Bacteria 3136
481 Ga0105238_10088538 3300009551 Bacteria 3082
482 Ga0105238_10101522 3300009551 Bacteria 2859
483 Ga0105238_10163216 3300009551 Bacteria 2204
484 Ga0105238_10180284 3300009551 Bacteria 2089
485 Ga0105238_10503548 3300009551 Bacteria 1212
486 Ga0105249_10013656 3300009553 Bacteria 7171
487 Ga0105249_10481519 3300009553 Bacteria 1284
488 Ga0105239_10006176 3300010375 Bacteria 13938
489 Ga0105239_10023213 3300010375 Bacteria 6835
490 Ga0105239_10025552 3300010375 Bacteria 6501
491 Ga0105239_10029298 3300010375 Bacteria 6053
492 Ga0105239_10053605 3300010375 Bacteria 4424
493 Ga0105239_10070943 3300010375 Bacteria 3827
494 Ga0105239_10134202 3300010375 Bacteria 2755
495 Ga0105239_10482461 3300010375 Bacteria 1408
496 Ga0105239_10891238 3300010375 Unclassified 1021
497 Ga0105246_10002877 3300011119 Bacteria 10417
498 Ga0105246_10029178 3300011119 Bacteria 3631
499 Ga0105246_10125753 3300011119 Bacteria 1907
500 Ga0105246_10216526 3300011119 Bacteria 1498
501 Ga0157373_10001758 3300013100 Bacteria 16488
502 Ga0157373_10001852 3300013100 Bacteria 16057
503 Ga0157373_10034685 3300013100 Bacteria 3624
504 Ga0157371_10002134 3300013102 Bacteria 19252
505 Ga0157371_10171629 3300013102 Bacteria 1550
506 Ga0157370_10011690 3300013104 Bacteria 9162
507 Ga0157370_10014980 3300013104 Bacteria 7905
508 Ga0157370_10021451 3300013104 Bacteria 6437
509 Ga0157370_10032468 3300013104 Bacteria 5098
510 Ga0157370_10036942 3300013104 Bacteria 4738
511 Ga0157370_10039544 3300013104 Bacteria 4558
512 Ga0157370_10082425 3300013104 Bacteria 3025
513 Ga0157370_10094346 3300013104 Bacteria 2807
514 Ga0157370_10114807 3300013104 Bacteria 2516
515 Ga0157369_10002875 3300013105 Bacteria 20565
516 Ga0157369_10004249 3300013105 Bacteria 16965
517 Ga0157369_10015406 3300013105 Bacteria 8617
518 Ga0157369_10077005 3300013105 Bacteria 3575
519 Ga0157369_10103257 3300013105 Bacteria 3037
520 Ga0157369_10106782 3300013105 Bacteria 2979
521 Ga0157369_10115593 3300013105 Bacteria 2849
522 Ga0157369_10143142 3300013105 Bacteria 2529
523 Ga0157369_10146989 3300013105 Bacteria 2492
524 Ga0157369_10156850 3300013105 Bacteria 2404
525 Ga0157369_10172638 3300013105 Bacteria 2277
526 Ga0157369_10194961 3300013105 Bacteria 2128
527 Ga0157369_10316590 3300013105 Bacteria 1622
528 Ga0157369_10520686 3300013105 Bacteria 1230
529 Ga0157374_10001473 3300013296 Bacteria 19879
530 Ga0157374_10012985 3300013296 Bacteria 7260
531 Ga0157374_10027563 3300013296 Bacteria 5128
532 Ga0157374_10071829 3300013296 Bacteria 3264
533 Ga0157374_10094279 3300013296 Bacteria 2860
534 Ga0157374_10126594 3300013296 Bacteria 2470
535 Ga0157374_10128118 3300013296 Bacteria 2455
536 Ga0157374_10132965 3300013296 Bacteria 2409
537 Ga0157374_10143209 3300013296 Bacteria 2321
538 Ga0157374_10271926 3300013296 Bacteria 1671
539 Ga0157378_10005297 3300013297 Bacteria 11331
540 Ga0157378_10065617 3300013297 Bacteria 3249
541 Ga0157378_10071209 3300013297 Unclassified 3122
542 Ga0157378_10089630 3300013297 Bacteria 2794
543 Ga0157378_10091240 3300013297 Bacteria 2769
544 Ga0157378_10103338 3300013297 Bacteria 2603
545 Ga0157378_10158461 3300013297 Bacteria 2115
546 Ga0157378_10160581 3300013297 Bacteria 2101
547 Ga0157378_10241671 3300013297 Bacteria 1725
548 Ga0157378_10310135 3300013297 Bacteria 1530
549 Ga0157378_10352806 3300013297 Unclassified 1437
550 Ga0157378_10477795 3300013297 Unclassified 1241
551 Ga0157378_10508902 3300013297 Bacteria 1204
552 Ga0157378_10526525 3300013297 Bacteria 1184
553 Ga0157378_10542606 3300013297 Bacteria 1167
554 Ga0163162_10003249 3300013306 Bacteria 15541
555 Ga0163162_10016482 3300013306 Bacteria 7219
556 Ga0163162_10063531 3300013306 Bacteria 3735
557 Ga0163162_10098120 3300013306 Bacteria 3019
558 Ga0163162_10226112 3300013306 Bacteria 2001
559 Ga0163162_10607886 3300013306 Bacteria 1219
560 Ga0163162_10666780 3300013306 Bacteria 1163
561 Ga0157372_10002154 3300013307 Bacteria 21421
562 Ga0157372_10003029 3300013307 Bacteria 18103
563 Ga0157372_10003780 3300013307 Bacteria 16254
564 Ga0157372_10016043 3300013307 Bacteria 8034
565 Ga0157372_10055014 3300013307 Bacteria 4442
566 Ga0157372_10063045 3300013307 Bacteria 4155
567 Ga0157372_10142588 3300013307 Bacteria 2762
568 Ga0157372_10156234 3300013307 Bacteria 2635
569 Ga0157372_10171756 3300013307 Bacteria 2508
570 Ga0157372_10176926 3300013307 Bacteria 2470
571 Ga0157372_10296310 3300013307 Bacteria 1881
572 Ga0157372_10348142 3300013307 Bacteria 1726
573 Ga0157375_10000287 3300013308 Bacteria 45998
574 Ga0157375_10057311 3300013308 Bacteria 3850
575 Ga0157375_10058540 3300013308 Bacteria 3812
576 Ga0157375_10159774 3300013308 Bacteria 2395
577 Ga0157375_10177291 3300013308 Bacteria 2281
578 Ga0157375_10260633 3300013308 Bacteria 1895
579 Ga0157375_10317288 3300013308 Bacteria 1723
580 Ga0157375_10540817 3300013308 Bacteria 1327
581 Ga0157375_10547567 3300013308 Unclassified 1319
582 Ga0157375_10772538 3300013308 Bacteria 1111
583 Ga0163163_10001073 3300014325 Bacteria 23224
584 Ga0163163_10001939 3300014325 Bacteria 17512
585 Ga0163163_10058318 3300014325 Bacteria 3817
586 Ga0163163_10099136 3300014325 Bacteria 2935
587 Ga0163163_10103142 3300014325 Bacteria 2876
588 Ga0163163_10106929 3300014325 Bacteria 2824
589 Ga0163163_10471968 3300014325 Unclassified 1315
590 Ga0157380_10030626 3300014326 Bacteria 4123
591 Ga0157380_10177306 3300014326 Bacteria 1869
592 Ga0182008_10009078 3300014497 Bacteria 5384
593 Ga0157377_10000768 3300014745 Bacteria 13272
594 Ga0157377_10495070 3300014745 Bacteria 853
595 Ga0157379_10005366 3300014968 Bacteria 11017
596 Ga0157379_10037071 3300014968 Bacteria 4347
597 Ga0157379_10067428 3300014968 Bacteria 3198
598 Ga0157379_10129398 3300014968 Bacteria 2272
599 Ga0157379_10335650 3300014968 Unclassified 1382
600 Ga0157379_10729915 3300014968 Unclassified 931
601 Ga0157376_10091330 3300014969 Bacteria 2637
602 Ga0157376_10106877 3300014969 Bacteria 2456
603 Ga0157376_10122914 3300014969 Bacteria 2304
604 Ga0157376_10160877 3300014969 Bacteria 2035
605 Ga0157376_10251468 3300014969 Bacteria 1651
606 Ga0157376_10319707 3300014969 Bacteria 1475
607 Ga0182007_10037722 3300015262 Bacteria 1622
608 Ga0163161_10001969 3300017792 Bacteria 14895
609 Ga0197907_10711641 3300020069 Bacteria 4414
610 Ga0197907_11267322 3300020069 Bacteria 5690
611 Ga0206356_10855686 3300020070 Unclassified 1678
612 Ga0206356_11341623 3300020070 Bacteria 2180
613 Ga0206349_1478125 3300020075 Bacteria 3224
614 Ga0206355_1663353 3300020076 Bacteria 1335
615 Ga0206352_10076272 3300020078 Bacteria 16136
616 Ga0206352_10411739 3300020078 Bacteria 3272
617 Ga0206350_10222252 3300020080 Bacteria 28695
618 Ga0206350_10589595 3300020080 Bacteria 4679
619 Ga0206353_11516411 3300020082 Bacteria 2131
620 Ga0213872_10004954 3300021361 Bacteria 6924
621 Ga0213876_10014843 3300021384 Bacteria 4128
622 Ga0213876_10021753 3300021384 Bacteria 3392
623 Ga0213875_10009126 3300021388 Bacteria 5037
624 Ga0224712_10000788 3300022467 Bacteria 6666
625 Ga0207666_1002756 3300025271 Unclassified 2133
626 Ga0207673_1007003 3300025290 Bacteria 1406
627 Ga0207697_10000060 3300025315 Bacteria 45290
628 Ga0207697_10000495 3300025315 Bacteria 22147
629 Ga0207697_10002087 3300025315 Bacteria 10514
630 Ga0207697_10002230 3300025315 Bacteria 10127
631 Ga0207697_10002322 3300025315 Bacteria 9909
632 Ga0207656_10007564 3300025321 Bacteria 3964
633 Ga0207656_10074580 3300025321 Bacteria 1514
634 Ga0207682_10060637 3300025893 Bacteria 1582
635 Ga0207682_10090716 3300025893 Bacteria 1324
636 Ga0207692_10016885 3300025898 Bacteria 3243
637 Ga0207692_10033289 3300025898 Bacteria 2485
638 Ga0207692_10042020 3300025898 Bacteria 2267
639 Ga0207692_10172867 3300025898 Unclassified 1253
640 Ga0207692_10183296 3300025898 Bacteria 1221
641 Ga0207642_10016366 3300025899 Bacteria 2791
642 Ga0207642_10059096 3300025899 Unclassified 1771
643 Ga0207642_10126846 3300025899 Bacteria 1325
644 Ga0207688_10001208 3300025901 Bacteria 13377
645 Ga0207688_10005204 3300025901 Bacteria 7069
646 Ga0207688_10041925 3300025901 Bacteria 2547
647 Ga0207680_10001756 3300025903 Bacteria 10229
648 Ga0207680_10003944 3300025903 Bacteria 7004
649 Ga0207680_10010397 3300025903 Bacteria 4652
650 Ga0207680_10090756 3300025903 Bacteria 1943
651 Ga0207647_10012233 3300025904 Bacteria 5980
652 Ga0207685_10049804 3300025905 Bacteria 1611
653 Ga0207699_10031222 3300025906 Bacteria 2989
654 Ga0207699_10067787 3300025906 Bacteria 2171
655 Ga0207699_10095624 3300025906 Bacteria 1874
656 Ga0207699_10199176 3300025906 Unclassified 1356
657 Ga0207699_10216187 3300025906 Bacteria 1306
658 Ga0207645_10001180 3300025907 Bacteria 21585
659 Ga0207645_10001786 3300025907 Bacteria 17391
660 Ga0207645_10012237 3300025907 Bacteria 5827
661 Ga0207645_10039192 3300025907 Bacteria 3036
662 Ga0207645_10227572 3300025907 Bacteria 1230
663 Ga0207643_10001067 3300025908 Bacteria 16207
664 Ga0207705_10018666 3300025909 Bacteria 4961
665 Ga0207705_10024750 3300025909 Bacteria 4284
666 Ga0207705_10162451 3300025909 Unclassified 1679
667 Ga0207705_10330950 3300025909 Bacteria 1171
668 Ga0207705_10349819 3300025909 Bacteria 1138
669 Ga0207684_10000028 3300025910 Bacteria 306450
670 Ga0207684_10003766 3300025910 Bacteria 14658
671 Ga0207684_10025317 3300025910 Bacteria 5056
672 Ga0207684_10226835 3300025910 Bacteria 1612
673 Ga0207684_10255372 3300025910 Bacteria 1512
674 Ga0207684_10343344 3300025910 Unclassified 1286
675 Ga0207654_10004384 3300025911 Bacteria 7113
676 Ga0207654_10007168 3300025911 Bacteria 5615
677 Ga0207654_10027698 3300025911 Bacteria 3082
678 Ga0207654_10106174 3300025911 Bacteria 1739
679 Ga0207654_10125899 3300025911 Bacteria 1615
680 Ga0207654_10128681 3300025911 Bacteria 1600
681 Ga0207654_10137910 3300025911 Bacteria 1552
682 Ga0207707_10003242 3300025912 Bacteria 14445
683 Ga0207707_10034988 3300025912 Bacteria 4393
684 Ga0207707_10045399 3300025912 Bacteria 3829
685 Ga0207707_10175645 3300025912 Bacteria 1871
686 Ga0207695_10004731 3300025913 Bacteria 18438
687 Ga0207695_10008431 3300025913 Bacteria 12906
688 Ga0207695_10008978 3300025913 Bacteria 12441
689 Ga0207695_10012958 3300025913 Bacteria 9966
690 Ga0207695_10023451 3300025913 Bacteria 6971
691 Ga0207695_10024322 3300025913 Bacteria 6818
692 Ga0207695_10091221 3300025913 Bacteria 3061
693 Ga0207695_10095948 3300025913 Bacteria 2968
694 Ga0207695_10161793 3300025913 Bacteria 2169
695 Ga0207695_10348021 3300025913 Bacteria 1369
696 Ga0207671_10015121 3300025914 Bacteria 6064
697 Ga0207671_10015173 3300025914 Bacteria 6050
698 Ga0207671_10041156 3300025914 Bacteria 3420
699 Ga0207671_10063120 3300025914 Bacteria 2752
700 Ga0207671_10063566 3300025914 Bacteria 2743
701 Ga0207671_10070079 3300025914 Bacteria 2613
702 Ga0207671_10081254 3300025914 Bacteria 2430
703 Ga0207671_10497170 3300025914 Bacteria 972
704 Ga0207693_10053617 3300025915 Bacteria 3164
705 Ga0207693_10167316 3300025915 Bacteria 1731
706 Ga0207693_10359693 3300025915 Bacteria 1139
707 Ga0207693_10375100 3300025915 Bacteria 1113
708 Ga0207693_10437479 3300025915 Bacteria 1022
709 Ga0207663_10013416 3300025916 Bacteria 4454
710 Ga0207663_10019058 3300025916 Bacteria 3857
711 Ga0207663_10060187 3300025916 Bacteria 2406
712 Ga0207663_10094020 3300025916 Bacteria 1997
713 Ga0207663_10298337 3300025916 Unclassified 1203
714 Ga0207660_10004348 3300025917 Bacteria 9236
715 Ga0207660_10008669 3300025917 Bacteria 6578
716 Ga0207660_10102482 3300025917 Bacteria 2140
717 Ga0207660_10255379 3300025917 Unclassified 1384
718 Ga0207662_10001544 3300025918 Bacteria 11236
719 Ga0207657_10003364 3300025919 Bacteria 17093
720 Ga0207657_10004069 3300025919 Bacteria 15518
721 Ga0207657_10009917 3300025919 Bacteria 9532
722 Ga0207657_10096007 3300025919 Bacteria 2466
723 Ga0207657_10228881 3300025919 Bacteria 1487
724 Ga0207649_10001087 3300025920 Bacteria 16517
725 Ga0207649_10244342 3300025920 Bacteria 1290
726 Ga0207652_10002066 3300025921 Bacteria 17278
727 Ga0207652_10057208 3300025921 Bacteria 3358
728 Ga0207652_10160096 3300025921 Bacteria 2018
729 Ga0207646_10003177 3300025922 Bacteria 18788
730 Ga0207646_10005640 3300025922 Bacteria 13143
731 Ga0207646_10005692 3300025922 Bacteria 13070
732 Ga0207646_10030370 3300025922 Bacteria 4899
733 Ga0207646_10186558 3300025922 Unclassified 1873
734 Ga0207646_10194332 3300025922 Bacteria 1832
735 Ga0207646_10238646 3300025922 Bacteria 1642
736 Ga0207646_10599667 3300025922 Bacteria 989
737 Ga0207681_10004055 3300025923 Bacteria 9086
738 Ga0207681_10070214 3300025923 Bacteria 2438
739 Ga0207681_10449871 3300025923 Bacteria 1048
740 Ga0207694_10003217 3300025924 Bacteria 13018
741 Ga0207694_10011837 3300025924 Bacteria 6580
742 Ga0207694_10013095 3300025924 Bacteria 6246
743 Ga0207694_10013585 3300025924 Bacteria 6136
744 Ga0207694_10040557 3300025924 Bacteria 3585
745 Ga0207694_10109854 3300025924 Bacteria 2193
746 Ga0207694_10165476 3300025924 Bacteria 1788
747 Ga0207694_10414454 3300025924 Bacteria 1121
748 Ga0207650_10000152 3300025925 Bacteria 83134
749 Ga0207650_10010071 3300025925 Bacteria 6476
750 Ga0207650_10174496 3300025925 Bacteria 1710
751 Ga0207650_10199446 3300025925 Bacteria 1602
752 Ga0207650_10263594 3300025925 Bacteria 1398
753 Ga0207659_10003498 3300025926 Bacteria 9434
754 Ga0207659_10004773 3300025926 Bacteria 8219
755 Ga0207659_10010234 3300025926 Bacteria 5884
756 Ga0207659_10178339 3300025926 Bacteria 1681
757 Ga0207659_10191095 3300025926 Bacteria 1629
758 Ga0207659_10493672 3300025926 Bacteria 1035
759 Ga0207687_10012876 3300025927 Bacteria 5467
760 Ga0207687_10021422 3300025927 Bacteria 4295
761 Ga0207687_10050273 3300025927 Bacteria 2901
762 Ga0207687_10113163 3300025927 Bacteria 2018
763 Ga0207687_10186144 3300025927 Bacteria 1612
764 Ga0207700_10006981 3300025928 Bacteria 6872
765 Ga0207700_10025877 3300025928 Bacteria 4083
766 Ga0207700_10044731 3300025928 Bacteria 3261
767 Ga0207700_10097109 3300025928 Unclassified 2341
768 Ga0207700_10230802 3300025928 Bacteria 1573
769 Ga0207700_10289360 3300025928 Bacteria 1412
770 Ga0207700_10335323 3300025928 Bacteria 1314
771 Ga0207664_10000909 3300025929 Bacteria 19988
772 Ga0207664_10002006 3300025929 Bacteria 13411
773 Ga0207664_10019697 3300025929 Bacteria 4993
774 Ga0207664_10039554 3300025929 Bacteria 3661
775 Ga0207664_10046667 3300025929 Bacteria 3401
776 Ga0207664_10071614 3300025929 Bacteria 2793
777 Ga0207664_10094896 3300025929 Bacteria 2453
778 Ga0207664_10177890 3300025929 Bacteria 1825
779 Ga0207664_10275663 3300025929 Bacteria 1475
780 Ga0207664_10329846 3300025929 Unclassified 1348
781 Ga0207664_10492672 3300025929 Bacteria 1097
782 Ga0207644_10003335 3300025931 Bacteria 10358
783 Ga0207644_10017665 3300025931 Bacteria 4822
784 Ga0207644_10076737 3300025931 Bacteria 2459
785 Ga0207644_10096632 3300025931 Bacteria 2212
786 Ga0207644_10161647 3300025931 Bacteria 1741
787 Ga0207690_10055956 3300025932 Bacteria 2659
788 Ga0207706_10000740 3300025933 Bacteria 34067
789 Ga0207706_10008197 3300025933 Bacteria 9637
790 Ga0207706_10029663 3300025933 Bacteria 4882
791 Ga0207706_10095009 3300025933 Bacteria 2622
792 Ga0207706_10121963 3300025933 Bacteria 2292
793 Ga0207706_10264204 3300025933 Bacteria 1502
794 Ga0207706_10264880 3300025933 Bacteria 1500
795 Ga0207686_10003275 3300025934 Bacteria 8702
796 Ga0207686_10014551 3300025934 Bacteria 4383
797 Ga0207686_10086300 3300025934 Bacteria 2061
798 Ga0207686_10172353 3300025934 Bacteria 1527
799 Ga0207686_10191771 3300025934 Bacteria 1457
800 Ga0207686_10368417 3300025934 Bacteria 1086
801 Ga0207709_10024829 3300025935 Bacteria 3427
802 Ga0207709_10042044 3300025935 Bacteria 2747
803 Ga0207709_10341528 3300025935 Bacteria 1127
804 Ga0207670_10024662 3300025936 Bacteria 3762
805 Ga0207670_10040360 3300025936 Bacteria 3063
806 Ga0207670_10053443 3300025936 Bacteria 2721
807 Ga0207670_10058550 3300025936 Bacteria 2617
808 Ga0207670_10188175 3300025936 Bacteria 1560
809 Ga0207670_10190987 3300025936 Bacteria 1550
810 Ga0207670_10210717 3300025936 Bacteria 1482
811 Ga0207669_10002532 3300025937 Bacteria 7802
812 Ga0207669_10064158 3300025937 Bacteria 2272
813 Ga0207669_10223840 3300025937 Bacteria 1383
814 Ga0207704_10039043 3300025938 Bacteria 2760
815 Ga0207704_10057335 3300025938 Bacteria 2392
816 Ga0207704_10351970 3300025938 Bacteria 1147
817 Ga0207665_10011698 3300025939 Bacteria 5766
818 Ga0207665_10055084 3300025939 Bacteria 2683
819 Ga0207665_10085230 3300025939 Bacteria 2181
820 Ga0207665_10096927 3300025939 Unclassified 2052
821 Ga0207665_10169642 3300025939 Bacteria 1575
822 Ga0207665_10305805 3300025939 Bacteria 1190
823 Ga0207665_10417864 3300025939 Bacteria 1024
824 Ga0207691_10000142 3300025940 Bacteria 66224
825 Ga0207691_10000308 3300025940 Bacteria 48637
826 Ga0207691_10016028 3300025940 Bacteria 7119
827 Ga0207691_10257276 3300025940 Bacteria 1505
828 Ga0207711_10002553 3300025941 Bacteria 16220
829 Ga0207711_10003068 3300025941 Bacteria 14584
830 Ga0207711_10026838 3300025941 Bacteria 4834
831 Ga0207711_10333900 3300025941 Bacteria 1402
832 Ga0207689_10000618 3300025942 Bacteria 33979
833 Ga0207689_10053357 3300025942 Bacteria 3331
834 Ga0207689_10168013 3300025942 Bacteria 1807
835 Ga0207689_10560885 3300025942 Unclassified 959
836 Ga0207661_10000023 3300025944 Bacteria 197512
837 Ga0207661_10007082 3300025944 Bacteria 7965
838 Ga0207661_10021824 3300025944 Bacteria 4805
839 Ga0207661_10032868 3300025944 Bacteria 4023
840 Ga0207661_10072611 3300025944 Bacteria 2815
841 Ga0207661_10086509 3300025944 Bacteria 2601
842 Ga0207661_10154223 3300025944 Bacteria 1988
843 Ga0207661_10163363 3300025944 Bacteria 1933
844 Ga0207679_10000298 3300025945 Bacteria 37205
845 Ga0207679_10314870 3300025945 Bacteria 1353
846 Ga0207667_10003860 3300025949 Bacteria 18438
847 Ga0207667_10008786 3300025949 Bacteria 11963
848 Ga0207667_10012357 3300025949 Bacteria 9846
849 Ga0207667_10097712 3300025949 Bacteria 3030
850 Ga0207667_10153929 3300025949 Bacteria 2366
851 Ga0207667_10212694 3300025949 Bacteria 1982
852 Ga0207667_10359759 3300025949 Bacteria 1484
853 Ga0207667_10547997 3300025949 Unclassified 1170
854 Ga0207651_10008879 3300025960 Bacteria 5458
855 Ga0207651_10035896 3300025960 Bacteria 3230
856 Ga0207651_10038658 3300025960 Bacteria 3139
857 Ga0207651_10051410 3300025960 Bacteria 2803
858 Ga0207651_10097059 3300025960 Bacteria 2175
859 Ga0207651_10288404 3300025960 Bacteria 1360
860 Ga0207651_10613734 3300025960 Bacteria 952
861 Ga0207712_10029086 3300025961 Bacteria 3703
862 Ga0207712_10235345 3300025961 Bacteria 1473
863 Ga0207712_10309292 3300025961 Bacteria 1300
864 Ga0207668_10019735 3300025972 Bacteria 4267
865 Ga0207668_10027206 3300025972 Bacteria 3724
866 Ga0207668_10182042 3300025972 Bacteria 1658
867 Ga0207640_10313409 3300025981 Bacteria 1246
868 Ga0207658_10003391 3300025986 Bacteria 11277
869 Ga0207658_10051112 3300025986 Bacteria 3044
870 Ga0207658_10199370 3300025986 Bacteria 1670
871 Ga0207658_10219513 3300025986 Bacteria 1599
872 Ga0207658_10247036 3300025986 Unclassified 1515
873 Ga0207658_10339869 3300025986 Bacteria 1304
874 Ga0207677_10010267 3300026023 Bacteria 5295
875 Ga0207677_10078244 3300026023 Unclassified 2361
876 Ga0207677_10367612 3300026023 Bacteria 1210
877 Ga0207703_10023476 3300026035 Bacteria 4844
878 Ga0207703_10059694 3300026035 Bacteria 3116
879 Ga0207703_10080651 3300026035 Bacteria 2710
880 Ga0207703_10104116 3300026035 Bacteria 2410
881 Ga0207639_10003445 3300026041 Bacteria 10647
882 Ga0207639_10034659 3300026041 Bacteria 3732
883 Ga0207639_10118501 3300026041 Bacteria 2171
884 Ga0207639_10121046 3300026041 Bacteria 2150
885 Ga0207639_10165307 3300026041 Bacteria 1869
886 Ga0207639_10611343 3300026041 Unclassified 1006
887 Ga0207678_10003018 3300026067 Bacteria 15226
888 Ga0207678_10023215 3300026067 Bacteria 5426
889 Ga0207678_10266155 3300026067 Unclassified 1469
890 Ga0207708_10068366 3300026075 Bacteria 2719
891 Ga0207708_10578579 3300026075 Bacteria 949
892 Ga0207702_10002606 3300026078 Bacteria 16944
893 Ga0207702_10005439 3300026078 Bacteria 11145
894 Ga0207702_10013988 3300026078 Bacteria 6666
895 Ga0207702_10038642 3300026078 Bacteria 3997
896 Ga0207702_10047058 3300026078 Bacteria 3633
897 Ga0207702_10239063 3300026078 Bacteria 1701
898 Ga0207702_10877097 3300026078 Unclassified 889
899 Ga0207641_10000052 3300026088 Bacteria 173672
900 Ga0207641_10018994 3300026088 Bacteria 5639
901 Ga0207641_10033827 3300026088 Bacteria 4248
902 Ga0207641_10109531 3300026088 Bacteria 2446
903 Ga0207641_10164898 3300026088 Bacteria 2017
904 Ga0207641_10183195 3300026088 Bacteria 1920
905 Ga0207641_10472955 3300026088 Bacteria 1214
906 Ga0207648_10003962 3300026089 Bacteria 15393
907 Ga0207648_10018272 3300026089 Bacteria 6351
908 Ga0207648_10034197 3300026089 Bacteria 4481
909 Ga0207648_10122665 3300026089 Bacteria 2285
910 Ga0207648_10902665 3300026089 Bacteria 825
911 Ga0207676_10000176 3300026095 Bacteria 56110
912 Ga0207676_10031184 3300026095 Bacteria 4008
913 Ga0207676_10111916 3300026095 Bacteria 2286
914 Ga0207676_10138472 3300026095 Bacteria 2080
915 Ga0207676_10358855 3300026095 Bacteria 1350
916 Ga0207676_10417637 3300026095 Unclassified 1257
917 Ga0207674_10000561 3300026116 Bacteria 48618
918 Ga0207674_10003800 3300026116 Bacteria 18420
919 Ga0207674_10013233 3300026116 Bacteria 9170
920 Ga0207674_10019987 3300026116 Bacteria 7247
921 Ga0207674_10123807 3300026116 Bacteria 2551
922 Ga0207674_10206978 3300026116 Bacteria 1911
923 Ga0207674_10259095 3300026116 Bacteria 1686
924 Ga0207674_10446927 3300026116 Bacteria 1249
925 Ga0207675_100005443 3300026118 Bacteria 12201
926 Ga0207675_100150895 3300026118 Bacteria 2211
927 Ga0207675_100417748 3300026118 Bacteria 1324
928 Ga0207675_101021651 3300026118 Bacteria 845
929 Ga0207683_10001978 3300026121 Bacteria 18120
930 Ga0207683_10004854 3300026121 Bacteria 11575
931 Ga0207683_10025868 3300026121 Bacteria 5065
932 Ga0207683_10046837 3300026121 Bacteria 3785
933 Ga0207683_10482435 3300026121 Bacteria 1144
934 Ga0207683_10586629 3300026121 Bacteria 1031
935 Ga0207698_10020106 3300026142 Bacteria 4589
936 Ga0207698_10025672 3300026142 Bacteria 4155
937 Ga0207698_10025720 3300026142 Bacteria 4152
938 Ga0207698_10520667 3300026142 Unclassified 1160
939 Ga0207428_10035093 3300027907 Bacteria 4102
940 Ga0207428_10120599 3300027907 Bacteria 2011
941 Ga0207428_10278963 3300027907 Bacteria 1241
942 Ga0268266_10001266 3300028379 Bacteria 30870
943 Ga0268266_10004179 3300028379 Bacteria 13926
944 Ga0268266_10032276 3300028379 Bacteria 4449
945 Ga0268266_10140561 3300028379 Bacteria 2167
946 Ga0268266_10181199 3300028379 Bacteria 1918
947 Ga0268266_10243094 3300028379 Bacteria 1662
948 Ga0268265_10008088 3300028380 Bacteria 7106
949 Ga0268265_10031143 3300028380 Bacteria 3851
950 Ga0268265_10774708 3300028380 Bacteria 933
951 Ga0268264_10005269 3300028381 Bacteria 10950
952 Ga0268264_10020362 3300028381 Bacteria 5421
953 Ga0268264_10072293 3300028381 Bacteria 2925
954 Ga0268264_10381760 3300028381 Bacteria 1349
955 Ga0268264_10672890 3300028381 Bacteria 1026
956 Ga0265318_10048134 3300028577 Unclassified 1607
957 Ga0265318_10062204 3300028577 Bacteria 1390
958 Ga0265323_10000551 3300028653 Bacteria 20743
959 Ga0265338_10021019 3300028800 Bacteria 6828
960 Ga0265338_10034694 3300028800 Bacteria 4871
961 Ga0265338_10077484 3300028800 Bacteria 2810
962 Ga0265338_10144839 3300028800 Bacteria 1855
963 Ga0265760_10026130 3300031090 Bacteria 1707
964 Ga0265760_10038649 3300031090 Bacteria 1419
965 Ga0265760_10071285 3300031090 Bacteria 1066
966 Ga0265332_10052454 3300031238 Bacteria 1751
967 Ga0265328_10014331 3300031239 Bacteria 3123
968 Ga0265320_10007751 3300031240 Bacteria 6633
969 Ga0265325_10002701 3300031241 Bacteria 11857
970 Ga0265325_10064969 3300031241 Bacteria 1844
971 Ga0265325_10067080 3300031241 Bacteria 1808
972 Ga0265325_10103649 3300031241 Bacteria 1390
973 Ga0265339_10015497 3300031249 Bacteria 4568
974 Ga0265331_10095495 3300031250 Bacteria 1371
975 Ga0265327_10012364 3300031251 Bacteria 5768
976 Ga0265316_10026620 3300031344 Bacteria 4805
977 Ga0265316_10027029 3300031344 Bacteria 4761
978 Ga0265316_10027518 3300031344 Bacteria 4706
979 Ga0265316_10033705 3300031344 Bacteria 4168
980 Ga0265316_10037369 3300031344 Bacteria 3920
981 Ga0265316_10039389 3300031344 Bacteria 3796
982 Ga0265316_10052352 3300031344 Bacteria 3203
983 Ga0265316_10070326 3300031344 Bacteria 2699
984 Ga0265316_10219842 3300031344 Bacteria 1402
985 Ga0265316_10232599 3300031344 Bacteria 1357
986 Ga0265316_10251128 3300031344 Unclassified 1299
987 Ga0265316_10394216 3300031344 Bacteria 998
988 Ga0265313_10005858 3300031595 Bacteria 8917
989 Ga0265313_10134275 3300031595 Bacteria 1069
990 Ga0316579_10006004 3300031691 Bacteria 4933
991 Ga0265314_10000833 3300031711 Bacteria 36549
992 Ga0265314_10005858 3300031711 Bacteria 11002
993 Ga0265314_10079052 3300031711 Bacteria 2175
994 Ga0265314_10081046 3300031711 Bacteria 2140
995 Ga0265342_10041881 3300031712 Bacteria 2769
996 Ga0265342_10042172 3300031712 Bacteria 2758
997 Ga0316576_10050774 3300031727 Bacteria 3017
998 Ga0316578_10012096 3300031728 Bacteria 4541
999 Ga0316577_10010706 3300031733 Bacteria 4957
1000 Ga0307413_10463283 3300031824 Bacteria 1009
1001 Ga0307410_10003818 3300031852 Bacteria 7657
1002 Ga0307412_10178408 3300031911 Bacteria 1595
1003 Ga0307409_100071703 3300031995 Bacteria 2755
1004 Ga0307416_100439073 3300032002 Unclassified 1355
1005 Ga0307415_100530388 3300032126 Bacteria 1035
1006 Ga0373934_0003296 3300035086 Bacteria 5908
1007 Ga0373934_0006348 3300035086 Bacteria 4384
1008 Ga0373923_0005936 3300035111 Bacteria 4180
1009 Ga0373923_0025821 3300035111 Bacteria 2332
1010 Ga0373923_0078546 3300035111 Bacteria 1428
1011 Ga0373936_0030745 3300035113 Bacteria 2118
1012 Ga0373936_0048562 3300035113 Bacteria 1713
1013 Ga0373953_0016064 3300035117 Bacteria 2726
1014 Ga0373953_0034400 3300035117 Bacteria 1986
1015 Ga0373954_0008950 3300035118 Bacteria 4407
1016 Ga0373954_0036606 3300035118 Bacteria 2278
1017 Ga0373954_0055451 3300035118 Bacteria 1865
1018 Ga0373954_0058319 3300035118 Bacteria 1819
1019 Ga0373954_0097328 3300035118 Unclassified 1418
1020 Ga0373954_0131185 3300035118 Bacteria 1220
1021 Ga0373954_0162008 3300035118 Bacteria 1095
1022 Ga0373956_0093199 3300035119 Bacteria 1391
1023 Ga0373957_0091150 3300035120 Bacteria 1212
1024 Ga0373943_0024014 3300035170 Bacteria 2840
1025 Ga0373943_0087273 3300035170 Bacteria 1610
1026 Ga0373943_0176710 3300035170 Bacteria 1171
1027 Ga0373943_0451896 3300035170 Bacteria 747
1028 Ga0373946_0016683 3300035171 Bacteria 2801
1029 Ga0373946_0031037 3300035171 Bacteria 2137
1030 Ga0373955_0011059 3300035172 Bacteria 4286
1031 Ga0373955_0016645 3300035172 Bacteria 3623
1032 Ga0373955_0084562 3300035172 Bacteria 1799
1033 Ga0373955_0103107 3300035172 Bacteria 1640
1034 Ga0373942_0067946 3300035207 Unclassified 1035
1035 Ga0373962_0055991 3300035242 Bacteria 1147
1036 Ga0373924_0135782 3300035410 Unclassified 1072
1037 Ga0373924_0191054 3300035410 Bacteria 902
1038 Ga0373931_0029244 3300035691 Bacteria 2827
1039 Ga0373931_0059249 3300035691 Bacteria 2059
1040 Ga0373931_0068690 3300035691 Bacteria 1929
1041 Ga0373931_0146378 3300035691 Bacteria 1373
1042 Ga0373935_0030347 3300035692 Bacteria 3350
1043 Ga0373935_0037217 3300035692 Bacteria 3044
1044 Ga0373935_0045050 3300035692 Bacteria 2782
1045 Ga0373935_0320186 3300035692 Bacteria 1100
1046 Ga0373935_0482444 3300035692 Bacteria 898
1047 Ga0373927_0001798 3300035695 Bacteria 16005
1048 Ga0373927_0002498 3300035695 Bacteria 13419
1049 Ga0373927_0003041 3300035695 Bacteria 12161
1050 Ga0373927_0046397 3300035695 Bacteria 2811
1051 Ga0373927_0054109 3300035695 Bacteria 2596
1052 Ga0373927_0088990 3300035695 Bacteria 2005
1053 Ga0373927_0205256 3300035695 Bacteria 1294
1054 Ga0373933_0027964 3300035724 Bacteria 3251
1055 Ga0373933_0069483 3300035724 Bacteria 2141
1056 Ga0373933_0100318 3300035724 Bacteria 1796
1057 Ga0373933_0178471 3300035724 Bacteria 1354
1058 Ga0373933_0355986 3300035724 Bacteria 951
1059 Ga0373933_0386866 3300035724 Unclassified 911
1060 Ga0373947_0019414 3300035725 Bacteria 3919
1061 Ga0373947_0052864 3300035725 Bacteria 2448
1062 Ga0373947_0263295 3300035725 Bacteria 1143
1063 Ga0373947_0266253 3300035725 Bacteria 1137
1064 Ga0373937_0002194 3300036401 Bacteria 16322
1065 Ga0373937_0006233 3300036401 Bacteria 10284
1066 Ga0373937_0015396 3300036401 Bacteria 6764
1067 Ga0373937_0041083 3300036401 Bacteria 4219
1068 Ga0373937_0042220 3300036401 Bacteria 4161
1069 Ga0373937_0058015 3300036401 Bacteria 3556
1070 Ga0373937_0090377 3300036401 Bacteria 2836
1071 Ga0373937_0097234 3300036401 Bacteria 2731
1072 Ga0373937_0125227 3300036401 Bacteria 2397
1073 Ga0373937_0288201 3300036401 Bacteria 1551
1074 Ga0373937_0420117 3300036401 Bacteria 1269
1075 Ga0373937_0457692 3300036401 Bacteria 1212
1076 Ga0373937_0472894 3300036401 Bacteria 1190
1077 Ga0316582_0004359 3300036647 Bacteria 7131
1078 Ga0316582_0453055 3300036647 Bacteria 884
1079 Ga0316584_0046061 3300036712 Bacteria 3257
1080 Ga0373925_0006124 3300037068 Bacteria 8887
1081 Ga0373925_0016717 3300037068 Bacteria 5313
1082 Ga0373925_0024354 3300037068 Bacteria 4420
1083 Ga0373925_0032616 3300037068 Bacteria 3834
1084 Ga0373925_0062710 3300037068 Bacteria 2796
1085 Ga0373925_0065985 3300037068 Bacteria 2727
1086 Ga0373925_0116098 3300037068 Bacteria 2073
1087 Ga0373925_0138584 3300037068 Bacteria 1903
1088 Ga0373925_0221979 3300037068 Bacteria 1509
1089 Ga0373925_0433408 3300037068 Bacteria 1075
1090 Ga0395899_0004980 3300037312 Bacteria 10333
1091 Ga0395900_0026327 3300037418 Bacteria 5956
1092 Ga0395900_0028674 3300037418 Bacteria 5705
1093 Ga0395900_0129142 3300037418 Unclassified 2591
1094 Ga0395898_0002044 3300037466 Bacteria 25218
1095 Ga0395898_0038182 3300037466 Bacteria 4761
1096 Ga0395905_0023999 3300037471 Bacteria 5758
1097 Ga0395905_0279271 3300037471 Bacteria 1556
1098 Ga0395905_0402553 3300037471 Bacteria 1264
1099 Ga0316581_0053488 3300037588 Bacteria 1238
1100 Ga0436364_0193186 3300037853 Bacteria 7568
1101 Ga0436364_0227271 3300037853 Bacteria 1097
1102 Ga0395901_0001709 3300038443 Bacteria 22672
1103 Ga0395901_0030557 3300038443 Bacteria 5550
1104 Ga0436365_0920906 3300039437 Bacteria 6588
1105 Ga0436365_0990624 3300039437 Bacteria 1408
1106 Ga0436365_1503121 3300039437 Bacteria 2748
1107 Ga0436365_1765895 3300039437 Bacteria 7734
1108 Ga0436360_0160419 3300039438 Bacteria 997
1109 Ga0436360_0314645 3300039438 Bacteria 1048
1110 Ga0436361_0406086 3300039447 Bacteria 1155
1111 Ga0436361_0754359 3300039447 Bacteria 78520
1112 Ga0436361_0878657 3300039447 Bacteria 1700
1113 Ga0436361_0952691 3300039447 Bacteria 4200
1114 Ga0436362_0433610 3300039453 Bacteria 812
1115 Ga0451853_1799426 3300041512 Bacteria 1436
1116 Ga0439451_021551 3300042009 Bacteria 1300
1117 Ga0450920_018373 3300042122 Bacteria 1338
1118 Ga0450894_002033 3300042131 Bacteria 2788
1119 Ga0450906_009432 3300042145 Bacteria 1862
1120 Ga0450918_004663 3300042531 Bacteria 2486
1121 Ga0451577_0080524 3300042876 Bacteria 2904
1122 Ga0451577_0147926 3300042876 Bacteria 2113
1123 Ga0466966_0371108 3300044684 Unclassified 860
1124 Ga0466961_0441654 3300044693 Unclassified 788
1125 Ga0466963_0003486 3300044694 Bacteria 9022
1126 Ga0466963_0049300 3300044694 Bacteria 2785
1127 Ga0466964_0103678 3300044706 Bacteria 1258
1128 Ga0453684_0025231 3300044712 Bacteria 8640
1129 Ga0453684_0115398 3300044712 Bacteria 3254
1130 Ga0453684_0218075 3300044712 Bacteria 2212
1131 Ga0453684_0240802 3300044712 Bacteria 2083
1132 Ga0453684_0369365 3300044712 Bacteria 1613
1133 Ga0466968_0043236 3300044735 Bacteria 1907
1134 Ga0466957_0055813 3300044842 Bacteria 2414
1135 Ga0466959_0078504 3300045049 Bacteria 2381
1136 Ga0451576_0023038 3300045051 Bacteria 6749
1137 Ga0451576_0026353 3300045051 Bacteria 6254
1138 Ga0451576_0032619 3300045051 Bacteria 5542
1139 Ga0451576_0070018 3300045051 Bacteria 3651
1140 Ga0451576_0972514 3300045051 Bacteria 890
1141 Ga0466958_0005653 3300045836 Bacteria 6751
1142 Ga0466958_0210342 3300045836 Bacteria 1239
1143 Ga0466958_0242527 3300045836 Bacteria 1152
1144 Ga0466967_0001979 3300045976 Bacteria 12433
1145 Ga0466967_0043681 3300045976 Bacteria 3882
1146 Ga0466967_0173695 3300045976 Bacteria 2029
1147 Ga0466967_0608985 3300045976 Bacteria 1078
1148 Ga0495592_0020179 3300046454 Bacteria 5070
1149 Ga0495592_0026186 3300046454 Bacteria 4424
1150 Ga0495592_0053532 3300046454 Bacteria 2993
1151 Ga0495592_0055729 3300046454 Bacteria 2923
1152 Ga0495603_0256616 3300046455 Bacteria 1006
1153 Ga0495629_0000126 3300046459 Bacteria 66833
1154 Ga0495629_0140026 3300046459 Bacteria 1684
1155 Ga0495651_0018367 3300046462 Bacteria 5416
1156 Ga0495653_0029166 3300046463 Bacteria 4409
1157 Ga0495653_0153895 3300046463 Bacteria 1604
1158 Ga0495580_0003198 3300046472 Bacteria 14027
1159 Ga0495580_0003953 3300046472 Bacteria 12504
1160 Ga0495580_0005699 3300046472 Bacteria 10245
1161 Ga0495580_0005942 3300046472 Bacteria 10013
1162 Ga0495580_0008093 3300046472 Bacteria 8388
1163 Ga0495580_0059582 3300046472 Bacteria 2683
1164 Ga0495580_0098540 3300046472 Bacteria 2033
1165 Ga0495580_0223273 3300046472 Unclassified 1294
1166 Ga0495580_0328125 3300046472 Bacteria 1039
1167 Ga0495582_0003850 3300046473 Bacteria 8447
1168 Ga0495582_0029029 3300046473 Bacteria 3037
1169 Ga0495582_0034776 3300046473 Bacteria 2770
1170 Ga0495662_0014703 3300046476 Bacteria 3805
1171 Ga0495662_0015298 3300046476 Bacteria 3728
1172 Ga0495664_0216841 3300046477 Bacteria 1159
1173 Ga0495664_0264886 3300046477 Unclassified 1039
1174 Ga0495664_0290893 3300046477 Bacteria 987
1175 Ga0495594_0009365 3300046499 Bacteria 5059
1176 Ga0495594_0129117 3300046499 Bacteria 1431
1177 Ga0495594_0256951 3300046499 Bacteria 995
1178 Ga0495594_0366945 3300046499 Bacteria 820
1179 Ga0495628_0045730 3300046516 Bacteria 3479
1180 Ga0495628_0057030 3300046516 Bacteria 3073
1181 Ga0495628_0076356 3300046516 Bacteria 2607
1182 Ga0495630_0040363 3300046517 Bacteria 3488
1183 Ga0495630_0152955 3300046517 Bacteria 1756
1184 Ga0495652_0017191 3300046529 Bacteria 6457
1185 Ga0495652_0018013 3300046529 Bacteria 6301
1186 Ga0495652_0137486 3300046529 Bacteria 1925
1187 Ga0495640_0038007 3300046533 Bacteria 3390
1188 Ga0495640_0228277 3300046533 Unclassified 1172
1189 Ga0495640_0244821 3300046533 Bacteria 1124
1190 Ga0495586_0017815 3300046535 Bacteria 3780
1191 Ga0495587_0007817 3300046536 Bacteria 6908
1192 Ga0495645_0003913 3300046543 Bacteria 10152
1193 Ga0495667_0025733 3300046559 Bacteria 3964
1194 Ga0495634_0024544 3300046642 Bacteria 4228
1195 Ga0495634_0052228 3300046642 Bacteria 2740
1196 Ga0495635_0001790 3300046663 Bacteria 14519
1197 Ga0495635_0147645 3300046663 Bacteria 1601
1198 Ga0495635_0172690 3300046663 Bacteria 1470
1199 Ga0495635_0354196 3300046663 Unclassified 979
1200 Ga0495599_0036542 3300046678 Bacteria 3085
1201 Ga0495599_0255299 3300046678 Bacteria 1066
1202 Ga0495623_0035539 3300046679 Bacteria 3193
1203 Ga0495623_0104870 3300046679 Bacteria 1719
1204 Ga0495623_0258784 3300046679 Bacteria 976
1205 Ga0495646_0064649 3300046680 Bacteria 2168
1206 Ga0495647_0001519 3300046681 Bacteria 7163
1207 Ga0495658_0000327 3300046683 Bacteria 26569
1208 Ga0495658_0025563 3300046683 Bacteria 3157
1209 Ga0495658_0083630 3300046683 Bacteria 1878
1210 Ga0495658_0164275 3300046683 Bacteria 1371
1211 Ga0495669_0020683 3300046684 Bacteria 2851
1212 Ga0495669_0063203 3300046684 Unclassified 1679
1213 Ga0495669_0170909 3300046684 Unclassified 1034
1214 Ga0495669_0203945 3300046684 Bacteria 946
1215 Ga0495669_0233829 3300046684 Bacteria 882
1216 Ga0495613_0019720 3300046689 Bacteria 5026
1217 Ga0495613_0025308 3300046689 Bacteria 4422
1218 Ga0495613_0042513 3300046689 Bacteria 3362
1219 Ga0495613_0149423 3300046689 Bacteria 1667
1220 Ga0495613_0391752 3300046689 Unclassified 949
1221 Ga0495600_0164416 3300046809 Bacteria 1434
1222 Ga0495600_0169904 3300046809 Unclassified 1408
1223 Ga0495581_0000280 3300047315 Bacteria 24770
1224 Ga0495604_0106268 3300047317 Bacteria 2054
1225 Ga0495674_0006604 3300047319 Bacteria 11123
1226 Ga0495674_0108606 3300047319 Bacteria 2354
1227 Ga0495674_0218335 3300047319 Bacteria 1577
1228 Ga0495674_0327067 3300047319 Unclassified 1247
1229 Ga0495676_0040130 3300047321 Bacteria 3867
1230 Ga0495676_0302782 3300047321 Unclassified 1078
1231 Ga0495680_0000838 3300047322 Bacteria 34052
1232 Ga0495680_0050036 3300047322 Bacteria 3269
1233 Ga0495680_0210283 3300047322 Bacteria 1393
1234 Ga0495675_0002584 3300047444 Bacteria 10850
1235 Ga0495675_0136612 3300047444 Bacteria 1522
1236 Ga0495675_0178869 3300047444 Unclassified 1300
1237 Ga0495684_0004975 3300047471 Bacteria 10379
1238 Ga0495684_0035564 3300047471 Bacteria 3819
1239 Ga0495684_0047975 3300047471 Bacteria 3265
1240 Ga0495684_0129164 3300047471 Bacteria 1899
1241 Ga0495684_0183139 3300047471 Bacteria 1552
1242 Ga0495684_0183631 3300047471 Bacteria 1549
1243 Ga0495593_0146324 3300047673 Unclassified 1196
1244 Ga0495602_0034630 3300048088 Bacteria 4722
1245 Ga0495602_0220095 3300048088 Bacteria 1434
1246 Ga0495602_0251293 3300048088 Unclassified 1317
1247 Ga0495602_0318104 3300048088 Bacteria 1133
1248 Ga0495602_0469220 3300048088 Bacteria 885
1249 Ga0496100_0296118 3300048903 Bacteria 1210
1250 Ga0496100_0319161 3300048903 Unclassified 1167
1251 Ga0496101_0034045 3300048904 Bacteria 3597
1252 Ga0496101_0398477 3300048904 Bacteria 1084
1253 Ga0496102_0021206 3300048905 Bacteria 5746
1254 Ga0496102_0578043 3300048905 Bacteria 1046
1255 Ga0496104_0069492 3300048907 Bacteria 3348
1256 Ga0496104_0124961 3300048907 Bacteria 2470
1257 Ga0496104_0664271 3300048907 Bacteria 951
1258 Ga0496105_0031988 3300048908 Bacteria 4315
1259 Ga0496105_0548993 3300048908 Bacteria 902
1260 Ga0496106_0196672 3300048909 Bacteria 1604
1261 Ga0496107_0192429 3300048910 Bacteria 1516
1262 Ga0496107_0348825 3300048910 Bacteria 1102
1263 Ga0496108_0000242 3300048911 Bacteria 48793
1264 Ga0496108_0087444 3300048911 Bacteria 2647
1265 Ga0496108_0182628 3300048911 Bacteria 1817
1266 Ga0496108_0435860 3300048911 Bacteria 1145
1267 Ga0496109_0000120 3300048912 Bacteria 81828
1268 Ga0496110_0000795 3300048913 Bacteria 22036
1269 Ga0496110_0028365 3300048913 Bacteria 4808
1270 Ga0496110_0041634 3300048913 Bacteria 4009
1271 Ga0496112_0000198 3300048915 Bacteria 39413
1272 Ga0496112_0003360 3300048915 Bacteria 13207
1273 Ga0496112_0116398 3300048915 Bacteria 2644
1274 Ga0496112_0169995 3300048915 Bacteria 2145
1275 Ga0496112_0259009 3300048915 Unclassified 1689
1276 Ga0496112_0324377 3300048915 Bacteria 1484
1277 Ga0496112_0475350 3300048915 Bacteria 1187
1278 Ga0496113_0000111 3300048916 Bacteria 35094
1279 Ga0496113_0049168 3300048916 Bacteria 3139
1280 Ga0496113_0480848 3300048916 Bacteria 998
1281 Ga0496114_0393737 3300048917 Bacteria 1227
1282 Ga0496115_0018551 3300048918 Bacteria 5344
1283 Ga0496115_0032876 3300048918 Bacteria 4094
1284 Ga0496115_0041211 3300048918 Bacteria 3674
1285 Ga0496115_0134483 3300048918 Bacteria 2039
1286 Ga0496115_0383649 3300048918 Bacteria 1142
1287 Ga0501031_0005420 3300049568 Bacteria 8308
1288 Ga0501032_0003219 3300049569 Bacteria 12559
1289 Ga0501033_0018974 3300049570 Bacteria 5198
1290 Ga0501034_0005315 3300049571 Bacteria 14116
1291 Ga0501034_0053308 3300049571 Bacteria 4073
1292 Ga0501034_0069697 3300049571 Bacteria 3527
1293 Ga0501034_0219476 3300049571 Bacteria 1854
1294 Ga0501034_0235409 3300049571 Bacteria 1779
1295 Ga0501034_0321408 3300049571 Bacteria 1480
1296 Ga0501036_0000166 3300049572 Bacteria 43443
1297 Ga0501036_0096410 3300049572 Bacteria 2500
1298 Ga0501037_0000725 3300049573 Bacteria 24969
1299 Ga0501038_0001071 3300049574 Bacteria 24706
1300 Ga0501039_0005223 3300049575 Bacteria 9835
1301 Ga0501039_0050552 3300049575 Bacteria 3216
1302 Ga0501039_0209295 3300049575 Bacteria 1534
1303 Ga0501040_0071336 3300049576 Bacteria 2398
1304 Ga0501040_0260784 3300049576 Bacteria 1237
1305 Ga0501042_0062732 3300049578 Bacteria 2656
1306 Ga0501042_0200794 3300049578 Bacteria 1438
1307 Ga0501043_0002427 3300049579 Bacteria 15777
1308 Ga0501043_0229661 3300049579 Unclassified 1434
1309 Ga0501046_0111657 3300049580 Bacteria 2087
1310 Ga0501047_0077820 3300049581 Bacteria 3190
1311 Ga0501048_0004510 3300049582 Bacteria 10606
1312 Ga0501067_0103923 3300049583 Bacteria 1578
1313 Ga0501068_0001612 3300049584 Bacteria 12016
1314 Ga0501069_0000541 3300049585 Bacteria 17301
1315 Ga0501070_0018412 3300049586 Bacteria 5859
1316 Ga0501070_0069179 3300049586 Bacteria 2923
1317 Ga0501072_0001111 3300049588 Bacteria 20026
1318 Ga0501072_0022546 3300049588 Bacteria 4882
1319 Ga0501073_0001369 3300049589 Bacteria 18006
1320 Ga0501073_0128900 3300049589 Bacteria 1753
1321 Ga0501074_0005425 3300049590 Bacteria 9170
1322 Ga0501074_0121942 3300049590 Bacteria 1864
1323 Ga0501075_0056221 3300049591 Bacteria 2962
1324 Ga0501076_0003279 3300049592 Bacteria 11337
1325 Ga0501076_0121937 3300049592 Bacteria 2111
1326 Ga0501076_0128536 3300049592 Bacteria 2054
1327 Ga0501076_0149331 3300049592 Bacteria 1901
1328 Ga0501076_0296575 3300049592 Bacteria 1325
1329 Ga0501077_0016527 3300049593 Bacteria 4649
1330 Ga0501079_0540947 3300049741 Bacteria 916
1331 Ga0501080_0001872 3300049742 Bacteria 18101
1332 Ga0501080_0023861 3300049742 Bacteria 5668
1333 Ga0501080_0076641 3300049742 Bacteria 3109
1334 Ga0501080_0309613 3300049742 Bacteria 1431
1335 Ga0501081_0009031 3300049743 Bacteria 6482
1336 Ga0501081_0193196 3300049743 Bacteria 1474
1337 Ga0501083_0023568 3300049744 Bacteria 4267
1338 Ga0501035_0224573 3300049822 Bacteria 1602
1339 Ga0501044_0019407 3300049823 Bacteria 7274
1340 Ga0501045_0206366 3300049824 Bacteria 1464
1341 nmdc:mga05p37_387576_c1 3300050507 Bacteria 1635
1342 nmdc:mga05p37_6378_c1 3300050507 Bacteria 13895
1343 nmdc:mga05p37_67830_c1 3300050507 Bacteria 4388
1344 nmdc:mga05p37_88852_c1 3300050507 Bacteria 3808
1345 nmdc:mga09592_48086_c1 3300050508 Bacteria 3595
1346 nmdc:mga09592_594324_c1 3300050508 Bacteria 948
1347 nmdc:mga0qj67_68418_c1 3300050509 Bacteria 2830
1348 nmdc:mga06r32_251727_c1 3300050510 Bacteria 1754
1349 nmdc:mga06r32_338524_c1 3300050510 Bacteria 1489
1350 nmdc:mga08y16_175843_c1 3300050511 Bacteria 2223
1351 nmdc:mga08y16_43521_c1 3300050511 Bacteria 4706
1352 nmdc:mga08y16_562428_c1 3300050511 Bacteria 1153
1353 nmdc:mga08y16_63396_c1 3300050511 Bacteria 3860
1354 nmdc:mga08y16_78791_c1 3300050511 Bacteria 3435
1355 nmdc:mga0n895_42179_c1 3300050512 Bacteria 4439
1356 nmdc:mga0n895_97680_c1 3300050512 Bacteria 2943
1357 nmdc:mga0rr50_92966_c1 3300050513 Bacteria 2352
1358 nmdc:mga08x19_107812_c1 3300050514 Bacteria 1855
1359 nmdc:mga08x19_22786_c1 3300050514 Bacteria 3880
1360 nmdc:mga08x19_249026_c1 3300050514 Bacteria 1226
1361 nmdc:mga08x19_298846_c1 3300050514 Unclassified 1118
1362 nmdc:mga08x19_437745_c1 3300050514 Bacteria 919
1363 nmdc:mga08x19_876_c1 3300050514 Bacteria 19129
1364 nmdc:mga0a205_456137_c1 3300050515 Bacteria 1138
1365 Ga0495601_0179298 3300053077 Bacteria 1385
1366 Ga0495612_0052164 3300053078 Bacteria 1682
1367 Ga0495619_0001327 3300053085 Bacteria 16220
1368 Ga0495619_0238802 3300053085 Unclassified 1259
1369 Ga0495619_0322967 3300053085 Unclassified 1068
1370 Ga0500568_0002264 3300053139 Bacteria 11497
1371 Ga0500616_0003859 3300053153 Bacteria 11067
1372 Ga0501084_0002720 3300054114 Bacteria 14253
1373 Ga0501084_0200722 3300054114 Bacteria 1683
1374 Ga0501084_0274391 3300054114 Unclassified 1424
1375 Ga0501084_0300223 3300054114 Unclassified 1356
1376 Ga0501084_0952747 3300054114 Bacteria 722
1377 Ga0501082_0000322 3300060353 Bacteria 42523
1378 Ga0501082_0015727 3300060353 Bacteria 6509
1379 Ga0501082_0125774 3300060353 Bacteria 2223
1380 Ga0530510_0014821 3300061734 Bacteria 5504
1381 Ga0530510_0148156 3300061734 Bacteria 1732

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046477 Ga0495664_0216841 Ga0495664_0216841_13_624 200
2 3300044693 Ga0466961_0441654 Ga0466961_0441654_122_775 203
3 3300046679 Ga0495623_0258784 Ga0495623_0258784_24_659 209
4 3300035692 Ga0373935_0482444 Ga0373935_0482444_10_648 210
5 3300044684 Ga0466966_0371108 Ga0466966_0371108_211_849 210
6 3300035170 Ga0373943_0451896 Ga0373943_0451896_20_655 211
7 3300035724 Ga0373933_0355986 Ga0373933_0355986_14_649 211
8 3300046684 Ga0495669_0233829 Ga0495669_0233829_52_687 211
9 3300048916 Ga0496113_0480848 Ga0496113_0480848_286_921 211
10 3300054114 Ga0501084_0952747 Ga0501084_0952747_12_698 215
11 3300046477 Ga0495664_0290893 Ga0495664_0290893_23_682 219
12 3300046684 Ga0495669_0203945 Ga0495669_0203945_277_936 219
13 3300001976 JGI24752J21851_1000767 JGI24752J21851_10007674 226
14 3300001991 JGI24743J22301_10002084 JGI24743J22301_100020842 226
15 3300002076 JGI24749J21850_1007909 JGI24749J21850_10079091 226
16 3300004801 Ga0058860_11998827 Ga0058860_119988274 226
17 3300005329 Ga0070683_100191401 Ga0070683_1001914013 226
18 3300005331 Ga0070670_100103499 Ga0070670_1001034992 226
19 3300005334 Ga0068869_100049372 Ga0068869_1000493723 226
20 3300005337 Ga0070682_100085550 Ga0070682_1000855502 226
21 3300005338 Ga0068868_100011852 Ga0068868_1000118526 226
22 3300005339 Ga0070660_100002901 Ga0070660_10000290110 226
23 3300005340 Ga0070689_100048981 Ga0070689_1000489814 226
24 3300005343 Ga0070687_100000493 Ga0070687_10000049310 226
25 3300005344 Ga0070661_100012073 Ga0070661_1000120737 226
26 3300005347 Ga0070668_100014649 Ga0070668_1000146498 226
27 3300005353 Ga0070669_100007500 Ga0070669_1000075002 226
28 3300005354 Ga0070675_100004817 Ga0070675_10000481713 226
29 3300005356 Ga0070674_100010705 Ga0070674_1000107055 226
30 3300005364 Ga0070673_100042360 Ga0070673_1000423603 226
31 3300005365 Ga0070688_100049229 Ga0070688_1000492292 226
32 3300005366 Ga0070659_100023459 Ga0070659_1000234597 226
33 3300005455 Ga0070663_100058366 Ga0070663_1000583663 226
34 3300005456 Ga0070678_100081424 Ga0070678_1000814243 226
35 3300005459 Ga0068867_100009657 Ga0068867_1000096575 226
36 3300005466 Ga0070685_10001292 Ga0070685_100012928 226
37 3300005539 Ga0068853_100008308 Ga0068853_10000830813 226
38 3300005543 Ga0070672_100128304 Ga0070672_1001283041 226
39 3300005544 Ga0070686_100005280 Ga0070686_10000528011 226
40 3300005563 Ga0068855_100025048 Ga0068855_10002504811 226
41 3300005564 Ga0070664_100017663 Ga0070664_1000176638 226
42 3300005577 Ga0068857_100001133 Ga0068857_10000113317 226
43 3300005578 Ga0068854_100037159 Ga0068854_1000371592 226
44 3300005614 Ga0068856_100033324 Ga0068856_1000333242 226
45 3300005615 Ga0070702_100034390 Ga0070702_1000343903 226
46 3300005616 Ga0068852_100001223 Ga0068852_1000012237 226
47 3300005617 Ga0068859_100229921 Ga0068859_1002299213 226
48 3300005618 Ga0068864_100178050 Ga0068864_1001780503 226
49 3300005718 Ga0068866_10001380 Ga0068866_100013808 226
50 3300005834 Ga0068851_10001352 Ga0068851_100013526 226
51 3300005840 Ga0068870_10007394 Ga0068870_100073941 226
52 3300005841 Ga0068863_100020550 Ga0068863_1000205501 226
53 3300005842 Ga0068858_100023794 Ga0068858_1000237948 226
54 3300005843 Ga0068860_100036537 Ga0068860_1000365376 226
55 3300005844 Ga0068862_100010568 Ga0068862_1000105685 226
56 3300006358 Ga0068871_100119210 Ga0068871_1001192103 226
57 3300006931 Ga0097620_100229950 Ga0097620_1002299501 226
58 3300025315 Ga0207697_10002087 Ga0207697_100020872 226
59 3300025321 Ga0207656_10007564 Ga0207656_100075641 226
60 3300025893 Ga0207682_10060637 Ga0207682_100606372 226
61 3300025899 Ga0207642_10016366 Ga0207642_100163662 226
62 3300025901 Ga0207688_10005204 Ga0207688_100052046 226
63 3300025903 Ga0207680_10001756 Ga0207680_1000175616 226
64 3300025904 Ga0207647_10012233 Ga0207647_100122332 226
65 3300025907 Ga0207645_10001180 Ga0207645_1000118010 226
66 3300025908 Ga0207643_10001067 Ga0207643_100010677 226
67 3300025914 Ga0207671_10070079 Ga0207671_100700794 226
68 3300025918 Ga0207662_10001544 Ga0207662_100015442 226
69 3300025919 Ga0207657_10004069 Ga0207657_1000406925 226
70 3300025920 Ga0207649_10001087 Ga0207649_1000108725 226
71 3300025923 Ga0207681_10070214 Ga0207681_100702142 226
72 3300025926 Ga0207659_10003498 Ga0207659_1000349815 226
73 3300025931 Ga0207644_10003335 Ga0207644_1000333516 226
74 3300025933 Ga0207706_10000740 Ga0207706_1000074025 226
75 3300025936 Ga0207670_10188175 Ga0207670_101881752 226
76 3300025941 Ga0207711_10003068 Ga0207711_100030687 226
77 3300025942 Ga0207689_10000618 Ga0207689_1000061825 226
78 3300025944 Ga0207661_10007082 Ga0207661_100070827 226
79 3300025945 Ga0207679_10000298 Ga0207679_1000029825 226
80 3300025981 Ga0207640_10313409 Ga0207640_103134092 226
81 3300025986 Ga0207658_10003391 Ga0207658_100033916 226
82 3300026023 Ga0207677_10010267 Ga0207677_100102678 226
83 3300026041 Ga0207639_10003445 Ga0207639_100034455 226
84 3300026067 Ga0207678_10003018 Ga0207678_100030185 226
85 3300026089 Ga0207648_10003962 Ga0207648_1000396225 226
86 3300026118 Ga0207675_100005443 Ga0207675_1000054437 226
87 3300026121 Ga0207683_10001978 Ga0207683_100019788 226
88 3300028379 Ga0268266_10001266 Ga0268266_1000126622 226
89 3300028380 Ga0268265_10008088 Ga0268265_1000808812 226
90 3300028381 Ga0268264_10005269 Ga0268264_1000526916 226
91 3300031852 Ga0307410_10003818 Ga0307410_100038182 226
92 3300025921 Ga0207652_10160096 Ga0207652_101600962 228
93 3300045051 Ga0451576_0026353 Ga0451576_0026353_4915_5607 229
94 3300050508 nmdc:mga09592_594324_c1 nmdc:mga09592_594324_c1_14_718 229
95 3300039453 Ga0436362_0433610 Ga0436362_0433610_15_719 231
96 3300025920 Ga0207649_10244342 Ga0207649_102443422 233
97 3300031241 Ga0265325_10064969 Ga0265325_100649692 233
98 3300005563 Ga0068855_100476329 Ga0068855_1004763293 234
99 3300039447 Ga0436361_0754359 Ga0436361_0754359_12679_13398 234
100 3300049592 Ga0501076_0296575 Ga0501076_0296575_244_978 234
101 3300049741 Ga0501079_0540947 Ga0501079_0540947_109_843 234
102 3300061734 Ga0530510_0148156 Ga0530510_0148156_445_1179 234
103 3300025929 Ga0207664_10492672 Ga0207664_104926721 235
104 3300005340 Ga0070689_100047018 Ga0070689_1000470182 236
105 3300005471 Ga0070698_100240349 Ga0070698_1002403492 236
106 3300005563 Ga0068855_100597836 Ga0068855_1005978362 236
107 3300006237 Ga0097621_100037109 Ga0097621_1000371093 236
108 3300006358 Ga0068871_100048431 Ga0068871_1000484316 236
109 3300009093 Ga0105240_10110027 Ga0105240_101100274 236
110 3300013105 Ga0157369_10077005 Ga0157369_100770053 236
111 3300013105 Ga0157369_10156850 Ga0157369_101568504 236
112 3300013307 Ga0157372_10003780 Ga0157372_100037804 236
113 3300014745 Ga0157377_10495070 Ga0157377_104950701 236
114 3300025913 Ga0207695_10095948 Ga0207695_100959482 236
115 3300025929 Ga0207664_10039554 Ga0207664_100395542 236
116 3300026075 Ga0207708_10578579 Ga0207708_105785791 236
117 3300026089 Ga0207648_10122665 Ga0207648_101226653 236
118 3300035111 Ga0373923_0025821 Ga0373923_0025821_467_1219 236
119 3300035170 Ga0373943_0087273 Ga0373943_0087273_725_1477 236
120 3300036401 Ga0373937_0042220 Ga0373937_0042220_857_1609 236
121 3300048088 Ga0495602_0251293 Ga0495602_0251293_127_879 236
122 3300048915 Ga0496112_0169995 Ga0496112_0169995_640_1392 236
123 3300050511 nmdc:mga08y16_78791_c1 nmdc:mga08y16_78791_c1_2014_2751 236
124 3300006871 Ga0075434_100046000 Ga0075434_1000460003 237
125 3300001978 JGI24747J21853_1009156 JGI24747J21853_10091562 238
126 3300002459 JGI24751J29686_10002130 JGI24751J29686_100021303 238
127 3300005293 Ga0065715_10104408 Ga0065715_101044082 238
128 3300005328 Ga0070676_10017267 Ga0070676_100172672 238
129 3300005330 Ga0070690_100000550 Ga0070690_10000055025 238
130 3300005335 Ga0070666_10080569 Ga0070666_100805693 238
131 3300005367 Ga0070667_100167166 Ga0070667_1001671663 238
132 3300005457 Ga0070662_100020616 Ga0070662_1000206164 238
133 3300005535 Ga0070684_100001423 Ga0070684_10000142313 238
134 3300009092 Ga0105250_10021050 Ga0105250_100210502 238
135 3300009094 Ga0111539_10356638 Ga0111539_103566382 238
136 3300009098 Ga0105245_10005029 Ga0105245_100050297 238
137 3300009174 Ga0105241_10014226 Ga0105241_100142264 238
138 3300009177 Ga0105248_10050861 Ga0105248_100508614 238
139 3300009545 Ga0105237_10105001 Ga0105237_101050013 238
140 3300009553 Ga0105249_10481519 Ga0105249_104815192 238
141 3300010375 Ga0105239_10029298 Ga0105239_100292984 238
142 3300011119 Ga0105246_10002877 Ga0105246_1000287717 238
143 3300013100 Ga0157373_10001758 Ga0157373_1000175825 238
144 3300013102 Ga0157371_10002134 Ga0157371_100021348 238
145 3300013105 Ga0157369_10146989 Ga0157369_101469893 238
146 3300013306 Ga0163162_10226112 Ga0163162_102261122 238
147 3300013307 Ga0157372_10002154 Ga0157372_100021549 238
148 3300013308 Ga0157375_10177291 Ga0157375_101772913 238
149 3300014325 Ga0163163_10001073 Ga0163163_1000107325 238
150 3300014745 Ga0157377_10000768 Ga0157377_1000076821 238
151 3300014968 Ga0157379_10005366 Ga0157379_1000536616 238
152 3300017792 Ga0163161_10001969 Ga0163161_1000196924 238
153 3300025911 Ga0207654_10137910 Ga0207654_101379101 238
154 3300025925 Ga0207650_10000152 Ga0207650_1000015256 238
155 3300025940 Ga0207691_10000308 Ga0207691_1000030831 238
156 3300025960 Ga0207651_10051410 Ga0207651_100514102 238
157 3300025961 Ga0207712_10235345 Ga0207712_102353451 238
158 3300026088 Ga0207641_10000052 Ga0207641_1000005224 238
159 3300026095 Ga0207676_10000176 Ga0207676_1000017637 238
160 3300026116 Ga0207674_10000561 Ga0207674_1000056131 238
161 3300031995 Ga0307409_100071703 Ga0307409_1000717033 238
162 3300048904 Ga0496101_0034045 Ga0496101_0034045_436_1188 238
163 3300048905 Ga0496102_0021206 Ga0496102_0021206_1932_2684 238
164 3300048911 Ga0496108_0000242 Ga0496108_0000242_12905_13657 238
165 3300048912 Ga0496109_0000120 Ga0496109_0000120_11530_12282 238
166 3300048913 Ga0496110_0000795 Ga0496110_0000795_12766_13518 238
167 3300048915 Ga0496112_0000198 Ga0496112_0000198_24889_25641 238
168 3300048916 Ga0496113_0000111 Ga0496113_0000111_21610_22362 238
169 3300048918 Ga0496115_0018551 Ga0496115_0018551_1581_2333 238
170 3300005365 Ga0070688_100221371 Ga0070688_1002213711 239
171 3300005435 Ga0070714_100005407 Ga0070714_1000054072 239
172 3300005436 Ga0070713_100001320 Ga0070713_10000132021 239
173 3300005439 Ga0070711_100009101 Ga0070711_10000910110 239
174 3300005544 Ga0070686_100066137 Ga0070686_1000661373 239
175 3300005548 Ga0070665_100067248 Ga0070665_1000672483 239
176 3300005843 Ga0068860_100039390 Ga0068860_1000393907 239
177 3300006028 Ga0070717_10030474 Ga0070717_100304746 239
178 3300014325 Ga0163163_10058318 Ga0163163_100583186 239
179 3300014968 Ga0157379_10037071 Ga0157379_100370717 239
180 3300025916 Ga0207663_10013416 Ga0207663_100134163 239
181 3300025928 Ga0207700_10006981 Ga0207700_1000698110 239
182 3300025929 Ga0207664_10000909 Ga0207664_1000090910 239
183 3300025933 Ga0207706_10121963 Ga0207706_101219633 239
184 3300026075 Ga0207708_10068366 Ga0207708_100683665 239
185 3300026118 Ga0207675_100150895 Ga0207675_1001508954 239
186 3300028800 Ga0265338_10144839 Ga0265338_101448393 239
187 3300031344 Ga0265316_10033705 Ga0265316_100337053 239
188 3300035410 Ga0373924_0135782 Ga0373924_0135782_250_984 239
189 3300035695 Ga0373927_0054109 Ga0373927_0054109_821_1555 239
190 3300042876 Ga0451577_0147926 Ga0451577_0147926_1354_2088 239
191 3300046472 Ga0495580_0098540 Ga0495580_0098540_866_1600 239
192 3300046529 Ga0495652_0137486 Ga0495652_0137486_1157_1891 239
193 3300046663 Ga0495635_0354196 Ga0495635_0354196_223_957 239
194 3300031691 Ga0316579_10006004 Ga0316579_100060047 240
195 3300031733 Ga0316577_10010706 Ga0316577_100107062 240
196 3300042122 Ga0450920_018373 Ga0450920_018373_260_1030 241
197 3300042131 Ga0450894_002033 Ga0450894_002033_1898_2668 241
198 3300042145 Ga0450906_009432 Ga0450906_009432_637_1407 241
199 3300042531 Ga0450918_004663 Ga0450918_004663_1562_2332 241
200 3300049575 Ga0501039_0209295 Ga0501039_0209295_609_1373 241
201 3300049576 Ga0501040_0260784 Ga0501040_0260784_198_962 241
202 3300031344 Ga0265316_10037369 Ga0265316_100373692 243
203 3300049592 Ga0501076_0149331 Ga0501076_0149331_143_949 243
204 3300049571 Ga0501034_0053308 Ga0501034_0053308_219_974 244
205 3300053139 Ga0500568_0002264 Ga0500568_0002264_6172_6921 244
206 3300005546 Ga0070696_100082401 Ga0070696_1000824014 245
207 3300035695 Ga0373927_0001798 Ga0373927_0001798_11545_12297 245
208 3300005329 Ga0070683_100602272 Ga0070683_1006022722 246
209 3300005337 Ga0070682_100106509 Ga0070682_1001065092 246
210 3300005344 Ga0070661_100095814 Ga0070661_1000958144 246
211 3300005366 Ga0070659_100063774 Ga0070659_1000637743 246
212 3300005455 Ga0070663_100054849 Ga0070663_1000548493 246
213 3300005456 Ga0070678_100386453 Ga0070678_1003864532 246
214 3300005458 Ga0070681_10347694 Ga0070681_103476941 246
215 3300005459 Ga0068867_100009379 Ga0068867_1000093799 246
216 3300005468 Ga0070707_100000292 Ga0070707_10000029219 246
217 3300005530 Ga0070679_100040259 Ga0070679_1000402596 246
218 3300005539 Ga0068853_100064371 Ga0068853_1000643713 246
219 3300005539 Ga0068853_100119967 Ga0068853_1001199671 246
220 3300005547 Ga0070693_100312613 Ga0070693_1003126131 246
221 3300005563 Ga0068855_100116695 Ga0068855_1001166953 246
222 3300005577 Ga0068857_100023624 Ga0068857_1000236244 246
223 3300005578 Ga0068854_100315041 Ga0068854_1003150412 246
224 3300005614 Ga0068856_100170654 Ga0068856_1001706542 246
225 3300005618 Ga0068864_100485200 Ga0068864_1004852002 246
226 3300005983 Ga0081540_1041605 Ga0081540_10416056 246
227 3300006237 Ga0097621_100150971 Ga0097621_1001509712 246
228 3300006358 Ga0068871_100168449 Ga0068871_1001684492 246
229 3300006881 Ga0068865_100030105 Ga0068865_1000301053 246
230 3300009098 Ga0105245_10232602 Ga0105245_102326022 246
231 3300009148 Ga0105243_10643013 Ga0105243_106430132 246
232 3300009177 Ga0105248_10178671 Ga0105248_101786714 246
233 3300009551 Ga0105238_10059077 Ga0105238_100590772 246
234 3300009551 Ga0105238_10088538 Ga0105238_100885382 246
235 3300010375 Ga0105239_10482461 Ga0105239_104824613 246
236 3300011119 Ga0105246_10125753 Ga0105246_101257533 246
237 3300013100 Ga0157373_10034685 Ga0157373_100346852 246
238 3300013105 Ga0157369_10106782 Ga0157369_101067824 246
239 3300013296 Ga0157374_10071829 Ga0157374_100718294 246
240 3300013296 Ga0157374_10143209 Ga0157374_101432093 246
241 3300013297 Ga0157378_10091240 Ga0157378_100912402 246
242 3300013297 Ga0157378_10103338 Ga0157378_101033382 246
243 3300013307 Ga0157372_10176926 Ga0157372_101769262 246
244 3300014325 Ga0163163_10103142 Ga0163163_101031423 246
245 3300014497 Ga0182008_10009078 Ga0182008_100090783 246
246 3300014969 Ga0157376_10106877 Ga0157376_101068771 246
247 3300015262 Ga0182007_10037722 Ga0182007_100377222 246
248 3300025909 Ga0207705_10349819 Ga0207705_103498192 246
249 3300025911 Ga0207654_10106174 Ga0207654_101061742 246
250 3300025914 Ga0207671_10063120 Ga0207671_100631203 246
251 3300025917 Ga0207660_10255379 Ga0207660_102553792 246
252 3300025919 Ga0207657_10009917 Ga0207657_100099179 246
253 3300025924 Ga0207694_10003217 Ga0207694_100032178 246
254 3300025924 Ga0207694_10109854 Ga0207694_101098543 246
255 3300025927 Ga0207687_10021422 Ga0207687_100214223 246
256 3300025931 Ga0207644_10096632 Ga0207644_100966324 246
257 3300025933 Ga0207706_10029663 Ga0207706_100296637 246
258 3300025934 Ga0207686_10172353 Ga0207686_101723532 246
259 3300025949 Ga0207667_10153929 Ga0207667_101539292 246
260 3300026041 Ga0207639_10121046 Ga0207639_101210462 246
261 3300026088 Ga0207641_10183195 Ga0207641_101831952 246
262 3300026089 Ga0207648_10018272 Ga0207648_100182725 246
263 3300026116 Ga0207674_10206978 Ga0207674_102069783 246
264 3300026116 Ga0207674_10446927 Ga0207674_104469271 246
265 3300026118 Ga0207675_100417748 Ga0207675_1004177482 246
266 3300035172 Ga0373955_0103107 Ga0373955_0103107_12_752 246
267 3300035410 Ga0373924_0191054 Ga0373924_0191054_142_882 246
268 3300036401 Ga0373937_0457692 Ga0373937_0457692_214_963 246
269 3300044706 Ga0466964_0103678 Ga0466964_0103678_176_925 246
270 3300048904 Ga0496101_0398477 Ga0496101_0398477_22_771 246
271 3300048905 Ga0496102_0578043 Ga0496102_0578043_275_1024 246
272 3300048909 Ga0496106_0196672 Ga0496106_0196672_473_1222 246
273 3300048910 Ga0496107_0348825 Ga0496107_0348825_40_789 246
274 3300048911 Ga0496108_0087444 Ga0496108_0087444_1427_2176 246
275 3300048913 Ga0496110_0041634 Ga0496110_0041634_2067_2816 246
276 3300048915 Ga0496112_0259009 Ga0496112_0259009_32_772 246
277 3300048916 Ga0496113_0049168 Ga0496113_0049168_90_839 246
278 3300054114 Ga0501084_0200722 Ga0501084_0200722_750_1520 246
279 3300005293 Ga0065715_10170240 Ga0065715_101702402 247
280 3300005365 Ga0070688_100044002 Ga0070688_1000440021 247
281 3300005434 Ga0070709_10010621 Ga0070709_100106216 247
282 3300005434 Ga0070709_10084037 Ga0070709_100840373 247
283 3300005434 Ga0070709_10313544 Ga0070709_103135441 247
284 3300005434 Ga0070709_10407690 Ga0070709_104076902 247
285 3300005435 Ga0070714_100016574 Ga0070714_1000165749 247
286 3300005435 Ga0070714_100024289 Ga0070714_1000242892 247
287 3300005435 Ga0070714_100066679 Ga0070714_1000666792 247
288 3300005435 Ga0070714_100074032 Ga0070714_1000740321 247
289 3300005435 Ga0070714_100429656 Ga0070714_1004296562 247
290 3300005436 Ga0070713_100109308 Ga0070713_1001093082 247
291 3300005437 Ga0070710_10059524 Ga0070710_100595243 247
292 3300005437 Ga0070710_10102068 Ga0070710_101020682 247
293 3300005439 Ga0070711_100073974 Ga0070711_1000739743 247
294 3300005467 Ga0070706_100387582 Ga0070706_1003875822 247
295 3300005563 Ga0068855_100721609 Ga0068855_1007216092 247
296 3300005563 Ga0068855_100918952 Ga0068855_1009189521 247
297 3300005577 Ga0068857_100772085 Ga0068857_1007720852 247
298 3300005614 Ga0068856_100005788 Ga0068856_1000057887 247
299 3300005614 Ga0068856_100020373 Ga0068856_1000203738 247
300 3300006028 Ga0070717_10012892 Ga0070717_100128923 247
301 3300006028 Ga0070717_10155083 Ga0070717_101550832 247
302 3300006028 Ga0070717_10513284 Ga0070717_105132842 247
303 3300006163 Ga0070715_10066541 Ga0070715_100665412 247
304 3300006173 Ga0070716_100007139 Ga0070716_1000071393 247
305 3300006173 Ga0070716_100065879 Ga0070716_1000658793 247
306 3300006175 Ga0070712_100008275 Ga0070712_1000082758 247
307 3300006175 Ga0070712_100344784 Ga0070712_1003447843 247
308 3300006358 Ga0068871_100206948 Ga0068871_1002069482 247
309 3300006871 Ga0075434_100098816 Ga0075434_1000988163 247
310 3300006914 Ga0075436_100089955 Ga0075436_1000899551 247
311 3300007076 Ga0075435_100084472 Ga0075435_1000844724 247
312 3300009093 Ga0105240_10154296 Ga0105240_101542966 247
313 3300009174 Ga0105241_10002253 Ga0105241_1000225315 247
314 3300013100 Ga0157373_10001852 Ga0157373_100018526 247
315 3300013104 Ga0157370_10039544 Ga0157370_100395444 247
316 3300013105 Ga0157369_10015406 Ga0157369_1001540611 247
317 3300013296 Ga0157374_10126594 Ga0157374_101265942 247
318 3300013307 Ga0157372_10016043 Ga0157372_100160437 247
319 3300013307 Ga0157372_10055014 Ga0157372_100550142 247
320 3300013307 Ga0157372_10142588 Ga0157372_101425883 247
321 3300013307 Ga0157372_10156234 Ga0157372_101562342 247
322 3300025898 Ga0207692_10016885 Ga0207692_100168853 247
323 3300025898 Ga0207692_10042020 Ga0207692_100420203 247
324 3300025898 Ga0207692_10172867 Ga0207692_101728672 247
325 3300025905 Ga0207685_10049804 Ga0207685_100498041 247
326 3300025906 Ga0207699_10067787 Ga0207699_100677872 247
327 3300025906 Ga0207699_10199176 Ga0207699_101991762 247
328 3300025911 Ga0207654_10004384 Ga0207654_100043841 247
329 3300025915 Ga0207693_10053617 Ga0207693_100536173 247
330 3300025915 Ga0207693_10359693 Ga0207693_103596932 247
331 3300025916 Ga0207663_10019058 Ga0207663_100190583 247
332 3300025928 Ga0207700_10025877 Ga0207700_100258773 247
333 3300025928 Ga0207700_10335323 Ga0207700_103353232 247
334 3300025929 Ga0207664_10019697 Ga0207664_100196977 247
335 3300025929 Ga0207664_10046667 Ga0207664_100466673 247
336 3300025929 Ga0207664_10275663 Ga0207664_102756632 247
337 3300025929 Ga0207664_10329846 Ga0207664_103298462 247
338 3300025939 Ga0207665_10011698 Ga0207665_100116986 247
339 3300025939 Ga0207665_10085230 Ga0207665_100852303 247
340 3300025939 Ga0207665_10096927 Ga0207665_100969271 247
341 3300025949 Ga0207667_10547997 Ga0207667_105479972 247
342 3300026078 Ga0207702_10013988 Ga0207702_100139883 247
343 3300026078 Ga0207702_10047058 Ga0207702_100470583 247
344 3300035113 Ga0373936_0030745 Ga0373936_0030745_903_1655 247
345 3300035113 Ga0373936_0048562 Ga0373936_0048562_548_1300 247
346 3300035170 Ga0373943_0176710 Ga0373943_0176710_310_1062 247
347 3300035171 Ga0373946_0016683 Ga0373946_0016683_1535_2290 247
348 3300035172 Ga0373955_0011059 Ga0373955_0011059_1669_2424 247
349 3300035207 Ga0373942_0067946 Ga0373942_0067946_268_1020 247
350 3300035691 Ga0373931_0068690 Ga0373931_0068690_994_1746 247
351 3300035692 Ga0373935_0320186 Ga0373935_0320186_49_801 247
352 3300035695 Ga0373927_0205256 Ga0373927_0205256_521_1273 247
353 3300035725 Ga0373947_0019414 Ga0373947_0019414_1824_2576 247
354 3300035725 Ga0373947_0052864 Ga0373947_0052864_567_1319 247
355 3300037068 Ga0373925_0032616 Ga0373925_0032616_2026_2778 247
356 3300037068 Ga0373925_0065985 Ga0373925_0065985_1568_2320 247
357 3300037068 Ga0373925_0221979 Ga0373925_0221979_44_796 247
358 3300044735 Ga0466968_0043236 Ga0466968_0043236_383_1135 247
359 3300045049 Ga0466959_0078504 Ga0466959_0078504_1338_2090 247
360 3300045836 Ga0466958_0210342 Ga0466958_0210342_261_1013 247
361 3300045836 Ga0466958_0242527 Ga0466958_0242527_222_974 247
362 3300045976 Ga0466967_0043681 Ga0466967_0043681_989_1741 247
363 3300046472 Ga0495580_0005699 Ga0495580_0005699_46_798 247
364 3300046472 Ga0495580_0005942 Ga0495580_0005942_7372_8124 247
365 3300046472 Ga0495580_0059582 Ga0495580_0059582_1832_2584 247
366 3300046472 Ga0495580_0223273 Ga0495580_0223273_488_1240 247
367 3300046476 Ga0495662_0014703 Ga0495662_0014703_307_1062 247
368 3300046516 Ga0495628_0076356 Ga0495628_0076356_689_1444 247
369 3300046535 Ga0495586_0017815 Ga0495586_0017815_775_1530 247
370 3300046642 Ga0495634_0052228 Ga0495634_0052228_1540_2295 247
371 3300046663 Ga0495635_0147645 Ga0495635_0147645_58_813 247
372 3300046679 Ga0495623_0035539 Ga0495623_0035539_2052_2804 247
373 3300046683 Ga0495658_0164275 Ga0495658_0164275_163_918 247
374 3300047319 Ga0495674_0108606 Ga0495674_0108606_590_1342 247
375 3300047673 Ga0495593_0146324 Ga0495593_0146324_280_1032 247
376 3300048088 Ga0495602_0220095 Ga0495602_0220095_82_834 247
377 3300048088 Ga0495602_0318104 Ga0495602_0318104_125_877 247
378 3300048915 Ga0496112_0003360 Ga0496112_0003360_4229_4981 247
379 3300050512 nmdc:mga0n895_97680_c1 nmdc:mga0n895_97680_c1_676_1428 247
380 3300050513 nmdc:mga0rr50_92966_c1 nmdc:mga0rr50_92966_c1_319_1071 247
381 3300050514 nmdc:mga08x19_107812_c1 nmdc:mga08x19_107812_c1_197_949 247
382 3300050514 nmdc:mga08x19_249026_c1 nmdc:mga08x19_249026_c1_273_1025 247
383 3300005330 Ga0070690_100068053 Ga0070690_1000680534 248
384 3300005340 Ga0070689_100114914 Ga0070689_1001149144 248
385 3300005343 Ga0070687_100113613 Ga0070687_1001136131 248
386 3300005353 Ga0070669_100125216 Ga0070669_1001252162 248
387 3300005354 Ga0070675_100216456 Ga0070675_1002164563 248
388 3300005365 Ga0070688_100122162 Ga0070688_1001221623 248
389 3300005438 Ga0070701_10148349 Ga0070701_101483492 248
390 3300005445 Ga0070708_100093006 Ga0070708_1000930065 248
391 3300005468 Ga0070707_100540769 Ga0070707_1005407692 248
392 3300005536 Ga0070697_100196704 Ga0070697_1001967043 248
393 3300005544 Ga0070686_100146526 Ga0070686_1001465263 248
394 3300005545 Ga0070695_100142211 Ga0070695_1001422112 248
395 3300005549 Ga0070704_100211736 Ga0070704_1002117362 248
396 3300005617 Ga0068859_100088488 Ga0068859_1000884883 248
397 3300006844 Ga0075428_100069972 Ga0075428_1000699726 248
398 3300006852 Ga0075433_10202842 Ga0075433_102028422 248
399 3300006871 Ga0075434_100788829 Ga0075434_1007888292 248
400 3300006881 Ga0068865_100172116 Ga0068865_1001721162 248
401 3300006931 Ga0097620_100088488 Ga0097620_1000884883 248
402 3300009094 Ga0111539_10078011 Ga0111539_100780114 248
403 3300009094 Ga0111539_10140824 Ga0111539_101408243 248
404 3300009094 Ga0111539_10261293 Ga0111539_102612932 248
405 3300009147 Ga0114129_10000347 Ga0114129_1000034742 248
406 3300009177 Ga0105248_10718584 Ga0105248_107185841 248
407 3300013297 Ga0157378_10158461 Ga0157378_101584613 248
408 3300014326 Ga0157380_10177306 Ga0157380_101773063 248
409 3300014969 Ga0157376_10319707 Ga0157376_103197072 248
410 3300021384 Ga0213876_10021753 Ga0213876_100217534 248
411 3300025915 Ga0207693_10437479 Ga0207693_104374791 248
412 3300025922 Ga0207646_10194332 Ga0207646_101943325 248
413 3300025922 Ga0207646_10599667 Ga0207646_105996672 248
414 3300025925 Ga0207650_10263594 Ga0207650_102635942 248
415 3300025926 Ga0207659_10178339 Ga0207659_101783393 248
416 3300025926 Ga0207659_10191095 Ga0207659_101910953 248
417 3300025936 Ga0207670_10024662 Ga0207670_100246623 248
418 3300025936 Ga0207670_10058550 Ga0207670_100585503 248
419 3300025936 Ga0207670_10190987 Ga0207670_101909872 248
420 3300025960 Ga0207651_10288404 Ga0207651_102884043 248
421 3300027907 Ga0207428_10035093 Ga0207428_100350935 248
422 3300027907 Ga0207428_10278963 Ga0207428_102789632 248
423 3300035242 Ga0373962_0055991 Ga0373962_0055991_350_1111 248
424 3300039437 Ga0436365_0920906 Ga0436365_0920906_399_1160 248
425 3300039438 Ga0436360_0160419 Ga0436360_0160419_103_873 248
426 3300045051 Ga0451576_0032619 Ga0451576_0032619_2357_3136 248
427 3300046454 Ga0495592_0055729 Ga0495592_0055729_1211_1987 248
428 3300046517 Ga0495630_0152955 Ga0495630_0152955_501_1262 248
429 3300046678 Ga0495599_0255299 Ga0495599_0255299_158_934 248
430 3300049571 Ga0501034_0069697 Ga0501034_0069697_1742_2521 248
431 3300049571 Ga0501034_0321408 Ga0501034_0321408_616_1395 248
432 3300049572 Ga0501036_0096410 Ga0501036_0096410_665_1444 248
433 3300049575 Ga0501039_0050552 Ga0501039_0050552_279_1058 248
434 3300049579 Ga0501043_0229661 Ga0501043_0229661_279_1058 248
435 3300049580 Ga0501046_0111657 Ga0501046_0111657_1261_2040 248
436 3300049583 Ga0501067_0103923 Ga0501067_0103923_348_1127 248
437 3300049588 Ga0501072_0022546 Ga0501072_0022546_3160_3939 248
438 3300049589 Ga0501073_0128900 Ga0501073_0128900_348_1127 248
439 3300049590 Ga0501074_0121942 Ga0501074_0121942_455_1234 248
440 3300049592 Ga0501076_0128536 Ga0501076_0128536_358_1122 248
441 3300049742 Ga0501080_0076641 Ga0501080_0076641_342_1121 248
442 3300049742 Ga0501080_0309613 Ga0501080_0309613_311_1090 248
443 3300049744 Ga0501083_0023568 Ga0501083_0023568_3357_4136 248
444 3300049822 Ga0501035_0224573 Ga0501035_0224573_119_898 248
445 3300050507 nmdc:mga05p37_6378_c1 nmdc:mga05p37_6378_c1_7920_8693 248
446 3300050508 nmdc:mga09592_48086_c1 nmdc:mga09592_48086_c1_440_1207 248
447 3300050510 nmdc:mga06r32_338524_c1 nmdc:mga06r32_338524_c1_284_1057 248
448 3300050511 nmdc:mga08y16_43521_c1 nmdc:mga08y16_43521_c1_509_1282 248
449 3300050511 nmdc:mga08y16_63396_c1 nmdc:mga08y16_63396_c1_2677_3450 248
450 3300050514 nmdc:mga08x19_437745_c1 nmdc:mga08x19_437745_c1_144_905 248
451 3300050515 nmdc:mga0a205_456137_c1 nmdc:mga0a205_456137_c1_342_1115 248
452 3300053078 Ga0495612_0052164 Ga0495612_0052164_202_963 248
453 3300054114 Ga0501084_0274391 Ga0501084_0274391_344_1108 248
454 3300054114 Ga0501084_0300223 Ga0501084_0300223_392_1171 248
455 3300060353 Ga0501082_0125774 Ga0501082_0125774_341_1120 248
456 3300005617 Ga0068859_100127003 Ga0068859_1001270033 249
457 3300006931 Ga0097620_100127005 Ga0097620_1001270054 249
458 3300009177 Ga0105248_10178339 Ga0105248_101783393 249
459 3300031911 Ga0307412_10178408 Ga0307412_101784082 249
460 3300032002 Ga0307416_100439073 Ga0307416_1004390732 249
461 3300032126 Ga0307415_100530388 Ga0307415_1005303882 249
462 3300035086 Ga0373934_0003296 Ga0373934_0003296_750_1541 249
463 3300035724 Ga0373933_0100318 Ga0373933_0100318_603_1388 249
464 3300042876 Ga0451577_0080524 Ga0451577_0080524_1381_2148 249
465 3300044712 Ga0453684_0115398 Ga0453684_0115398_22_789 249
466 3300049571 Ga0501034_0219476 Ga0501034_0219476_954_1709 249
467 3300049586 Ga0501070_0069179 Ga0501070_0069179_1112_1867 249
468 3300050512 nmdc:mga0n895_42179_c1 nmdc:mga0n895_42179_c1_561_1331 249
469 3300009177 Ga0105248_10160395 Ga0105248_101603955 250
470 3300036647 Ga0316582_0453055 Ga0316582_0453055_60_824 250
471 3300004798 Ga0058859_11505369 Ga0058859_115053691 251
472 3300004803 Ga0058862_12584123 Ga0058862_125841232 251
473 3300005295 Ga0065707_10087316 Ga0065707_100873167 251
474 3300005327 Ga0070658_10004794 Ga0070658_1000479414 251
475 3300005327 Ga0070658_10132457 Ga0070658_101324572 251
476 3300005329 Ga0070683_100000047 Ga0070683_10000004725 251
477 3300005330 Ga0070690_100184741 Ga0070690_1001847412 251
478 3300005330 Ga0070690_100218595 Ga0070690_1002185952 251
479 3300005330 Ga0070690_100435090 Ga0070690_1004350901 251
480 3300005331 Ga0070670_100197847 Ga0070670_1001978472 251
481 3300005335 Ga0070666_10118575 Ga0070666_101185752 251
482 3300005336 Ga0070680_100002147 Ga0070680_1000021474 251
483 3300005336 Ga0070680_100040402 Ga0070680_1000404022 251
484 3300005336 Ga0070680_100411338 Ga0070680_1004113381 251
485 3300005338 Ga0068868_100107994 Ga0068868_1001079943 251
486 3300005338 Ga0068868_100128168 Ga0068868_1001281684 251
487 3300005339 Ga0070660_100006419 Ga0070660_10000641910 251
488 3300005339 Ga0070660_100026381 Ga0070660_1000263812 251
489 3300005340 Ga0070689_100043310 Ga0070689_1000433104 251
490 3300005340 Ga0070689_100111961 Ga0070689_1001119612 251
491 3300005341 Ga0070691_10009940 Ga0070691_100099404 251
492 3300005353 Ga0070669_100222360 Ga0070669_1002223602 251
493 3300005354 Ga0070675_100612724 Ga0070675_1006127241 251
494 3300005355 Ga0070671_100064488 Ga0070671_1000644883 251
495 3300005364 Ga0070673_100050251 Ga0070673_1000502514 251
496 3300005365 Ga0070688_100055152 Ga0070688_1000551524 251
497 3300005365 Ga0070688_100281587 Ga0070688_1002815871 251
498 3300005367 Ga0070667_100320419 Ga0070667_1003204192 251
499 3300005434 Ga0070709_10054134 Ga0070709_100541343 251
500 3300005434 Ga0070709_10100025 Ga0070709_101000253 251
501 3300005434 Ga0070709_10325643 Ga0070709_103256432 251
502 3300005435 Ga0070714_100149549 Ga0070714_1001495492 251
503 3300005435 Ga0070714_100189302 Ga0070714_1001893021 251
504 3300005435 Ga0070714_100210781 Ga0070714_1002107812 251
505 3300005436 Ga0070713_100043833 Ga0070713_1000438333 251
506 3300005436 Ga0070713_100050575 Ga0070713_1000505753 251
507 3300005436 Ga0070713_100289204 Ga0070713_1002892041 251
508 3300005436 Ga0070713_100879812 Ga0070713_1008798121 251
509 3300005438 Ga0070701_10065687 Ga0070701_100656872 251
510 3300005439 Ga0070711_100052373 Ga0070711_1000523732 251
511 3300005439 Ga0070711_100272977 Ga0070711_1002729772 251
512 3300005445 Ga0070708_100397893 Ga0070708_1003978932 251
513 3300005456 Ga0070678_100244042 Ga0070678_1002440423 251
514 3300005457 Ga0070662_100122247 Ga0070662_1001222471 251
515 3300005457 Ga0070662_100136066 Ga0070662_1001360662 251
516 3300005458 Ga0070681_10008798 Ga0070681_100087988 251
517 3300005458 Ga0070681_10053126 Ga0070681_100531264 251
518 3300005458 Ga0070681_10108514 Ga0070681_101085144 251
519 3300005458 Ga0070681_10133261 Ga0070681_101332613 251
520 3300005458 Ga0070681_10208287 Ga0070681_102082872 251
521 3300005458 Ga0070681_10265321 Ga0070681_102653211 251
522 3300005458 Ga0070681_10334608 Ga0070681_103346082 251
523 3300005530 Ga0070679_100002074 Ga0070679_1000020749 251
524 3300005530 Ga0070679_100080351 Ga0070679_1000803513 251
525 3300005530 Ga0070679_100196450 Ga0070679_1001964502 251
526 3300005535 Ga0070684_100000137 Ga0070684_1000001373 251
527 3300005535 Ga0070684_100002839 Ga0070684_1000028395 251
528 3300005535 Ga0070684_100119308 Ga0070684_1001193084 251
529 3300005535 Ga0070684_100170382 Ga0070684_1001703823 251
530 3300005535 Ga0070684_100416035 Ga0070684_1004160351 251
531 3300005535 Ga0070684_100540894 Ga0070684_1005408941 251
532 3300005536 Ga0070697_100174796 Ga0070697_1001747962 251
533 3300005536 Ga0070697_100272563 Ga0070697_1002725632 251
534 3300005539 Ga0068853_100036717 Ga0068853_1000367173 251
535 3300005539 Ga0068853_100095321 Ga0068853_1000953212 251
536 3300005539 Ga0068853_100193688 Ga0068853_1001936882 251
537 3300005539 Ga0068853_100485340 Ga0068853_1004853401 251
538 3300005545 Ga0070695_100001197 Ga0070695_10000119724 251
539 3300005546 Ga0070696_100001670 Ga0070696_10000167017 251
540 3300005548 Ga0070665_100024919 Ga0070665_1000249193 251
541 3300005548 Ga0070665_100399655 Ga0070665_1003996552 251
542 3300005563 Ga0068855_100005394 Ga0068855_10000539410 251
543 3300005563 Ga0068855_100007676 Ga0068855_1000076762 251
544 3300005563 Ga0068855_100037209 Ga0068855_1000372098 251
545 3300005563 Ga0068855_100089630 Ga0068855_1000896303 251
546 3300005563 Ga0068855_100113772 Ga0068855_1001137723 251
547 3300005563 Ga0068855_100123182 Ga0068855_1001231823 251
548 3300005563 Ga0068855_100134644 Ga0068855_1001346443 251
549 3300005577 Ga0068857_100000617 Ga0068857_10000061716 251
550 3300005577 Ga0068857_100001770 Ga0068857_10000177025 251
551 3300005577 Ga0068857_100010318 Ga0068857_1000103182 251
552 3300005577 Ga0068857_100280766 Ga0068857_1002807662 251
553 3300005578 Ga0068854_100442001 Ga0068854_1004420011 251
554 3300005614 Ga0068856_100012325 Ga0068856_10001232511 251
555 3300005614 Ga0068856_100020993 Ga0068856_10002099310 251
556 3300005614 Ga0068856_100023713 Ga0068856_1000237135 251
557 3300005614 Ga0068856_100046027 Ga0068856_1000460272 251
558 3300005614 Ga0068856_100067056 Ga0068856_1000670567 251
559 3300005614 Ga0068856_100179201 Ga0068856_1001792014 251
560 3300005616 Ga0068852_100036119 Ga0068852_1000361196 251
561 3300005616 Ga0068852_100047160 Ga0068852_1000471604 251
562 3300005616 Ga0068852_100060159 Ga0068852_1000601593 251
563 3300005617 Ga0068859_100163092 Ga0068859_1001630923 251
564 3300005617 Ga0068859_100218277 Ga0068859_1002182773 251
565 3300005617 Ga0068859_100663175 Ga0068859_1006631752 251
566 3300005618 Ga0068864_100120162 Ga0068864_1001201623 251
567 3300005834 Ga0068851_10153097 Ga0068851_101530972 251
568 3300005841 Ga0068863_100050282 Ga0068863_1000502823 251
569 3300005841 Ga0068863_100076165 Ga0068863_1000761652 251
570 3300005841 Ga0068863_100118116 Ga0068863_1001181164 251
571 3300005842 Ga0068858_100030549 Ga0068858_1000305499 251
572 3300005842 Ga0068858_100107866 Ga0068858_1001078663 251
573 3300005842 Ga0068858_100192996 Ga0068858_1001929963 251
574 3300005843 Ga0068860_100128494 Ga0068860_1001284943 251
575 3300006028 Ga0070717_10056623 Ga0070717_100566236 251
576 3300006028 Ga0070717_10107859 Ga0070717_101078593 251
577 3300006028 Ga0070717_10207610 Ga0070717_102076102 251
578 3300006175 Ga0070712_100238869 Ga0070712_1002388692 251
579 3300006175 Ga0070712_100498850 Ga0070712_1004988502 251
580 3300006175 Ga0070712_100722372 Ga0070712_1007223721 251
581 3300006237 Ga0097621_100053862 Ga0097621_1000538627 251
582 3300006237 Ga0097621_100056199 Ga0097621_1000561996 251
583 3300006237 Ga0097621_100122038 Ga0097621_1001220384 251
584 3300006237 Ga0097621_100379383 Ga0097621_1003793832 251
585 3300006237 Ga0097621_100484670 Ga0097621_1004846702 251
586 3300006358 Ga0068871_100044434 Ga0068871_1000444344 251
587 3300006358 Ga0068871_100058198 Ga0068871_1000581982 251
588 3300006358 Ga0068871_100100538 Ga0068871_1001005383 251
589 3300006358 Ga0068871_100405951 Ga0068871_1004059512 251
590 3300006844 Ga0075428_100006341 Ga0075428_10000634125 251
591 3300006846 Ga0075430_100160196 Ga0075430_1001601962 251
592 3300006847 Ga0075431_100026517 Ga0075431_1000265172 251
593 3300006881 Ga0068865_100036218 Ga0068865_1000362185 251
594 3300006881 Ga0068865_100094879 Ga0068865_1000948793 251
595 3300006914 Ga0075436_100001836 Ga0075436_10000183625 251
596 3300006931 Ga0097620_100163094 Ga0097620_1001630943 251
597 3300006931 Ga0097620_100218300 Ga0097620_1002183003 251
598 3300006931 Ga0097620_100663120 Ga0097620_1006631202 251
599 3300006931 Ga0097620_100997502 Ga0097620_1009975021 251
600 3300009093 Ga0105240_10000499 Ga0105240_1000049924 251
601 3300009093 Ga0105240_10026374 Ga0105240_100263749 251
602 3300009093 Ga0105240_10027786 Ga0105240_1002778611 251
603 3300009093 Ga0105240_10113316 Ga0105240_101133164 251
604 3300009093 Ga0105240_10124650 Ga0105240_101246503 251
605 3300009093 Ga0105240_10191688 Ga0105240_101916882 251
606 3300009093 Ga0105240_10227623 Ga0105240_102276232 251
607 3300009094 Ga0111539_10221706 Ga0111539_102217062 251
608 3300009094 Ga0111539_10397291 Ga0111539_103972912 251
609 3300009094 Ga0111539_10597479 Ga0111539_105974792 251
610 3300009098 Ga0105245_10029959 Ga0105245_100299595 251
611 3300009098 Ga0105245_10095289 Ga0105245_100952896 251
612 3300009098 Ga0105245_10261081 Ga0105245_102610811 251
613 3300009098 Ga0105245_10339884 Ga0105245_103398843 251
614 3300009147 Ga0114129_10476023 Ga0114129_104760232 251
615 3300009148 Ga0105243_10028508 Ga0105243_100285086 251
616 3300009148 Ga0105243_10103786 Ga0105243_101037863 251
617 3300009174 Ga0105241_10008790 Ga0105241_100087905 251
618 3300009174 Ga0105241_10038464 Ga0105241_100384642 251
619 3300009174 Ga0105241_10064205 Ga0105241_100642053 251
620 3300009176 Ga0105242_10054413 Ga0105242_100544133 251
621 3300009176 Ga0105242_10253760 Ga0105242_102537602 251
622 3300009176 Ga0105242_10382542 Ga0105242_103825423 251
623 3300009176 Ga0105242_10402421 Ga0105242_104024212 251
624 3300009177 Ga0105248_10094925 Ga0105248_100949252 251
625 3300009177 Ga0105248_10147066 Ga0105248_101470663 251
626 3300009177 Ga0105248_10163907 Ga0105248_101639072 251
627 3300009177 Ga0105248_10222548 Ga0105248_102225483 251
628 3300009177 Ga0105248_10302396 Ga0105248_103023963 251
629 3300009177 Ga0105248_10591203 Ga0105248_105912033 251
630 3300009177 Ga0105248_10756710 Ga0105248_107567102 251
631 3300009545 Ga0105237_10007763 Ga0105237_1000776320 251
632 3300009545 Ga0105237_10019899 Ga0105237_100198999 251
633 3300009545 Ga0105237_10022289 Ga0105237_100222898 251
634 3300009545 Ga0105237_10026113 Ga0105237_1002611311 251
635 3300009545 Ga0105237_10059671 Ga0105237_100596715 251
636 3300009545 Ga0105237_10082754 Ga0105237_100827543 251
637 3300009545 Ga0105237_10133950 Ga0105237_101339506 251
638 3300009545 Ga0105237_10245483 Ga0105237_102454833 251
639 3300009545 Ga0105237_10518779 Ga0105237_105187792 251
640 3300009551 Ga0105238_10002481 Ga0105238_1000248125 251
641 3300009551 Ga0105238_10030357 Ga0105238_100303578 251
642 3300009551 Ga0105238_10041345 Ga0105238_100413453 251
643 3300009551 Ga0105238_10085794 Ga0105238_100857944 251
644 3300009551 Ga0105238_10101522 Ga0105238_101015223 251
645 3300009551 Ga0105238_10163216 Ga0105238_101632164 251
646 3300009551 Ga0105238_10180284 Ga0105238_101802843 251
647 3300009551 Ga0105238_10503548 Ga0105238_105035482 251
648 3300009553 Ga0105249_10013656 Ga0105249_100136569 251
649 3300010375 Ga0105239_10006176 Ga0105239_1000617625 251
650 3300010375 Ga0105239_10023213 Ga0105239_100232134 251
651 3300010375 Ga0105239_10025552 Ga0105239_100255528 251
652 3300010375 Ga0105239_10053605 Ga0105239_100536056 251
653 3300010375 Ga0105239_10134202 Ga0105239_101342025 251
654 3300010375 Ga0105239_10891238 Ga0105239_108912382 251
655 3300011119 Ga0105246_10029178 Ga0105246_100291784 251
656 3300013102 Ga0157371_10171629 Ga0157371_101716291 251
657 3300013104 Ga0157370_10011690 Ga0157370_100116903 251
658 3300013104 Ga0157370_10014980 Ga0157370_100149804 251
659 3300013104 Ga0157370_10021451 Ga0157370_1002145110 251
660 3300013104 Ga0157370_10032468 Ga0157370_100324683 251
661 3300013104 Ga0157370_10036942 Ga0157370_100369422 251
662 3300013104 Ga0157370_10094346 Ga0157370_100943465 251
663 3300013104 Ga0157370_10114807 Ga0157370_101148075 251
664 3300013105 Ga0157369_10002875 Ga0157369_1000287513 251
665 3300013105 Ga0157369_10004249 Ga0157369_1000424923 251
666 3300013105 Ga0157369_10103257 Ga0157369_101032572 251
667 3300013105 Ga0157369_10115593 Ga0157369_101155935 251
668 3300013105 Ga0157369_10143142 Ga0157369_101431422 251
669 3300013105 Ga0157369_10172638 Ga0157369_101726381 251
670 3300013105 Ga0157369_10194961 Ga0157369_101949615 251
671 3300013105 Ga0157369_10316590 Ga0157369_103165902 251
672 3300013296 Ga0157374_10012985 Ga0157374_100129852 251
673 3300013296 Ga0157374_10027563 Ga0157374_100275636 251
674 3300013296 Ga0157374_10094279 Ga0157374_100942793 251
675 3300013296 Ga0157374_10128118 Ga0157374_101281184 251
676 3300013296 Ga0157374_10132965 Ga0157374_101329653 251
677 3300013297 Ga0157378_10005297 Ga0157378_1000529716 251
678 3300013297 Ga0157378_10241671 Ga0157378_102416713 251
679 3300013297 Ga0157378_10310135 Ga0157378_103101353 251
680 3300013297 Ga0157378_10352806 Ga0157378_103528063 251
681 3300013297 Ga0157378_10477795 Ga0157378_104777952 251
682 3300013306 Ga0163162_10016482 Ga0163162_1001648210 251
683 3300013306 Ga0163162_10607886 Ga0163162_106078864 251
684 3300013307 Ga0157372_10003029 Ga0157372_1000302910 251
685 3300013307 Ga0157372_10063045 Ga0157372_100630456 251
686 3300013307 Ga0157372_10171756 Ga0157372_101717563 251
687 3300013307 Ga0157372_10296310 Ga0157372_102963105 251
688 3300013307 Ga0157372_10348142 Ga0157372_103481422 251
689 3300013308 Ga0157375_10058540 Ga0157375_100585405 251
690 3300013308 Ga0157375_10159774 Ga0157375_101597742 251
691 3300013308 Ga0157375_10260633 Ga0157375_102606333 251
692 3300013308 Ga0157375_10317288 Ga0157375_103172881 251
693 3300013308 Ga0157375_10540817 Ga0157375_105408172 251
694 3300014325 Ga0163163_10001939 Ga0163163_100019393 251
695 3300014325 Ga0163163_10099136 Ga0163163_100991362 251
696 3300014325 Ga0163163_10471968 Ga0163163_104719682 251
697 3300014326 Ga0157380_10030626 Ga0157380_100306265 251
698 3300014968 Ga0157379_10067428 Ga0157379_100674282 251
699 3300014968 Ga0157379_10129398 Ga0157379_101293982 251
700 3300014968 Ga0157379_10335650 Ga0157379_103356502 251
701 3300014969 Ga0157376_10122914 Ga0157376_101229142 251
702 3300020069 Ga0197907_10711641 Ga0197907_107116413 251
703 3300020070 Ga0206356_11341623 Ga0206356_113416232 251
704 3300020076 Ga0206355_1663353 Ga0206355_16633532 251
705 3300020078 Ga0206352_10076272 Ga0206352_100762728 251
706 3300020080 Ga0206350_10589595 Ga0206350_105895958 251
707 3300025321 Ga0207656_10074580 Ga0207656_100745802 251
708 3300025898 Ga0207692_10183296 Ga0207692_101832962 251
709 3300025899 Ga0207642_10126846 Ga0207642_101268462 251
710 3300025903 Ga0207680_10090756 Ga0207680_100907563 251
711 3300025906 Ga0207699_10031222 Ga0207699_100312226 251
712 3300025906 Ga0207699_10095624 Ga0207699_100956242 251
713 3300025906 Ga0207699_10216187 Ga0207699_102161872 251
714 3300025909 Ga0207705_10018666 Ga0207705_100186663 251
715 3300025909 Ga0207705_10024750 Ga0207705_100247502 251
716 3300025909 Ga0207705_10162451 Ga0207705_101624512 251
717 3300025909 Ga0207705_10330950 Ga0207705_103309502 251
718 3300025911 Ga0207654_10007168 Ga0207654_100071685 251
719 3300025911 Ga0207654_10027698 Ga0207654_100276984 251
720 3300025911 Ga0207654_10125899 Ga0207654_101258993 251
721 3300025911 Ga0207654_10128681 Ga0207654_101286813 251
722 3300025912 Ga0207707_10003242 Ga0207707_100032425 251
723 3300025912 Ga0207707_10034988 Ga0207707_100349885 251
724 3300025912 Ga0207707_10045399 Ga0207707_100453996 251
725 3300025912 Ga0207707_10175645 Ga0207707_101756453 251
726 3300025913 Ga0207695_10004731 Ga0207695_1000473125 251
727 3300025913 Ga0207695_10008431 Ga0207695_1000843111 251
728 3300025913 Ga0207695_10008978 Ga0207695_1000897812 251
729 3300025913 Ga0207695_10012958 Ga0207695_1001295811 251
730 3300025913 Ga0207695_10023451 Ga0207695_100234515 251
731 3300025913 Ga0207695_10024322 Ga0207695_100243226 251
732 3300025913 Ga0207695_10091221 Ga0207695_100912213 251
733 3300025913 Ga0207695_10161793 Ga0207695_101617932 251
734 3300025913 Ga0207695_10348021 Ga0207695_103480212 251
735 3300025914 Ga0207671_10015121 Ga0207671_100151215 251
736 3300025914 Ga0207671_10015173 Ga0207671_100151738 251
737 3300025914 Ga0207671_10041156 Ga0207671_100411562 251
738 3300025914 Ga0207671_10063566 Ga0207671_100635662 251
739 3300025914 Ga0207671_10081254 Ga0207671_100812542 251
740 3300025914 Ga0207671_10497170 Ga0207671_104971702 251
741 3300025916 Ga0207663_10060187 Ga0207663_100601874 251
742 3300025916 Ga0207663_10094020 Ga0207663_100940202 251
743 3300025916 Ga0207663_10298337 Ga0207663_102983372 251
744 3300025917 Ga0207660_10004348 Ga0207660_100043488 251
745 3300025917 Ga0207660_10008669 Ga0207660_100086695 251
746 3300025917 Ga0207660_10102482 Ga0207660_101024822 251
747 3300025919 Ga0207657_10003364 Ga0207657_1000336413 251
748 3300025919 Ga0207657_10096007 Ga0207657_100960073 251
749 3300025919 Ga0207657_10228881 Ga0207657_102288812 251
750 3300025921 Ga0207652_10002066 Ga0207652_1000206620 251
751 3300025921 Ga0207652_10057208 Ga0207652_100572083 251
752 3300025923 Ga0207681_10449871 Ga0207681_104498712 251
753 3300025924 Ga0207694_10011837 Ga0207694_100118373 251
754 3300025924 Ga0207694_10013095 Ga0207694_100130953 251
755 3300025924 Ga0207694_10013585 Ga0207694_100135857 251
756 3300025924 Ga0207694_10040557 Ga0207694_100405573 251
757 3300025924 Ga0207694_10165476 Ga0207694_101654765 251
758 3300025924 Ga0207694_10414454 Ga0207694_104144542 251
759 3300025925 Ga0207650_10199446 Ga0207650_101994462 251
760 3300025927 Ga0207687_10012876 Ga0207687_100128766 251
761 3300025927 Ga0207687_10050273 Ga0207687_100502733 251
762 3300025927 Ga0207687_10186144 Ga0207687_101861442 251
763 3300025928 Ga0207700_10097109 Ga0207700_100971093 251
764 3300025928 Ga0207700_10289360 Ga0207700_102893602 251
765 3300025929 Ga0207664_10094896 Ga0207664_100948962 251
766 3300025931 Ga0207644_10076737 Ga0207644_100767375 251
767 3300025931 Ga0207644_10161647 Ga0207644_101616473 251
768 3300025932 Ga0207690_10055956 Ga0207690_100559563 251
769 3300025933 Ga0207706_10264204 Ga0207706_102642042 251
770 3300025934 Ga0207686_10003275 Ga0207686_100032755 251
771 3300025934 Ga0207686_10086300 Ga0207686_100863003 251
772 3300025934 Ga0207686_10191771 Ga0207686_101917712 251
773 3300025934 Ga0207686_10368417 Ga0207686_103684172 251
774 3300025935 Ga0207709_10024829 Ga0207709_100248293 251
775 3300025935 Ga0207709_10042044 Ga0207709_100420445 251
776 3300025935 Ga0207709_10341528 Ga0207709_103415282 251
777 3300025936 Ga0207670_10053443 Ga0207670_100534433 251
778 3300025936 Ga0207670_10210717 Ga0207670_102107172 251
779 3300025937 Ga0207669_10064158 Ga0207669_100641584 251
780 3300025937 Ga0207669_10223840 Ga0207669_102238402 251
781 3300025938 Ga0207704_10039043 Ga0207704_100390433 251
782 3300025938 Ga0207704_10057335 Ga0207704_100573352 251
783 3300025938 Ga0207704_10351970 Ga0207704_103519702 251
784 3300025941 Ga0207711_10002553 Ga0207711_1000255325 251
785 3300025941 Ga0207711_10026838 Ga0207711_100268387 251
786 3300025941 Ga0207711_10333900 Ga0207711_103339002 251
787 3300025942 Ga0207689_10053357 Ga0207689_100533574 251
788 3300025942 Ga0207689_10560885 Ga0207689_105608852 251
789 3300025944 Ga0207661_10000023 Ga0207661_1000002325 251
790 3300025944 Ga0207661_10021824 Ga0207661_100218247 251
791 3300025944 Ga0207661_10032868 Ga0207661_100328686 251
792 3300025944 Ga0207661_10072611 Ga0207661_100726113 251
793 3300025944 Ga0207661_10086509 Ga0207661_100865092 251
794 3300025944 Ga0207661_10154223 Ga0207661_101542233 251
795 3300025949 Ga0207667_10003860 Ga0207667_1000386025 251
796 3300025949 Ga0207667_10008786 Ga0207667_1000878612 251
797 3300025949 Ga0207667_10012357 Ga0207667_1001235711 251
798 3300025949 Ga0207667_10097712 Ga0207667_100977123 251
799 3300025949 Ga0207667_10212694 Ga0207667_102126942 251
800 3300025949 Ga0207667_10359759 Ga0207667_103597592 251
801 3300025960 Ga0207651_10008879 Ga0207651_100088793 251
802 3300025960 Ga0207651_10035896 Ga0207651_100358965 251
803 3300025960 Ga0207651_10038658 Ga0207651_100386582 251
804 3300025960 Ga0207651_10613734 Ga0207651_106137342 251
805 3300025961 Ga0207712_10029086 Ga0207712_100290864 251
806 3300025961 Ga0207712_10309292 Ga0207712_103092924 251
807 3300025986 Ga0207658_10219513 Ga0207658_102195132 251
808 3300025986 Ga0207658_10247036 Ga0207658_102470362 251
809 3300026023 Ga0207677_10078244 Ga0207677_100782443 251
810 3300026023 Ga0207677_10367612 Ga0207677_103676122 251
811 3300026035 Ga0207703_10023476 Ga0207703_100234769 251
812 3300026035 Ga0207703_10059694 Ga0207703_100596945 251
813 3300026035 Ga0207703_10080651 Ga0207703_100806516 251
814 3300026035 Ga0207703_10104116 Ga0207703_101041163 251
815 3300026041 Ga0207639_10034659 Ga0207639_100346597 251
816 3300026041 Ga0207639_10118501 Ga0207639_101185013 251
817 3300026041 Ga0207639_10165307 Ga0207639_101653072 251
818 3300026078 Ga0207702_10002606 Ga0207702_1000260625 251
819 3300026078 Ga0207702_10005439 Ga0207702_1000543910 251
820 3300026078 Ga0207702_10038642 Ga0207702_100386423 251
821 3300026078 Ga0207702_10239063 Ga0207702_102390632 251
822 3300026078 Ga0207702_10877097 Ga0207702_108770972 251
823 3300026088 Ga0207641_10018994 Ga0207641_100189942 251
824 3300026088 Ga0207641_10033827 Ga0207641_100338274 251
825 3300026088 Ga0207641_10109531 Ga0207641_101095313 251
826 3300026088 Ga0207641_10164898 Ga0207641_101648983 251
827 3300026095 Ga0207676_10031184 Ga0207676_100311843 251
828 3300026095 Ga0207676_10111916 Ga0207676_101119165 251
829 3300026095 Ga0207676_10358855 Ga0207676_103588552 251
830 3300026116 Ga0207674_10003800 Ga0207674_1000380010 251
831 3300026116 Ga0207674_10013233 Ga0207674_100132336 251
832 3300026116 Ga0207674_10019987 Ga0207674_1001998711 251
833 3300026116 Ga0207674_10123807 Ga0207674_101238071 251
834 3300026116 Ga0207674_10259095 Ga0207674_102590955 251
835 3300026121 Ga0207683_10025868 Ga0207683_100258688 251
836 3300026121 Ga0207683_10482435 Ga0207683_104824351 251
837 3300026121 Ga0207683_10586629 Ga0207683_105866292 251
838 3300026142 Ga0207698_10020106 Ga0207698_100201064 251
839 3300026142 Ga0207698_10025672 Ga0207698_100256723 251
840 3300026142 Ga0207698_10025720 Ga0207698_100257203 251
841 3300026142 Ga0207698_10520667 Ga0207698_105206672 251
842 3300027907 Ga0207428_10120599 Ga0207428_101205994 251
843 3300028379 Ga0268266_10181199 Ga0268266_101811993 251
844 3300028379 Ga0268266_10243094 Ga0268266_102430942 251
845 3300028381 Ga0268264_10072293 Ga0268264_100722933 251
846 3300028381 Ga0268264_10381760 Ga0268264_103817601 251
847 3300028381 Ga0268264_10672890 Ga0268264_106728901 251
848 3300028577 Ga0265318_10048134 Ga0265318_100481342 251
849 3300028653 Ga0265323_10000551 Ga0265323_1000055120 251
850 3300028800 Ga0265338_10021019 Ga0265338_100210198 251
851 3300028800 Ga0265338_10034694 Ga0265338_100346945 251
852 3300028800 Ga0265338_10077484 Ga0265338_100774845 251
853 3300031090 Ga0265760_10026130 Ga0265760_100261302 251
854 3300031090 Ga0265760_10038649 Ga0265760_100386492 251
855 3300031090 Ga0265760_10071285 Ga0265760_100712852 251
856 3300031238 Ga0265332_10052454 Ga0265332_100524542 251
857 3300031239 Ga0265328_10014331 Ga0265328_100143315 251
858 3300031240 Ga0265320_10007751 Ga0265320_1000775110 251
859 3300031241 Ga0265325_10002701 Ga0265325_100027017 251
860 3300031241 Ga0265325_10067080 Ga0265325_100670803 251
861 3300031241 Ga0265325_10103649 Ga0265325_101036491 251
862 3300031249 Ga0265339_10015497 Ga0265339_100154978 251
863 3300031250 Ga0265331_10095495 Ga0265331_100954952 251
864 3300031344 Ga0265316_10026620 Ga0265316_100266206 251
865 3300031344 Ga0265316_10027029 Ga0265316_100270291 251
866 3300031344 Ga0265316_10027518 Ga0265316_100275185 251
867 3300031344 Ga0265316_10039389 Ga0265316_100393896 251
868 3300031344 Ga0265316_10052352 Ga0265316_100523521 251
869 3300031344 Ga0265316_10070326 Ga0265316_100703262 251
870 3300031344 Ga0265316_10219842 Ga0265316_102198422 251
871 3300031344 Ga0265316_10232599 Ga0265316_102325992 251
872 3300031344 Ga0265316_10251128 Ga0265316_102511282 251
873 3300031344 Ga0265316_10394216 Ga0265316_103942161 251
874 3300031595 Ga0265313_10005858 Ga0265313_1000585812 251
875 3300031595 Ga0265313_10134275 Ga0265313_101342751 251
876 3300031711 Ga0265314_10000833 Ga0265314_1000083324 251
877 3300031711 Ga0265314_10005858 Ga0265314_1000585813 251
878 3300031711 Ga0265314_10079052 Ga0265314_100790523 251
879 3300031712 Ga0265342_10041881 Ga0265342_100418812 251
880 3300031712 Ga0265342_10042172 Ga0265342_100421723 251
881 3300031824 Ga0307413_10463283 Ga0307413_104632831 251
882 3300035086 Ga0373934_0006348 Ga0373934_0006348_60_830 251
883 3300035111 Ga0373923_0005936 Ga0373923_0005936_528_1298 251
884 3300035111 Ga0373923_0078546 Ga0373923_0078546_618_1388 251
885 3300035117 Ga0373953_0016064 Ga0373953_0016064_883_1653 251
886 3300035118 Ga0373954_0008950 Ga0373954_0008950_2502_3272 251
887 3300035118 Ga0373954_0036606 Ga0373954_0036606_1387_2157 251
888 3300035118 Ga0373954_0055451 Ga0373954_0055451_290_1060 251
889 3300035118 Ga0373954_0058319 Ga0373954_0058319_580_1350 251
890 3300035118 Ga0373954_0097328 Ga0373954_0097328_285_1055 251
891 3300035118 Ga0373954_0131185 Ga0373954_0131185_278_1048 251
892 3300035118 Ga0373954_0162008 Ga0373954_0162008_144_917 251
893 3300035119 Ga0373956_0093199 Ga0373956_0093199_457_1227 251
894 3300035120 Ga0373957_0091150 Ga0373957_0091150_306_1076 251
895 3300035172 Ga0373955_0016645 Ga0373955_0016645_2463_3233 251
896 3300035172 Ga0373955_0084562 Ga0373955_0084562_925_1695 251
897 3300035691 Ga0373931_0059249 Ga0373931_0059249_170_940 251
898 3300035692 Ga0373935_0045050 Ga0373935_0045050_1641_2411 251
899 3300035695 Ga0373927_0002498 Ga0373927_0002498_4930_5700 251
900 3300035695 Ga0373927_0003041 Ga0373927_0003041_8707_9477 251
901 3300035695 Ga0373927_0088990 Ga0373927_0088990_411_1181 251
902 3300035724 Ga0373933_0027964 Ga0373933_0027964_829_1599 251
903 3300035724 Ga0373933_0069483 Ga0373933_0069483_854_1624 251
904 3300035724 Ga0373933_0178471 Ga0373933_0178471_415_1188 251
905 3300035724 Ga0373933_0386866 Ga0373933_0386866_103_873 251
906 3300035725 Ga0373947_0263295 Ga0373947_0263295_162_932 251
907 3300035725 Ga0373947_0266253 Ga0373947_0266253_232_1002 251
908 3300036401 Ga0373937_0002194 Ga0373937_0002194_11429_12199 251
909 3300036401 Ga0373937_0006233 Ga0373937_0006233_7297_8067 251
910 3300036401 Ga0373937_0015396 Ga0373937_0015396_2645_3415 251
911 3300036401 Ga0373937_0041083 Ga0373937_0041083_570_1343 251
912 3300036401 Ga0373937_0058015 Ga0373937_0058015_55_825 251
913 3300036401 Ga0373937_0097234 Ga0373937_0097234_632_1402 251
914 3300036401 Ga0373937_0125227 Ga0373937_0125227_1344_2114 251
915 3300036401 Ga0373937_0288201 Ga0373937_0288201_699_1490 251
916 3300036401 Ga0373937_0420117 Ga0373937_0420117_125_895 251
917 3300037068 Ga0373925_0016717 Ga0373925_0016717_4440_5210 251
918 3300037068 Ga0373925_0024354 Ga0373925_0024354_2291_3061 251
919 3300037068 Ga0373925_0062710 Ga0373925_0062710_1250_2020 251
920 3300037068 Ga0373925_0116098 Ga0373925_0116098_155_925 251
921 3300037068 Ga0373925_0138584 Ga0373925_0138584_755_1525 251
922 3300037068 Ga0373925_0433408 Ga0373925_0433408_29_799 251
923 3300037471 Ga0395905_0279271 Ga0395905_0279271_210_1004 251
924 3300037853 Ga0436364_0227271 Ga0436364_0227271_221_991 251
925 3300039437 Ga0436365_1503121 Ga0436365_1503121_720_1490 251
926 3300044712 Ga0453684_0025231 Ga0453684_0025231_1237_2013 251
927 3300044712 Ga0453684_0218075 Ga0453684_0218075_33_797 251
928 3300044712 Ga0453684_0240802 Ga0453684_0240802_871_1647 251
929 3300044712 Ga0453684_0369365 Ga0453684_0369365_306_1076 251
930 3300045051 Ga0451576_0023038 Ga0451576_0023038_1665_2435 251
931 3300045051 Ga0451576_0972514 Ga0451576_0972514_15_785 251
932 3300045976 Ga0466967_0608985 Ga0466967_0608985_112_882 251
933 3300046454 Ga0495592_0026186 Ga0495592_0026186_1927_2697 251
934 3300046454 Ga0495592_0053532 Ga0495592_0053532_1696_2466 251
935 3300046455 Ga0495603_0256616 Ga0495603_0256616_187_978 251
936 3300046459 Ga0495629_0000126 Ga0495629_0000126_59124_59915 251
937 3300046459 Ga0495629_0140026 Ga0495629_0140026_399_1169 251
938 3300046463 Ga0495653_0029166 Ga0495653_0029166_2482_3270 251
939 3300046463 Ga0495653_0153895 Ga0495653_0153895_757_1527 251
940 3300046472 Ga0495580_0003198 Ga0495580_0003198_4828_5598 251
941 3300046472 Ga0495580_0003953 Ga0495580_0003953_7271_8041 251
942 3300046472 Ga0495580_0008093 Ga0495580_0008093_3542_4312 251
943 3300046472 Ga0495580_0328125 Ga0495580_0328125_97_867 251
944 3300046473 Ga0495582_0003850 Ga0495582_0003850_7548_8339 251
945 3300046473 Ga0495582_0029029 Ga0495582_0029029_623_1393 251
946 3300046473 Ga0495582_0034776 Ga0495582_0034776_332_1105 251
947 3300046476 Ga0495662_0015298 Ga0495662_0015298_2750_3541 251
948 3300046477 Ga0495664_0264886 Ga0495664_0264886_257_1027 251
949 3300046499 Ga0495594_0009365 Ga0495594_0009365_1308_2099 251
950 3300046499 Ga0495594_0129117 Ga0495594_0129117_158_928 251
951 3300046499 Ga0495594_0256951 Ga0495594_0256951_160_930 251
952 3300046499 Ga0495594_0366945 Ga0495594_0366945_37_807 251
953 3300046516 Ga0495628_0045730 Ga0495628_0045730_1601_2371 251
954 3300046529 Ga0495652_0017191 Ga0495652_0017191_5226_5996 251
955 3300046533 Ga0495640_0228277 Ga0495640_0228277_339_1109 251
956 3300046533 Ga0495640_0244821 Ga0495640_0244821_273_1043 251
957 3300046536 Ga0495587_0007817 Ga0495587_0007817_3635_4405 251
958 3300046543 Ga0495645_0003913 Ga0495645_0003913_6991_7761 251
959 3300046559 Ga0495667_0025733 Ga0495667_0025733_2802_3572 251
960 3300046642 Ga0495634_0024544 Ga0495634_0024544_629_1420 251
961 3300046663 Ga0495635_0001790 Ga0495635_0001790_1327_2118 251
962 3300046678 Ga0495599_0036542 Ga0495599_0036542_1842_2612 251
963 3300046679 Ga0495623_0104870 Ga0495623_0104870_288_1058 251
964 3300046680 Ga0495646_0064649 Ga0495646_0064649_442_1212 251
965 3300046681 Ga0495647_0001519 Ga0495647_0001519_6266_7057 251
966 3300046683 Ga0495658_0000327 Ga0495658_0000327_13232_14023 251
967 3300046683 Ga0495658_0083630 Ga0495658_0083630_809_1579 251
968 3300046684 Ga0495669_0170909 Ga0495669_0170909_190_960 251
969 3300046689 Ga0495613_0019720 Ga0495613_0019720_1788_2558 251
970 3300046689 Ga0495613_0025308 Ga0495613_0025308_703_1494 251
971 3300046689 Ga0495613_0042513 Ga0495613_0042513_25_798 251
972 3300046689 Ga0495613_0149423 Ga0495613_0149423_542_1312 251
973 3300046809 Ga0495600_0164416 Ga0495600_0164416_264_1055 251
974 3300046809 Ga0495600_0169904 Ga0495600_0169904_256_1026 251
975 3300047315 Ga0495581_0000280 Ga0495581_0000280_16432_17223 251
976 3300047317 Ga0495604_0106268 Ga0495604_0106268_950_1720 251
977 3300047319 Ga0495674_0006604 Ga0495674_0006604_197_967 251
978 3300047319 Ga0495674_0218335 Ga0495674_0218335_614_1384 251
979 3300047319 Ga0495674_0327067 Ga0495674_0327067_457_1227 251
980 3300047321 Ga0495676_0040130 Ga0495676_0040130_2947_3738 251
981 3300047321 Ga0495676_0302782 Ga0495676_0302782_243_1013 251
982 3300047322 Ga0495680_0000838 Ga0495680_0000838_14502_15293 251
983 3300047322 Ga0495680_0050036 Ga0495680_0050036_1684_2454 251
984 3300047322 Ga0495680_0210283 Ga0495680_0210283_118_888 251
985 3300047444 Ga0495675_0136612 Ga0495675_0136612_65_835 251
986 3300047444 Ga0495675_0178869 Ga0495675_0178869_213_983 251
987 3300047471 Ga0495684_0004975 Ga0495684_0004975_6452_7222 251
988 3300047471 Ga0495684_0047975 Ga0495684_0047975_1208_1978 251
989 3300047471 Ga0495684_0129164 Ga0495684_0129164_811_1581 251
990 3300047471 Ga0495684_0183139 Ga0495684_0183139_171_941 251
991 3300047471 Ga0495684_0183631 Ga0495684_0183631_291_1061 251
992 3300048088 Ga0495602_0034630 Ga0495602_0034630_1278_2048 251
993 3300048088 Ga0495602_0469220 Ga0495602_0469220_14_784 251
994 3300048903 Ga0496100_0319161 Ga0496100_0319161_220_990 251
995 3300048907 Ga0496104_0124961 Ga0496104_0124961_853_1623 251
996 3300048908 Ga0496105_0548993 Ga0496105_0548993_120_890 251
997 3300048915 Ga0496112_0116398 Ga0496112_0116398_881_1651 251
998 3300048917 Ga0496114_0393737 Ga0496114_0393737_238_1008 251
999 3300048918 Ga0496115_0134483 Ga0496115_0134483_1046_1816 251
1000 3300048918 Ga0496115_0383649 Ga0496115_0383649_190_960 251
1001 3300049568 Ga0501031_0005420 Ga0501031_0005420_3049_3819 251
1002 3300049569 Ga0501032_0003219 Ga0501032_0003219_8298_9068 251
1003 3300049570 Ga0501033_0018974 Ga0501033_0018974_3492_4262 251
1004 3300049571 Ga0501034_0005315 Ga0501034_0005315_8298_9068 251
1005 3300049571 Ga0501034_0235409 Ga0501034_0235409_127_897 251
1006 3300049572 Ga0501036_0000166 Ga0501036_0000166_31390_32160 251
1007 3300049573 Ga0501037_0000725 Ga0501037_0000725_16458_17228 251
1008 3300049574 Ga0501038_0001071 Ga0501038_0001071_15206_15976 251
1009 3300049575 Ga0501039_0005223 Ga0501039_0005223_641_1411 251
1010 3300049576 Ga0501040_0071336 Ga0501040_0071336_655_1446 251
1011 3300049578 Ga0501042_0062732 Ga0501042_0062732_1842_2612 251
1012 3300049579 Ga0501043_0002427 Ga0501043_0002427_6786_7556 251
1013 3300049581 Ga0501047_0077820 Ga0501047_0077820_1237_2007 251
1014 3300049582 Ga0501048_0004510 Ga0501048_0004510_3845_4615 251
1015 3300049584 Ga0501068_0001612 Ga0501068_0001612_7434_8204 251
1016 3300049585 Ga0501069_0000541 Ga0501069_0000541_9248_10018 251
1017 3300049586 Ga0501070_0018412 Ga0501070_0018412_1723_2493 251
1018 3300049588 Ga0501072_0001111 Ga0501072_0001111_4857_5627 251
1019 3300049589 Ga0501073_0001369 Ga0501073_0001369_6111_6881 251
1020 3300049590 Ga0501074_0005425 Ga0501074_0005425_3492_4262 251
1021 3300049591 Ga0501075_0056221 Ga0501075_0056221_80_871 251
1022 3300049592 Ga0501076_0121937 Ga0501076_0121937_1128_1919 251
1023 3300049593 Ga0501077_0016527 Ga0501077_0016527_2884_3654 251
1024 3300049742 Ga0501080_0001872 Ga0501080_0001872_11221_11991 251
1025 3300049743 Ga0501081_0009031 Ga0501081_0009031_4094_4885 251
1026 3300049823 Ga0501044_0019407 Ga0501044_0019407_1596_2366 251
1027 3300049824 Ga0501045_0206366 Ga0501045_0206366_621_1412 251
1028 3300050507 nmdc:mga05p37_387576_c1 nmdc:mga05p37_387576_c1_200_970 251
1029 3300050507 nmdc:mga05p37_88852_c1 nmdc:mga05p37_88852_c1_2944_3714 251
1030 3300050509 nmdc:mga0qj67_68418_c1 nmdc:mga0qj67_68418_c1_1430_2200 251
1031 3300050510 nmdc:mga06r32_251727_c1 nmdc:mga06r32_251727_c1_722_1492 251
1032 3300050511 nmdc:mga08y16_175843_c1 nmdc:mga08y16_175843_c1_822_1613 251
1033 3300050511 nmdc:mga08y16_562428_c1 nmdc:mga08y16_562428_c1_321_1091 251
1034 3300050514 nmdc:mga08x19_876_c1 nmdc:mga08x19_876_c1_12393_13163 251
1035 3300053077 Ga0495601_0179298 Ga0495601_0179298_415_1185 251
1036 3300053085 Ga0495619_0001327 Ga0495619_0001327_6479_7270 251
1037 3300053085 Ga0495619_0238802 Ga0495619_0238802_328_1098 251
1038 3300054114 Ga0501084_0002720 Ga0501084_0002720_6237_7007 251
1039 3300060353 Ga0501082_0000322 Ga0501082_0000322_29800_30570 251
1040 3300060353 Ga0501082_0015727 Ga0501082_0015727_4144_4914 251
1041 3300005434 Ga0070709_10095295 Ga0070709_100952952 252
1042 3300005440 Ga0070705_100142961 Ga0070705_1001429612 252
1043 3300005455 Ga0070663_100475845 Ga0070663_1004758452 252
1044 3300005467 Ga0070706_100030278 Ga0070706_1000302787 252
1045 3300005546 Ga0070696_100357681 Ga0070696_1003576812 252
1046 3300005617 Ga0068859_100542893 Ga0068859_1005428932 252
1047 3300005618 Ga0068864_100082569 Ga0068864_1000825693 252
1048 3300005844 Ga0068862_100037943 Ga0068862_1000379433 252
1049 3300006173 Ga0070716_100030312 Ga0070716_1000303124 252
1050 3300006914 Ga0075436_100124009 Ga0075436_1001240092 252
1051 3300006931 Ga0097620_100542852 Ga0097620_1005428522 252
1052 3300009147 Ga0114129_11045903 Ga0114129_110459032 252
1053 3300025910 Ga0207684_10255372 Ga0207684_102553722 252
1054 3300025939 Ga0207665_10169642 Ga0207665_101696424 252
1055 3300025939 Ga0207665_10305805 Ga0207665_103058053 252
1056 3300026041 Ga0207639_10611343 Ga0207639_106113432 252
1057 3300026095 Ga0207676_10138472 Ga0207676_101384722 252
1058 3300026118 Ga0207675_101021651 Ga0207675_1010216511 252
1059 3300028380 Ga0268265_10031143 Ga0268265_100311434 252
1060 3300028380 Ga0268265_10774708 Ga0268265_107747081 252
1061 3300031727 Ga0316576_10050774 Ga0316576_100507744 252
1062 3300031728 Ga0316578_10012096 Ga0316578_100120963 252
1063 3300035691 Ga0373931_0029244 Ga0373931_0029244_1558_2319 252
1064 3300036647 Ga0316582_0004359 Ga0316582_0004359_3802_4569 252
1065 3300036712 Ga0316584_0046061 Ga0316584_0046061_330_1097 252
1066 3300037588 Ga0316581_0053488 Ga0316581_0053488_172_939 252
1067 3300005334 Ga0068869_100132255 Ga0068869_1001322553 253
1068 3300005435 Ga0070714_100000519 Ga0070714_10000051943 253
1069 3300005457 Ga0070662_100513572 Ga0070662_1005135721 253
1070 3300005459 Ga0068867_100140153 Ga0068867_1001401532 253
1071 3300005842 Ga0068858_100778034 Ga0068858_1007780341 253
1072 3300009094 Ga0111539_10385588 Ga0111539_103855882 253
1073 3300013104 Ga0157370_10082425 Ga0157370_100824253 253
1074 3300013105 Ga0157369_10520686 Ga0157369_105206862 253
1075 3300021361 Ga0213872_10004954 Ga0213872_1000495410 253
1076 3300021384 Ga0213876_10014843 Ga0213876_100148433 253
1077 3300021388 Ga0213875_10009126 Ga0213875_100091265 253
1078 3300025929 Ga0207664_10002006 Ga0207664_1000200623 253
1079 3300025929 Ga0207664_10071614 Ga0207664_100716143 253
1080 3300025933 Ga0207706_10264880 Ga0207706_102648802 253
1081 3300026088 Ga0207641_10472955 Ga0207641_104729551 253
1082 3300028577 Ga0265318_10062204 Ga0265318_100622043 253
1083 3300036401 Ga0373937_0090377 Ga0373937_0090377_1239_2045 253
1084 3300037312 Ga0395899_0004980 Ga0395899_0004980_1784_2587 253
1085 3300037418 Ga0395900_0026327 Ga0395900_0026327_2895_3698 253
1086 3300037466 Ga0395898_0038182 Ga0395898_0038182_2767_3570 253
1087 3300037471 Ga0395905_0402553 Ga0395905_0402553_334_1137 253
1088 3300037853 Ga0436364_0193186 Ga0436364_0193186_2964_3761 253
1089 3300038443 Ga0395901_0030557 Ga0395901_0030557_1256_2059 253
1090 3300039437 Ga0436365_0990624 Ga0436365_0990624_51_851 253
1091 3300039437 Ga0436365_1765895 Ga0436365_1765895_4431_5207 253
1092 3300039438 Ga0436360_0314645 Ga0436360_0314645_179_982 253
1093 3300039447 Ga0436361_0406086 Ga0436361_0406086_112_915 253
1094 3300039447 Ga0436361_0878657 Ga0436361_0878657_689_1492 253
1095 3300039447 Ga0436361_0952691 Ga0436361_0952691_3189_3992 253
1096 3300044694 Ga0466963_0003486 Ga0466963_0003486_4098_4901 253
1097 3300044694 Ga0466963_0049300 Ga0466963_0049300_315_1118 253
1098 3300044842 Ga0466957_0055813 Ga0466957_0055813_1433_2236 253
1099 3300045836 Ga0466958_0005653 Ga0466958_0005653_926_1729 253
1100 3300045976 Ga0466967_0001979 Ga0466967_0001979_3114_3917 253
1101 3300045976 Ga0466967_0173695 Ga0466967_0173695_301_1104 253
1102 3300048910 Ga0496107_0192429 Ga0496107_0192429_146_952 253
1103 3300049578 Ga0501042_0200794 Ga0501042_0200794_170_973 253
1104 3300049592 Ga0501076_0003279 Ga0501076_0003279_3052_3855 253
1105 3300049743 Ga0501081_0193196 Ga0501081_0193196_68_871 253
1106 3300061734 Ga0530510_0014821 Ga0530510_0014821_413_1216 253
1107 3300025271 Ga0207666_1002756 Ga0207666_10027562 254
1108 3300005436 Ga0070713_100126690 Ga0070713_1001266902 255
1109 3300020069 Ga0197907_11267322 Ga0197907_112673227 255
1110 3300020070 Ga0206356_10855686 Ga0206356_108556861 255
1111 3300020075 Ga0206349_1478125 Ga0206349_14781254 255
1112 3300020078 Ga0206352_10411739 Ga0206352_104117393 255
1113 3300020080 Ga0206350_10222252 Ga0206350_1022225229 255
1114 3300020082 Ga0206353_11516411 Ga0206353_115164113 255
1115 3300022467 Ga0224712_10000788 Ga0224712_100007888 255
1116 3300025928 Ga0207700_10044731 Ga0207700_100447312 255
1117 3300000545 CNXas_1000052 CNXas_10000528 258
1118 3300002077 JGI24744J21845_10020986 JGI24744J21845_100209862 258
1119 3300003203 JGI25406J46586_10027721 JGI25406J46586_100277212 258
1120 3300005290 Ga0065712_10004601 Ga0065712_100046015 258
1121 3300005293 Ga0065715_10090524 Ga0065715_1009052411 258
1122 3300005293 Ga0065715_10123342 Ga0065715_101233423 258
1123 3300005293 Ga0065715_10289801 Ga0065715_102898011 258
1124 3300005328 Ga0070676_10002984 Ga0070676_100029849 258
1125 3300005328 Ga0070676_10011483 Ga0070676_100114835 258
1126 3300005328 Ga0070676_10027020 Ga0070676_100270203 258
1127 3300005329 Ga0070683_100129722 Ga0070683_1001297222 258
1128 3300005330 Ga0070690_100051861 Ga0070690_1000518613 258
1129 3300005330 Ga0070690_100214180 Ga0070690_1002141802 258
1130 3300005330 Ga0070690_100458095 Ga0070690_1004580952 258
1131 3300005331 Ga0070670_100000833 Ga0070670_10000083315 258
1132 3300005331 Ga0070670_100003742 Ga0070670_1000037427 258
1133 3300005331 Ga0070670_100333600 Ga0070670_1003336002 258
1134 3300005335 Ga0070666_10001876 Ga0070666_1000187616 258
1135 3300005335 Ga0070666_10002056 Ga0070666_1000205616 258
1136 3300005335 Ga0070666_10009254 Ga0070666_100092545 258
1137 3300005340 Ga0070689_100026249 Ga0070689_1000262492 258
1138 3300005340 Ga0070689_100036381 Ga0070689_1000363812 258
1139 3300005347 Ga0070668_100000403 Ga0070668_10000040317 258
1140 3300005347 Ga0070668_100025979 Ga0070668_1000259795 258
1141 3300005347 Ga0070668_100260285 Ga0070668_1002602851 258
1142 3300005347 Ga0070668_100470568 Ga0070668_1004705682 258
1143 3300005353 Ga0070669_100002011 Ga0070669_1000020115 258
1144 3300005353 Ga0070669_100006097 Ga0070669_10000609715 258
1145 3300005354 Ga0070675_100001318 Ga0070675_1000013187 258
1146 3300005354 Ga0070675_100004678 Ga0070675_1000046782 258
1147 3300005355 Ga0070671_100000283 Ga0070671_10000028325 258
1148 3300005355 Ga0070671_100001873 Ga0070671_1000018735 258
1149 3300005355 Ga0070671_100011134 Ga0070671_1000111349 258
1150 3300005355 Ga0070671_100478534 Ga0070671_1004785341 258
1151 3300005356 Ga0070674_100013617 Ga0070674_1000136177 258
1152 3300005364 Ga0070673_100030438 Ga0070673_1000304383 258
1153 3300005364 Ga0070673_100178734 Ga0070673_1001787343 258
1154 3300005365 Ga0070688_100009439 Ga0070688_1000094396 258
1155 3300005365 Ga0070688_100154947 Ga0070688_1001549472 258
1156 3300005367 Ga0070667_100010004 Ga0070667_10001000413 258
1157 3300005367 Ga0070667_100021024 Ga0070667_1000210245 258
1158 3300005367 Ga0070667_100144062 Ga0070667_1001440622 258
1159 3300005367 Ga0070667_100375971 Ga0070667_1003759711 258
1160 3300005434 Ga0070709_10058930 Ga0070709_100589303 258
1161 3300005436 Ga0070713_100120642 Ga0070713_1001206424 258
1162 3300005437 Ga0070710_10049023 Ga0070710_100490233 258
1163 3300005439 Ga0070711_100020289 Ga0070711_1000202893 258
1164 3300005439 Ga0070711_100059847 Ga0070711_1000598473 258
1165 3300005440 Ga0070705_100209612 Ga0070705_1002096122 258
1166 3300005445 Ga0070708_100012981 Ga0070708_1000129817 258
1167 3300005445 Ga0070708_100016263 Ga0070708_1000162635 258
1168 3300005445 Ga0070708_100114653 Ga0070708_1001146533 258
1169 3300005445 Ga0070708_100149752 Ga0070708_1001497523 258
1170 3300005445 Ga0070708_100560249 Ga0070708_1005602492 258
1171 3300005445 Ga0070708_100571817 Ga0070708_1005718172 258
1172 3300005455 Ga0070663_100175994 Ga0070663_1001759942 258
1173 3300005455 Ga0070663_100274827 Ga0070663_1002748272 258
1174 3300005456 Ga0070678_100001511 Ga0070678_10000151117 258
1175 3300005456 Ga0070678_100467434 Ga0070678_1004674341 258
1176 3300005457 Ga0070662_100004281 Ga0070662_10000428112 258
1177 3300005457 Ga0070662_100653478 Ga0070662_1006534782 258
1178 3300005458 Ga0070681_10024791 Ga0070681_100247913 258
1179 3300005459 Ga0068867_100024489 Ga0068867_1000244893 258
1180 3300005459 Ga0068867_100365336 Ga0068867_1003653362 258
1181 3300005466 Ga0070685_10049290 Ga0070685_100492903 258
1182 3300005467 Ga0070706_100000210 Ga0070706_10000021053 258
1183 3300005467 Ga0070706_100006435 Ga0070706_10000643512 258
1184 3300005467 Ga0070706_100006577 Ga0070706_1000065779 258
1185 3300005467 Ga0070706_100105963 Ga0070706_1001059632 258
1186 3300005467 Ga0070706_100129399 Ga0070706_1001293993 258
1187 3300005467 Ga0070706_100232835 Ga0070706_1002328353 258
1188 3300005468 Ga0070707_100003721 Ga0070707_1000037214 258
1189 3300005468 Ga0070707_100040915 Ga0070707_1000409155 258
1190 3300005468 Ga0070707_100048002 Ga0070707_1000480022 258
1191 3300005468 Ga0070707_100055022 Ga0070707_1000550224 258
1192 3300005468 Ga0070707_100059000 Ga0070707_1000590004 258
1193 3300005468 Ga0070707_100097107 Ga0070707_1000971072 258
1194 3300005471 Ga0070698_100001836 Ga0070698_1000018368 258
1195 3300005471 Ga0070698_100191656 Ga0070698_1001916564 258
1196 3300005518 Ga0070699_100021584 Ga0070699_1000215846 258
1197 3300005535 Ga0070684_100211723 Ga0070684_1002117234 258
1198 3300005535 Ga0070684_100375899 Ga0070684_1003758991 258
1199 3300005536 Ga0070697_100000826 Ga0070697_10000082610 258
1200 3300005536 Ga0070697_100003773 Ga0070697_10000377317 258
1201 3300005536 Ga0070697_100016162 Ga0070697_1000161625 258
1202 3300005536 Ga0070697_100050516 Ga0070697_1000505163 258
1203 3300005536 Ga0070697_100078461 Ga0070697_1000784613 258
1204 3300005536 Ga0070697_100414151 Ga0070697_1004141511 258
1205 3300005543 Ga0070672_100000353 Ga0070672_10000035315 258
1206 3300005543 Ga0070672_100004247 Ga0070672_1000042474 258
1207 3300005548 Ga0070665_100013901 Ga0070665_1000139018 258
1208 3300005548 Ga0070665_100076888 Ga0070665_1000768887 258
1209 3300005548 Ga0070665_100120258 Ga0070665_1001202582 258
1210 3300005548 Ga0070665_100177238 Ga0070665_1001772382 258
1211 3300005549 Ga0070704_100159839 Ga0070704_1001598392 258
1212 3300005564 Ga0070664_100078302 Ga0070664_1000783023 258
1213 3300005564 Ga0070664_100237416 Ga0070664_1002374162 258
1214 3300005618 Ga0068864_100181131 Ga0068864_1001811312 258
1215 3300005718 Ga0068866_10078124 Ga0068866_100781242 258
1216 3300005718 Ga0068866_10264386 Ga0068866_102643861 258
1217 3300005843 Ga0068860_100026105 Ga0068860_1000261055 258
1218 3300005844 Ga0068862_100036020 Ga0068862_1000360204 258
1219 3300005937 Ga0081455_10000328 Ga0081455_1000032856 258
1220 3300005937 Ga0081455_10021886 Ga0081455_100218862 258
1221 3300005937 Ga0081455_10106882 Ga0081455_101068823 258
1222 3300005983 Ga0081540_1000036 Ga0081540_100003648 258
1223 3300005985 Ga0081539_10001730 Ga0081539_1000173028 258
1224 3300006028 Ga0070717_10125539 Ga0070717_101255392 258
1225 3300006028 Ga0070717_10174034 Ga0070717_101740342 258
1226 3300006237 Ga0097621_100007340 Ga0097621_1000073409 258
1227 3300006237 Ga0097621_100056116 Ga0097621_1000561163 258
1228 3300006358 Ga0068871_100010917 Ga0068871_1000109173 258
1229 3300006358 Ga0068871_100020136 Ga0068871_1000201367 258
1230 3300006358 Ga0068871_100055094 Ga0068871_1000550945 258
1231 3300006871 Ga0075434_100994532 Ga0075434_1009945321 258
1232 3300006914 Ga0075436_100024075 Ga0075436_1000240755 258
1233 3300006914 Ga0075436_100090249 Ga0075436_1000902493 258
1234 3300009098 Ga0105245_10006614 Ga0105245_1000661417 258
1235 3300009098 Ga0105245_10141508 Ga0105245_101415083 258
1236 3300009098 Ga0105245_10568245 Ga0105245_105682452 258
1237 3300009147 Ga0114129_10038066 Ga0114129_100380662 258
1238 3300009147 Ga0114129_10257011 Ga0114129_102570113 258
1239 3300010375 Ga0105239_10070943 Ga0105239_100709432 258
1240 3300011119 Ga0105246_10216526 Ga0105246_102165262 258
1241 3300013296 Ga0157374_10001473 Ga0157374_100014731 258
1242 3300013296 Ga0157374_10271926 Ga0157374_102719263 258
1243 3300013297 Ga0157378_10065617 Ga0157378_100656173 258
1244 3300013297 Ga0157378_10071209 Ga0157378_100712093 258
1245 3300013297 Ga0157378_10089630 Ga0157378_100896301 258
1246 3300013297 Ga0157378_10160581 Ga0157378_101605812 258
1247 3300013297 Ga0157378_10508902 Ga0157378_105089022 258
1248 3300013297 Ga0157378_10526525 Ga0157378_105265252 258
1249 3300013297 Ga0157378_10542606 Ga0157378_105426061 258
1250 3300013306 Ga0163162_10003249 Ga0163162_100032497 258
1251 3300013306 Ga0163162_10063531 Ga0163162_100635313 258
1252 3300013306 Ga0163162_10098120 Ga0163162_100981203 258
1253 3300013306 Ga0163162_10666780 Ga0163162_106667801 258
1254 3300013308 Ga0157375_10000287 Ga0157375_1000028732 258
1255 3300013308 Ga0157375_10057311 Ga0157375_100573113 258
1256 3300013308 Ga0157375_10547567 Ga0157375_105475671 258
1257 3300013308 Ga0157375_10772538 Ga0157375_107725382 258
1258 3300014325 Ga0163163_10106929 Ga0163163_101069296 258
1259 3300014968 Ga0157379_10729915 Ga0157379_107299152 258
1260 3300014969 Ga0157376_10091330 Ga0157376_100913303 258
1261 3300014969 Ga0157376_10160877 Ga0157376_101608773 258
1262 3300014969 Ga0157376_10251468 Ga0157376_102514683 258
1263 3300025290 Ga0207673_1007003 Ga0207673_10070032 258
1264 3300025315 Ga0207697_10000060 Ga0207697_1000006044 258
1265 3300025315 Ga0207697_10000495 Ga0207697_1000049522 258
1266 3300025315 Ga0207697_10002230 Ga0207697_1000223016 258
1267 3300025315 Ga0207697_10002322 Ga0207697_100023224 258
1268 3300025893 Ga0207682_10090716 Ga0207682_100907162 258
1269 3300025898 Ga0207692_10033289 Ga0207692_100332893 258
1270 3300025899 Ga0207642_10059096 Ga0207642_100590963 258
1271 3300025901 Ga0207688_10001208 Ga0207688_1000120811 258
1272 3300025901 Ga0207688_10041925 Ga0207688_100419253 258
1273 3300025903 Ga0207680_10003944 Ga0207680_1000394412 258
1274 3300025903 Ga0207680_10010397 Ga0207680_100103973 258
1275 3300025907 Ga0207645_10001786 Ga0207645_100017864 258
1276 3300025907 Ga0207645_10012237 Ga0207645_100122379 258
1277 3300025907 Ga0207645_10039192 Ga0207645_100391922 258
1278 3300025907 Ga0207645_10227572 Ga0207645_102275723 258
1279 3300025910 Ga0207684_10000028 Ga0207684_1000002828 258
1280 3300025910 Ga0207684_10003766 Ga0207684_1000376617 258
1281 3300025910 Ga0207684_10025317 Ga0207684_100253172 258
1282 3300025910 Ga0207684_10226835 Ga0207684_102268353 258
1283 3300025910 Ga0207684_10343344 Ga0207684_103433442 258
1284 3300025915 Ga0207693_10167316 Ga0207693_101673161 258
1285 3300025915 Ga0207693_10375100 Ga0207693_103751002 258
1286 3300025922 Ga0207646_10003177 Ga0207646_1000317720 258
1287 3300025922 Ga0207646_10005640 Ga0207646_1000564019 258
1288 3300025922 Ga0207646_10005692 Ga0207646_1000569211 258
1289 3300025922 Ga0207646_10030370 Ga0207646_100303705 258
1290 3300025922 Ga0207646_10186558 Ga0207646_101865582 258
1291 3300025922 Ga0207646_10238646 Ga0207646_102386462 258
1292 3300025923 Ga0207681_10004055 Ga0207681_1000405514 258
1293 3300025925 Ga0207650_10010071 Ga0207650_100100713 258
1294 3300025925 Ga0207650_10174496 Ga0207650_101744963 258
1295 3300025926 Ga0207659_10004773 Ga0207659_100047735 258
1296 3300025926 Ga0207659_10010234 Ga0207659_100102347 258
1297 3300025926 Ga0207659_10493672 Ga0207659_104936722 258
1298 3300025927 Ga0207687_10113163 Ga0207687_101131633 258
1299 3300025928 Ga0207700_10230802 Ga0207700_102308022 258
1300 3300025929 Ga0207664_10177890 Ga0207664_101778902 258
1301 3300025931 Ga0207644_10017665 Ga0207644_100176655 258
1302 3300025933 Ga0207706_10008197 Ga0207706_100081974 258
1303 3300025933 Ga0207706_10095009 Ga0207706_100950093 258
1304 3300025934 Ga0207686_10014551 Ga0207686_100145515 258
1305 3300025936 Ga0207670_10040360 Ga0207670_100403603 258
1306 3300025937 Ga0207669_10002532 Ga0207669_100025326 258
1307 3300025939 Ga0207665_10055084 Ga0207665_100550845 258
1308 3300025939 Ga0207665_10417864 Ga0207665_104178642 258
1309 3300025940 Ga0207691_10000142 Ga0207691_1000014227 258
1310 3300025940 Ga0207691_10016028 Ga0207691_100160284 258
1311 3300025940 Ga0207691_10257276 Ga0207691_102572762 258
1312 3300025942 Ga0207689_10168013 Ga0207689_101680134 258
1313 3300025944 Ga0207661_10163363 Ga0207661_101633634 258
1314 3300025945 Ga0207679_10314870 Ga0207679_103148702 258
1315 3300025960 Ga0207651_10097059 Ga0207651_100970594 258
1316 3300025972 Ga0207668_10019735 Ga0207668_100197353 258
1317 3300025972 Ga0207668_10027206 Ga0207668_100272063 258
1318 3300025972 Ga0207668_10182042 Ga0207668_101820422 258
1319 3300025986 Ga0207658_10051112 Ga0207658_100511124 258
1320 3300025986 Ga0207658_10199370 Ga0207658_101993702 258
1321 3300025986 Ga0207658_10339869 Ga0207658_103398692 258
1322 3300026067 Ga0207678_10023215 Ga0207678_100232157 258
1323 3300026067 Ga0207678_10266155 Ga0207678_102661552 258
1324 3300026089 Ga0207648_10034197 Ga0207648_100341975 258
1325 3300026089 Ga0207648_10902665 Ga0207648_109026651 258
1326 3300026095 Ga0207676_10417637 Ga0207676_104176372 258
1327 3300026121 Ga0207683_10004854 Ga0207683_100048542 258
1328 3300026121 Ga0207683_10046837 Ga0207683_100468375 258
1329 3300028379 Ga0268266_10004179 Ga0268266_1000417922 258
1330 3300028379 Ga0268266_10032276 Ga0268266_100322763 258
1331 3300028379 Ga0268266_10140561 Ga0268266_101405612 258
1332 3300028381 Ga0268264_10020362 Ga0268264_100203623 258
1333 3300031251 Ga0265327_10012364 Ga0265327_100123643 258
1334 3300031711 Ga0265314_10081046 Ga0265314_100810462 258
1335 3300035117 Ga0373953_0034400 Ga0373953_0034400_701_1477 258
1336 3300035170 Ga0373943_0024014 Ga0373943_0024014_1683_2459 258
1337 3300035171 Ga0373946_0031037 Ga0373946_0031037_859_1635 258
1338 3300035691 Ga0373931_0146378 Ga0373931_0146378_376_1152 258
1339 3300035692 Ga0373935_0030347 Ga0373935_0030347_2406_3182 258
1340 3300035692 Ga0373935_0037217 Ga0373935_0037217_1034_1810 258
1341 3300035695 Ga0373927_0046397 Ga0373927_0046397_1648_2424 258
1342 3300036401 Ga0373937_0472894 Ga0373937_0472894_154_930 258
1343 3300037068 Ga0373925_0006124 Ga0373925_0006124_4973_5749 258
1344 3300037418 Ga0395900_0028674 Ga0395900_0028674_2390_3166 258
1345 3300037418 Ga0395900_0129142 Ga0395900_0129142_342_1118 258
1346 3300037466 Ga0395898_0002044 Ga0395898_0002044_13950_14726 258
1347 3300037471 Ga0395905_0023999 Ga0395905_0023999_305_1081 258
1348 3300038443 Ga0395901_0001709 Ga0395901_0001709_20788_21564 258
1349 3300041512 Ga0451853_1799426 Ga0451853_1799426_150_926 258
1350 3300042009 Ga0439451_021551 Ga0439451_021551_68_844 258
1351 3300045051 Ga0451576_0070018 Ga0451576_0070018_432_1208 258
1352 3300046454 Ga0495592_0020179 Ga0495592_0020179_1034_1810 258
1353 3300046462 Ga0495651_0018367 Ga0495651_0018367_1945_2721 258
1354 3300046516 Ga0495628_0057030 Ga0495628_0057030_2082_2858 258
1355 3300046517 Ga0495630_0040363 Ga0495630_0040363_673_1449 258
1356 3300046529 Ga0495652_0018013 Ga0495652_0018013_4574_5350 258
1357 3300046533 Ga0495640_0038007 Ga0495640_0038007_2339_3115 258
1358 3300046663 Ga0495635_0172690 Ga0495635_0172690_259_1035 258
1359 3300046683 Ga0495658_0025563 Ga0495658_0025563_587_1363 258
1360 3300046684 Ga0495669_0020683 Ga0495669_0020683_434_1210 258
1361 3300046684 Ga0495669_0063203 Ga0495669_0063203_826_1602 258
1362 3300046689 Ga0495613_0391752 Ga0495613_0391752_39_815 258
1363 3300047444 Ga0495675_0002584 Ga0495675_0002584_2101_2877 258
1364 3300047471 Ga0495684_0035564 Ga0495684_0035564_2723_3499 258
1365 3300048903 Ga0496100_0296118 Ga0496100_0296118_293_1069 258
1366 3300048907 Ga0496104_0069492 Ga0496104_0069492_1447_2223 258
1367 3300048907 Ga0496104_0664271 Ga0496104_0664271_46_822 258
1368 3300048908 Ga0496105_0031988 Ga0496105_0031988_3077_3853 258
1369 3300048911 Ga0496108_0182628 Ga0496108_0182628_54_830 258
1370 3300048911 Ga0496108_0435860 Ga0496108_0435860_21_797 258
1371 3300048913 Ga0496110_0028365 Ga0496110_0028365_3607_4383 258
1372 3300048915 Ga0496112_0324377 Ga0496112_0324377_332_1108 258
1373 3300048915 Ga0496112_0475350 Ga0496112_0475350_287_1063 258
1374 3300048918 Ga0496115_0032876 Ga0496115_0032876_878_1654 258
1375 3300048918 Ga0496115_0041211 Ga0496115_0041211_2360_3136 258
1376 3300049742 Ga0501080_0023861 Ga0501080_0023861_559_1383 258
1377 3300050507 nmdc:mga05p37_67830_c1 nmdc:mga05p37_67830_c1_903_1679 258
1378 3300050514 nmdc:mga08x19_22786_c1 nmdc:mga08x19_22786_c1_1471_2247 258
1379 3300050514 nmdc:mga08x19_298846_c1 nmdc:mga08x19_298846_c1_208_984 258
1380 3300053085 Ga0495619_0322967 Ga0495619_0322967_99_875 258
1381 3300053153 Ga0500616_0003859 Ga0500616_0003859_8128_8952 258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

44

280

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9826 1 251
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9787 1 251
4ook-assembly1.cif.gz_A third metal bound m.tuberculosis methionine aminopeptidase 0.9785 4 252
5ypj-assembly1.cif.gz_A mycobacterium tuberculosis methionine aminopeptidase type 1c (c105n mutant). 0.9785 4 252
5yoi-assembly1.cif.gz_A mycobacterium tuberculosis methionine aminopeptidase type 1c (c105t mutant) in complex with methionine 0.9776 4 252
ID Description Score Start End Superfamily
af_Q4VBS4_53_336_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9854 1 254 3.90.230.10
af_Q6Z3V9_1_121_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9848 13 128 3.90.230.10
af_Q9VKV9_33_317_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9837 1 251 3.90.230.10
af_I1J6Q1_1_201_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9825 48 252 3.90.230.10
4fukB01 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9814 9 250 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A838TBJ0-F1-model_v4 Methionine aminopeptidase (EC 3.4.11.18) 1.002 1 197 GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A356ZCU1-F1-model_v4 Type I methionyl aminopeptidase 0.9965 87 192 GO:0005829
GO:0006508
GO:0070006
AF-A0A4Q3Q0Z2-F1-model_v4 deleted 0.9947 71 251
AF-A0A4Q2XNK5-F1-model_v4 Methionine aminopeptidase (EC 3.4.11.18) 0.9941 13 189 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A2A2YGF7-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9939 1 252 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006

Feature Viewer

pLDDT pTM Quality
96.39 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map