F493489
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1377 | 674 | 1153 | 304 |
Family's Representative Sequence
| Representative Sequence | 3300048908|Ga0496105_0029657|Ga0496105_0029657_1225_2349 |
| Length | 350 |
| Sequence | MVEFLVSKLHDVRFMTMLLAAIAASATVYTLVMPLFAGEGLAKRMKAVASEKQVVSRVVEDFNLTKWLAQEAARDKLIMAGYRGQAPYITFLFARMVAPLVLFVGSIIYVFLIAHMQQSMPIKIGICIGAAYLGLQAPMLFLKNAISKRQLSIKRAFPDALDLLLICIESGMSVEMAFRKVATEIVGQSIALSEEFTLTTAELSYLQDRKVAYENLARRTGLEGVKSVCLALQQAERYGTPLGHSLRVMAQENRDMRMNEAEKKAAALPPKLTVPMILFFLPVLFVVILGPTGIKISELQLLLDADRARSAGSFRIARSGSDQSGWLSEATGVRFGAPRGASLRLSISLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 6 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 7 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 8 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 9 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 10 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 11 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 12 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 13 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 14 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 15 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 16 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 17 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 18 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 19 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 20 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 21 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 22 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 23 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 24 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 25 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 26 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 27 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 28 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 29 | 2791355199 | |||
| 30 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 31 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 32 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 33 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 34 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 35 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 36 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 37 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 38 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 39 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 40 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 41 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 42 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 43 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 44 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 45 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 46 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 47 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 48 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 49 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 50 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 51 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 52 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 53 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 54 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 55 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 56 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 57 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 58 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 59 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 60 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 61 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 62 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 63 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 64 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 65 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 66 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 67 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 68 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 69 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 70 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 71 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 72 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 73 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 74 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 75 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 76 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 77 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 78 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 79 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 80 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 81 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 82 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 83 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 84 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 85 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 86 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 87 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 88 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 89 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 90 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 91 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 92 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 93 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 94 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 95 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 96 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 97 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 98 | 2904699407 | |||
| 99 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 100 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 101 | 2906610324 | |||
| 102 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 103 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 104 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 105 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 106 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 107 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 108 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 109 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 110 | 2922368715 | |||
| 111 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 112 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 113 | 2922425934 | |||
| 114 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 115 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 116 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 117 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 118 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 119 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 120 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 121 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 122 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 123 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 124 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 125 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 126 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 127 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 128 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 129 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 130 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 131 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 132 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 133 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 134 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 135 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 136 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 137 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 138 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 139 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 140 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 141 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 142 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 143 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 144 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 145 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 146 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 147 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 148 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 149 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 150 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 151 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 152 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 153 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 154 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 155 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 156 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 157 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 158 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 159 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 160 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 161 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 162 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 163 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 164 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 165 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 166 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 167 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 168 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 169 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 170 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 171 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 172 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 173 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 174 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 175 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 176 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 177 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 178 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 179 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 180 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 181 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 182 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 183 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 184 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 185 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 186 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 187 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 188 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 189 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 190 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 191 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 192 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 193 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 194 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 195 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 196 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 197 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 198 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 199 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 200 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 202 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 204 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 205 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 207 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 208 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 215 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 218 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 220 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 221 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 224 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 225 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 227 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 229 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 230 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 231 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 232 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 234 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 235 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 236 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 238 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 239 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 240 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 241 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 242 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 243 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 244 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 245 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 246 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 247 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 248 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 249 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 250 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 251 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 252 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 253 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 254 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 255 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 256 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 257 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 258 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 259 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 260 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 261 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 262 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 263 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 264 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 266 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 267 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 269 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 270 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 271 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 272 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 274 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 275 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 276 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 277 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 278 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 279 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 280 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 281 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 282 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 283 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 284 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 285 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 286 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 287 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 288 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 289 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 290 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 291 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 292 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 293 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 294 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 295 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 296 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 297 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 298 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 299 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 300 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 301 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 302 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 303 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 304 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 305 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 306 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 307 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 308 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 309 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 310 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 311 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 312 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 313 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 314 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 373 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 374 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 375 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 376 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 381 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 382 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 383 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 384 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 385 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 386 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 387 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 388 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 389 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 390 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 391 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 392 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 393 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 394 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 395 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 396 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 397 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 398 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 399 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 400 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 401 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 402 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 403 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 404 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 405 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 406 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 407 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 408 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 409 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 410 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 411 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 412 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 413 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 414 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 415 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 416 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 417 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 418 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 419 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 420 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 421 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 422 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 423 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 424 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 425 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 426 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 427 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 428 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 429 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 430 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 431 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 432 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 433 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 434 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 435 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 436 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 437 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 438 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 439 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 440 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 441 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 442 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 443 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 444 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 445 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 446 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 447 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 448 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 449 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 450 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 524 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 525 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 526 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 527 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 528 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 529 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 530 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 531 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 532 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 533 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 534 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 535 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 536 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 537 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 538 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 539 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 540 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 541 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 542 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 543 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 544 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 545 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 546 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 547 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 548 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 550 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 551 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 552 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 553 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 554 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 555 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 556 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 557 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 558 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 559 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 560 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 561 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 562 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 563 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 564 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 565 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 566 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 567 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 568 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 569 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 570 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 571 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 572 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 573 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 574 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 575 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 576 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 577 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 578 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 579 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 580 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 581 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 582 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 583 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 584 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 585 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 586 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 589 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 592 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 593 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 594 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 595 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 596 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 597 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 598 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 599 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 600 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 601 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 602 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 603 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 604 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 605 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 606 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 607 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 608 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 609 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 610 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 611 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 612 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 613 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 614 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 615 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 616 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 617 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 618 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 619 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 620 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 621 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 622 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 623 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 624 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 625 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 626 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 627 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 628 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 629 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 630 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 631 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 632 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 633 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 634 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 635 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 636 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 637 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 638 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 639 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 640 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 641 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 642 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 643 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 644 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 645 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 646 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 647 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 648 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 649 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 650 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 651 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 652 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 653 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 654 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 655 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 656 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 657 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 658 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 659 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 660 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 661 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 662 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 663 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 664 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 665 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 666 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 667 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 668 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 669 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 670 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 671 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 672 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 673 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 674 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.04 |
| Metatranscriptomes | 0 |
| Isolates | 15.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.97 |
| Nodule | 12.42 |
| Rhizoplane | 5.45 |
| Rhizosphere | 60.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1005339 | 3300000549 | Bacteria | 1636 |
| 2 | JGI24740J21852_10007574 | 3300001979 | Bacteria | 4399 |
| 3 | JGI24739J22299_10008847 | 3300001989 | Bacteria | 3754 |
| 4 | JGI24737J22298_10000804 | 3300001990 | Bacteria | 11129 |
| 5 | JGI24735J21928_10013308 | 3300002067 | Bacteria | 2588 |
| 6 | JGI24750J21931_1003837 | 3300002070 | Bacteria | 1809 |
| 7 | JGI24742J22300_10002754 | 3300002244 | Bacteria | 2831 |
| 8 | JGI25406J46586_10000012 | 3300003203 | Bacteria | 102438 |
| 9 | JGI25165J46597_1004140 | 3300003214 | Bacteria | 3227 |
| 10 | JGI25153J46596_10004406 | 3300003215 | Bacteria | 7599 |
| 11 | JGI25153J46596_10005221 | 3300003215 | Bacteria | 6835 |
| 12 | JGI25153J46596_10005329 | 3300003215 | Bacteria | 6758 |
| 13 | JGI25153J46596_10010431 | 3300003215 | Bacteria | 4202 |
| 14 | JGI25160J50197_1002246 | 3300003354 | Bacteria | 9074 |
| 15 | JGI25404J52841_10007705 | 3300003659 | Bacteria | 2283 |
| 16 | JGI25404J52841_10009784 | 3300003659 | Bacteria | 2055 |
| 17 | Ga0055531_10002655 | 3300003794 | Bacteria | 11794 |
| 18 | Ga0055543_1001363 | 3300004625 | Bacteria | 9855 |
| 19 | Ga0065165_1000982 | 3300005262 | Bacteria | 35331 |
| 20 | Ga0070658_10068350 | 3300005327 | Bacteria | 2904 |
| 21 | Ga0070658_10079986 | 3300005327 | Bacteria | 2684 |
| 22 | Ga0070658_10423658 | 3300005327 | Bacteria | 1145 |
| 23 | Ga0070683_100047292 | 3300005329 | Bacteria | 3975 |
| 24 | Ga0070683_100102927 | 3300005329 | Bacteria | 2690 |
| 25 | Ga0070683_100106272 | 3300005329 | Bacteria | 2646 |
| 26 | Ga0070666_10064994 | 3300005335 | Bacteria | 2475 |
| 27 | Ga0070680_100037092 | 3300005336 | Bacteria | 3939 |
| 28 | Ga0070680_100163929 | 3300005336 | Bacteria | 1868 |
| 29 | Ga0068868_100009313 | 3300005338 | Bacteria | 7060 |
| 30 | Ga0068868_100048804 | 3300005338 | Bacteria | 3321 |
| 31 | Ga0070660_100398703 | 3300005339 | Bacteria | 1137 |
| 32 | Ga0070689_100017900 | 3300005340 | Bacteria | 5209 |
| 33 | Ga0070691_10059080 | 3300005341 | Bacteria | 1842 |
| 34 | Ga0070661_100120947 | 3300005344 | Bacteria | 1961 |
| 35 | Ga0070668_100091738 | 3300005347 | Bacteria | 2395 |
| 36 | Ga0070669_100110039 | 3300005353 | Bacteria | 2089 |
| 37 | Ga0070671_100001845 | 3300005355 | Bacteria | 16138 |
| 38 | Ga0070671_100043091 | 3300005355 | Bacteria | 3751 |
| 39 | Ga0070674_100169637 | 3300005356 | Bacteria | 1662 |
| 40 | Ga0070673_100002424 | 3300005364 | Bacteria | 11361 |
| 41 | Ga0070688_100200220 | 3300005365 | Bacteria | 1397 |
| 42 | Ga0070659_100051244 | 3300005366 | Bacteria | 3245 |
| 43 | Ga0070659_100069509 | 3300005366 | Bacteria | 2795 |
| 44 | Ga0070659_100126238 | 3300005366 | Bacteria | 2075 |
| 45 | Ga0070659_100153950 | 3300005366 | Bacteria | 1876 |
| 46 | Ga0070659_100231343 | 3300005366 | Bacteria | 1528 |
| 47 | Ga0070659_100275573 | 3300005366 | Bacteria | 1399 |
| 48 | Ga0070667_100019427 | 3300005367 | Bacteria | 5637 |
| 49 | Ga0070667_100138512 | 3300005367 | Bacteria | 2129 |
| 50 | Ga0070709_10003906 | 3300005434 | Bacteria | 8038 |
| 51 | Ga0070709_10004543 | 3300005434 | Bacteria | 7491 |
| 52 | Ga0070709_10012306 | 3300005434 | Bacteria | 4786 |
| 53 | Ga0070709_10016795 | 3300005434 | Bacteria | 4186 |
| 54 | Ga0070709_10037413 | 3300005434 | Bacteria | 2963 |
| 55 | Ga0070714_100002945 | 3300005435 | Bacteria | 12607 |
| 56 | Ga0070714_100106715 | 3300005435 | Bacteria | 2475 |
| 57 | Ga0070714_100162185 | 3300005435 | Bacteria | 2023 |
| 58 | Ga0070714_100207719 | 3300005435 | Bacteria | 1794 |
| 59 | Ga0070713_100053233 | 3300005436 | Bacteria | 3353 |
| 60 | Ga0070713_100334865 | 3300005436 | Bacteria | 1401 |
| 61 | Ga0070713_100396101 | 3300005436 | Bacteria | 1289 |
| 62 | Ga0070710_10000251 | 3300005437 | Bacteria | 25319 |
| 63 | Ga0070710_10002918 | 3300005437 | Bacteria | 8129 |
| 64 | Ga0070710_10044041 | 3300005437 | Bacteria | 2474 |
| 65 | Ga0070711_100000261 | 3300005439 | Bacteria | 27019 |
| 66 | Ga0070711_100001524 | 3300005439 | Bacteria | 12774 |
| 67 | Ga0070711_100006208 | 3300005439 | Bacteria | 7190 |
| 68 | Ga0070711_100042930 | 3300005439 | Bacteria | 3060 |
| 69 | Ga0070705_100157962 | 3300005440 | Bacteria | 1512 |
| 70 | Ga0070700_100026245 | 3300005441 | Bacteria | 3438 |
| 71 | Ga0070694_100068491 | 3300005444 | Bacteria | 2439 |
| 72 | Ga0070663_100022555 | 3300005455 | Bacteria | 4210 |
| 73 | Ga0070663_100079217 | 3300005455 | Bacteria | 2410 |
| 74 | Ga0070663_100095518 | 3300005455 | Bacteria | 2210 |
| 75 | Ga0070663_100257304 | 3300005455 | Bacteria | 1384 |
| 76 | Ga0070678_100008171 | 3300005456 | Bacteria | 6254 |
| 77 | Ga0070678_100227861 | 3300005456 | Bacteria | 1552 |
| 78 | Ga0070662_100049507 | 3300005457 | Bacteria | 3030 |
| 79 | Ga0070681_10077923 | 3300005458 | Bacteria | 3271 |
| 80 | Ga0070681_10098406 | 3300005458 | Bacteria | 2871 |
| 81 | Ga0070681_10115483 | 3300005458 | Bacteria | 2622 |
| 82 | Ga0070681_10408946 | 3300005458 | Bacteria | 1269 |
| 83 | Ga0070681_10494262 | 3300005458 | Bacteria | 1136 |
| 84 | Ga0070706_100303288 | 3300005467 | Bacteria | 1490 |
| 85 | Ga0070707_100362581 | 3300005468 | Bacteria | 1408 |
| 86 | Ga0070698_100073038 | 3300005471 | Bacteria | 3438 |
| 87 | Ga0070699_100169809 | 3300005518 | Bacteria | 1932 |
| 88 | Ga0070699_100525571 | 3300005518 | Bacteria | 1076 |
| 89 | Ga0070679_100024224 | 3300005530 | Bacteria | 5947 |
| 90 | Ga0070679_100040368 | 3300005530 | Bacteria | 4643 |
| 91 | Ga0070679_100057989 | 3300005530 | Bacteria | 3859 |
| 92 | Ga0070679_100121093 | 3300005530 | Bacteria | 2601 |
| 93 | Ga0070684_100010714 | 3300005535 | Bacteria | 7274 |
| 94 | Ga0070684_100129222 | 3300005535 | Bacteria | 2278 |
| 95 | Ga0068853_100004793 | 3300005539 | Bacteria | 10521 |
| 96 | Ga0068853_100076182 | 3300005539 | Bacteria | 2929 |
| 97 | Ga0068853_100099554 | 3300005539 | Bacteria | 2568 |
| 98 | Ga0070672_100074667 | 3300005543 | Bacteria | 2705 |
| 99 | Ga0070672_100193157 | 3300005543 | Bacteria | 1700 |
| 100 | Ga0070686_100050421 | 3300005544 | Bacteria | 2645 |
| 101 | Ga0070665_100009999 | 3300005548 | Bacteria | 9598 |
| 102 | Ga0070665_100033056 | 3300005548 | Bacteria | 5204 |
| 103 | Ga0070665_100043790 | 3300005548 | Bacteria | 4497 |
| 104 | Ga0070665_100080134 | 3300005548 | Bacteria | 3270 |
| 105 | Ga0070665_100103205 | 3300005548 | Bacteria | 2854 |
| 106 | Ga0068855_100032380 | 3300005563 | Bacteria | 6243 |
| 107 | Ga0068855_100087063 | 3300005563 | Bacteria | 3611 |
| 108 | Ga0068855_100138815 | 3300005563 | Bacteria | 2772 |
| 109 | Ga0068855_100274591 | 3300005563 | Bacteria | 1873 |
| 110 | Ga0070664_100043519 | 3300005564 | Bacteria | 3788 |
| 111 | Ga0068854_100001506 | 3300005578 | Bacteria | 14100 |
| 112 | Ga0068854_100001788 | 3300005578 | Bacteria | 13097 |
| 113 | Ga0068854_100360369 | 3300005578 | Bacteria | 1193 |
| 114 | Ga0068856_100000137 | 3300005614 | Bacteria | 73762 |
| 115 | Ga0068856_100001074 | 3300005614 | Bacteria | 28942 |
| 116 | Ga0068856_100081807 | 3300005614 | Bacteria | 3204 |
| 117 | Ga0068856_100240006 | 3300005614 | Bacteria | 1828 |
| 118 | Ga0068856_100334622 | 3300005614 | Bacteria | 1532 |
| 119 | Ga0068856_100428682 | 3300005614 | Bacteria | 1343 |
| 120 | Ga0068852_100028969 | 3300005616 | Bacteria | 4541 |
| 121 | Ga0068852_100057592 | 3300005616 | Bacteria | 3363 |
| 122 | Ga0068852_100182296 | 3300005616 | Bacteria | 1975 |
| 123 | Ga0068852_100537531 | 3300005616 | Bacteria | 1168 |
| 124 | Ga0068859_100583281 | 3300005617 | Bacteria | 1212 |
| 125 | Ga0068864_100129831 | 3300005618 | Bacteria | 2262 |
| 126 | Ga0068866_10021348 | 3300005718 | Bacteria | 2981 |
| 127 | Ga0068866_10059241 | 3300005718 | Bacteria | 1980 |
| 128 | Ga0068861_100109122 | 3300005719 | Bacteria | 2215 |
| 129 | Ga0068861_100119117 | 3300005719 | Bacteria | 2127 |
| 130 | Ga0068851_10007723 | 3300005834 | Bacteria | 4946 |
| 131 | Ga0068851_10055527 | 3300005834 | Bacteria | 2018 |
| 132 | Ga0068863_100109668 | 3300005841 | Bacteria | 2628 |
| 133 | Ga0068858_100072648 | 3300005842 | Bacteria | 3192 |
| 134 | Ga0068858_100078409 | 3300005842 | Bacteria | 3070 |
| 135 | Ga0068858_100136181 | 3300005842 | Bacteria | 2304 |
| 136 | Ga0068858_100303077 | 3300005842 | Bacteria | 1525 |
| 137 | Ga0068860_100000837 | 3300005843 | Bacteria | 34452 |
| 138 | Ga0068860_100517711 | 3300005843 | Bacteria | 1193 |
| 139 | Ga0081455_10018080 | 3300005937 | Bacteria | 6731 |
| 140 | Ga0081455_10026840 | 3300005937 | Bacteria | 5289 |
| 141 | Ga0081455_10034630 | 3300005937 | Bacteria | 4523 |
| 142 | Ga0081455_10042185 | 3300005937 | Bacteria | 4005 |
| 143 | Ga0081455_10079511 | 3300005937 | Bacteria | 2692 |
| 144 | Ga0081538_10032966 | 3300005981 | Bacteria | 3458 |
| 145 | Ga0081540_1000721 | 3300005983 | Bacteria | 30491 |
| 146 | Ga0081540_1002063 | 3300005983 | Bacteria | 16750 |
| 147 | Ga0081540_1010031 | 3300005983 | Bacteria | 6449 |
| 148 | Ga0081540_1021769 | 3300005983 | Bacteria | 3806 |
| 149 | Ga0081540_1022188 | 3300005983 | Bacteria | 3752 |
| 150 | Ga0081540_1024847 | 3300005983 | Bacteria | 3466 |
| 151 | Ga0081540_1035426 | 3300005983 | Bacteria | 2676 |
| 152 | Ga0081540_1062350 | 3300005983 | Bacteria | 1771 |
| 153 | Ga0081540_1100765 | 3300005983 | Bacteria | 1245 |
| 154 | Ga0081539_10000040 | 3300005985 | Bacteria | 292753 |
| 155 | Ga0081539_10000157 | 3300005985 | Bacteria | 158278 |
| 156 | Ga0081539_10033396 | 3300005985 | Bacteria | 3135 |
| 157 | Ga0070717_10007408 | 3300006028 | Bacteria | 8149 |
| 158 | Ga0070717_10037586 | 3300006028 | Bacteria | 3932 |
| 159 | Ga0075365_10014233 | 3300006038 | Bacteria | 4781 |
| 160 | Ga0075365_10021213 | 3300006038 | Bacteria | 4048 |
| 161 | Ga0075365_10040274 | 3300006038 | Bacteria | 3047 |
| 162 | Ga0075365_10070752 | 3300006038 | Bacteria | 2347 |
| 163 | Ga0075363_100105108 | 3300006048 | Bacteria | 1566 |
| 164 | Ga0075364_10067575 | 3300006051 | Bacteria | 2349 |
| 165 | Ga0075364_10074775 | 3300006051 | Bacteria | 2235 |
| 166 | Ga0070715_10000749 | 3300006163 | Bacteria | 8767 |
| 167 | Ga0070715_10117130 | 3300006163 | Bacteria | 1265 |
| 168 | Ga0070712_100002194 | 3300006175 | Bacteria | 12004 |
| 169 | Ga0070712_100128675 | 3300006175 | Bacteria | 1916 |
| 170 | Ga0070712_100178765 | 3300006175 | Bacteria | 1652 |
| 171 | Ga0070712_100305098 | 3300006175 | Bacteria | 1290 |
| 172 | Ga0075369_10078004 | 3300006186 | Bacteria | 1466 |
| 173 | Ga0075369_10116658 | 3300006186 | Bacteria | 1206 |
| 174 | Ga0075366_10036589 | 3300006195 | Bacteria | 2894 |
| 175 | Ga0075366_10089529 | 3300006195 | Bacteria | 1843 |
| 176 | Ga0097621_100156117 | 3300006237 | Bacteria | 1959 |
| 177 | Ga0075370_10013631 | 3300006353 | Bacteria | 4326 |
| 178 | Ga0075429_100269386 | 3300006880 | Bacteria | 1491 |
| 179 | Ga0097620_100583269 | 3300006931 | Bacteria | 1212 |
| 180 | Ga0075435_100045113 | 3300007076 | Bacteria | 3532 |
| 181 | Ga0075435_100061823 | 3300007076 | Bacteria | 3038 |
| 182 | Ga0099794_10003243 | 3300007265 | Bacteria | 6167 |
| 183 | Ga0099794_10081608 | 3300007265 | Bacteria | 1595 |
| 184 | Ga0099795_10004122 | 3300007788 | Bacteria | 3708 |
| 185 | Ga0099795_10012627 | 3300007788 | Bacteria | 2568 |
| 186 | Ga0099795_10044008 | 3300007788 | Bacteria | 1599 |
| 187 | Ga0105240_10004694 | 3300009093 | Bacteria | 20654 |
| 188 | Ga0105240_10006068 | 3300009093 | Bacteria | 17849 |
| 189 | Ga0105240_10011324 | 3300009093 | Bacteria | 12425 |
| 190 | Ga0105240_10011879 | 3300009093 | Bacteria | 12083 |
| 191 | Ga0105240_10046776 | 3300009093 | Bacteria | 5480 |
| 192 | Ga0105240_10067164 | 3300009093 | Bacteria | 4445 |
| 193 | Ga0105240_10193225 | 3300009093 | Bacteria | 2392 |
| 194 | Ga0105240_10389828 | 3300009093 | Bacteria | 1571 |
| 195 | Ga0105240_10753321 | 3300009093 | Bacteria | 1059 |
| 196 | Ga0111539_10123838 | 3300009094 | Bacteria | 3030 |
| 197 | Ga0111539_10331660 | 3300009094 | Bacteria | 1771 |
| 198 | Ga0105245_10074417 | 3300009098 | Bacteria | 3091 |
| 199 | Ga0105245_10430542 | 3300009098 | Bacteria | 1324 |
| 200 | Ga0105247_10138362 | 3300009101 | Bacteria | 1593 |
| 201 | Ga0105247_10219484 | 3300009101 | Bacteria | 1286 |
| 202 | Ga0105243_10346994 | 3300009148 | Bacteria | 1362 |
| 203 | Ga0105241_10009922 | 3300009174 | Bacteria | 6998 |
| 204 | Ga0105241_10011272 | 3300009174 | Bacteria | 6554 |
| 205 | Ga0105241_10057927 | 3300009174 | Bacteria | 2974 |
| 206 | Ga0105241_10109572 | 3300009174 | Bacteria | 2208 |
| 207 | Ga0105241_10208362 | 3300009174 | Bacteria | 1637 |
| 208 | Ga0105248_10091835 | 3300009177 | Bacteria | 3419 |
| 209 | Ga0105248_10237689 | 3300009177 | Bacteria | 2051 |
| 210 | Ga0105237_10002118 | 3300009545 | Bacteria | 25049 |
| 211 | Ga0105237_10023062 | 3300009545 | Bacteria | 6382 |
| 212 | Ga0105237_10064354 | 3300009545 | Bacteria | 3664 |
| 213 | Ga0105237_10075396 | 3300009545 | Bacteria | 3365 |
| 214 | Ga0105237_10111021 | 3300009545 | Bacteria | 2733 |
| 215 | Ga0105237_10154200 | 3300009545 | Bacteria | 2293 |
| 216 | Ga0105237_10272808 | 3300009545 | Bacteria | 1694 |
| 217 | Ga0105237_10319612 | 3300009545 | Bacteria | 1556 |
| 218 | Ga0105237_10410049 | 3300009545 | Bacteria | 1360 |
| 219 | Ga0105237_10539498 | 3300009545 | Bacteria | 1173 |
| 220 | Ga0105238_10004460 | 3300009551 | Bacteria | 13879 |
| 221 | Ga0105238_10017095 | 3300009551 | Bacteria | 7362 |
| 222 | Ga0105238_10020882 | 3300009551 | Bacteria | 6671 |
| 223 | Ga0105238_10043133 | 3300009551 | Bacteria | 4564 |
| 224 | Ga0105238_10261492 | 3300009551 | Bacteria | 1710 |
| 225 | Ga0105238_10299492 | 3300009551 | Bacteria | 1591 |
| 226 | Ga0105249_10258761 | 3300009553 | Bacteria | 1728 |
| 227 | Ga0099796_10016174 | 3300010159 | Bacteria | 2198 |
| 228 | Ga0105239_10005955 | 3300010375 | Bacteria | 14187 |
| 229 | Ga0105239_10015728 | 3300010375 | Bacteria | 8375 |
| 230 | Ga0105239_10020720 | 3300010375 | Bacteria | 7253 |
| 231 | Ga0105239_10065937 | 3300010375 | Bacteria | 3978 |
| 232 | Ga0105239_10086632 | 3300010375 | Bacteria | 3452 |
| 233 | Ga0105239_10091614 | 3300010375 | Bacteria | 3355 |
| 234 | Ga0105239_10100157 | 3300010375 | Bacteria | 3205 |
| 235 | Ga0105239_10133631 | 3300010375 | Bacteria | 2761 |
| 236 | Ga0105239_10272337 | 3300010375 | Bacteria | 1904 |
| 237 | Ga0105246_10011111 | 3300011119 | Bacteria | 5579 |
| 238 | Ga0105246_10056087 | 3300011119 | Bacteria | 2722 |
| 239 | Ga0105246_10143818 | 3300011119 | Bacteria | 1797 |
| 240 | Ga0105246_10249314 | 3300011119 | Bacteria | 1408 |
| 241 | Ga0157371_10046519 | 3300013102 | Bacteria | 3086 |
| 242 | Ga0157370_10011688 | 3300013104 | Bacteria | 9163 |
| 243 | Ga0157370_10071396 | 3300013104 | Bacteria | 3275 |
| 244 | Ga0157370_10109493 | 3300013104 | Bacteria | 2582 |
| 245 | Ga0157369_10002281 | 3300013105 | Bacteria | 23076 |
| 246 | Ga0157369_10003351 | 3300013105 | Bacteria | 19026 |
| 247 | Ga0157369_10023959 | 3300013105 | Bacteria | 6791 |
| 248 | Ga0157374_10052418 | 3300013296 | Bacteria | 3800 |
| 249 | Ga0157374_10166903 | 3300013296 | Bacteria | 2146 |
| 250 | Ga0157374_10286525 | 3300013296 | Bacteria | 1627 |
| 251 | Ga0157374_10321590 | 3300013296 | Bacteria | 1533 |
| 252 | Ga0157378_10118327 | 3300013297 | Bacteria | 2439 |
| 253 | Ga0163162_10038773 | 3300013306 | Bacteria | 4756 |
| 254 | Ga0163162_10045055 | 3300013306 | Bacteria | 4419 |
| 255 | Ga0163162_10092404 | 3300013306 | Bacteria | 3109 |
| 256 | Ga0163162_10133390 | 3300013306 | Bacteria | 2593 |
| 257 | Ga0163162_10271476 | 3300013306 | Bacteria | 1828 |
| 258 | Ga0157372_10178769 | 3300013307 | Bacteria | 2456 |
| 259 | Ga0157372_10219310 | 3300013307 | Bacteria | 2205 |
| 260 | Ga0157372_10399237 | 3300013307 | Bacteria | 1602 |
| 261 | Ga0157372_10560699 | 3300013307 | Bacteria | 1332 |
| 262 | Ga0157375_10251039 | 3300013308 | Bacteria | 1930 |
| 263 | Ga0157375_10385441 | 3300013308 | Bacteria | 1568 |
| 264 | Ga0163163_10003826 | 3300014325 | Bacteria | 12814 |
| 265 | Ga0163163_10020851 | 3300014325 | Bacteria | 6178 |
| 266 | Ga0163163_10029087 | 3300014325 | Bacteria | 5313 |
| 267 | Ga0163163_10288974 | 3300014325 | Bacteria | 1692 |
| 268 | Ga0163163_10313023 | 3300014325 | Bacteria | 1623 |
| 269 | Ga0157377_10083982 | 3300014745 | Bacteria | 1867 |
| 270 | Ga0157379_10025262 | 3300014968 | Bacteria | 5276 |
| 271 | Ga0157379_10317833 | 3300014968 | Bacteria | 1421 |
| 272 | Ga0157379_10380867 | 3300014968 | Bacteria | 1294 |
| 273 | Ga0157376_10018180 | 3300014969 | Bacteria | 5381 |
| 274 | Ga0214544_1000011 | 3300021320 | Bacteria | 262952 |
| 275 | Ga0214542_1000009 | 3300021321 | Bacteria | 262861 |
| 276 | Ga0214545_1000007 | 3300021324 | Bacteria | 262984 |
| 277 | Ga0214543_1000020 | 3300021327 | Bacteria | 262861 |
| 278 | Ga0213873_10017467 | 3300021358 | Bacteria | 1637 |
| 279 | Ga0213872_10044001 | 3300021361 | Bacteria | 2033 |
| 280 | Ga0213876_10005309 | 3300021384 | Bacteria | 7092 |
| 281 | Ga0213876_10029749 | 3300021384 | Bacteria | 2878 |
| 282 | Ga0213876_10040722 | 3300021384 | Bacteria | 2455 |
| 283 | Ga0213876_10095749 | 3300021384 | Bacteria | 1573 |
| 284 | Ga0213876_10114675 | 3300021384 | Bacteria | 1430 |
| 285 | Ga0209563_100776 | 3300025230 | Bacteria | 9652 |
| 286 | Ga0207425_1017907 | 3300025245 | Bacteria | 1547 |
| 287 | Ga0209677_100388 | 3300025253 | Bacteria | 26746 |
| 288 | Ga0209677_100400 | 3300025253 | Bacteria | 26165 |
| 289 | Ga0209148_1000321 | 3300025254 | Bacteria | 66604 |
| 290 | Ga0209233_1005842 | 3300025261 | Bacteria | 4041 |
| 291 | Ga0209233_1008676 | 3300025261 | Bacteria | 3128 |
| 292 | Ga0209233_1008776 | 3300025261 | Bacteria | 3105 |
| 293 | Ga0209233_1008870 | 3300025261 | Bacteria | 3083 |
| 294 | Ga0209455_1001351 | 3300025272 | Bacteria | 11271 |
| 295 | Ga0209455_1001976 | 3300025272 | Bacteria | 8424 |
| 296 | Ga0209455_1004752 | 3300025272 | Bacteria | 4359 |
| 297 | Ga0209564_1000477 | 3300025295 | Bacteria | 66843 |
| 298 | Ga0209564_1006461 | 3300025295 | Bacteria | 6312 |
| 299 | Ga0209564_1008490 | 3300025295 | Bacteria | 5059 |
| 300 | Ga0209758_1000206 | 3300025297 | Bacteria | 130177 |
| 301 | Ga0209758_1000536 | 3300025297 | Bacteria | 60374 |
| 302 | Ga0209758_1001992 | 3300025297 | Bacteria | 22001 |
| 303 | Ga0209758_1002275 | 3300025297 | Bacteria | 19895 |
| 304 | Ga0209758_1002550 | 3300025297 | Bacteria | 18367 |
| 305 | Ga0209758_1003319 | 3300025297 | Bacteria | 14823 |
| 306 | Ga0209758_1005044 | 3300025297 | Bacteria | 10495 |
| 307 | Ga0209758_1005519 | 3300025297 | Bacteria | 9666 |
| 308 | Ga0209256_1009447 | 3300025299 | Bacteria | 4274 |
| 309 | Ga0207426_1000773 | 3300025302 | Bacteria | 35199 |
| 310 | Ga0207426_1001183 | 3300025302 | Bacteria | 23298 |
| 311 | Ga0207426_1008206 | 3300025302 | Bacteria | 4252 |
| 312 | Ga0207426_1013106 | 3300025302 | Bacteria | 3086 |
| 313 | Ga0209257_1000394 | 3300025304 | Bacteria | 86654 |
| 314 | Ga0209257_1032679 | 3300025304 | Bacteria | 1646 |
| 315 | Ga0207697_10049588 | 3300025315 | Bacteria | 1733 |
| 316 | Ga0207656_10044269 | 3300025321 | Bacteria | 1900 |
| 317 | Ga0207656_10128202 | 3300025321 | Bacteria | 1186 |
| 318 | Ga0207692_10000717 | 3300025898 | Bacteria | 11668 |
| 319 | Ga0207692_10021767 | 3300025898 | Bacteria | 2939 |
| 320 | Ga0207692_10032232 | 3300025898 | Bacteria | 2517 |
| 321 | Ga0207642_10071949 | 3300025899 | Bacteria | 1649 |
| 322 | Ga0207710_10036010 | 3300025900 | Bacteria | 2180 |
| 323 | Ga0207710_10099970 | 3300025900 | Bacteria | 1367 |
| 324 | Ga0207688_10046505 | 3300025901 | Bacteria | 2423 |
| 325 | Ga0207680_10056509 | 3300025903 | Bacteria | 2370 |
| 326 | Ga0207647_10000764 | 3300025904 | Bacteria | 25126 |
| 327 | Ga0207647_10010156 | 3300025904 | Bacteria | 6653 |
| 328 | Ga0207647_10184968 | 3300025904 | Bacteria | 1209 |
| 329 | Ga0207685_10000368 | 3300025905 | Bacteria | 7391 |
| 330 | Ga0207685_10082822 | 3300025905 | Bacteria | 1332 |
| 331 | Ga0207699_10000122 | 3300025906 | Bacteria | 55116 |
| 332 | Ga0207699_10000967 | 3300025906 | Bacteria | 13702 |
| 333 | Ga0207699_10028502 | 3300025906 | Bacteria | 3104 |
| 334 | Ga0207699_10261047 | 3300025906 | Bacteria | 1197 |
| 335 | Ga0207645_10029692 | 3300025907 | Bacteria | 3524 |
| 336 | Ga0207645_10164429 | 3300025907 | Bacteria | 1452 |
| 337 | Ga0207705_10051762 | 3300025909 | Bacteria | 2955 |
| 338 | Ga0207684_10097971 | 3300025910 | Bacteria | 2504 |
| 339 | Ga0207654_10000201 | 3300025911 | Bacteria | 36898 |
| 340 | Ga0207654_10027667 | 3300025911 | Bacteria | 3084 |
| 341 | Ga0207654_10149180 | 3300025911 | Bacteria | 1499 |
| 342 | Ga0207707_10000515 | 3300025912 | Bacteria | 39696 |
| 343 | Ga0207707_10000706 | 3300025912 | Bacteria | 33199 |
| 344 | Ga0207707_10007092 | 3300025912 | Bacteria | 9765 |
| 345 | Ga0207707_10024841 | 3300025912 | Bacteria | 5240 |
| 346 | Ga0207707_10129917 | 3300025912 | Bacteria | 2203 |
| 347 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 348 | Ga0207695_10000343 | 3300025913 | Bacteria | 107739 |
| 349 | Ga0207695_10017441 | 3300025913 | Bacteria | 8356 |
| 350 | Ga0207695_10044192 | 3300025913 | Bacteria | 4741 |
| 351 | Ga0207695_10165737 | 3300025913 | Bacteria | 2138 |
| 352 | Ga0207671_10025726 | 3300025914 | Bacteria | 4418 |
| 353 | Ga0207671_10025913 | 3300025914 | Bacteria | 4400 |
| 354 | Ga0207671_10079304 | 3300025914 | Bacteria | 2460 |
| 355 | Ga0207671_10110224 | 3300025914 | Bacteria | 2094 |
| 356 | Ga0207671_10199660 | 3300025914 | Bacteria | 1562 |
| 357 | Ga0207671_10286383 | 3300025914 | Bacteria | 1300 |
| 358 | Ga0207693_10001659 | 3300025915 | Bacteria | 19621 |
| 359 | Ga0207693_10003226 | 3300025915 | Bacteria | 14002 |
| 360 | Ga0207693_10026017 | 3300025915 | Bacteria | 4634 |
| 361 | Ga0207693_10051991 | 3300025915 | Bacteria | 3213 |
| 362 | Ga0207693_10157712 | 3300025915 | Bacteria | 1785 |
| 363 | Ga0207693_10167364 | 3300025915 | Bacteria | 1731 |
| 364 | Ga0207663_10000161 | 3300025916 | Bacteria | 30665 |
| 365 | Ga0207663_10002134 | 3300025916 | Bacteria | 9435 |
| 366 | Ga0207663_10026504 | 3300025916 | Bacteria | 3365 |
| 367 | Ga0207663_10042512 | 3300025916 | Bacteria | 2777 |
| 368 | Ga0207663_10066009 | 3300025916 | Bacteria | 2315 |
| 369 | Ga0207663_10231516 | 3300025916 | Bacteria | 1350 |
| 370 | Ga0207663_10260013 | 3300025916 | Bacteria | 1281 |
| 371 | Ga0207662_10176548 | 3300025918 | Bacteria | 1373 |
| 372 | Ga0207657_10038738 | 3300025919 | Bacteria | 4240 |
| 373 | Ga0207649_10148779 | 3300025920 | Bacteria | 1610 |
| 374 | Ga0207652_10001458 | 3300025921 | Bacteria | 20929 |
| 375 | Ga0207652_10049105 | 3300025921 | Bacteria | 3610 |
| 376 | Ga0207652_10065919 | 3300025921 | Bacteria | 3137 |
| 377 | Ga0207681_10099713 | 3300025923 | Bacteria | 2092 |
| 378 | Ga0207694_10000339 | 3300025924 | Bacteria | 44198 |
| 379 | Ga0207694_10023031 | 3300025924 | Bacteria | 4727 |
| 380 | Ga0207694_10032046 | 3300025924 | Bacteria | 4021 |
| 381 | Ga0207694_10078416 | 3300025924 | Bacteria | 2589 |
| 382 | Ga0207687_10051832 | 3300025927 | Bacteria | 2862 |
| 383 | Ga0207700_10013500 | 3300025928 | Bacteria | 5318 |
| 384 | Ga0207700_10042747 | 3300025928 | Bacteria | 3324 |
| 385 | Ga0207700_10115258 | 3300025928 | Bacteria | 2169 |
| 386 | Ga0207700_10169333 | 3300025928 | Bacteria | 1821 |
| 387 | Ga0207700_10292764 | 3300025928 | Bacteria | 1404 |
| 388 | Ga0207664_10008456 | 3300025929 | Bacteria | 7181 |
| 389 | Ga0207664_10020719 | 3300025929 | Bacteria | 4880 |
| 390 | Ga0207664_10182276 | 3300025929 | Bacteria | 1803 |
| 391 | Ga0207664_10203364 | 3300025929 | Bacteria | 1711 |
| 392 | Ga0207664_10330991 | 3300025929 | Bacteria | 1345 |
| 393 | Ga0207644_10005690 | 3300025931 | Bacteria | 8114 |
| 394 | Ga0207644_10077679 | 3300025931 | Bacteria | 2445 |
| 395 | Ga0207644_10253037 | 3300025931 | Bacteria | 1406 |
| 396 | Ga0207706_10170125 | 3300025933 | Bacteria | 1915 |
| 397 | Ga0207686_10037403 | 3300025934 | Bacteria | 2929 |
| 398 | Ga0207709_10057528 | 3300025935 | Bacteria | 2412 |
| 399 | Ga0207709_10206519 | 3300025935 | Bacteria | 1407 |
| 400 | Ga0207670_10012710 | 3300025936 | Bacteria | 4934 |
| 401 | Ga0207670_10325970 | 3300025936 | Bacteria | 1210 |
| 402 | Ga0207670_10361656 | 3300025936 | Bacteria | 1152 |
| 403 | Ga0207669_10020230 | 3300025937 | Bacteria | 3484 |
| 404 | Ga0207704_10056141 | 3300025938 | Bacteria | 2411 |
| 405 | Ga0207665_10000183 | 3300025939 | Bacteria | 41938 |
| 406 | Ga0207665_10003747 | 3300025939 | Bacteria | 10153 |
| 407 | Ga0207665_10027066 | 3300025939 | Bacteria | 3788 |
| 408 | Ga0207691_10239561 | 3300025940 | Bacteria | 1569 |
| 409 | Ga0207711_10112309 | 3300025941 | Bacteria | 2425 |
| 410 | Ga0207711_10352832 | 3300025941 | Bacteria | 1362 |
| 411 | Ga0207711_10537562 | 3300025941 | Bacteria | 1090 |
| 412 | Ga0207689_10174330 | 3300025942 | Bacteria | 1773 |
| 413 | Ga0207661_10000828 | 3300025944 | Bacteria | 20288 |
| 414 | Ga0207679_10064390 | 3300025945 | Bacteria | 2740 |
| 415 | Ga0207667_10006413 | 3300025949 | Bacteria | 14251 |
| 416 | Ga0207667_10008033 | 3300025949 | Bacteria | 12586 |
| 417 | Ga0207667_10123190 | 3300025949 | Bacteria | 2671 |
| 418 | Ga0207667_10194358 | 3300025949 | Bacteria | 2082 |
| 419 | Ga0207667_10214888 | 3300025949 | Bacteria | 1971 |
| 420 | Ga0207651_10106993 | 3300025960 | Bacteria | 2089 |
| 421 | Ga0207651_10441719 | 3300025960 | Bacteria | 1115 |
| 422 | Ga0207712_10094480 | 3300025961 | Bacteria | 2209 |
| 423 | Ga0207668_10027989 | 3300025972 | Bacteria | 3679 |
| 424 | Ga0207668_10069284 | 3300025972 | Bacteria | 2511 |
| 425 | Ga0207640_10031248 | 3300025981 | Bacteria | 3288 |
| 426 | Ga0207640_10111487 | 3300025981 | Bacteria | 1940 |
| 427 | Ga0207677_10012235 | 3300026023 | Bacteria | 4924 |
| 428 | Ga0207677_10034462 | 3300026023 | Bacteria | 3278 |
| 429 | Ga0207703_10057392 | 3300026035 | Bacteria | 3174 |
| 430 | Ga0207703_10059969 | 3300026035 | Bacteria | 3109 |
| 431 | Ga0207703_10116608 | 3300026035 | Bacteria | 2287 |
| 432 | Ga0207639_10006655 | 3300026041 | Bacteria | 7859 |
| 433 | Ga0207639_10015983 | 3300026041 | Bacteria | 5301 |
| 434 | Ga0207639_10017564 | 3300026041 | Bacteria | 5073 |
| 435 | Ga0207678_10026769 | 3300026067 | Bacteria | 5030 |
| 436 | Ga0207678_10039422 | 3300026067 | Bacteria | 4100 |
| 437 | Ga0207678_10062086 | 3300026067 | Bacteria | 3213 |
| 438 | Ga0207678_10121298 | 3300026067 | Bacteria | 2231 |
| 439 | Ga0207678_10136532 | 3300026067 | Bacteria | 2092 |
| 440 | Ga0207678_10418352 | 3300026067 | Bacteria | 1162 |
| 441 | Ga0207678_10513520 | 3300026067 | Bacteria | 1045 |
| 442 | Ga0207708_10021890 | 3300026075 | Bacteria | 4824 |
| 443 | Ga0207708_10126365 | 3300026075 | Bacteria | 1996 |
| 444 | Ga0207702_10000006 | 3300026078 | Bacteria | 346370 |
| 445 | Ga0207702_10000063 | 3300026078 | Bacteria | 123034 |
| 446 | Ga0207702_10005641 | 3300026078 | Bacteria | 10914 |
| 447 | Ga0207702_10123853 | 3300026078 | Bacteria | 2317 |
| 448 | Ga0207702_10621278 | 3300026078 | Bacteria | 1061 |
| 449 | Ga0207641_10155908 | 3300026088 | Bacteria | 2072 |
| 450 | Ga0207648_10058331 | 3300026089 | Bacteria | 3367 |
| 451 | Ga0207674_10002334 | 3300026116 | Bacteria | 24007 |
| 452 | Ga0207674_10003146 | 3300026116 | Bacteria | 20343 |
| 453 | Ga0207674_10040962 | 3300026116 | Bacteria | 4794 |
| 454 | Ga0207674_10043341 | 3300026116 | Bacteria | 4640 |
| 455 | Ga0207674_10213110 | 3300026116 | Bacteria | 1880 |
| 456 | Ga0207675_100133979 | 3300026118 | Bacteria | 2350 |
| 457 | Ga0207683_10012826 | 3300026121 | Bacteria | 7154 |
| 458 | Ga0207698_10002272 | 3300026142 | Bacteria | 11377 |
| 459 | Ga0207698_10068252 | 3300026142 | Bacteria | 2807 |
| 460 | Ga0207698_10082645 | 3300026142 | Bacteria | 2597 |
| 461 | Ga0207698_10581656 | 3300026142 | Bacteria | 1102 |
| 462 | Ga0209389_1000034 | 3300027296 | Bacteria | 127289 |
| 463 | Ga0209389_1000039 | 3300027296 | Bacteria | 124545 |
| 464 | Ga0209589_1000038 | 3300027357 | Bacteria | 127285 |
| 465 | Ga0209589_1000055 | 3300027357 | Bacteria | 111890 |
| 466 | Ga0209489_100023 | 3300027361 | Bacteria | 198829 |
| 467 | Ga0209489_100087 | 3300027361 | Bacteria | 124545 |
| 468 | Ga0209489_100128 | 3300027361 | Bacteria | 111890 |
| 469 | Ga0209700_100090 | 3300027363 | Bacteria | 124545 |
| 470 | Ga0209700_100137 | 3300027363 | Bacteria | 111890 |
| 471 | Ga0209179_1013565 | 3300027512 | Bacteria | 1482 |
| 472 | Ga0209179_1018494 | 3300027512 | Bacteria | 1332 |
| 473 | Ga0209179_1026845 | 3300027512 | Bacteria | 1158 |
| 474 | Ga0268266_10002818 | 3300028379 | Bacteria | 18134 |
| 475 | Ga0268266_10003102 | 3300028379 | Bacteria | 16930 |
| 476 | Ga0268266_10008468 | 3300028379 | Bacteria | 9143 |
| 477 | Ga0268266_10046002 | 3300028379 | Bacteria | 3735 |
| 478 | Ga0268266_10064786 | 3300028379 | Bacteria | 3158 |
| 479 | Ga0268266_10081068 | 3300028379 | Bacteria | 2828 |
| 480 | Ga0268266_10107480 | 3300028379 | Bacteria | 2467 |
| 481 | Ga0268265_10068850 | 3300028380 | Bacteria | 2746 |
| 482 | Ga0268265_10188346 | 3300028380 | Bacteria | 1779 |
| 483 | Ga0268264_10000194 | 3300028381 | Bacteria | 125395 |
| 484 | Ga0268264_10034068 | 3300028381 | Bacteria | 4187 |
| 485 | Ga0268264_10056082 | 3300028381 | Bacteria | 3293 |
| 486 | Ga0265337_1002558 | 3300028556 | Bacteria | 8273 |
| 487 | Ga0265326_10002652 | 3300028558 | Bacteria | 5990 |
| 488 | Ga0265319_1003402 | 3300028563 | Bacteria | 8315 |
| 489 | Ga0265334_10001143 | 3300028573 | Bacteria | 12967 |
| 490 | Ga0265323_10000720 | 3300028653 | Bacteria | 17903 |
| 491 | Ga0265336_10000640 | 3300028666 | Bacteria | 19119 |
| 492 | Ga0307517_10002317 | 3300028786 | Bacteria | 30737 |
| 493 | Ga0307517_10105494 | 3300028786 | Bacteria | 2186 |
| 494 | Ga0307517_10121559 | 3300028786 | Bacteria | 1928 |
| 495 | Ga0307515_10012851 | 3300028794 | Bacteria | 15710 |
| 496 | Ga0307515_10179532 | 3300028794 | Bacteria | 2073 |
| 497 | Ga0265338_10001434 | 3300028800 | Bacteria | 38730 |
| 498 | Ga0265330_10014639 | 3300031235 | Bacteria | 3638 |
| 499 | Ga0265330_10040683 | 3300031235 | Bacteria | 2063 |
| 500 | Ga0265332_10016892 | 3300031238 | Bacteria | 3219 |
| 501 | Ga0265332_10030913 | 3300031238 | Bacteria | 2337 |
| 502 | Ga0265340_10028634 | 3300031247 | Bacteria | 2801 |
| 503 | Ga0265339_10000281 | 3300031249 | Bacteria | 41044 |
| 504 | Ga0265331_10013782 | 3300031250 | Bacteria | 4335 |
| 505 | Ga0307513_10085319 | 3300031456 | Bacteria | 3241 |
| 506 | Ga0307513_10311219 | 3300031456 | Bacteria | 1337 |
| 507 | Ga0307509_10152637 | 3300031507 | Bacteria | 2221 |
| 508 | Ga0307408_100131833 | 3300031548 | Bacteria | 1951 |
| 509 | Ga0307408_100256759 | 3300031548 | Bacteria | 1444 |
| 510 | Ga0265313_10054318 | 3300031595 | Bacteria | 1903 |
| 511 | Ga0307508_10000012 | 3300031616 | Bacteria | 243167 |
| 512 | Ga0307508_10204919 | 3300031616 | Bacteria | 1573 |
| 513 | Ga0307508_10213311 | 3300031616 | Bacteria | 1530 |
| 514 | Ga0265314_10018837 | 3300031711 | Bacteria | 5363 |
| 515 | Ga0265314_10075804 | 3300031711 | Bacteria | 2237 |
| 516 | Ga0265342_10004319 | 3300031712 | Bacteria | 11250 |
| 517 | Ga0265342_10030921 | 3300031712 | Bacteria | 3314 |
| 518 | Ga0265342_10033828 | 3300031712 | Bacteria | 3139 |
| 519 | Ga0307516_10005964 | 3300031730 | Bacteria | 14402 |
| 520 | Ga0307516_10009187 | 3300031730 | Bacteria | 11066 |
| 521 | Ga0307516_10062855 | 3300031730 | Bacteria | 3596 |
| 522 | Ga0307516_10159719 | 3300031730 | Bacteria | 2005 |
| 523 | Ga0307405_10064526 | 3300031731 | Bacteria | 2328 |
| 524 | Ga0307413_10038316 | 3300031824 | Bacteria | 2777 |
| 525 | Ga0307410_10255565 | 3300031852 | Bacteria | 1364 |
| 526 | Ga0307407_10156931 | 3300031903 | Bacteria | 1485 |
| 527 | Ga0307412_10065284 | 3300031911 | Bacteria | 2463 |
| 528 | Ga0307409_100127681 | 3300031995 | Bacteria | 2166 |
| 529 | Ga0307409_100145191 | 3300031995 | Bacteria | 2051 |
| 530 | Ga0307416_100161927 | 3300032002 | Bacteria | 2069 |
| 531 | Ga0307415_100067532 | 3300032126 | Bacteria | 2499 |
| 532 | Ga0307415_100235560 | 3300032126 | Bacteria | 1477 |
| 533 | Ga0307415_100255907 | 3300032126 | Bacteria | 1425 |
| 534 | Ga0307507_10014168 | 3300033179 | Bacteria | 9545 |
| 535 | Ga0307510_10006595 | 3300033180 | Bacteria | 13844 |
| 536 | Ga0307510_10019169 | 3300033180 | Bacteria | 8027 |
| 537 | Ga0307510_10022895 | 3300033180 | Bacteria | 7247 |
| 538 | Ga0307510_10268887 | 3300033180 | Bacteria | 1182 |
| 539 | Ga0315911_1000005 | 3300033442 | Bacteria | 426255 |
| 540 | Ga0373934_0001556 | 3300035086 | Bacteria | 8416 |
| 541 | Ga0373934_0072251 | 3300035086 | Bacteria | 1381 |
| 542 | Ga0373923_0001907 | 3300035111 | Bacteria | 6227 |
| 543 | Ga0373923_0004211 | 3300035111 | Bacteria | 4749 |
| 544 | Ga0373923_0012481 | 3300035111 | Bacteria | 3141 |
| 545 | Ga0373932_0013293 | 3300035112 | Bacteria | 2044 |
| 546 | Ga0373936_0029637 | 3300035113 | Bacteria | 2155 |
| 547 | Ga0373953_0004296 | 3300035117 | Bacteria | 4528 |
| 548 | Ga0373953_0013110 | 3300035117 | Bacteria | 2952 |
| 549 | Ga0373954_0001461 | 3300035118 | Bacteria | 9600 |
| 550 | Ga0373954_0026816 | 3300035118 | Bacteria | 2642 |
| 551 | Ga0373956_0004051 | 3300035119 | Bacteria | 5883 |
| 552 | Ga0373956_0033451 | 3300035119 | Bacteria | 2260 |
| 553 | Ga0373956_0050751 | 3300035119 | Bacteria | 1863 |
| 554 | Ga0373957_0002595 | 3300035120 | Bacteria | 5183 |
| 555 | Ga0373957_0021723 | 3300035120 | Bacteria | 2281 |
| 556 | Ga0373957_0117227 | 3300035120 | Bacteria | 1076 |
| 557 | Ga0373943_0002146 | 3300035170 | Bacteria | 8966 |
| 558 | Ga0373955_0001659 | 3300035172 | Bacteria | 9523 |
| 559 | Ga0373955_0003672 | 3300035172 | Bacteria | 6760 |
| 560 | Ga0373955_0005485 | 3300035172 | Bacteria | 5704 |
| 561 | Ga0373955_0007024 | 3300035172 | Bacteria | 5155 |
| 562 | Ga0373924_0001138 | 3300035410 | Bacteria | 8551 |
| 563 | Ga0373924_0003160 | 3300035410 | Bacteria | 5630 |
| 564 | Ga0373924_0008500 | 3300035410 | Bacteria | 3734 |
| 565 | Ga0373924_0012615 | 3300035410 | Bacteria | 3160 |
| 566 | Ga0373931_0003491 | 3300035691 | Bacteria | 7072 |
| 567 | Ga0373931_0057983 | 3300035691 | Bacteria | 2078 |
| 568 | Ga0373935_0002054 | 3300035692 | Bacteria | 11396 |
| 569 | Ga0373935_0150356 | 3300035692 | Bacteria | 1580 |
| 570 | Ga0373927_0000634 | 3300035695 | Bacteria | 26631 |
| 571 | Ga0373927_0007812 | 3300035695 | Bacteria | 7238 |
| 572 | Ga0373933_0000105 | 3300035724 | Bacteria | 53488 |
| 573 | Ga0373933_0060127 | 3300035724 | Bacteria | 2290 |
| 574 | Ga0373933_0079211 | 3300035724 | Bacteria | 2011 |
| 575 | Ga0373947_0001111 | 3300035725 | Bacteria | 16509 |
| 576 | Ga0373947_0006400 | 3300035725 | Bacteria | 6842 |
| 577 | Ga0373937_0016133 | 3300036401 | Bacteria | 6627 |
| 578 | Ga0373937_0018898 | 3300036401 | Bacteria | 6160 |
| 579 | Ga0373937_0042762 | 3300036401 | Bacteria | 4134 |
| 580 | Ga0373937_0053961 | 3300036401 | Bacteria | 3687 |
| 581 | Ga0373937_0310831 | 3300036401 | Bacteria | 1490 |
| 582 | Ga0373925_0001281 | 3300037068 | Bacteria | 22164 |
| 583 | Ga0373925_0019299 | 3300037068 | Bacteria | 4958 |
| 584 | Ga0373925_0025701 | 3300037068 | Bacteria | 4305 |
| 585 | Ga0373925_0285739 | 3300037068 | Bacteria | 1329 |
| 586 | Ga0395900_0001496 | 3300037418 | Bacteria | 27775 |
| 587 | Ga0395900_0047303 | 3300037418 | Bacteria | 4429 |
| 588 | Ga0395900_0518763 | 3300037418 | Bacteria | 1140 |
| 589 | Ga0395898_0013732 | 3300037466 | Bacteria | 8330 |
| 590 | Ga0395898_0018464 | 3300037466 | Bacteria | 7110 |
| 591 | Ga0395898_0083135 | 3300037466 | Bacteria | 3086 |
| 592 | Ga0395898_0132794 | 3300037466 | Bacteria | 2383 |
| 593 | Ga0395905_0001273 | 3300037471 | Bacteria | 31107 |
| 594 | Ga0395905_0258497 | 3300037471 | Bacteria | 1626 |
| 595 | Ga0395905_0444911 | 3300037471 | Bacteria | 1193 |
| 596 | Ga0436364_1544624 | 3300037853 | Bacteria | 3931 |
| 597 | Ga0395901_0010282 | 3300038443 | Bacteria | 9478 |
| 598 | Ga0395901_0139954 | 3300038443 | Bacteria | 2544 |
| 599 | Ga0395901_0209917 | 3300038443 | Bacteria | 2038 |
| 600 | Ga0395901_0214633 | 3300038443 | Bacteria | 2013 |
| 601 | Ga0395901_0278811 | 3300038443 | Bacteria | 1737 |
| 602 | Ga0436365_0353256 | 3300039437 | Bacteria | 3541 |
| 603 | Ga0436365_0703944 | 3300039437 | Bacteria | 21999 |
| 604 | Ga0436365_1233391 | 3300039437 | Bacteria | 4497 |
| 605 | Ga0436365_1704823 | 3300039437 | Bacteria | 3185 |
| 606 | Ga0436360_0133086 | 3300039438 | Bacteria | 1727 |
| 607 | Ga0436360_0432344 | 3300039438 | Bacteria | 2522 |
| 608 | Ga0436361_0329418 | 3300039447 | Bacteria | 1283 |
| 609 | Ga0436361_0911334 | 3300039447 | Bacteria | 1406 |
| 610 | Ga0436363_0997155 | 3300039450 | Bacteria | 2170 |
| 611 | Ga0436362_0516204 | 3300039453 | Bacteria | 1591 |
| 612 | Ga0436362_0675816 | 3300039453 | Bacteria | 5239 |
| 613 | Ga0451807_2628458 | 3300041486 | Bacteria | 1413 |
| 614 | Ga0466969_0083139 | 3300044656 | Bacteria | 1525 |
| 615 | Ga0466972_0000053 | 3300044658 | Bacteria | 112876 |
| 616 | Ga0466972_0031207 | 3300044658 | Bacteria | 2622 |
| 617 | Ga0466966_0000322 | 3300044684 | Bacteria | 30928 |
| 618 | Ga0466966_0076811 | 3300044684 | Bacteria | 2085 |
| 619 | Ga0466961_0000227 | 3300044693 | Bacteria | 38175 |
| 620 | Ga0466968_0008614 | 3300044735 | Bacteria | 3909 |
| 621 | Ga0466968_0072252 | 3300044735 | Bacteria | 1504 |
| 622 | Ga0466957_0036799 | 3300044842 | Bacteria | 2944 |
| 623 | Ga0466959_0013768 | 3300045049 | Bacteria | 5872 |
| 624 | Ga0466959_0048682 | 3300045049 | Bacteria | 3115 |
| 625 | Ga0466959_0213159 | 3300045049 | Bacteria | 1341 |
| 626 | Ga0466967_0015018 | 3300045976 | Bacteria | 6057 |
| 627 | Ga0466967_0024100 | 3300045976 | Bacteria | 4998 |
| 628 | Ga0466967_0186823 | 3300045976 | Bacteria | 1957 |
| 629 | Ga0495592_0004059 | 3300046454 | Bacteria | 10646 |
| 630 | Ga0495592_0008007 | 3300046454 | Bacteria | 7931 |
| 631 | Ga0495592_0020450 | 3300046454 | Bacteria | 5034 |
| 632 | Ga0495592_0058954 | 3300046454 | Bacteria | 2829 |
| 633 | Ga0495592_0067621 | 3300046454 | Bacteria | 2610 |
| 634 | Ga0495603_0000036 | 3300046455 | Bacteria | 57443 |
| 635 | Ga0495603_0017687 | 3300046455 | Bacteria | 4314 |
| 636 | Ga0495603_0031308 | 3300046455 | Bacteria | 3202 |
| 637 | Ga0495603_0036309 | 3300046455 | Bacteria | 2959 |
| 638 | Ga0495629_0000148 | 3300046459 | Bacteria | 61440 |
| 639 | Ga0495629_0000331 | 3300046459 | Bacteria | 40528 |
| 640 | Ga0495629_0006986 | 3300046459 | Bacteria | 8320 |
| 641 | Ga0495638_0006359 | 3300046460 | Bacteria | 8603 |
| 642 | Ga0495638_0049174 | 3300046460 | Bacteria | 2637 |
| 643 | Ga0495641_0006132 | 3300046461 | Bacteria | 7873 |
| 644 | Ga0495641_0026182 | 3300046461 | Bacteria | 2850 |
| 645 | Ga0495651_0005847 | 3300046462 | Bacteria | 9380 |
| 646 | Ga0495651_0010973 | 3300046462 | Bacteria | 6971 |
| 647 | Ga0495651_0012599 | 3300046462 | Bacteria | 6525 |
| 648 | Ga0495651_0028754 | 3300046462 | Bacteria | 4332 |
| 649 | Ga0495651_0053752 | 3300046462 | Bacteria | 3099 |
| 650 | Ga0495651_0083973 | 3300046462 | Bacteria | 2400 |
| 651 | Ga0495653_0006476 | 3300046463 | Bacteria | 9603 |
| 652 | Ga0495653_0032452 | 3300046463 | Bacteria | 4145 |
| 653 | Ga0495580_0001864 | 3300046472 | Bacteria | 18543 |
| 654 | Ga0495580_0026569 | 3300046472 | Bacteria | 4220 |
| 655 | Ga0495580_0227117 | 3300046472 | Bacteria | 1282 |
| 656 | Ga0495582_0000191 | 3300046473 | Bacteria | 33824 |
| 657 | Ga0495582_0080994 | 3300046473 | Bacteria | 1803 |
| 658 | Ga0495582_0140661 | 3300046473 | Bacteria | 1367 |
| 659 | Ga0495605_0114940 | 3300046474 | Bacteria | 1225 |
| 660 | Ga0495639_0000209 | 3300046475 | Bacteria | 30154 |
| 661 | Ga0495639_0007581 | 3300046475 | Bacteria | 4663 |
| 662 | Ga0495662_0000787 | 3300046476 | Bacteria | 15382 |
| 663 | Ga0495662_0014956 | 3300046476 | Bacteria | 3770 |
| 664 | Ga0495664_0005407 | 3300046477 | Bacteria | 7013 |
| 665 | Ga0495664_0010510 | 3300046477 | Bacteria | 5194 |
| 666 | Ga0495664_0038308 | 3300046477 | Bacteria | 2830 |
| 667 | Ga0495584_0042279 | 3300046491 | Bacteria | 2300 |
| 668 | Ga0495594_0001199 | 3300046499 | Bacteria | 13572 |
| 669 | Ga0495596_0067221 | 3300046500 | Bacteria | 1393 |
| 670 | Ga0495607_0045280 | 3300046501 | Bacteria | 2589 |
| 671 | Ga0495607_0103065 | 3300046501 | Bacteria | 1525 |
| 672 | Ga0495606_0001350 | 3300046507 | Bacteria | 33317 |
| 673 | Ga0495606_0031891 | 3300046507 | Bacteria | 3658 |
| 674 | Ga0495608_0000988 | 3300046511 | Bacteria | 20058 |
| 675 | Ga0495608_0021075 | 3300046511 | Bacteria | 4476 |
| 676 | Ga0495608_0035589 | 3300046511 | Bacteria | 3357 |
| 677 | Ga0495610_0131250 | 3300046512 | Bacteria | 1087 |
| 678 | Ga0495616_0033075 | 3300046513 | Bacteria | 2697 |
| 679 | Ga0495616_0069543 | 3300046513 | Bacteria | 1706 |
| 680 | Ga0495616_0120015 | 3300046513 | Bacteria | 1215 |
| 681 | Ga0495618_0016909 | 3300046514 | Bacteria | 4470 |
| 682 | Ga0495618_0017038 | 3300046514 | Bacteria | 4452 |
| 683 | Ga0495620_0062114 | 3300046515 | Bacteria | 1552 |
| 684 | Ga0495628_0008438 | 3300046516 | Bacteria | 8837 |
| 685 | Ga0495628_0020271 | 3300046516 | Bacteria | 5488 |
| 686 | Ga0495628_0099374 | 3300046516 | Bacteria | 2247 |
| 687 | Ga0495630_0026354 | 3300046517 | Bacteria | 4303 |
| 688 | Ga0495630_0052952 | 3300046517 | Bacteria | 3038 |
| 689 | Ga0495630_0108945 | 3300046517 | Bacteria | 2098 |
| 690 | Ga0495631_0053301 | 3300046518 | Bacteria | 1765 |
| 691 | Ga0495632_0146819 | 3300046519 | Bacteria | 1092 |
| 692 | Ga0495643_0008913 | 3300046522 | Bacteria | 6305 |
| 693 | Ga0495643_0024248 | 3300046522 | Bacteria | 3443 |
| 694 | Ga0495643_0054168 | 3300046522 | Bacteria | 2149 |
| 695 | Ga0495648_0000310 | 3300046524 | Bacteria | 53884 |
| 696 | Ga0495648_0004195 | 3300046524 | Bacteria | 12378 |
| 697 | Ga0495648_0065576 | 3300046524 | Bacteria | 2134 |
| 698 | Ga0495652_0048650 | 3300046529 | Bacteria | 3631 |
| 699 | Ga0495652_0082236 | 3300046529 | Bacteria | 2655 |
| 700 | Ga0495652_0098568 | 3300046529 | Bacteria | 2375 |
| 701 | Ga0495652_0301196 | 3300046529 | Bacteria | 1165 |
| 702 | Ga0495654_0012515 | 3300046530 | Bacteria | 4554 |
| 703 | Ga0495665_0000118 | 3300046531 | Bacteria | 37731 |
| 704 | Ga0495665_0093347 | 3300046531 | Bacteria | 1582 |
| 705 | Ga0495640_0000577 | 3300046533 | Bacteria | 27019 |
| 706 | Ga0495640_0007069 | 3300046533 | Bacteria | 8837 |
| 707 | Ga0495640_0007374 | 3300046533 | Bacteria | 8656 |
| 708 | Ga0495640_0029434 | 3300046533 | Bacteria | 3944 |
| 709 | Ga0495640_0174689 | 3300046533 | Bacteria | 1372 |
| 710 | Ga0495587_0028191 | 3300046536 | Bacteria | 3416 |
| 711 | Ga0495587_0069695 | 3300046536 | Bacteria | 2047 |
| 712 | Ga0495587_0106991 | 3300046536 | Bacteria | 1608 |
| 713 | Ga0495598_0000848 | 3300046537 | Bacteria | 5865 |
| 714 | Ga0495645_0001885 | 3300046543 | Bacteria | 14254 |
| 715 | Ga0495645_0006263 | 3300046543 | Bacteria | 8248 |
| 716 | Ga0495645_0007903 | 3300046543 | Bacteria | 7400 |
| 717 | Ga0495645_0038260 | 3300046543 | Bacteria | 3499 |
| 718 | Ga0495645_0044351 | 3300046543 | Bacteria | 3244 |
| 719 | Ga0495622_0011977 | 3300046557 | Bacteria | 4012 |
| 720 | Ga0495622_0015444 | 3300046557 | Bacteria | 3550 |
| 721 | Ga0495622_0018516 | 3300046557 | Bacteria | 3244 |
| 722 | Ga0495622_0024799 | 3300046557 | Bacteria | 2800 |
| 723 | Ga0495667_0002269 | 3300046559 | Bacteria | 12874 |
| 724 | Ga0495667_0174073 | 3300046559 | Bacteria | 1382 |
| 725 | Ga0495668_0028353 | 3300046616 | Bacteria | 3166 |
| 726 | Ga0495668_0098966 | 3300046616 | Bacteria | 1596 |
| 727 | Ga0495634_0007487 | 3300046642 | Bacteria | 8189 |
| 728 | Ga0495634_0014131 | 3300046642 | Bacteria | 5764 |
| 729 | Ga0495634_0043947 | 3300046642 | Bacteria | 3026 |
| 730 | Ga0495625_0034285 | 3300046660 | Bacteria | 3747 |
| 731 | Ga0495625_0161209 | 3300046660 | Bacteria | 1502 |
| 732 | Ga0495635_0000434 | 3300046663 | Bacteria | 26421 |
| 733 | Ga0495635_0008844 | 3300046663 | Bacteria | 7030 |
| 734 | Ga0495635_0014396 | 3300046663 | Bacteria | 5533 |
| 735 | Ga0495635_0053086 | 3300046663 | Bacteria | 2792 |
| 736 | Ga0495635_0118597 | 3300046663 | Bacteria | 1805 |
| 737 | Ga0495588_0011770 | 3300046674 | Bacteria | 4115 |
| 738 | Ga0495588_0017042 | 3300046674 | Bacteria | 3520 |
| 739 | Ga0495657_0005590 | 3300046675 | Bacteria | 9917 |
| 740 | Ga0495657_0021545 | 3300046675 | Bacteria | 4623 |
| 741 | Ga0495657_0030444 | 3300046675 | Bacteria | 3779 |
| 742 | Ga0495657_0055579 | 3300046675 | Bacteria | 2640 |
| 743 | Ga0495657_0074400 | 3300046675 | Bacteria | 2211 |
| 744 | Ga0495599_0012640 | 3300046678 | Bacteria | 5206 |
| 745 | Ga0495599_0039174 | 3300046678 | Bacteria | 2978 |
| 746 | Ga0495599_0122482 | 3300046678 | Bacteria | 1616 |
| 747 | Ga0495599_0124808 | 3300046678 | Bacteria | 1600 |
| 748 | Ga0495623_0016473 | 3300046679 | Bacteria | 4775 |
| 749 | Ga0495623_0027226 | 3300046679 | Bacteria | 3676 |
| 750 | Ga0495623_0085377 | 3300046679 | Bacteria | 1946 |
| 751 | Ga0495646_0009025 | 3300046680 | Bacteria | 6324 |
| 752 | Ga0495646_0022497 | 3300046680 | Bacteria | 3976 |
| 753 | Ga0495646_0022821 | 3300046680 | Bacteria | 3942 |
| 754 | Ga0495646_0028374 | 3300046680 | Bacteria | 3505 |
| 755 | Ga0495646_0058243 | 3300046680 | Bacteria | 2310 |
| 756 | Ga0495647_0001407 | 3300046681 | Bacteria | 7427 |
| 757 | Ga0495647_0010961 | 3300046681 | Bacteria | 3098 |
| 758 | Ga0495647_0044778 | 3300046681 | Bacteria | 1698 |
| 759 | Ga0495658_0000703 | 3300046683 | Bacteria | 18118 |
| 760 | Ga0495658_0011805 | 3300046683 | Bacteria | 4405 |
| 761 | Ga0495669_0022157 | 3300046684 | Bacteria | 2759 |
| 762 | Ga0495613_0001856 | 3300046689 | Bacteria | 16097 |
| 763 | Ga0495613_0021992 | 3300046689 | Bacteria | 4755 |
| 764 | Ga0495613_0026316 | 3300046689 | Bacteria | 4335 |
| 765 | Ga0495613_0160730 | 3300046689 | Bacteria | 1598 |
| 766 | Ga0495624_0006594 | 3300046690 | Bacteria | 8220 |
| 767 | Ga0495670_0028737 | 3300046691 | Bacteria | 2756 |
| 768 | Ga0495671_0029736 | 3300046692 | Bacteria | 2802 |
| 769 | Ga0495649_0010519 | 3300046694 | Bacteria | 5454 |
| 770 | Ga0495649_0131635 | 3300046694 | Bacteria | 1320 |
| 771 | Ga0495649_0216680 | 3300046694 | Bacteria | 991 |
| 772 | Ga0495600_0003449 | 3300046809 | Bacteria | 9298 |
| 773 | Ga0495600_0011288 | 3300046809 | Bacteria | 5563 |
| 774 | Ga0495600_0112567 | 3300046809 | Bacteria | 1772 |
| 775 | Ga0495600_0182838 | 3300046809 | Bacteria | 1351 |
| 776 | Ga0495581_0000313 | 3300047315 | Bacteria | 23828 |
| 777 | Ga0495581_0038273 | 3300047315 | Bacteria | 2775 |
| 778 | Ga0495581_0276731 | 3300047315 | Bacteria | 981 |
| 779 | Ga0495604_0003918 | 3300047317 | Bacteria | 11850 |
| 780 | Ga0495604_0011366 | 3300047317 | Bacteria | 7064 |
| 781 | Ga0495604_0044487 | 3300047317 | Bacteria | 3468 |
| 782 | Ga0495604_0080997 | 3300047317 | Bacteria | 2431 |
| 783 | Ga0495674_0000443 | 3300047319 | Bacteria | 37259 |
| 784 | Ga0495674_0003051 | 3300047319 | Bacteria | 16285 |
| 785 | Ga0495674_0022928 | 3300047319 | Bacteria | 5752 |
| 786 | Ga0495674_0035111 | 3300047319 | Bacteria | 4526 |
| 787 | Ga0495674_0125709 | 3300047319 | Bacteria | 2164 |
| 788 | Ga0495674_0140116 | 3300047319 | Bacteria | 2033 |
| 789 | Ga0495674_0147836 | 3300047319 | Bacteria | 1972 |
| 790 | Ga0495672_0010289 | 3300047320 | Bacteria | 6682 |
| 791 | Ga0495676_0027033 | 3300047321 | Bacteria | 4928 |
| 792 | Ga0495676_0058602 | 3300047321 | Bacteria | 3029 |
| 793 | Ga0495676_0074951 | 3300047321 | Bacteria | 2589 |
| 794 | Ga0495680_0012949 | 3300047322 | Bacteria | 7306 |
| 795 | Ga0495680_0041645 | 3300047322 | Bacteria | 3650 |
| 796 | Ga0495680_0063164 | 3300047322 | Bacteria | 2844 |
| 797 | Ga0495683_0034943 | 3300047323 | Bacteria | 2555 |
| 798 | Ga0495683_0075237 | 3300047323 | Bacteria | 1654 |
| 799 | Ga0495683_0111720 | 3300047323 | Bacteria | 1304 |
| 800 | Ga0495683_0113852 | 3300047323 | Bacteria | 1289 |
| 801 | Ga0495687_014616 | 3300047443 | Bacteria | 4029 |
| 802 | Ga0495675_0011557 | 3300047444 | Bacteria | 5542 |
| 803 | Ga0495675_0063796 | 3300047444 | Bacteria | 2330 |
| 804 | Ga0495679_029272 | 3300047446 | Bacteria | 1798 |
| 805 | Ga0495673_0011793 | 3300047469 | Bacteria | 4675 |
| 806 | Ga0495673_0061998 | 3300047469 | Bacteria | 1599 |
| 807 | Ga0495684_0000842 | 3300047471 | Bacteria | 24799 |
| 808 | Ga0495684_0005571 | 3300047471 | Bacteria | 9807 |
| 809 | Ga0495684_0019738 | 3300047471 | Bacteria | 5194 |
| 810 | Ga0495684_0039380 | 3300047471 | Bacteria | 3623 |
| 811 | Ga0495686_0004839 | 3300047472 | Bacteria | 10865 |
| 812 | Ga0495686_0022543 | 3300047472 | Bacteria | 4167 |
| 813 | Ga0495686_0047246 | 3300047472 | Bacteria | 2719 |
| 814 | Ga0495686_0092528 | 3300047472 | Bacteria | 1834 |
| 815 | Ga0495686_0140550 | 3300047472 | Bacteria | 1425 |
| 816 | Ga0495593_0000039 | 3300047673 | Bacteria | 53005 |
| 817 | Ga0495593_0002371 | 3300047673 | Bacteria | 11319 |
| 818 | Ga0495593_0033283 | 3300047673 | Bacteria | 2807 |
| 819 | Ga0495593_0135142 | 3300047673 | Bacteria | 1250 |
| 820 | Ga0495602_0014899 | 3300048088 | Bacteria | 7869 |
| 821 | Ga0495602_0021472 | 3300048088 | Bacteria | 6353 |
| 822 | Ga0495602_0054330 | 3300048088 | Bacteria | 3537 |
| 823 | Ga0495602_0057593 | 3300048088 | Bacteria | 3407 |
| 824 | Ga0495614_0042233 | 3300048089 | Bacteria | 1955 |
| 825 | Ga0495615_0005324 | 3300048090 | Bacteria | 2306 |
| 826 | Ga0496101_0079128 | 3300048904 | Bacteria | 2427 |
| 827 | Ga0496101_0138677 | 3300048904 | Bacteria | 1852 |
| 828 | Ga0496102_0016408 | 3300048905 | Bacteria | 6468 |
| 829 | Ga0496102_0038136 | 3300048905 | Bacteria | 4336 |
| 830 | Ga0496102_0043325 | 3300048905 | Bacteria | 4080 |
| 831 | Ga0496102_0046430 | 3300048905 | Bacteria | 3945 |
| 832 | Ga0496102_0076234 | 3300048905 | Bacteria | 3084 |
| 833 | Ga0496102_0104675 | 3300048905 | Bacteria | 2632 |
| 834 | Ga0496102_0136685 | 3300048905 | Bacteria | 2297 |
| 835 | Ga0496102_0415362 | 3300048905 | Bacteria | 1264 |
| 836 | Ga0496103_0080164 | 3300048906 | Bacteria | 2052 |
| 837 | Ga0496103_0138932 | 3300048906 | Bacteria | 1553 |
| 838 | Ga0496103_0142946 | 3300048906 | Bacteria | 1531 |
| 839 | Ga0496104_0002225 | 3300048907 | Bacteria | 16743 |
| 840 | Ga0496104_0021761 | 3300048907 | Bacteria | 5889 |
| 841 | Ga0496104_0032583 | 3300048907 | Bacteria | 4851 |
| 842 | Ga0496104_0039609 | 3300048907 | Bacteria | 4412 |
| 843 | Ga0496104_0054214 | 3300048907 | Bacteria | 3790 |
| 844 | Ga0496104_0054726 | 3300048907 | Bacteria | 3772 |
| 845 | Ga0496104_0154363 | 3300048907 | Bacteria | 2203 |
| 846 | Ga0496104_0445928 | 3300048907 | Bacteria | 1206 |
| 847 | Ga0496105_0001134 | 3300048908 | Bacteria | 18563 |
| 848 | Ga0496105_0003701 | 3300048908 | Bacteria | 11378 |
| 849 | Ga0496105_0029657 | 3300048908 | Bacteria | 4478 |
| 850 | Ga0496105_0055063 | 3300048908 | Bacteria | 3284 |
| 851 | Ga0496105_0097045 | 3300048908 | Bacteria | 2434 |
| 852 | Ga0496106_0003366 | 3300048909 | Bacteria | 11919 |
| 853 | Ga0496106_0004011 | 3300048909 | Bacteria | 11005 |
| 854 | Ga0496106_0022335 | 3300048909 | Bacteria | 4699 |
| 855 | Ga0496106_0060011 | 3300048909 | Bacteria | 2883 |
| 856 | Ga0496106_0222247 | 3300048909 | Bacteria | 1506 |
| 857 | Ga0496107_0005653 | 3300048910 | Bacteria | 8564 |
| 858 | Ga0496107_0059138 | 3300048910 | Bacteria | 2773 |
| 859 | Ga0496107_0156884 | 3300048910 | Bacteria | 1685 |
| 860 | Ga0496108_0000891 | 3300048911 | Bacteria | 23254 |
| 861 | Ga0496108_0039396 | 3300048911 | Bacteria | 3939 |
| 862 | Ga0496108_0122922 | 3300048911 | Bacteria | 2227 |
| 863 | Ga0496108_0165214 | 3300048911 | Bacteria | 1913 |
| 864 | Ga0496109_0005103 | 3300048912 | Bacteria | 10964 |
| 865 | Ga0496109_0016035 | 3300048912 | Bacteria | 6549 |
| 866 | Ga0496109_0035249 | 3300048912 | Bacteria | 4512 |
| 867 | Ga0496110_0054384 | 3300048913 | Bacteria | 3521 |
| 868 | Ga0496110_0055397 | 3300048913 | Bacteria | 3489 |
| 869 | Ga0496110_0073535 | 3300048913 | Bacteria | 3033 |
| 870 | Ga0496110_0083400 | 3300048913 | Bacteria | 2851 |
| 871 | Ga0496110_0093580 | 3300048913 | Bacteria | 2690 |
| 872 | Ga0496110_0116184 | 3300048913 | Bacteria | 2409 |
| 873 | Ga0496111_0005854 | 3300048914 | Bacteria | 7929 |
| 874 | Ga0496111_0009495 | 3300048914 | Bacteria | 6497 |
| 875 | Ga0496111_0018373 | 3300048914 | Bacteria | 4844 |
| 876 | Ga0496111_0021273 | 3300048914 | Bacteria | 4527 |
| 877 | Ga0496111_0188475 | 3300048914 | Bacteria | 1533 |
| 878 | Ga0496112_0000029 | 3300048915 | Bacteria | 122291 |
| 879 | Ga0496112_0001958 | 3300048915 | Bacteria | 16269 |
| 880 | Ga0496112_0010230 | 3300048915 | Bacteria | 8504 |
| 881 | Ga0496112_0021877 | 3300048915 | Bacteria | 6085 |
| 882 | Ga0496112_0083180 | 3300048915 | Bacteria | 3165 |
| 883 | Ga0496112_0156714 | 3300048915 | Bacteria | 2244 |
| 884 | Ga0496112_0218641 | 3300048915 | Bacteria | 1861 |
| 885 | Ga0496112_0292219 | 3300048915 | Bacteria | 1575 |
| 886 | Ga0496113_0005191 | 3300048916 | Bacteria | 8099 |
| 887 | Ga0496113_0013457 | 3300048916 | Bacteria | 5546 |
| 888 | Ga0496113_0021994 | 3300048916 | Bacteria | 4504 |
| 889 | Ga0496113_0026554 | 3300048916 | Bacteria | 4141 |
| 890 | Ga0496113_0061879 | 3300048916 | Bacteria | 2825 |
| 891 | Ga0496113_0132999 | 3300048916 | Bacteria | 1953 |
| 892 | Ga0496114_0070227 | 3300048917 | Bacteria | 2941 |
| 893 | Ga0496114_0135771 | 3300048917 | Bacteria | 2127 |
| 894 | Ga0496115_0000295 | 3300048918 | Bacteria | 42998 |
| 895 | Ga0496115_0057368 | 3300048918 | Bacteria | 3132 |
| 896 | Ga0496115_0170190 | 3300048918 | Bacteria | 1802 |
| 897 | Ga0496115_0296966 | 3300048918 | Bacteria | 1324 |
| 898 | Ga0496116_0002462 | 3300048919 | Bacteria | 19411 |
| 899 | Ga0496116_0037092 | 3300048919 | Bacteria | 3403 |
| 900 | Ga0496117_0014848 | 3300048920 | Bacteria | 6683 |
| 901 | Ga0496117_0064612 | 3300048920 | Bacteria | 2494 |
| 902 | Ga0496117_0070520 | 3300048920 | Bacteria | 2346 |
| 903 | Ga0496117_0082796 | 3300048920 | Bacteria | 2100 |
| 904 | Ga0496118_0003033 | 3300048921 | Bacteria | 21657 |
| 905 | Ga0496118_0008353 | 3300048921 | Bacteria | 10714 |
| 906 | Ga0496118_0010319 | 3300048921 | Bacteria | 9262 |
| 907 | Ga0496118_0019326 | 3300048921 | Bacteria | 6093 |
| 908 | Ga0496118_0056974 | 3300048921 | Bacteria | 2933 |
| 909 | Ga0496118_0143091 | 3300048921 | Bacteria | 1511 |
| 910 | Ga0496118_0230413 | 3300048921 | Bacteria | 1069 |
| 911 | Ga0496119_0004887 | 3300048922 | Bacteria | 13119 |
| 912 | Ga0496119_0026140 | 3300048922 | Bacteria | 4056 |
| 913 | Ga0496119_0036885 | 3300048922 | Bacteria | 3184 |
| 914 | Ga0496119_0059377 | 3300048922 | Bacteria | 2298 |
| 915 | Ga0496119_0116277 | 3300048922 | Bacteria | 1476 |
| 916 | Ga0496120_0006736 | 3300048923 | Bacteria | 8730 |
| 917 | Ga0496120_0011735 | 3300048923 | Bacteria | 6006 |
| 918 | Ga0496120_0106434 | 3300048923 | Bacteria | 1472 |
| 919 | Ga0496121_0002294 | 3300048924 | Bacteria | 29707 |
| 920 | Ga0496121_0002330 | 3300048924 | Bacteria | 29336 |
| 921 | Ga0496121_0013124 | 3300048924 | Bacteria | 8937 |
| 922 | Ga0496121_0013885 | 3300048924 | Bacteria | 8613 |
| 923 | Ga0496121_0021406 | 3300048924 | Bacteria | 6333 |
| 924 | Ga0496121_0037884 | 3300048924 | Bacteria | 4278 |
| 925 | Ga0496121_0047408 | 3300048924 | Bacteria | 3666 |
| 926 | Ga0496121_0047766 | 3300048924 | Bacteria | 3648 |
| 927 | Ga0496121_0051307 | 3300048924 | Bacteria | 3475 |
| 928 | Ga0496121_0051853 | 3300048924 | Bacteria | 3452 |
| 929 | Ga0496121_0064894 | 3300048924 | Bacteria | 2974 |
| 930 | Ga0496121_0133331 | 3300048924 | Bacteria | 1855 |
| 931 | Ga0496122_0108857 | 3300048925 | Bacteria | 1826 |
| 932 | Ga0496124_0013819 | 3300048927 | Bacteria | 7852 |
| 933 | Ga0496125_0001204 | 3300048928 | Bacteria | 38897 |
| 934 | Ga0496125_0010748 | 3300048928 | Bacteria | 9221 |
| 935 | Ga0496125_0062913 | 3300048928 | Bacteria | 2963 |
| 936 | Ga0496125_0070496 | 3300048928 | Bacteria | 2736 |
| 937 | Ga0496125_0078461 | 3300048928 | Bacteria | 2538 |
| 938 | Ga0496125_0098173 | 3300048928 | Bacteria | 2167 |
| 939 | Ga0496125_0105186 | 3300048928 | Bacteria | 2064 |
| 940 | Ga0496125_0189618 | 3300048928 | Bacteria | 1359 |
| 941 | Ga0496126_0004033 | 3300048929 | Bacteria | 17863 |
| 942 | Ga0496126_0011553 | 3300048929 | Bacteria | 9119 |
| 943 | Ga0496126_0022314 | 3300048929 | Bacteria | 6162 |
| 944 | Ga0496126_0025463 | 3300048929 | Bacteria | 5692 |
| 945 | Ga0496126_0034144 | 3300048929 | Bacteria | 4781 |
| 946 | Ga0496126_0044111 | 3300048929 | Bacteria | 4109 |
| 947 | Ga0496126_0052167 | 3300048929 | Bacteria | 3719 |
| 948 | Ga0496126_0058202 | 3300048929 | Bacteria | 3484 |
| 949 | Ga0496126_0086233 | 3300048929 | Bacteria | 2767 |
| 950 | Ga0496126_0133903 | 3300048929 | Bacteria | 2139 |
| 951 | Ga0496126_0154305 | 3300048929 | Bacteria | 1966 |
| 952 | Ga0496126_0159952 | 3300048929 | Bacteria | 1925 |
| 953 | Ga0496126_0182054 | 3300048929 | Bacteria | 1784 |
| 954 | Ga0496126_0217044 | 3300048929 | Bacteria | 1609 |
| 955 | Ga0496126_0262385 | 3300048929 | Bacteria | 1436 |
| 956 | Ga0495682_0015605 | 3300049460 | Bacteria | 2878 |
| 957 | Ga0501031_0000511 | 3300049568 | Bacteria | 22716 |
| 958 | Ga0501031_0006718 | 3300049568 | Bacteria | 7503 |
| 959 | Ga0501031_0023266 | 3300049568 | Bacteria | 4039 |
| 960 | Ga0501032_0000073 | 3300049569 | Bacteria | 85584 |
| 961 | Ga0501032_0014750 | 3300049569 | Bacteria | 5531 |
| 962 | Ga0501032_0072007 | 3300049569 | Bacteria | 2303 |
| 963 | Ga0501032_0204740 | 3300049569 | Bacteria | 1287 |
| 964 | Ga0501033_0001342 | 3300049570 | Bacteria | 21886 |
| 965 | Ga0501033_0001845 | 3300049570 | Bacteria | 18448 |
| 966 | Ga0501033_0038402 | 3300049570 | Bacteria | 3579 |
| 967 | Ga0501033_0056537 | 3300049570 | Bacteria | 2899 |
| 968 | Ga0501033_0127481 | 3300049570 | Bacteria | 1845 |
| 969 | Ga0501033_0205260 | 3300049570 | Bacteria | 1407 |
| 970 | Ga0501034_0000251 | 3300049571 | Bacteria | 99406 |
| 971 | Ga0501034_0032366 | 3300049571 | Bacteria | 5311 |
| 972 | Ga0501034_0040843 | 3300049571 | Bacteria | 4694 |
| 973 | Ga0501034_0151321 | 3300049571 | Bacteria | 2296 |
| 974 | Ga0501034_0174718 | 3300049571 | Bacteria | 2114 |
| 975 | Ga0501034_0392577 | 3300049571 | Bacteria | 1311 |
| 976 | Ga0501036_0000036 | 3300049572 | Bacteria | 87244 |
| 977 | Ga0501036_0156208 | 3300049572 | Bacteria | 1924 |
| 978 | Ga0501037_0000040 | 3300049573 | Bacteria | 119364 |
| 979 | Ga0501037_0020880 | 3300049573 | Bacteria | 4835 |
| 980 | Ga0501037_0036094 | 3300049573 | Bacteria | 3643 |
| 981 | Ga0501037_0323002 | 3300049573 | Bacteria | 1068 |
| 982 | Ga0501038_0000150 | 3300049574 | Bacteria | 59508 |
| 983 | Ga0501038_0005621 | 3300049574 | Bacteria | 11634 |
| 984 | Ga0501038_0013948 | 3300049574 | Bacteria | 7324 |
| 985 | Ga0501038_0041771 | 3300049574 | Bacteria | 3998 |
| 986 | Ga0501038_0134241 | 3300049574 | Bacteria | 2029 |
| 987 | Ga0501039_0001837 | 3300049575 | Bacteria | 15670 |
| 988 | Ga0501039_0081341 | 3300049575 | Bacteria | 2522 |
| 989 | Ga0501039_0327821 | 3300049575 | Bacteria | 1203 |
| 990 | Ga0501042_0010937 | 3300049578 | Bacteria | 6110 |
| 991 | Ga0501043_0000464 | 3300049579 | Bacteria | 36232 |
| 992 | Ga0501043_0008498 | 3300049579 | Bacteria | 8082 |
| 993 | Ga0501043_0023171 | 3300049579 | Bacteria | 4870 |
| 994 | Ga0501046_0000398 | 3300049580 | Bacteria | 43497 |
| 995 | Ga0501046_0184273 | 3300049580 | Bacteria | 1559 |
| 996 | Ga0501046_0274822 | 3300049580 | Bacteria | 1235 |
| 997 | Ga0501047_0000656 | 3300049581 | Bacteria | 36126 |
| 998 | Ga0501047_0257098 | 3300049581 | Bacteria | 1594 |
| 999 | Ga0501047_0282564 | 3300049581 | Bacteria | 1504 |
| 1000 | Ga0501048_0002054 | 3300049582 | Bacteria | 15303 |
| 1001 | Ga0501048_0161366 | 3300049582 | Bacteria | 1586 |
| 1002 | Ga0501067_0000192 | 3300049583 | Bacteria | 34520 |
| 1003 | Ga0501068_0008599 | 3300049584 | Bacteria | 5688 |
| 1004 | Ga0501070_0002215 | 3300049586 | Bacteria | 17070 |
| 1005 | Ga0501070_0128317 | 3300049586 | Bacteria | 2096 |
| 1006 | Ga0501070_0174733 | 3300049586 | Bacteria | 1769 |
| 1007 | Ga0501071_0101717 | 3300049587 | Bacteria | 2119 |
| 1008 | Ga0501072_0001038 | 3300049588 | Bacteria | 20561 |
| 1009 | Ga0501073_0000037 | 3300049589 | Bacteria | 87345 |
| 1010 | Ga0501073_0004501 | 3300049589 | Bacteria | 10471 |
| 1011 | Ga0501073_0143128 | 3300049589 | Bacteria | 1657 |
| 1012 | Ga0501074_0000212 | 3300049590 | Bacteria | 31886 |
| 1013 | Ga0501079_0002283 | 3300049741 | Bacteria | 13852 |
| 1014 | Ga0501079_0012536 | 3300049741 | Bacteria | 6471 |
| 1015 | Ga0501080_0000054 | 3300049742 | Bacteria | 74316 |
| 1016 | Ga0501080_0114479 | 3300049742 | Bacteria | 2500 |
| 1017 | Ga0501080_0188750 | 3300049742 | Bacteria | 1894 |
| 1018 | Ga0501080_0191576 | 3300049742 | Bacteria | 1879 |
| 1019 | Ga0501083_0001153 | 3300049744 | Bacteria | 17779 |
| 1020 | Ga0501083_0006025 | 3300049744 | Bacteria | 8589 |
| 1021 | Ga0501035_0000142 | 3300049822 | Bacteria | 87561 |
| 1022 | Ga0501035_0001311 | 3300049822 | Bacteria | 25709 |
| 1023 | Ga0501035_0040499 | 3300049822 | Bacteria | 4210 |
| 1024 | Ga0501035_0096777 | 3300049822 | Bacteria | 2593 |
| 1025 | Ga0501035_0106232 | 3300049822 | Bacteria | 2461 |
| 1026 | Ga0501035_0186285 | 3300049822 | Bacteria | 1786 |
| 1027 | Ga0501044_0000985 | 3300049823 | Bacteria | 34233 |
| 1028 | Ga0501044_0005451 | 3300049823 | Bacteria | 14137 |
| 1029 | Ga0501044_0043845 | 3300049823 | Bacteria | 4645 |
| 1030 | Ga0501044_0090036 | 3300049823 | Bacteria | 3096 |
| 1031 | Ga0501044_0168165 | 3300049823 | Bacteria | 2165 |
| 1032 | Ga0501044_0326674 | 3300049823 | Bacteria | 1457 |
| 1033 | Ga0501044_0329376 | 3300049823 | Bacteria | 1450 |
| 1034 | Ga0501045_0008122 | 3300049824 | Bacteria | 7311 |
| 1035 | Ga0501045_0009166 | 3300049824 | Bacteria | 6915 |
| 1036 | nmdc:mga03683_54928_c1 | 3300050489 | Bacteria | 1671 |
| 1037 | nmdc:mga03n38_31193_c1 | 3300050490 | Bacteria | 2247 |
| 1038 | nmdc:mga03n38_63825_c1 | 3300050490 | Bacteria | 1684 |
| 1039 | nmdc:mga00v17_114807_c1 | 3300050491 | Bacteria | 1711 |
| 1040 | nmdc:mga00v17_39602_c1 | 3300050491 | Bacteria | 2823 |
| 1041 | nmdc:mga00v17_52913_c1 | 3300050491 | Bacteria | 2473 |
| 1042 | nmdc:mga0yw44_31040_c1 | 3300050492 | Bacteria | 3104 |
| 1043 | nmdc:mga0yw44_33722_c1 | 3300050492 | Bacteria | 2994 |
| 1044 | nmdc:mga0yw44_35154_c1 | 3300050492 | Bacteria | 2943 |
| 1045 | nmdc:mga0k408_53176_c1 | 3300050493 | Bacteria | 2347 |
| 1046 | nmdc:mga06z11_103762_c1 | 3300050494 | Bacteria | 1564 |
| 1047 | nmdc:mga06z11_24305_c1 | 3300050494 | Bacteria | 2857 |
| 1048 | nmdc:mga06z11_5094_c1 | 3300050494 | Bacteria | 5236 |
| 1049 | nmdc:mga07m45_44572_c2 | 3300050496 | Bacteria | 2324 |
| 1050 | nmdc:mga07m45_69723_c1 | 3300050496 | Bacteria | 1999 |
| 1051 | nmdc:mga07m45_8273_c1 | 3300050496 | Bacteria | 5339 |
| 1052 | nmdc:mga07m45_95405_c1 | 3300050496 | Bacteria | 1706 |
| 1053 | nmdc:mga05p37_96716_c1 | 3300050507 | Bacteria | 3638 |
| 1054 | nmdc:mga0n895_3593_c1 | 3300050512 | Bacteria | 12539 |
| 1055 | nmdc:mga0n895_98808_c1 | 3300050512 | Bacteria | 2926 |
| 1056 | nmdc:mga0rr50_12738_c1 | 3300050513 | Bacteria | 5448 |
| 1057 | nmdc:mga0rr50_518829_c1 | 3300050513 | Bacteria | 1014 |
| 1058 | nmdc:mga0sz30_22385_c2 | 3300050516 | Bacteria | 1412 |
| 1059 | Ga0495601_0022363 | 3300053077 | Bacteria | 3880 |
| 1060 | Ga0495601_0055598 | 3300053077 | Bacteria | 2506 |
| 1061 | Ga0495601_0125553 | 3300053077 | Bacteria | 1669 |
| 1062 | Ga0495612_0008650 | 3300053078 | Bacteria | 4128 |
| 1063 | Ga0495612_0017970 | 3300053078 | Bacteria | 2830 |
| 1064 | Ga0495612_0018844 | 3300053078 | Bacteria | 2763 |
| 1065 | Ga0500635_0002159 | 3300053080 | Bacteria | 4839 |
| 1066 | Ga0495595_0000869 | 3300053084 | Bacteria | 11590 |
| 1067 | Ga0495619_0000617 | 3300053085 | Bacteria | 23526 |
| 1068 | Ga0495619_0320311 | 3300053085 | Bacteria | 1073 |
| 1069 | Ga0500643_000168 | 3300053087 | Bacteria | 64858 |
| 1070 | Ga0500643_012650 | 3300053087 | Bacteria | 3015 |
| 1071 | Ga0500643_012952 | 3300053087 | Bacteria | 2968 |
| 1072 | Ga0500583_0002232 | 3300053092 | Bacteria | 5760 |
| 1073 | Ga0500651_0041562 | 3300053093 | Bacteria | 2898 |
| 1074 | Ga0500651_0088282 | 3300053093 | Bacteria | 1912 |
| 1075 | Ga0500566_0000191 | 3300053094 | Bacteria | 31941 |
| 1076 | Ga0500566_0004238 | 3300053094 | Bacteria | 8556 |
| 1077 | Ga0500566_0011660 | 3300053094 | Bacteria | 5175 |
| 1078 | Ga0500566_0055812 | 3300053094 | Bacteria | 2248 |
| 1079 | Ga0500640_002832 | 3300053095 | Bacteria | 5864 |
| 1080 | Ga0500641_0007929 | 3300053096 | Bacteria | 3787 |
| 1081 | Ga0500641_0064727 | 3300053096 | Bacteria | 1528 |
| 1082 | Ga0500650_0005221 | 3300053098 | Bacteria | 4809 |
| 1083 | Ga0500650_0036809 | 3300053098 | Bacteria | 2247 |
| 1084 | Ga0500555_001077 | 3300053103 | Bacteria | 9158 |
| 1085 | Ga0500556_0000047 | 3300053104 | Bacteria | 126199 |
| 1086 | Ga0500556_0002685 | 3300053104 | Bacteria | 5524 |
| 1087 | Ga0500556_0041476 | 3300053104 | Bacteria | 1623 |
| 1088 | Ga0500557_000032 | 3300053105 | Bacteria | 74032 |
| 1089 | Ga0500569_056872 | 3300053109 | Bacteria | 1197 |
| 1090 | Ga0500572_000153 | 3300053111 | Bacteria | 23968 |
| 1091 | Ga0500572_000186 | 3300053111 | Bacteria | 21909 |
| 1092 | Ga0500572_014382 | 3300053111 | Bacteria | 1976 |
| 1093 | Ga0500592_010161 | 3300053116 | Bacteria | 1498 |
| 1094 | Ga0500595_001727 | 3300053119 | Bacteria | 11395 |
| 1095 | Ga0500595_002174 | 3300053119 | Bacteria | 9960 |
| 1096 | Ga0500595_010866 | 3300053119 | Bacteria | 3593 |
| 1097 | Ga0500607_046171 | 3300053121 | Bacteria | 2335 |
| 1098 | Ga0500608_000229 | 3300053122 | Bacteria | 22140 |
| 1099 | Ga0500608_000896 | 3300053122 | Bacteria | 10739 |
| 1100 | Ga0500614_001636 | 3300053123 | Bacteria | 5280 |
| 1101 | Ga0500642_0000142 | 3300053130 | Bacteria | 32016 |
| 1102 | Ga0500642_0000197 | 3300053130 | Bacteria | 24598 |
| 1103 | Ga0500642_0002669 | 3300053130 | Bacteria | 5272 |
| 1104 | Ga0500642_0004996 | 3300053130 | Bacteria | 4228 |
| 1105 | Ga0500652_001091 | 3300053131 | Bacteria | 8752 |
| 1106 | Ga0500559_0000105 | 3300053136 | Bacteria | 65809 |
| 1107 | Ga0500559_0001758 | 3300053136 | Bacteria | 11888 |
| 1108 | Ga0500559_0006740 | 3300053136 | Bacteria | 5159 |
| 1109 | Ga0500559_0022199 | 3300053136 | Bacteria | 2692 |
| 1110 | Ga0500559_0031101 | 3300053136 | Bacteria | 2289 |
| 1111 | Ga0500561_0012590 | 3300053137 | Bacteria | 1808 |
| 1112 | Ga0500564_017343 | 3300053138 | Bacteria | 3271 |
| 1113 | Ga0500568_0004453 | 3300053139 | Bacteria | 7481 |
| 1114 | Ga0500568_0012641 | 3300053139 | Bacteria | 3876 |
| 1115 | Ga0500568_0057381 | 3300053139 | Bacteria | 1515 |
| 1116 | Ga0500573_0041265 | 3300053140 | Bacteria | 2663 |
| 1117 | Ga0500577_0039956 | 3300053142 | Bacteria | 1703 |
| 1118 | Ga0500577_0045769 | 3300053142 | Bacteria | 1618 |
| 1119 | Ga0500577_0069803 | 3300053142 | Bacteria | 1375 |
| 1120 | Ga0500590_045744 | 3300053148 | Bacteria | 2239 |
| 1121 | Ga0500590_099125 | 3300053148 | Bacteria | 1402 |
| 1122 | Ga0500603_002116 | 3300053150 | Bacteria | 4398 |
| 1123 | Ga0500604_0014548 | 3300053151 | Bacteria | 2144 |
| 1124 | Ga0500616_0000038 | 3300053153 | Bacteria | 386801 |
| 1125 | Ga0500616_0000784 | 3300053153 | Bacteria | 36530 |
| 1126 | Ga0500616_0006953 | 3300053153 | Bacteria | 7287 |
| 1127 | Ga0500619_033075 | 3300053154 | Bacteria | 1589 |
| 1128 | Ga0500619_057190 | 3300053154 | Bacteria | 1276 |
| 1129 | Ga0500622_0005469 | 3300053156 | Bacteria | 7625 |
| 1130 | Ga0500622_0012272 | 3300053156 | Bacteria | 4645 |
| 1131 | Ga0500624_006620 | 3300053157 | Bacteria | 1572 |
| 1132 | Ga0500627_0022311 | 3300053158 | Bacteria | 2566 |
| 1133 | Ga0500630_002217 | 3300053159 | Bacteria | 9399 |
| 1134 | Ga0500638_001436 | 3300053162 | Bacteria | 7473 |
| 1135 | Ga0500638_131217 | 3300053162 | Bacteria | 1135 |
| 1136 | Ga0500639_000031 | 3300053163 | Bacteria | 69938 |
| 1137 | Ga0500639_015280 | 3300053163 | Unclassified | 4041 |
| 1138 | Ga0500639_044784 | 3300053163 | Bacteria | 2317 |
| 1139 | Ga0500636_0000990 | 3300053177 | Bacteria | 15245 |
| 1140 | Ga0500636_0003222 | 3300053177 | Bacteria | 9139 |
| 1141 | Ga0500636_0035756 | 3300053177 | Bacteria | 2938 |
| 1142 | Ga0500637_0000519 | 3300053178 | Bacteria | 15026 |
| 1143 | Ga0500637_0005808 | 3300053178 | Bacteria | 6011 |
| 1144 | Ga0500637_0025159 | 3300053178 | Bacteria | 3269 |
| 1145 | Ga0500637_0083276 | 3300053178 | Bacteria | 1848 |
| 1146 | Ga0500576_092262 | 3300053725 | Bacteria | 1255 |
| 1147 | Ga0500625_015418 | 3300053729 | Bacteria | 3545 |
| 1148 | Ga0500645_009851 | 3300053730 | Bacteria | 3193 |
| 1149 | Ga0500596_001012 | 3300053735 | Bacteria | 5632 |
| 1150 | Ga0501084_0007428 | 3300054114 | Bacteria | 9034 |
| 1151 | Ga0501084_0011305 | 3300054114 | Bacteria | 7391 |
| 1152 | Ga0501082_0004487 | 3300060353 | Bacteria | 12195 |
| 1153 | Ga0501082_0012051 | 3300060353 | Bacteria | 7429 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8019678201 | 8019687292 | 269 |
| 2 | 3300049580 | Ga0501046_0274822 | Ga0501046_0274822_161_1087 | 273 |
| 3 | 3300046455 | Ga0495603_0017687 | Ga0495603_0017687_1490_2452 | 277 |
| 4 | 3300046529 | Ga0495652_0301196 | Ga0495652_0301196_10_987 | 278 |
| 5 | 3300005435 | Ga0070714_100207719 | Ga0070714_1002077192 | 282 |
| 6 | 3300006175 | Ga0070712_100178765 | Ga0070712_1001787652 | 282 |
| 7 | 3300025929 | Ga0207664_10203364 | Ga0207664_102033641 | 282 |
| 8 | 3300037418 | Ga0395900_0518763 | Ga0395900_0518763_19_951 | 283 |
| 9 | 3300046512 | Ga0495610_0131250 | Ga0495610_0131250_137_1069 | 283 |
| 10 | 3300046533 | Ga0495640_0029434 | Ga0495640_0029434_2975_3907 | 283 |
| 11 | 3300046557 | Ga0495622_0024799 | Ga0495622_0024799_1848_2780 | 283 |
| 12 | 3300047673 | Ga0495593_0033283 | Ga0495593_0033283_1863_2795 | 283 |
| 13 | 3300053136 | Ga0500559_0006740 | Ga0500559_0006740_17_949 | 283 |
| 14 | 3300005329 | Ga0070683_100106272 | Ga0070683_1001062722 | 284 |
| 15 | 3300005535 | Ga0070684_100129222 | Ga0070684_1001292222 | 284 |
| 16 | 3300046694 | Ga0495649_0216680 | Ga0495649_0216680_26_958 | 284 |
| 17 | 3300053105 | Ga0500557_000032 | Ga0500557_000032_34876_35802 | 284 |
| 18 | 3300053109 | Ga0500569_056872 | Ga0500569_056872_247_1179 | 284 |
| 19 | 3300053729 | Ga0500625_015418 | Ga0500625_015418_2079_3005 | 284 |
| 20 | 3300003659 | JGI25404J52841_10009784 | JGI25404J52841_100097841 | 285 |
| 21 | 3300005983 | Ga0081540_1002063 | Ga0081540_10020635 | 285 |
| 22 | 3300046694 | Ga0495649_0131635 | Ga0495649_0131635_359_1291 | 285 |
| 23 | 3300047315 | Ga0495581_0276731 | Ga0495581_0276731_23_955 | 285 |
| 24 | 3300049822 | Ga0501035_0106232 | Ga0501035_0106232_27_962 | 285 |
| 25 | 3300005455 | Ga0070663_100257304 | Ga0070663_1002573042 | 286 |
| 26 | 3300007788 | Ga0099795_10004122 | Ga0099795_100041223 | 286 |
| 27 | 3300010159 | Ga0099796_10016174 | Ga0099796_100161741 | 286 |
| 28 | 3300026067 | Ga0207678_10062086 | Ga0207678_100620862 | 286 |
| 29 | 3300027512 | Ga0209179_1013565 | Ga0209179_10135652 | 286 |
| 30 | 3300046501 | Ga0495607_0103065 | Ga0495607_0103065_556_1488 | 286 |
| 31 | 3300047469 | Ga0495673_0061998 | Ga0495673_0061998_640_1572 | 286 |
| 32 | 3300048928 | Ga0496125_0189618 | Ga0496125_0189618_21_953 | 286 |
| 33 | 3300045049 | Ga0466959_0213159 | Ga0466959_0213159_173_1147 | 287 |
| 34 | iso_pu_bacteria | 2824600985 | 2824603652 | 287 |
| 35 | iso_pu_bacteria | 2824609381 | 2824610762 | 287 |
| 36 | iso_pu_bacteria | 2824653114 | 2824660505 | 287 |
| 37 | iso_pu_bacteria | 2824661429 | 2824667370 | 287 |
| 38 | iso_pu_bacteria | 2888419890 | 2888421204 | 287 |
| 39 | iso_pu_bacteria | 2893066018 | 2893066359 | 287 |
| 40 | iso_pu_bacteria | 2906643746 | 2906646755 | 287 |
| 41 | 3300013307 | Ga0157372_10399237 | Ga0157372_103992372 | 288 |
| 42 | 3300046616 | Ga0495668_0028353 | Ga0495668_0028353_1444_2367 | 288 |
| 43 | 3300048929 | Ga0496126_0159952 | Ga0496126_0159952_19_951 | 288 |
| 44 | 3300053085 | Ga0495619_0320311 | Ga0495619_0320311_22_978 | 288 |
| 45 | 3300046454 | Ga0495592_0058954 | Ga0495592_0058954_1456_2412 | 289 |
| 46 | 3300046462 | Ga0495651_0083973 | Ga0495651_0083973_874_1830 | 289 |
| 47 | 3300046531 | Ga0495665_0093347 | Ga0495665_0093347_614_1546 | 289 |
| 48 | 3300047317 | Ga0495604_0080997 | Ga0495604_0080997_390_1346 | 289 |
| 49 | 3300048922 | Ga0496119_0059377 | Ga0496119_0059377_19_969 | 289 |
| 50 | 3300053104 | Ga0500556_0002685 | Ga0500556_0002685_3761_4693 | 289 |
| 51 | 3300053142 | Ga0500577_0069803 | Ga0500577_0069803_187_1119 | 289 |
| 52 | 3300053153 | Ga0500616_0006953 | Ga0500616_0006953_3989_4921 | 289 |
| 53 | 3300053156 | Ga0500622_0012272 | Ga0500622_0012272_1311_2243 | 289 |
| 54 | 3300025924 | Ga0207694_10023031 | Ga0207694_100230313 | 293 |
| 55 | 3300031247 | Ga0265340_10028634 | Ga0265340_100286342 | 293 |
| 56 | 3300031249 | Ga0265339_10000281 | Ga0265339_1000028123 | 293 |
| 57 | 3300048929 | Ga0496126_0154305 | Ga0496126_0154305_401_1363 | 293 |
| 58 | 3300049570 | Ga0501033_0127481 | Ga0501033_0127481_608_1585 | 293 |
| 59 | 3300049571 | Ga0501034_0040843 | Ga0501034_0040843_2587_3564 | 293 |
| 60 | 3300049574 | Ga0501038_0134241 | Ga0501038_0134241_72_1049 | 293 |
| 61 | 3300049575 | Ga0501039_0081341 | Ga0501039_0081341_1166_2143 | 293 |
| 62 | 3300049581 | Ga0501047_0257098 | Ga0501047_0257098_383_1360 | 293 |
| 63 | 3300049586 | Ga0501070_0174733 | Ga0501070_0174733_117_1094 | 293 |
| 64 | 3300053119 | Ga0500595_001727 | Ga0500595_001727_8408_9370 | 293 |
| 65 | 3300053162 | Ga0500638_001436 | Ga0500638_001436_6056_7018 | 293 |
| 66 | 3300021384 | Ga0213876_10040722 | Ga0213876_100407222 | 294 |
| 67 | 3300037068 | Ga0373925_0285739 | Ga0373925_0285739_14_988 | 294 |
| 68 | 3300039438 | Ga0436360_0432344 | Ga0436360_0432344_1285_2259 | 294 |
| 69 | 3300039453 | Ga0436362_0516204 | Ga0436362_0516204_389_1363 | 294 |
| 70 | 3300046473 | Ga0495582_0080994 | Ga0495582_0080994_163_1137 | 294 |
| 71 | 3300046681 | Ga0495647_0044778 | Ga0495647_0044778_67_1041 | 294 |
| 72 | 3300046683 | Ga0495658_0011805 | Ga0495658_0011805_1747_2721 | 294 |
| 73 | 3300053148 | Ga0500590_099125 | Ga0500590_099125_372_1334 | 294 |
| 74 | 3300035691 | Ga0373931_0057983 | Ga0373931_0057983_165_1142 | 295 |
| 75 | 3300046462 | Ga0495651_0010973 | Ga0495651_0010973_1792_2766 | 295 |
| 76 | 3300046675 | Ga0495657_0074400 | Ga0495657_0074400_1057_2031 | 295 |
| 77 | 3300005458 | Ga0070681_10077923 | Ga0070681_100779233 | 296 |
| 78 | 3300011119 | Ga0105246_10249314 | Ga0105246_102493142 | 296 |
| 79 | 3300031250 | Ga0265331_10013782 | Ga0265331_100137823 | 296 |
| 80 | 3300031711 | Ga0265314_10075804 | Ga0265314_100758041 | 296 |
| 81 | 3300031712 | Ga0265342_10004319 | Ga0265342_100043198 | 296 |
| 82 | 3300039437 | Ga0436365_1233391 | Ga0436365_1233391_3505_4479 | 296 |
| 83 | 3300044684 | Ga0466966_0076811 | Ga0466966_0076811_155_1129 | 296 |
| 84 | 3300044842 | Ga0466957_0036799 | Ga0466957_0036799_1242_2216 | 296 |
| 85 | 3300045049 | Ga0466959_0048682 | Ga0466959_0048682_630_1604 | 296 |
| 86 | 3300048915 | Ga0496112_0156714 | Ga0496112_0156714_1258_2232 | 296 |
| 87 | 3300048929 | Ga0496126_0086233 | Ga0496126_0086233_1044_2018 | 296 |
| 88 | 3300003215 | JGI25153J46596_10005221 | JGI25153J46596_100052216 | 297 |
| 89 | 3300003215 | JGI25153J46596_10005329 | JGI25153J46596_100053293 | 297 |
| 90 | 3300003354 | JGI25160J50197_1002246 | JGI25160J50197_10022463 | 297 |
| 91 | 3300003794 | Ga0055531_10002655 | Ga0055531_100026554 | 297 |
| 92 | 3300005329 | Ga0070683_100047292 | Ga0070683_1000472923 | 297 |
| 93 | 3300005335 | Ga0070666_10064994 | Ga0070666_100649942 | 297 |
| 94 | 3300005340 | Ga0070689_100017900 | Ga0070689_1000179004 | 297 |
| 95 | 3300005353 | Ga0070669_100110039 | Ga0070669_1001100392 | 297 |
| 96 | 3300005355 | Ga0070671_100001845 | Ga0070671_1000018458 | 297 |
| 97 | 3300005355 | Ga0070671_100043091 | Ga0070671_1000430913 | 297 |
| 98 | 3300005364 | Ga0070673_100002424 | Ga0070673_10000242410 | 297 |
| 99 | 3300005365 | Ga0070688_100200220 | Ga0070688_1002002202 | 297 |
| 100 | 3300005366 | Ga0070659_100126238 | Ga0070659_1001262382 | 297 |
| 101 | 3300005367 | Ga0070667_100019427 | Ga0070667_1000194275 | 297 |
| 102 | 3300005434 | Ga0070709_10004543 | Ga0070709_100045434 | 297 |
| 103 | 3300005435 | Ga0070714_100002945 | Ga0070714_10000294511 | 297 |
| 104 | 3300005437 | Ga0070710_10000251 | Ga0070710_100002515 | 297 |
| 105 | 3300005439 | Ga0070711_100000261 | Ga0070711_10000026120 | 297 |
| 106 | 3300005439 | Ga0070711_100006208 | Ga0070711_1000062086 | 297 |
| 107 | 3300005456 | Ga0070678_100227861 | Ga0070678_1002278612 | 297 |
| 108 | 3300005457 | Ga0070662_100049507 | Ga0070662_1000495072 | 297 |
| 109 | 3300005458 | Ga0070681_10494262 | Ga0070681_104942622 | 297 |
| 110 | 3300005530 | Ga0070679_100040368 | Ga0070679_1000403684 | 297 |
| 111 | 3300005530 | Ga0070679_100057989 | Ga0070679_1000579893 | 297 |
| 112 | 3300005539 | Ga0068853_100076182 | Ga0068853_1000761822 | 297 |
| 113 | 3300005539 | Ga0068853_100099554 | Ga0068853_1000995542 | 297 |
| 114 | 3300005543 | Ga0070672_100193157 | Ga0070672_1001931572 | 297 |
| 115 | 3300005548 | Ga0070665_100009999 | Ga0070665_1000099997 | 297 |
| 116 | 3300005548 | Ga0070665_100080134 | Ga0070665_1000801343 | 297 |
| 117 | 3300005563 | Ga0068855_100032380 | Ga0068855_1000323803 | 297 |
| 118 | 3300005563 | Ga0068855_100138815 | Ga0068855_1001388153 | 297 |
| 119 | 3300005614 | Ga0068856_100240006 | Ga0068856_1002400062 | 297 |
| 120 | 3300005718 | Ga0068866_10059241 | Ga0068866_100592412 | 297 |
| 121 | 3300005842 | Ga0068858_100078409 | Ga0068858_1000784091 | 297 |
| 122 | 3300005937 | Ga0081455_10018080 | Ga0081455_100180806 | 297 |
| 123 | 3300005937 | Ga0081455_10042185 | Ga0081455_100421853 | 297 |
| 124 | 3300005937 | Ga0081455_10079511 | Ga0081455_100795112 | 297 |
| 125 | 3300005981 | Ga0081538_10032966 | Ga0081538_100329662 | 297 |
| 126 | 3300005983 | Ga0081540_1024847 | Ga0081540_10248472 | 297 |
| 127 | 3300005985 | Ga0081539_10000157 | Ga0081539_100001573 | 297 |
| 128 | 3300005985 | Ga0081539_10033396 | Ga0081539_100333963 | 297 |
| 129 | 3300006028 | Ga0070717_10007408 | Ga0070717_100074084 | 297 |
| 130 | 3300006048 | Ga0075363_100105108 | Ga0075363_1001051082 | 297 |
| 131 | 3300006163 | Ga0070715_10000749 | Ga0070715_100007492 | 297 |
| 132 | 3300006175 | Ga0070712_100128675 | Ga0070712_1001286752 | 297 |
| 133 | 3300006195 | Ga0075366_10036589 | Ga0075366_100365892 | 297 |
| 134 | 3300009093 | Ga0105240_10011324 | Ga0105240_100113248 | 297 |
| 135 | 3300009094 | Ga0111539_10331660 | Ga0111539_103316602 | 297 |
| 136 | 3300009098 | Ga0105245_10074417 | Ga0105245_100744173 | 297 |
| 137 | 3300009101 | Ga0105247_10219484 | Ga0105247_102194841 | 297 |
| 138 | 3300009174 | Ga0105241_10057927 | Ga0105241_100579272 | 297 |
| 139 | 3300009174 | Ga0105241_10109572 | Ga0105241_101095723 | 297 |
| 140 | 3300009177 | Ga0105248_10091835 | Ga0105248_100918353 | 297 |
| 141 | 3300009545 | Ga0105237_10002118 | Ga0105237_1000211812 | 297 |
| 142 | 3300009545 | Ga0105237_10023062 | Ga0105237_100230625 | 297 |
| 143 | 3300009545 | Ga0105237_10154200 | Ga0105237_101542002 | 297 |
| 144 | 3300009545 | Ga0105237_10319612 | Ga0105237_103196122 | 297 |
| 145 | 3300009551 | Ga0105238_10043133 | Ga0105238_100431334 | 297 |
| 146 | 3300009551 | Ga0105238_10261492 | Ga0105238_102614922 | 297 |
| 147 | 3300009553 | Ga0105249_10258761 | Ga0105249_102587612 | 297 |
| 148 | 3300010375 | Ga0105239_10065937 | Ga0105239_100659373 | 297 |
| 149 | 3300010375 | Ga0105239_10086632 | Ga0105239_100866322 | 297 |
| 150 | 3300010375 | Ga0105239_10091614 | Ga0105239_100916142 | 297 |
| 151 | 3300010375 | Ga0105239_10133631 | Ga0105239_101336313 | 297 |
| 152 | 3300011119 | Ga0105246_10011111 | Ga0105246_100111113 | 297 |
| 153 | 3300013105 | Ga0157369_10023959 | Ga0157369_100239592 | 297 |
| 154 | 3300013296 | Ga0157374_10166903 | Ga0157374_101669032 | 297 |
| 155 | 3300013306 | Ga0163162_10271476 | Ga0163162_102714762 | 297 |
| 156 | 3300013307 | Ga0157372_10178769 | Ga0157372_101787692 | 297 |
| 157 | 3300013308 | Ga0157375_10251039 | Ga0157375_102510392 | 297 |
| 158 | 3300014325 | Ga0163163_10029087 | Ga0163163_100290872 | 297 |
| 159 | 3300014325 | Ga0163163_10313023 | Ga0163163_103130231 | 297 |
| 160 | 3300021384 | Ga0213876_10095749 | Ga0213876_100957492 | 297 |
| 161 | 3300025245 | Ga0207425_1017907 | Ga0207425_10179072 | 297 |
| 162 | 3300025261 | Ga0209233_1008776 | Ga0209233_10087762 | 297 |
| 163 | 3300025297 | Ga0209758_1000206 | Ga0209758_100020622 | 297 |
| 164 | 3300025297 | Ga0209758_1000536 | Ga0209758_100053620 | 297 |
| 165 | 3300025297 | Ga0209758_1003319 | Ga0209758_100331915 | 297 |
| 166 | 3300025299 | Ga0209256_1009447 | Ga0209256_10094473 | 297 |
| 167 | 3300025302 | Ga0207426_1001183 | Ga0207426_10011839 | 297 |
| 168 | 3300025302 | Ga0207426_1008206 | Ga0207426_10082063 | 297 |
| 169 | 3300025302 | Ga0207426_1013106 | Ga0207426_10131062 | 297 |
| 170 | 3300025304 | Ga0209257_1000394 | Ga0209257_100039422 | 297 |
| 171 | 3300025900 | Ga0207710_10099970 | Ga0207710_100999701 | 297 |
| 172 | 3300025903 | Ga0207680_10056509 | Ga0207680_100565092 | 297 |
| 173 | 3300025904 | Ga0207647_10010156 | Ga0207647_100101567 | 297 |
| 174 | 3300025905 | Ga0207685_10000368 | Ga0207685_100003683 | 297 |
| 175 | 3300025906 | Ga0207699_10000967 | Ga0207699_100009674 | 297 |
| 176 | 3300025907 | Ga0207645_10164429 | Ga0207645_101644292 | 297 |
| 177 | 3300025912 | Ga0207707_10007092 | Ga0207707_100070927 | 297 |
| 178 | 3300025912 | Ga0207707_10024841 | Ga0207707_100248413 | 297 |
| 179 | 3300025913 | Ga0207695_10000006 | Ga0207695_10000006600 | 297 |
| 180 | 3300025914 | Ga0207671_10025726 | Ga0207671_100257263 | 297 |
| 181 | 3300025915 | Ga0207693_10003226 | Ga0207693_100032265 | 297 |
| 182 | 3300025915 | Ga0207693_10026017 | Ga0207693_100260174 | 297 |
| 183 | 3300025916 | Ga0207663_10000161 | Ga0207663_1000016118 | 297 |
| 184 | 3300025916 | Ga0207663_10042512 | Ga0207663_100425122 | 297 |
| 185 | 3300025921 | Ga0207652_10049105 | Ga0207652_100491052 | 297 |
| 186 | 3300025928 | Ga0207700_10013500 | Ga0207700_100135002 | 297 |
| 187 | 3300025928 | Ga0207700_10115258 | Ga0207700_101152582 | 297 |
| 188 | 3300025929 | Ga0207664_10008456 | Ga0207664_100084564 | 297 |
| 189 | 3300025931 | Ga0207644_10005690 | Ga0207644_100056904 | 297 |
| 190 | 3300025931 | Ga0207644_10077679 | Ga0207644_100776791 | 297 |
| 191 | 3300025931 | Ga0207644_10253037 | Ga0207644_102530371 | 297 |
| 192 | 3300025933 | Ga0207706_10170125 | Ga0207706_101701251 | 297 |
| 193 | 3300025936 | Ga0207670_10012710 | Ga0207670_100127102 | 297 |
| 194 | 3300025936 | Ga0207670_10361656 | Ga0207670_103616562 | 297 |
| 195 | 3300025939 | Ga0207665_10000183 | Ga0207665_1000018323 | 297 |
| 196 | 3300025949 | Ga0207667_10123190 | Ga0207667_101231903 | 297 |
| 197 | 3300025949 | Ga0207667_10214888 | Ga0207667_102148882 | 297 |
| 198 | 3300025960 | Ga0207651_10106993 | Ga0207651_101069932 | 297 |
| 199 | 3300025972 | Ga0207668_10069284 | Ga0207668_100692843 | 297 |
| 200 | 3300026035 | Ga0207703_10116608 | Ga0207703_101166082 | 297 |
| 201 | 3300026075 | Ga0207708_10126365 | Ga0207708_101263652 | 297 |
| 202 | 3300026078 | Ga0207702_10621278 | Ga0207702_106212781 | 297 |
| 203 | 3300027296 | Ga0209389_1000034 | Ga0209389_100003498 | 297 |
| 204 | 3300027296 | Ga0209389_1000039 | Ga0209389_100003998 | 297 |
| 205 | 3300027357 | Ga0209589_1000038 | Ga0209589_100003822 | 297 |
| 206 | 3300027361 | Ga0209489_100023 | Ga0209489_100023171 | 297 |
| 207 | 3300027361 | Ga0209489_100087 | Ga0209489_10008798 | 297 |
| 208 | 3300027363 | Ga0209700_100090 | Ga0209700_10009018 | 297 |
| 209 | 3300028379 | Ga0268266_10008468 | Ga0268266_1000846810 | 297 |
| 210 | 3300028786 | Ga0307517_10002317 | Ga0307517_1000231719 | 297 |
| 211 | 3300028794 | Ga0307515_10012851 | Ga0307515_100128515 | 297 |
| 212 | 3300031731 | Ga0307405_10064526 | Ga0307405_100645263 | 297 |
| 213 | 3300031824 | Ga0307413_10038316 | Ga0307413_100383163 | 297 |
| 214 | 3300031852 | Ga0307410_10255565 | Ga0307410_102555651 | 297 |
| 215 | 3300031903 | Ga0307407_10156931 | Ga0307407_101569312 | 297 |
| 216 | 3300031911 | Ga0307412_10065284 | Ga0307412_100652843 | 297 |
| 217 | 3300031995 | Ga0307409_100127681 | Ga0307409_1001276811 | 297 |
| 218 | 3300032002 | Ga0307416_100161927 | Ga0307416_1001619272 | 297 |
| 219 | 3300032126 | Ga0307415_100235560 | Ga0307415_1002355602 | 297 |
| 220 | 3300032126 | Ga0307415_100255907 | Ga0307415_1002559072 | 297 |
| 221 | 3300033180 | Ga0307510_10019169 | Ga0307510_100191692 | 297 |
| 222 | 3300035112 | Ga0373932_0013293 | Ga0373932_0013293_278_1258 | 297 |
| 223 | 3300035120 | Ga0373957_0021723 | Ga0373957_0021723_281_1255 | 297 |
| 224 | 3300035691 | Ga0373931_0003491 | Ga0373931_0003491_4309_5289 | 297 |
| 225 | 3300037471 | Ga0395905_0001273 | Ga0395905_0001273_28922_29896 | 297 |
| 226 | 3300037853 | Ga0436364_1544624 | Ga0436364_1544624_2245_3219 | 297 |
| 227 | 3300044658 | Ga0466972_0000053 | Ga0466972_0000053_22343_23317 | 297 |
| 228 | 3300046459 | Ga0495629_0006986 | Ga0495629_0006986_4010_4984 | 297 |
| 229 | 3300046461 | Ga0495641_0026182 | Ga0495641_0026182_491_1465 | 297 |
| 230 | 3300046462 | Ga0495651_0005847 | Ga0495651_0005847_6867_7841 | 297 |
| 231 | 3300046500 | Ga0495596_0067221 | Ga0495596_0067221_86_1060 | 297 |
| 232 | 3300046511 | Ga0495608_0035589 | Ga0495608_0035589_2184_3158 | 297 |
| 233 | 3300046514 | Ga0495618_0016909 | Ga0495618_0016909_1709_2683 | 297 |
| 234 | 3300046522 | Ga0495643_0008913 | Ga0495643_0008913_2715_3689 | 297 |
| 235 | 3300046536 | Ga0495587_0069695 | Ga0495587_0069695_265_1239 | 297 |
| 236 | 3300046543 | Ga0495645_0007903 | Ga0495645_0007903_6381_7355 | 297 |
| 237 | 3300046660 | Ga0495625_0161209 | Ga0495625_0161209_303_1277 | 297 |
| 238 | 3300046663 | Ga0495635_0014396 | Ga0495635_0014396_1708_2682 | 297 |
| 239 | 3300046675 | Ga0495657_0030444 | Ga0495657_0030444_2210_3184 | 297 |
| 240 | 3300046679 | Ga0495623_0016473 | Ga0495623_0016473_354_1328 | 297 |
| 241 | 3300046680 | Ga0495646_0028374 | Ga0495646_0028374_370_1344 | 297 |
| 242 | 3300046692 | Ga0495671_0029736 | Ga0495671_0029736_367_1341 | 297 |
| 243 | 3300046809 | Ga0495600_0112567 | Ga0495600_0112567_194_1168 | 297 |
| 244 | 3300047317 | Ga0495604_0003918 | Ga0495604_0003918_4010_4984 | 297 |
| 245 | 3300047319 | Ga0495674_0035111 | Ga0495674_0035111_1964_2938 | 297 |
| 246 | 3300047319 | Ga0495674_0125709 | Ga0495674_0125709_419_1399 | 297 |
| 247 | 3300047321 | Ga0495676_0027033 | Ga0495676_0027033_1437_2411 | 297 |
| 248 | 3300047322 | Ga0495680_0063164 | Ga0495680_0063164_1701_2675 | 297 |
| 249 | 3300047323 | Ga0495683_0034943 | Ga0495683_0034943_853_1827 | 297 |
| 250 | 3300047323 | Ga0495683_0113852 | Ga0495683_0113852_46_1020 | 297 |
| 251 | 3300047444 | Ga0495675_0011557 | Ga0495675_0011557_1736_2710 | 297 |
| 252 | 3300047446 | Ga0495679_029272 | Ga0495679_029272_184_1158 | 297 |
| 253 | 3300048088 | Ga0495602_0014899 | Ga0495602_0014899_6597_7571 | 297 |
| 254 | 3300048088 | Ga0495602_0054330 | Ga0495602_0054330_506_1480 | 297 |
| 255 | 3300048904 | Ga0496101_0138677 | Ga0496101_0138677_264_1244 | 297 |
| 256 | 3300048905 | Ga0496102_0043325 | Ga0496102_0043325_1723_2697 | 297 |
| 257 | 3300048905 | Ga0496102_0046430 | Ga0496102_0046430_733_1713 | 297 |
| 258 | 3300048905 | Ga0496102_0136685 | Ga0496102_0136685_1258_2229 | 297 |
| 259 | 3300048906 | Ga0496103_0080164 | Ga0496103_0080164_733_1707 | 297 |
| 260 | 3300048907 | Ga0496104_0002225 | Ga0496104_0002225_7554_8528 | 297 |
| 261 | 3300048907 | Ga0496104_0054214 | Ga0496104_0054214_200_1174 | 297 |
| 262 | 3300048907 | Ga0496104_0054726 | Ga0496104_0054726_1347_2318 | 297 |
| 263 | 3300048907 | Ga0496104_0445928 | Ga0496104_0445928_134_1108 | 297 |
| 264 | 3300048908 | Ga0496105_0001134 | Ga0496105_0001134_2127_3101 | 297 |
| 265 | 3300048908 | Ga0496105_0055063 | Ga0496105_0055063_707_1687 | 297 |
| 266 | 3300048911 | Ga0496108_0039396 | Ga0496108_0039396_856_1836 | 297 |
| 267 | 3300048911 | Ga0496108_0122922 | Ga0496108_0122922_940_1914 | 297 |
| 268 | 3300048913 | Ga0496110_0073535 | Ga0496110_0073535_1359_2333 | 297 |
| 269 | 3300048913 | Ga0496110_0093580 | Ga0496110_0093580_328_1308 | 297 |
| 270 | 3300048913 | Ga0496110_0116184 | Ga0496110_0116184_673_1644 | 297 |
| 271 | 3300048914 | Ga0496111_0009495 | Ga0496111_0009495_2230_3210 | 297 |
| 272 | 3300048915 | Ga0496112_0021877 | Ga0496112_0021877_4341_5321 | 297 |
| 273 | 3300048915 | Ga0496112_0083180 | Ga0496112_0083180_982_1953 | 297 |
| 274 | 3300048916 | Ga0496113_0013457 | Ga0496113_0013457_3929_4909 | 297 |
| 275 | 3300048916 | Ga0496113_0061879 | Ga0496113_0061879_881_1855 | 297 |
| 276 | 3300048917 | Ga0496114_0135771 | Ga0496114_0135771_100_1074 | 297 |
| 277 | 3300048918 | Ga0496115_0057368 | Ga0496115_0057368_1988_2959 | 297 |
| 278 | 3300048918 | Ga0496115_0170190 | Ga0496115_0170190_700_1674 | 297 |
| 279 | 3300048920 | Ga0496117_0064612 | Ga0496117_0064612_1500_2474 | 297 |
| 280 | 3300048921 | Ga0496118_0056974 | Ga0496118_0056974_1712_2686 | 297 |
| 281 | 3300048922 | Ga0496119_0004887 | Ga0496119_0004887_9970_10944 | 297 |
| 282 | 3300048923 | Ga0496120_0006736 | Ga0496120_0006736_2650_3624 | 297 |
| 283 | 3300048924 | Ga0496121_0037884 | Ga0496121_0037884_1865_2839 | 297 |
| 284 | 3300048928 | Ga0496125_0070496 | Ga0496125_0070496_693_1667 | 297 |
| 285 | 3300048928 | Ga0496125_0078461 | Ga0496125_0078461_1433_2407 | 297 |
| 286 | 3300048929 | Ga0496126_0058202 | Ga0496126_0058202_2100_3074 | 297 |
| 287 | 3300049571 | Ga0501034_0151321 | Ga0501034_0151321_1046_2023 | 297 |
| 288 | 3300049575 | Ga0501039_0327821 | Ga0501039_0327821_57_1031 | 297 |
| 289 | 3300049579 | Ga0501043_0008498 | Ga0501043_0008498_1529_2506 | 297 |
| 290 | 3300050489 | nmdc:mga03683_54928_c1 | nmdc:mga03683_54928_c1_90_1064 | 297 |
| 291 | 3300050490 | nmdc:mga03n38_63825_c1 | nmdc:mga03n38_63825_c1_326_1300 | 297 |
| 292 | 3300050492 | nmdc:mga0yw44_35154_c1 | nmdc:mga0yw44_35154_c1_1159_2133 | 297 |
| 293 | 3300050496 | nmdc:mga07m45_8273_c1 | nmdc:mga07m45_8273_c1_2738_3712 | 297 |
| 294 | 3300050496 | nmdc:mga07m45_95405_c1 | nmdc:mga07m45_95405_c1_181_1155 | 297 |
| 295 | 3300053093 | Ga0500651_0041562 | Ga0500651_0041562_146_1120 | 297 |
| 296 | 3300053096 | Ga0500641_0064727 | Ga0500641_0064727_192_1166 | 297 |
| 297 | 3300053137 | Ga0500561_0012590 | Ga0500561_0012590_665_1639 | 297 |
| 298 | 3300053151 | Ga0500604_0014548 | Ga0500604_0014548_577_1551 | 297 |
| 299 | 3300053153 | Ga0500616_0000038 | Ga0500616_0000038_328480_329457 | 297 |
| 300 | 3300002070 | JGI24750J21931_1003837 | JGI24750J21931_10038372 | 298 |
| 301 | 3300002244 | JGI24742J22300_10002754 | JGI24742J22300_100027542 | 298 |
| 302 | 3300003214 | JGI25165J46597_1004140 | JGI25165J46597_10041403 | 298 |
| 303 | 3300003215 | JGI25153J46596_10004406 | JGI25153J46596_100044061 | 298 |
| 304 | 3300004625 | Ga0055543_1001363 | Ga0055543_10013634 | 298 |
| 305 | 3300005262 | Ga0065165_1000982 | Ga0065165_100098219 | 298 |
| 306 | 3300005329 | Ga0070683_100102927 | Ga0070683_1001029271 | 298 |
| 307 | 3300005366 | Ga0070659_100069509 | Ga0070659_1000695093 | 298 |
| 308 | 3300005435 | Ga0070714_100106715 | Ga0070714_1001067153 | 298 |
| 309 | 3300005441 | Ga0070700_100026245 | Ga0070700_1000262452 | 298 |
| 310 | 3300005455 | Ga0070663_100022555 | Ga0070663_1000225553 | 298 |
| 311 | 3300005467 | Ga0070706_100303288 | Ga0070706_1003032882 | 298 |
| 312 | 3300005468 | Ga0070707_100362581 | Ga0070707_1003625812 | 298 |
| 313 | 3300005518 | Ga0070699_100525571 | Ga0070699_1005255711 | 298 |
| 314 | 3300005544 | Ga0070686_100050421 | Ga0070686_1000504213 | 298 |
| 315 | 3300005548 | Ga0070665_100043790 | Ga0070665_1000437903 | 298 |
| 316 | 3300005548 | Ga0070665_100103205 | Ga0070665_1001032052 | 298 |
| 317 | 3300005614 | Ga0068856_100000137 | Ga0068856_10000013769 | 298 |
| 318 | 3300005718 | Ga0068866_10021348 | Ga0068866_100213483 | 298 |
| 319 | 3300005719 | Ga0068861_100119117 | Ga0068861_1001191172 | 298 |
| 320 | 3300005983 | Ga0081540_1035426 | Ga0081540_10354262 | 298 |
| 321 | 3300005983 | Ga0081540_1062350 | Ga0081540_10623501 | 298 |
| 322 | 3300006038 | Ga0075365_10021213 | Ga0075365_100212133 | 298 |
| 323 | 3300006051 | Ga0075364_10067575 | Ga0075364_100675752 | 298 |
| 324 | 3300006186 | Ga0075369_10078004 | Ga0075369_100780042 | 298 |
| 325 | 3300006195 | Ga0075366_10089529 | Ga0075366_100895292 | 298 |
| 326 | 3300006353 | Ga0075370_10013631 | Ga0075370_100136313 | 298 |
| 327 | 3300007265 | Ga0099794_10081608 | Ga0099794_100816082 | 298 |
| 328 | 3300009093 | Ga0105240_10046776 | Ga0105240_100467763 | 298 |
| 329 | 3300009093 | Ga0105240_10067164 | Ga0105240_100671643 | 298 |
| 330 | 3300011119 | Ga0105246_10056087 | Ga0105246_100560873 | 298 |
| 331 | 3300013104 | Ga0157370_10109493 | Ga0157370_101094933 | 298 |
| 332 | 3300013105 | Ga0157369_10003351 | Ga0157369_1000335118 | 298 |
| 333 | 3300013297 | Ga0157378_10118327 | Ga0157378_101183272 | 298 |
| 334 | 3300013306 | Ga0163162_10092404 | Ga0163162_100924042 | 298 |
| 335 | 3300013307 | Ga0157372_10560699 | Ga0157372_105606992 | 298 |
| 336 | 3300021384 | Ga0213876_10029749 | Ga0213876_100297492 | 298 |
| 337 | 3300025254 | Ga0209148_1000321 | Ga0209148_100032136 | 298 |
| 338 | 3300025261 | Ga0209233_1008676 | Ga0209233_10086763 | 298 |
| 339 | 3300025261 | Ga0209233_1008870 | Ga0209233_10088703 | 298 |
| 340 | 3300025272 | Ga0209455_1001351 | Ga0209455_10013519 | 298 |
| 341 | 3300025297 | Ga0209758_1005044 | Ga0209758_100504411 | 298 |
| 342 | 3300025907 | Ga0207645_10029692 | Ga0207645_100296923 | 298 |
| 343 | 3300025913 | Ga0207695_10044192 | Ga0207695_100441923 | 298 |
| 344 | 3300025915 | Ga0207693_10051991 | Ga0207693_100519912 | 298 |
| 345 | 3300025918 | Ga0207662_10176548 | Ga0207662_101765481 | 298 |
| 346 | 3300025921 | Ga0207652_10065919 | Ga0207652_100659192 | 298 |
| 347 | 3300025923 | Ga0207681_10099713 | Ga0207681_100997132 | 298 |
| 348 | 3300025927 | Ga0207687_10051832 | Ga0207687_100518323 | 298 |
| 349 | 3300025928 | Ga0207700_10042747 | Ga0207700_100427475 | 298 |
| 350 | 3300025934 | Ga0207686_10037403 | Ga0207686_100374032 | 298 |
| 351 | 3300025935 | Ga0207709_10206519 | Ga0207709_102065192 | 298 |
| 352 | 3300025937 | Ga0207669_10020230 | Ga0207669_100202302 | 298 |
| 353 | 3300025938 | Ga0207704_10056141 | Ga0207704_100561413 | 298 |
| 354 | 3300025941 | Ga0207711_10352832 | Ga0207711_103528321 | 298 |
| 355 | 3300025944 | Ga0207661_10000828 | Ga0207661_1000082816 | 298 |
| 356 | 3300025949 | Ga0207667_10194358 | Ga0207667_101943581 | 298 |
| 357 | 3300026067 | Ga0207678_10121298 | Ga0207678_101212982 | 298 |
| 358 | 3300026075 | Ga0207708_10021890 | Ga0207708_100218903 | 298 |
| 359 | 3300026078 | Ga0207702_10000063 | Ga0207702_1000006366 | 298 |
| 360 | 3300026088 | Ga0207641_10155908 | Ga0207641_101559082 | 298 |
| 361 | 3300026142 | Ga0207698_10082645 | Ga0207698_100826452 | 298 |
| 362 | 3300026142 | Ga0207698_10581656 | Ga0207698_105816561 | 298 |
| 363 | 3300028379 | Ga0268266_10002818 | Ga0268266_1000281813 | 298 |
| 364 | 3300028379 | Ga0268266_10064786 | Ga0268266_100647863 | 298 |
| 365 | 3300028379 | Ga0268266_10107480 | Ga0268266_101074803 | 298 |
| 366 | 3300028380 | Ga0268265_10188346 | Ga0268265_101883462 | 298 |
| 367 | 3300028381 | Ga0268264_10056082 | Ga0268264_100560823 | 298 |
| 368 | 3300031548 | Ga0307408_100131833 | Ga0307408_1001318332 | 298 |
| 369 | 3300031995 | Ga0307409_100145191 | Ga0307409_1001451912 | 298 |
| 370 | 3300035086 | Ga0373934_0001556 | Ga0373934_0001556_4161_5135 | 298 |
| 371 | 3300035111 | Ga0373923_0012481 | Ga0373923_0012481_923_1897 | 298 |
| 372 | 3300035117 | Ga0373953_0004296 | Ga0373953_0004296_2004_2978 | 298 |
| 373 | 3300035118 | Ga0373954_0001461 | Ga0373954_0001461_6040_7014 | 298 |
| 374 | 3300035119 | Ga0373956_0050751 | Ga0373956_0050751_258_1232 | 298 |
| 375 | 3300035172 | Ga0373955_0003672 | Ga0373955_0003672_677_1651 | 298 |
| 376 | 3300035410 | Ga0373924_0003160 | Ga0373924_0003160_3531_4505 | 298 |
| 377 | 3300035724 | Ga0373933_0000105 | Ga0373933_0000105_48965_49939 | 298 |
| 378 | 3300035724 | Ga0373933_0060127 | Ga0373933_0060127_422_1396 | 298 |
| 379 | 3300036401 | Ga0373937_0310831 | Ga0373937_0310831_495_1469 | 298 |
| 380 | 3300037418 | Ga0395900_0047303 | Ga0395900_0047303_1703_2677 | 298 |
| 381 | 3300037466 | Ga0395898_0013732 | Ga0395898_0013732_1989_2963 | 298 |
| 382 | 3300038443 | Ga0395901_0010282 | Ga0395901_0010282_4225_5199 | 298 |
| 383 | 3300039437 | Ga0436365_0353256 | Ga0436365_0353256_830_1804 | 298 |
| 384 | 3300046454 | Ga0495592_0008007 | Ga0495592_0008007_6110_7084 | 298 |
| 385 | 3300046462 | Ga0495651_0053752 | Ga0495651_0053752_895_1869 | 298 |
| 386 | 3300046463 | Ga0495653_0032452 | Ga0495653_0032452_1471_2445 | 298 |
| 387 | 3300046477 | Ga0495664_0005407 | Ga0495664_0005407_5763_6737 | 298 |
| 388 | 3300046511 | Ga0495608_0021075 | Ga0495608_0021075_99_1073 | 298 |
| 389 | 3300046514 | Ga0495618_0017038 | Ga0495618_0017038_779_1753 | 298 |
| 390 | 3300046516 | Ga0495628_0008438 | Ga0495628_0008438_2020_2994 | 298 |
| 391 | 3300046517 | Ga0495630_0108945 | Ga0495630_0108945_19_993 | 298 |
| 392 | 3300046519 | Ga0495632_0146819 | Ga0495632_0146819_89_1063 | 298 |
| 393 | 3300046524 | Ga0495648_0000310 | Ga0495648_0000310_44801_45775 | 298 |
| 394 | 3300046529 | Ga0495652_0098568 | Ga0495652_0098568_1082_2056 | 298 |
| 395 | 3300046533 | Ga0495640_0174689 | Ga0495640_0174689_254_1228 | 298 |
| 396 | 3300046536 | Ga0495587_0106991 | Ga0495587_0106991_495_1469 | 298 |
| 397 | 3300046543 | Ga0495645_0001885 | Ga0495645_0001885_5648_6622 | 298 |
| 398 | 3300046559 | Ga0495667_0174073 | Ga0495667_0174073_295_1269 | 298 |
| 399 | 3300046642 | Ga0495634_0043947 | Ga0495634_0043947_1226_2200 | 298 |
| 400 | 3300046663 | Ga0495635_0053086 | Ga0495635_0053086_895_1869 | 298 |
| 401 | 3300046675 | Ga0495657_0005590 | Ga0495657_0005590_2703_3677 | 298 |
| 402 | 3300046678 | Ga0495599_0012640 | Ga0495599_0012640_3531_4505 | 298 |
| 403 | 3300046679 | Ga0495623_0027226 | Ga0495623_0027226_594_1568 | 298 |
| 404 | 3300046680 | Ga0495646_0022497 | Ga0495646_0022497_173_1147 | 298 |
| 405 | 3300046689 | Ga0495613_0021992 | Ga0495613_0021992_2083_3057 | 298 |
| 406 | 3300046809 | Ga0495600_0003449 | Ga0495600_0003449_8009_8983 | 298 |
| 407 | 3300047317 | Ga0495604_0044487 | Ga0495604_0044487_1319_2293 | 298 |
| 408 | 3300047319 | Ga0495674_0140116 | Ga0495674_0140116_723_1697 | 298 |
| 409 | 3300047322 | Ga0495680_0012949 | Ga0495680_0012949_5496_6470 | 298 |
| 410 | 3300047443 | Ga0495687_014616 | Ga0495687_014616_2015_2989 | 298 |
| 411 | 3300047471 | Ga0495684_0019738 | Ga0495684_0019738_2457_3431 | 298 |
| 412 | 3300048088 | Ga0495602_0057593 | Ga0495602_0057593_2084_3058 | 298 |
| 413 | 3300048905 | Ga0496102_0415362 | Ga0496102_0415362_219_1193 | 298 |
| 414 | 3300048916 | Ga0496113_0132999 | Ga0496113_0132999_189_1163 | 298 |
| 415 | 3300048917 | Ga0496114_0070227 | Ga0496114_0070227_1945_2919 | 298 |
| 416 | 3300048929 | Ga0496126_0133903 | Ga0496126_0133903_256_1230 | 298 |
| 417 | 3300050490 | nmdc:mga03n38_31193_c1 | nmdc:mga03n38_31193_c1_309_1283 | 298 |
| 418 | 3300050491 | nmdc:mga00v17_39602_c1 | nmdc:mga00v17_39602_c1_1344_2318 | 298 |
| 419 | 3300050494 | nmdc:mga06z11_5094_c1 | nmdc:mga06z11_5094_c1_2056_3030 | 298 |
| 420 | 3300050496 | nmdc:mga07m45_44572_c2 | nmdc:mga07m45_44572_c2_1266_2240 | 298 |
| 421 | 3300050516 | nmdc:mga0sz30_22385_c2 | nmdc:mga0sz30_22385_c2_141_1115 | 298 |
| 422 | 3300053077 | Ga0495601_0022363 | Ga0495601_0022363_309_1283 | 298 |
| 423 | 3300053078 | Ga0495612_0018844 | Ga0495612_0018844_20_994 | 298 |
| 424 | 3300003203 | JGI25406J46586_10000012 | JGI25406J46586_1000001262 | 299 |
| 425 | 3300005327 | Ga0070658_10068350 | Ga0070658_100683504 | 299 |
| 426 | 3300005338 | Ga0068868_100009313 | Ga0068868_1000093138 | 299 |
| 427 | 3300005339 | Ga0070660_100398703 | Ga0070660_1003987031 | 299 |
| 428 | 3300005341 | Ga0070691_10059080 | Ga0070691_100590802 | 299 |
| 429 | 3300005344 | Ga0070661_100120947 | Ga0070661_1001209472 | 299 |
| 430 | 3300005366 | Ga0070659_100153950 | Ga0070659_1001539502 | 299 |
| 431 | 3300005366 | Ga0070659_100231343 | Ga0070659_1002313432 | 299 |
| 432 | 3300005367 | Ga0070667_100138512 | Ga0070667_1001385121 | 299 |
| 433 | 3300005440 | Ga0070705_100157962 | Ga0070705_1001579621 | 299 |
| 434 | 3300005455 | Ga0070663_100079217 | Ga0070663_1000792173 | 299 |
| 435 | 3300005456 | Ga0070678_100008171 | Ga0070678_1000081713 | 299 |
| 436 | 3300005458 | Ga0070681_10115483 | Ga0070681_101154833 | 299 |
| 437 | 3300005471 | Ga0070698_100073038 | Ga0070698_1000730383 | 299 |
| 438 | 3300005518 | Ga0070699_100169809 | Ga0070699_1001698092 | 299 |
| 439 | 3300005530 | Ga0070679_100121093 | Ga0070679_1001210933 | 299 |
| 440 | 3300005535 | Ga0070684_100010714 | Ga0070684_1000107142 | 299 |
| 441 | 3300005548 | Ga0070665_100033056 | Ga0070665_1000330563 | 299 |
| 442 | 3300005563 | Ga0068855_100087063 | Ga0068855_1000870632 | 299 |
| 443 | 3300005564 | Ga0070664_100043519 | Ga0070664_1000435193 | 299 |
| 444 | 3300005614 | Ga0068856_100081807 | Ga0068856_1000818072 | 299 |
| 445 | 3300005614 | Ga0068856_100428682 | Ga0068856_1004286821 | 299 |
| 446 | 3300005616 | Ga0068852_100057592 | Ga0068852_1000575923 | 299 |
| 447 | 3300005616 | Ga0068852_100182296 | Ga0068852_1001822962 | 299 |
| 448 | 3300005618 | Ga0068864_100129831 | Ga0068864_1001298312 | 299 |
| 449 | 3300005834 | Ga0068851_10055527 | Ga0068851_100555272 | 299 |
| 450 | 3300005985 | Ga0081539_10000040 | Ga0081539_10000040227 | 299 |
| 451 | 3300006028 | Ga0070717_10037586 | Ga0070717_100375862 | 299 |
| 452 | 3300006038 | Ga0075365_10070752 | Ga0075365_100707522 | 299 |
| 453 | 3300006175 | Ga0070712_100305098 | Ga0070712_1003050982 | 299 |
| 454 | 3300007076 | Ga0075435_100045113 | Ga0075435_1000451133 | 299 |
| 455 | 3300007076 | Ga0075435_100061823 | Ga0075435_1000618232 | 299 |
| 456 | 3300009093 | Ga0105240_10004694 | Ga0105240_1000469410 | 299 |
| 457 | 3300009093 | Ga0105240_10389828 | Ga0105240_103898282 | 299 |
| 458 | 3300009094 | Ga0111539_10123838 | Ga0111539_101238381 | 299 |
| 459 | 3300009174 | Ga0105241_10011272 | Ga0105241_100112725 | 299 |
| 460 | 3300009545 | Ga0105237_10111021 | Ga0105237_101110211 | 299 |
| 461 | 3300009545 | Ga0105237_10272808 | Ga0105237_102728082 | 299 |
| 462 | 3300009551 | Ga0105238_10017095 | Ga0105238_100170955 | 299 |
| 463 | 3300009551 | Ga0105238_10299492 | Ga0105238_102994921 | 299 |
| 464 | 3300010375 | Ga0105239_10015728 | Ga0105239_100157285 | 299 |
| 465 | 3300010375 | Ga0105239_10020720 | Ga0105239_100207207 | 299 |
| 466 | 3300013102 | Ga0157371_10046519 | Ga0157371_100465192 | 299 |
| 467 | 3300013104 | Ga0157370_10011688 | Ga0157370_100116886 | 299 |
| 468 | 3300013104 | Ga0157370_10071396 | Ga0157370_100713962 | 299 |
| 469 | 3300013105 | Ga0157369_10002281 | Ga0157369_1000228115 | 299 |
| 470 | 3300013296 | Ga0157374_10052418 | Ga0157374_100524182 | 299 |
| 471 | 3300013296 | Ga0157374_10321590 | Ga0157374_103215901 | 299 |
| 472 | 3300013306 | Ga0163162_10038773 | Ga0163162_100387735 | 299 |
| 473 | 3300013307 | Ga0157372_10219310 | Ga0157372_102193103 | 299 |
| 474 | 3300013308 | Ga0157375_10385441 | Ga0157375_103854412 | 299 |
| 475 | 3300014325 | Ga0163163_10020851 | Ga0163163_100208512 | 299 |
| 476 | 3300014325 | Ga0163163_10288974 | Ga0163163_102889742 | 299 |
| 477 | 3300014745 | Ga0157377_10083982 | Ga0157377_100839821 | 299 |
| 478 | 3300014968 | Ga0157379_10025262 | Ga0157379_100252626 | 299 |
| 479 | 3300014969 | Ga0157376_10018180 | Ga0157376_100181804 | 299 |
| 480 | 3300021320 | Ga0214544_1000011 | Ga0214544_1000011133 | 299 |
| 481 | 3300021321 | Ga0214542_1000009 | Ga0214542_1000009109 | 299 |
| 482 | 3300021324 | Ga0214545_1000007 | Ga0214545_1000007133 | 299 |
| 483 | 3300021327 | Ga0214543_1000020 | Ga0214543_1000020109 | 299 |
| 484 | 3300021361 | Ga0213872_10044001 | Ga0213872_100440012 | 299 |
| 485 | 3300025230 | Ga0209563_100776 | Ga0209563_10077610 | 299 |
| 486 | 3300025253 | Ga0209677_100400 | Ga0209677_10040024 | 299 |
| 487 | 3300025297 | Ga0209758_1001992 | Ga0209758_10019929 | 299 |
| 488 | 3300025315 | Ga0207697_10049588 | Ga0207697_100495881 | 299 |
| 489 | 3300025321 | Ga0207656_10044269 | Ga0207656_100442692 | 299 |
| 490 | 3300025898 | Ga0207692_10032232 | Ga0207692_100322321 | 299 |
| 491 | 3300025899 | Ga0207642_10071949 | Ga0207642_100719491 | 299 |
| 492 | 3300025910 | Ga0207684_10097971 | Ga0207684_100979711 | 299 |
| 493 | 3300025911 | Ga0207654_10027667 | Ga0207654_100276673 | 299 |
| 494 | 3300025912 | Ga0207707_10000706 | Ga0207707_1000070635 | 299 |
| 495 | 3300025914 | Ga0207671_10199660 | Ga0207671_101996601 | 299 |
| 496 | 3300025915 | Ga0207693_10157712 | Ga0207693_101577122 | 299 |
| 497 | 3300025916 | Ga0207663_10026504 | Ga0207663_100265043 | 299 |
| 498 | 3300025916 | Ga0207663_10260013 | Ga0207663_102600132 | 299 |
| 499 | 3300025920 | Ga0207649_10148779 | Ga0207649_101487792 | 299 |
| 500 | 3300025921 | Ga0207652_10001458 | Ga0207652_1000145820 | 299 |
| 501 | 3300025924 | Ga0207694_10078416 | Ga0207694_100784162 | 299 |
| 502 | 3300025929 | Ga0207664_10182276 | Ga0207664_101822762 | 299 |
| 503 | 3300025939 | Ga0207665_10027066 | Ga0207665_100270663 | 299 |
| 504 | 3300025941 | Ga0207711_10112309 | Ga0207711_101123093 | 299 |
| 505 | 3300025941 | Ga0207711_10537562 | Ga0207711_105375622 | 299 |
| 506 | 3300025945 | Ga0207679_10064390 | Ga0207679_100643903 | 299 |
| 507 | 3300025949 | Ga0207667_10006413 | Ga0207667_100064135 | 299 |
| 508 | 3300025960 | Ga0207651_10441719 | Ga0207651_104417191 | 299 |
| 509 | 3300026023 | Ga0207677_10012235 | Ga0207677_100122357 | 299 |
| 510 | 3300026023 | Ga0207677_10034462 | Ga0207677_100344622 | 299 |
| 511 | 3300026035 | Ga0207703_10057392 | Ga0207703_100573921 | 299 |
| 512 | 3300026041 | Ga0207639_10006655 | Ga0207639_100066553 | 299 |
| 513 | 3300026067 | Ga0207678_10039422 | Ga0207678_100394224 | 299 |
| 514 | 3300026067 | Ga0207678_10418352 | Ga0207678_104183522 | 299 |
| 515 | 3300026067 | Ga0207678_10513520 | Ga0207678_105135201 | 299 |
| 516 | 3300026078 | Ga0207702_10123853 | Ga0207702_101238532 | 299 |
| 517 | 3300026116 | Ga0207674_10040962 | Ga0207674_100409625 | 299 |
| 518 | 3300026116 | Ga0207674_10043341 | Ga0207674_100433412 | 299 |
| 519 | 3300026121 | Ga0207683_10012826 | Ga0207683_100128268 | 299 |
| 520 | 3300027357 | Ga0209589_1000055 | Ga0209589_100005572 | 299 |
| 521 | 3300027361 | Ga0209489_100128 | Ga0209489_10012872 | 299 |
| 522 | 3300027363 | Ga0209700_100137 | Ga0209700_10013772 | 299 |
| 523 | 3300027512 | Ga0209179_1026845 | Ga0209179_10268452 | 299 |
| 524 | 3300028379 | Ga0268266_10046002 | Ga0268266_100460023 | 299 |
| 525 | 3300028379 | Ga0268266_10081068 | Ga0268266_100810682 | 299 |
| 526 | 3300031235 | Ga0265330_10014639 | Ga0265330_100146392 | 299 |
| 527 | 3300031595 | Ga0265313_10054318 | Ga0265313_100543182 | 299 |
| 528 | 3300031711 | Ga0265314_10018837 | Ga0265314_100188374 | 299 |
| 529 | 3300031712 | Ga0265342_10033828 | Ga0265342_100338281 | 299 |
| 530 | 3300033442 | Ga0315911_1000005 | Ga0315911_100000532 | 299 |
| 531 | 3300035692 | Ga0373935_0150356 | Ga0373935_0150356_350_1324 | 299 |
| 532 | 3300036401 | Ga0373937_0042762 | Ga0373937_0042762_2678_3652 | 299 |
| 533 | 3300037466 | Ga0395898_0083135 | Ga0395898_0083135_1880_2854 | 299 |
| 534 | 3300046455 | Ga0495603_0031308 | Ga0495603_0031308_933_1907 | 299 |
| 535 | 3300046462 | Ga0495651_0028754 | Ga0495651_0028754_2603_3583 | 299 |
| 536 | 3300046472 | Ga0495580_0227117 | Ga0495580_0227117_192_1166 | 299 |
| 537 | 3300046513 | Ga0495616_0069543 | Ga0495616_0069543_672_1646 | 299 |
| 538 | 3300046537 | Ga0495598_0000848 | Ga0495598_0000848_4699_5673 | 299 |
| 539 | 3300046543 | Ga0495645_0044351 | Ga0495645_0044351_734_1708 | 299 |
| 540 | 3300046616 | Ga0495668_0098966 | Ga0495668_0098966_468_1442 | 299 |
| 541 | 3300046674 | Ga0495588_0017042 | Ga0495588_0017042_1462_2436 | 299 |
| 542 | 3300046684 | Ga0495669_0022157 | Ga0495669_0022157_1639_2613 | 299 |
| 543 | 3300047319 | Ga0495674_0147836 | Ga0495674_0147836_152_1126 | 299 |
| 544 | 3300047321 | Ga0495676_0074951 | Ga0495676_0074951_703_1677 | 299 |
| 545 | 3300048090 | Ga0495615_0005324 | Ga0495615_0005324_596_1570 | 299 |
| 546 | 3300048904 | Ga0496101_0079128 | Ga0496101_0079128_901_1881 | 299 |
| 547 | 3300048905 | Ga0496102_0016408 | Ga0496102_0016408_1266_2246 | 299 |
| 548 | 3300048905 | Ga0496102_0104675 | Ga0496102_0104675_315_1289 | 299 |
| 549 | 3300048906 | Ga0496103_0138932 | Ga0496103_0138932_557_1531 | 299 |
| 550 | 3300048906 | Ga0496103_0142946 | Ga0496103_0142946_31_1005 | 299 |
| 551 | 3300048907 | Ga0496104_0021761 | Ga0496104_0021761_2413_3387 | 299 |
| 552 | 3300048907 | Ga0496104_0154363 | Ga0496104_0154363_666_1646 | 299 |
| 553 | 3300048908 | Ga0496105_0003701 | Ga0496105_0003701_4175_5155 | 299 |
| 554 | 3300048908 | Ga0496105_0097045 | Ga0496105_0097045_1038_2012 | 299 |
| 555 | 3300048909 | Ga0496106_0022335 | Ga0496106_0022335_506_1486 | 299 |
| 556 | 3300048910 | Ga0496107_0156884 | Ga0496107_0156884_126_1100 | 299 |
| 557 | 3300048911 | Ga0496108_0165214 | Ga0496108_0165214_14_988 | 299 |
| 558 | 3300048912 | Ga0496109_0005103 | Ga0496109_0005103_4370_5350 | 299 |
| 559 | 3300048912 | Ga0496109_0035249 | Ga0496109_0035249_3352_4326 | 299 |
| 560 | 3300048913 | Ga0496110_0083400 | Ga0496110_0083400_1830_2804 | 299 |
| 561 | 3300048914 | Ga0496111_0005854 | Ga0496111_0005854_4787_5767 | 299 |
| 562 | 3300048914 | Ga0496111_0188475 | Ga0496111_0188475_43_1017 | 299 |
| 563 | 3300048915 | Ga0496112_0218641 | Ga0496112_0218641_479_1453 | 299 |
| 564 | 3300048915 | Ga0496112_0292219 | Ga0496112_0292219_217_1197 | 299 |
| 565 | 3300048916 | Ga0496113_0005191 | Ga0496113_0005191_6032_7012 | 299 |
| 566 | 3300048916 | Ga0496113_0021994 | Ga0496113_0021994_2098_3072 | 299 |
| 567 | 3300048918 | Ga0496115_0000295 | Ga0496115_0000295_24311_25291 | 299 |
| 568 | 3300048918 | Ga0496115_0296966 | Ga0496115_0296966_17_994 | 299 |
| 569 | 3300048929 | Ga0496126_0004033 | Ga0496126_0004033_14145_15119 | 299 |
| 570 | 3300049568 | Ga0501031_0000511 | Ga0501031_0000511_7310_8287 | 299 |
| 571 | 3300049568 | Ga0501031_0006718 | Ga0501031_0006718_435_1412 | 299 |
| 572 | 3300049569 | Ga0501032_0000073 | Ga0501032_0000073_33009_33986 | 299 |
| 573 | 3300049570 | Ga0501033_0001845 | Ga0501033_0001845_13355_14332 | 299 |
| 574 | 3300049571 | Ga0501034_0000251 | Ga0501034_0000251_13585_14562 | 299 |
| 575 | 3300049571 | Ga0501034_0174718 | Ga0501034_0174718_57_1034 | 299 |
| 576 | 3300049572 | Ga0501036_0000036 | Ga0501036_0000036_74952_75929 | 299 |
| 577 | 3300049573 | Ga0501037_0000040 | Ga0501037_0000040_39436_40413 | 299 |
| 578 | 3300049573 | Ga0501037_0020880 | Ga0501037_0020880_1008_1985 | 299 |
| 579 | 3300049574 | Ga0501038_0000150 | Ga0501038_0000150_19746_20723 | 299 |
| 580 | 3300049574 | Ga0501038_0041771 | Ga0501038_0041771_2115_3092 | 299 |
| 581 | 3300049575 | Ga0501039_0001837 | Ga0501039_0001837_8323_9300 | 299 |
| 582 | 3300049578 | Ga0501042_0010937 | Ga0501042_0010937_4812_5789 | 299 |
| 583 | 3300049579 | Ga0501043_0000464 | Ga0501043_0000464_29328_30305 | 299 |
| 584 | 3300049580 | Ga0501046_0000398 | Ga0501046_0000398_13119_14096 | 299 |
| 585 | 3300049580 | Ga0501046_0184273 | Ga0501046_0184273_383_1360 | 299 |
| 586 | 3300049581 | Ga0501047_0000656 | Ga0501047_0000656_13355_14332 | 299 |
| 587 | 3300049582 | Ga0501048_0002054 | Ga0501048_0002054_10213_11190 | 299 |
| 588 | 3300049582 | Ga0501048_0161366 | Ga0501048_0161366_56_1033 | 299 |
| 589 | 3300049583 | Ga0501067_0000192 | Ga0501067_0000192_5200_6177 | 299 |
| 590 | 3300049584 | Ga0501068_0008599 | Ga0501068_0008599_2858_3835 | 299 |
| 591 | 3300049586 | Ga0501070_0002215 | Ga0501070_0002215_2601_3578 | 299 |
| 592 | 3300049587 | Ga0501071_0101717 | Ga0501071_0101717_809_1786 | 299 |
| 593 | 3300049588 | Ga0501072_0001038 | Ga0501072_0001038_11944_12921 | 299 |
| 594 | 3300049589 | Ga0501073_0000037 | Ga0501073_0000037_11344_12321 | 299 |
| 595 | 3300049589 | Ga0501073_0004501 | Ga0501073_0004501_9466_10443 | 299 |
| 596 | 3300049590 | Ga0501074_0000212 | Ga0501074_0000212_13295_14272 | 299 |
| 597 | 3300049741 | Ga0501079_0002283 | Ga0501079_0002283_5802_6779 | 299 |
| 598 | 3300049741 | Ga0501079_0012536 | Ga0501079_0012536_845_1822 | 299 |
| 599 | 3300049742 | Ga0501080_0000054 | Ga0501080_0000054_48427_49404 | 299 |
| 600 | 3300049742 | Ga0501080_0114479 | Ga0501080_0114479_1288_2265 | 299 |
| 601 | 3300049744 | Ga0501083_0001153 | Ga0501083_0001153_15046_16023 | 299 |
| 602 | 3300049744 | Ga0501083_0006025 | Ga0501083_0006025_1952_2929 | 299 |
| 603 | 3300049822 | Ga0501035_0000142 | Ga0501035_0000142_73000_73977 | 299 |
| 604 | 3300049823 | Ga0501044_0000985 | Ga0501044_0000985_13585_14562 | 299 |
| 605 | 3300049823 | Ga0501044_0005451 | Ga0501044_0005451_1443_2420 | 299 |
| 606 | 3300049824 | Ga0501045_0008122 | Ga0501045_0008122_3561_4538 | 299 |
| 607 | 3300049824 | Ga0501045_0009166 | Ga0501045_0009166_4453_5430 | 299 |
| 608 | 3300050493 | nmdc:mga0k408_53176_c1 | nmdc:mga0k408_53176_c1_293_1267 | 299 |
| 609 | 3300050494 | nmdc:mga06z11_24305_c1 | nmdc:mga06z11_24305_c1_431_1405 | 299 |
| 610 | 3300050512 | nmdc:mga0n895_3593_c1 | nmdc:mga0n895_3593_c1_5030_6004 | 299 |
| 611 | 3300050513 | nmdc:mga0rr50_12738_c1 | nmdc:mga0rr50_12738_c1_3448_4422 | 299 |
| 612 | 3300050513 | nmdc:mga0rr50_518829_c1 | nmdc:mga0rr50_518829_c1_20_994 | 299 |
| 613 | 3300053087 | Ga0500643_012650 | Ga0500643_012650_1964_2938 | 299 |
| 614 | 3300053130 | Ga0500642_0000197 | Ga0500642_0000197_22862_23836 | 299 |
| 615 | 3300054114 | Ga0501084_0007428 | Ga0501084_0007428_2257_3234 | 299 |
| 616 | 3300054114 | Ga0501084_0011305 | Ga0501084_0011305_990_1967 | 299 |
| 617 | 3300060353 | Ga0501082_0004487 | Ga0501082_0004487_6778_7755 | 299 |
| 618 | 3300060353 | Ga0501082_0012051 | Ga0501082_0012051_1614_2591 | 299 |
| 619 | 3300003659 | JGI25404J52841_10007705 | JGI25404J52841_100077052 | 300 |
| 620 | 3300005336 | Ga0070680_100037092 | Ga0070680_1000370922 | 300 |
| 621 | 3300005338 | Ga0068868_100048804 | Ga0068868_1000488042 | 300 |
| 622 | 3300005347 | Ga0070668_100091738 | Ga0070668_1000917383 | 300 |
| 623 | 3300005366 | Ga0070659_100275573 | Ga0070659_1002755732 | 300 |
| 624 | 3300005444 | Ga0070694_100068491 | Ga0070694_1000684912 | 300 |
| 625 | 3300005458 | Ga0070681_10098406 | Ga0070681_100984063 | 300 |
| 626 | 3300005458 | Ga0070681_10408946 | Ga0070681_104089461 | 300 |
| 627 | 3300005530 | Ga0070679_100024224 | Ga0070679_1000242242 | 300 |
| 628 | 3300005617 | Ga0068859_100583281 | Ga0068859_1005832812 | 300 |
| 629 | 3300005719 | Ga0068861_100109122 | Ga0068861_1001091222 | 300 |
| 630 | 3300005841 | Ga0068863_100109668 | Ga0068863_1001096682 | 300 |
| 631 | 3300005842 | Ga0068858_100303077 | Ga0068858_1003030771 | 300 |
| 632 | 3300005983 | Ga0081540_1010031 | Ga0081540_10100313 | 300 |
| 633 | 3300005983 | Ga0081540_1100765 | Ga0081540_11007651 | 300 |
| 634 | 3300006880 | Ga0075429_100269386 | Ga0075429_1002693862 | 300 |
| 635 | 3300006931 | Ga0097620_100583269 | Ga0097620_1005832692 | 300 |
| 636 | 3300009093 | Ga0105240_10753321 | Ga0105240_107533211 | 300 |
| 637 | 3300009148 | Ga0105243_10346994 | Ga0105243_103469942 | 300 |
| 638 | 3300009177 | Ga0105248_10237689 | Ga0105248_102376892 | 300 |
| 639 | 3300009545 | Ga0105237_10539498 | Ga0105237_105394982 | 300 |
| 640 | 3300010375 | Ga0105239_10100157 | Ga0105239_101001573 | 300 |
| 641 | 3300013306 | Ga0163162_10045055 | Ga0163162_100450552 | 300 |
| 642 | 3300014968 | Ga0157379_10380867 | Ga0157379_103808672 | 300 |
| 643 | 3300025302 | Ga0207426_1000773 | Ga0207426_100077331 | 300 |
| 644 | 3300025901 | Ga0207688_10046505 | Ga0207688_100465051 | 300 |
| 645 | 3300025904 | Ga0207647_10184968 | Ga0207647_101849681 | 300 |
| 646 | 3300025912 | Ga0207707_10000515 | Ga0207707_1000051529 | 300 |
| 647 | 3300025935 | Ga0207709_10057528 | Ga0207709_100575282 | 300 |
| 648 | 3300025942 | Ga0207689_10174330 | Ga0207689_101743302 | 300 |
| 649 | 3300025961 | Ga0207712_10094480 | Ga0207712_100944801 | 300 |
| 650 | 3300025972 | Ga0207668_10027989 | Ga0207668_100279892 | 300 |
| 651 | 3300026035 | Ga0207703_10059969 | Ga0207703_100599693 | 300 |
| 652 | 3300026067 | Ga0207678_10026769 | Ga0207678_100267692 | 300 |
| 653 | 3300026089 | Ga0207648_10058331 | Ga0207648_100583312 | 300 |
| 654 | 3300026116 | Ga0207674_10213110 | Ga0207674_102131102 | 300 |
| 655 | 3300026118 | Ga0207675_100133979 | Ga0207675_1001339793 | 300 |
| 656 | 3300028379 | Ga0268266_10003102 | Ga0268266_1000310211 | 300 |
| 657 | 3300028380 | Ga0268265_10068850 | Ga0268265_100688503 | 300 |
| 658 | 3300028381 | Ga0268264_10034068 | Ga0268264_100340683 | 300 |
| 659 | 3300028786 | Ga0307517_10105494 | Ga0307517_101054942 | 300 |
| 660 | 3300028786 | Ga0307517_10121559 | Ga0307517_101215592 | 300 |
| 661 | 3300031238 | Ga0265332_10016892 | Ga0265332_100168922 | 300 |
| 662 | 3300031548 | Ga0307408_100256759 | Ga0307408_1002567591 | 300 |
| 663 | 3300032126 | Ga0307415_100067532 | Ga0307415_1000675323 | 300 |
| 664 | 3300039438 | Ga0436360_0133086 | Ga0436360_0133086_31_1005 | 300 |
| 665 | 3300044656 | Ga0466969_0083139 | Ga0466969_0083139_225_1199 | 300 |
| 666 | 3300044658 | Ga0466972_0031207 | Ga0466972_0031207_581_1555 | 300 |
| 667 | 3300044684 | Ga0466966_0000322 | Ga0466966_0000322_13384_14358 | 300 |
| 668 | 3300044693 | Ga0466961_0000227 | Ga0466961_0000227_2821_3795 | 300 |
| 669 | 3300044735 | Ga0466968_0008614 | Ga0466968_0008614_547_1521 | 300 |
| 670 | 3300046513 | Ga0495616_0120015 | Ga0495616_0120015_211_1185 | 300 |
| 671 | 3300046522 | Ga0495643_0054168 | Ga0495643_0054168_1121_2095 | 300 |
| 672 | 3300046524 | Ga0495648_0065576 | Ga0495648_0065576_502_1476 | 300 |
| 673 | 3300046674 | Ga0495588_0011770 | Ga0495588_0011770_786_1760 | 300 |
| 674 | 3300046694 | Ga0495649_0010519 | Ga0495649_0010519_3955_4929 | 300 |
| 675 | 3300047323 | Ga0495683_0111720 | Ga0495683_0111720_183_1157 | 300 |
| 676 | 3300047472 | Ga0495686_0022543 | Ga0495686_0022543_1560_2534 | 300 |
| 677 | 3300048905 | Ga0496102_0076234 | Ga0496102_0076234_1452_2426 | 300 |
| 678 | 3300048907 | Ga0496104_0039609 | Ga0496104_0039609_1892_2866 | 300 |
| 679 | 3300048908 | Ga0496105_0029657 | Ga0496105_0029657_1225_2349 | 300 |
| 680 | 3300048909 | Ga0496106_0060011 | Ga0496106_0060011_1841_2815 | 300 |
| 681 | 3300048909 | Ga0496106_0222247 | Ga0496106_0222247_397_1371 | 300 |
| 682 | 3300048910 | Ga0496107_0059138 | Ga0496107_0059138_1406_2380 | 300 |
| 683 | 3300048914 | Ga0496111_0021273 | Ga0496111_0021273_1034_2008 | 300 |
| 684 | 3300048919 | Ga0496116_0037092 | Ga0496116_0037092_1825_2799 | 300 |
| 685 | 3300048924 | Ga0496121_0002330 | Ga0496121_0002330_23076_24050 | 300 |
| 686 | 3300048924 | Ga0496121_0013885 | Ga0496121_0013885_2276_3250 | 300 |
| 687 | 3300048924 | Ga0496121_0047408 | Ga0496121_0047408_2473_3447 | 300 |
| 688 | 3300048924 | Ga0496121_0047766 | Ga0496121_0047766_2339_3313 | 300 |
| 689 | 3300048929 | Ga0496126_0011553 | Ga0496126_0011553_2897_3871 | 300 |
| 690 | 3300048929 | Ga0496126_0034144 | Ga0496126_0034144_79_1053 | 300 |
| 691 | 3300048929 | Ga0496126_0044111 | Ga0496126_0044111_1890_2867 | 300 |
| 692 | 3300049460 | Ga0495682_0015605 | Ga0495682_0015605_1703_2677 | 300 |
| 693 | 3300050491 | nmdc:mga00v17_114807_c1 | nmdc:mga00v17_114807_c1_673_1647 | 300 |
| 694 | 3300050491 | nmdc:mga00v17_52913_c1 | nmdc:mga00v17_52913_c1_224_1198 | 300 |
| 695 | 3300050492 | nmdc:mga0yw44_31040_c1 | nmdc:mga0yw44_31040_c1_1887_2861 | 300 |
| 696 | 3300050496 | nmdc:mga07m45_69723_c1 | nmdc:mga07m45_69723_c1_557_1531 | 300 |
| 697 | 3300050507 | nmdc:mga05p37_96716_c1 | nmdc:mga05p37_96716_c1_1568_2542 | 300 |
| 698 | 3300050512 | nmdc:mga0n895_98808_c1 | nmdc:mga0n895_98808_c1_627_1601 | 300 |
| 699 | 3300053094 | Ga0500566_0004238 | Ga0500566_0004238_2457_3431 | 300 |
| 700 | 3300053104 | Ga0500556_0041476 | Ga0500556_0041476_587_1561 | 300 |
| 701 | 3300053119 | Ga0500595_002174 | Ga0500595_002174_4415_5389 | 300 |
| 702 | 3300053139 | Ga0500568_0057381 | Ga0500568_0057381_258_1232 | 300 |
| 703 | 3300003215 | JGI25153J46596_10010431 | JGI25153J46596_100104313 | 301 |
| 704 | 3300005578 | Ga0068854_100360369 | Ga0068854_1003603691 | 301 |
| 705 | 3300005937 | Ga0081455_10034630 | Ga0081455_100346303 | 301 |
| 706 | 3300005983 | Ga0081540_1000721 | Ga0081540_10007213 | 301 |
| 707 | 3300006038 | Ga0075365_10014233 | Ga0075365_100142332 | 301 |
| 708 | 3300007788 | Ga0099795_10012627 | Ga0099795_100126272 | 301 |
| 709 | 3300025295 | Ga0209564_1006461 | Ga0209564_10064614 | 301 |
| 710 | 3300025297 | Ga0209758_1002275 | Ga0209758_100227517 | 301 |
| 711 | 3300025304 | Ga0209257_1032679 | Ga0209257_10326792 | 301 |
| 712 | 3300027512 | Ga0209179_1018494 | Ga0209179_10184942 | 301 |
| 713 | 3300031456 | Ga0307513_10085319 | Ga0307513_100853193 | 301 |
| 714 | 3300037471 | Ga0395905_0258497 | Ga0395905_0258497_563_1537 | 301 |
| 715 | 3300045976 | Ga0466967_0024100 | Ga0466967_0024100_3477_4451 | 301 |
| 716 | 3300048928 | Ga0496125_0001204 | Ga0496125_0001204_1841_2815 | 301 |
| 717 | 3300048929 | Ga0496126_0025463 | Ga0496126_0025463_2204_3181 | 301 |
| 718 | 3300049569 | Ga0501032_0204740 | Ga0501032_0204740_260_1237 | 301 |
| 719 | 3300049571 | Ga0501034_0392577 | Ga0501034_0392577_177_1154 | 301 |
| 720 | 3300049572 | Ga0501036_0156208 | Ga0501036_0156208_166_1143 | 301 |
| 721 | 3300049573 | Ga0501037_0323002 | Ga0501037_0323002_11_988 | 301 |
| 722 | 3300049574 | Ga0501038_0005621 | Ga0501038_0005621_9990_10967 | 301 |
| 723 | 3300049574 | Ga0501038_0013948 | Ga0501038_0013948_6063_7040 | 301 |
| 724 | 3300049579 | Ga0501043_0023171 | Ga0501043_0023171_1271_2248 | 301 |
| 725 | 3300049589 | Ga0501073_0143128 | Ga0501073_0143128_179_1156 | 301 |
| 726 | 3300049742 | Ga0501080_0188750 | Ga0501080_0188750_694_1668 | 301 |
| 727 | 3300049822 | Ga0501035_0186285 | Ga0501035_0186285_399_1376 | 301 |
| 728 | 3300049823 | Ga0501044_0090036 | Ga0501044_0090036_336_1310 | 301 |
| 729 | 3300053094 | Ga0500566_0055812 | Ga0500566_0055812_615_1589 | 301 |
| 730 | 3300053111 | Ga0500572_014382 | Ga0500572_014382_232_1206 | 301 |
| 731 | 3300053121 | Ga0500607_046171 | Ga0500607_046171_531_1505 | 301 |
| 732 | 3300053136 | Ga0500559_0031101 | Ga0500559_0031101_14_988 | 301 |
| 733 | 3300053138 | Ga0500564_017343 | Ga0500564_017343_1879_2853 | 301 |
| 734 | 3300053148 | Ga0500590_045744 | Ga0500590_045744_463_1437 | 301 |
| 735 | 3300053157 | Ga0500624_006620 | Ga0500624_006620_513_1487 | 301 |
| 736 | 3300053162 | Ga0500638_131217 | Ga0500638_131217_112_1086 | 301 |
| 737 | 3300053177 | Ga0500636_0000990 | Ga0500636_0000990_1089_2063 | 301 |
| 738 | iso_pu_bacteria | 2508501009 | 2508540137 | 301 |
| 739 | iso_pu_bacteria | 2508501042 | 2508696211 | 301 |
| 740 | iso_pu_bacteria | 2508501128 | 2509148141 | 301 |
| 741 | iso_pu_bacteria | 2511231028 | 2511395837 | 301 |
| 742 | iso_pu_bacteria | 2513237095 | 2513649146 | 301 |
| 743 | iso_pu_bacteria | 2513237096 | 2513657485 | 301 |
| 744 | iso_pu_bacteria | 2513237098 | 2513674963 | 301 |
| 745 | iso_pu_bacteria | 2513237102 | 2513700211 | 301 |
| 746 | iso_pu_bacteria | 2513237104 | 2513716118 | 301 |
| 747 | iso_pu_bacteria | 2513237137 | 2513861187 | 301 |
| 748 | iso_pu_bacteria | 2513237139 | 2513877222 | 301 |
| 749 | iso_pu_bacteria | 2513237145 | 2513916738 | 301 |
| 750 | iso_pu_bacteria | 2513237161 | 2514014591 | 301 |
| 751 | iso_pu_bacteria | 2515154112 | 2515628509 | 301 |
| 752 | iso_pu_bacteria | 2517093001 | 2517103135 | 301 |
| 753 | iso_pu_bacteria | 2517572143 | 2517889646 | 301 |
| 754 | iso_pu_bacteria | 2524023205 | 2524440813 | 301 |
| 755 | iso_pu_bacteria | 2524023210 | 2524465279 | 301 |
| 756 | iso_pu_bacteria | 2524023228 | 2524533185 | 301 |
| 757 | iso_pu_bacteria | 2528768022 | 2528850717 | 301 |
| 758 | iso_pu_bacteria | 2602042107 | 2603857140 | 301 |
| 759 | iso_pu_bacteria | 2617270735 | 2617347831 | 301 |
| 760 | iso_pu_bacteria | 2617270741 | 2617374753 | 301 |
| 761 | iso_pu_bacteria | 2643221651 | 2644290474 | 301 |
| 762 | iso_pu_bacteria | 2667528175 | 2671119497 | 301 |
| 763 | iso_pu_bacteria | 2744054633 | 2745076054 | 301 |
| 764 | iso_pu_bacteria | 2791355196 | 2793061517 | 301 |
| 765 | iso_pu_bacteria | 2791355197 | 2793070374 | 301 |
| 766 | iso_pu_bacteria | 2791355199 | 2793080128 | 301 |
| 767 | iso_pu_bacteria | 2802429603 | 2805916178 | 301 |
| 768 | iso_pu_bacteria | 2816332527 | 2818240537 | 301 |
| 769 | iso_pu_bacteria | 2824617872 | 2824623222 | 301 |
| 770 | iso_pu_bacteria | 2824626560 | 2824632180 | 301 |
| 771 | iso_pu_bacteria | 2824635225 | 2824640827 | 301 |
| 772 | iso_pu_bacteria | 2824644064 | 2824647979 | 301 |
| 773 | iso_pu_bacteria | 2824671348 | 2824675034 | 301 |
| 774 | iso_pu_bacteria | 2824679649 | 2824684460 | 301 |
| 775 | iso_pu_bacteria | 2824687955 | 2824695845 | 301 |
| 776 | iso_pu_bacteria | 2824696289 | 2824701048 | 301 |
| 777 | iso_pu_bacteria | 2824714736 | 2824723437 | 301 |
| 778 | iso_pu_bacteria | 2824723954 | 2824732679 | 301 |
| 779 | iso_pu_bacteria | 2824732956 | 2824737050 | 301 |
| 780 | iso_pu_bacteria | 2824746037 | 2824750830 | 301 |
| 781 | iso_pu_bacteria | 2824753945 | 2824761986 | 301 |
| 782 | iso_pu_bacteria | 2824763712 | 2824772387 | 301 |
| 783 | iso_pu_bacteria | 2824773399 | 2824775686 | 301 |
| 784 | iso_pu_bacteria | 2838122688 | 2838125061 | 301 |
| 785 | iso_pu_bacteria | 2841941048 | 2841945800 | 301 |
| 786 | iso_pu_bacteria | 2841949485 | 2841956899 | 301 |
| 787 | iso_pu_bacteria | 2841957949 | 2841963977 | 301 |
| 788 | iso_pu_bacteria | 2841966195 | 2841973541 | 301 |
| 789 | iso_pu_bacteria | 2841974524 | 2841981981 | 301 |
| 790 | iso_pu_bacteria | 2841983080 | 2841989429 | 301 |
| 791 | iso_pu_bacteria | 2842038055 | 2842044414 | 301 |
| 792 | iso_pu_bacteria | 2842045827 | 2842051597 | 301 |
| 793 | iso_pu_bacteria | 2844315083 | 2844316287 | 301 |
| 794 | iso_pu_bacteria | 2847930680 | 2847939410 | 301 |
| 795 | iso_pu_bacteria | 2847939898 | 2847941169 | 301 |
| 796 | iso_pu_bacteria | 2849076700 | 2849082158 | 301 |
| 797 | iso_pu_bacteria | 2857509624 | 2857513367 | 301 |
| 798 | iso_pu_bacteria | 2857524615 | 2857530855 | 301 |
| 799 | iso_pu_bacteria | 2874590934 | 2874596316 | 301 |
| 800 | iso_pu_bacteria | 2874604998 | 2874610112 | 301 |
| 801 | iso_pu_bacteria | 2874612657 | 2874616483 | 301 |
| 802 | iso_pu_bacteria | 2874620515 | 2874622501 | 301 |
| 803 | iso_pu_bacteria | 2874628541 | 2874633409 | 301 |
| 804 | iso_pu_bacteria | 2874645413 | 2874650303 | 301 |
| 805 | iso_pu_bacteria | 2876761206 | 2876763712 | 301 |
| 806 | iso_pu_bacteria | 2876771140 | 2876776781 | 301 |
| 807 | iso_pu_bacteria | 2876808645 | 2876811119 | 301 |
| 808 | iso_pu_bacteria | 2876818435 | 2876824571 | 301 |
| 809 | iso_pu_bacteria | 2879074833 | 2879080918 | 301 |
| 810 | iso_pu_bacteria | 2879083081 | 2879087083 | 301 |
| 811 | iso_pu_bacteria | 2879099564 | 2879104413 | 301 |
| 812 | iso_pu_bacteria | 2879110137 | 2879116978 | 301 |
| 813 | iso_pu_bacteria | 2879127579 | 2879133763 | 301 |
| 814 | iso_pu_bacteria | 2879142872 | 2879148265 | 301 |
| 815 | iso_pu_bacteria | 2881364244 | 2881369574 | 301 |
| 816 | iso_pu_bacteria | 2881665667 | 2881669709 | 301 |
| 817 | iso_pu_bacteria | 2885366525 | 2885367779 | 301 |
| 818 | iso_pu_bacteria | 2885374607 | 2885380874 | 301 |
| 819 | iso_pu_bacteria | 2885383462 | 2885391716 | 301 |
| 820 | iso_pu_bacteria | 2885409591 | 2885418868 | 301 |
| 821 | iso_pu_bacteria | 2888378607 | 2888387214 | 301 |
| 822 | iso_pu_bacteria | 2888388044 | 2888389906 | 301 |
| 823 | iso_pu_bacteria | 2889033259 | 2889036423 | 301 |
| 824 | iso_pu_bacteria | 2903727486 | 2903728378 | 301 |
| 825 | iso_pu_bacteria | 2903748898 | 2903756099 | 301 |
| 826 | iso_pu_bacteria | 2903768456 | 2903774694 | 301 |
| 827 | iso_pu_bacteria | 2904666416 | 2904671492 | 301 |
| 828 | iso_pu_bacteria | 2904690495 | 2904692057 | 301 |
| 829 | iso_pu_bacteria | 2904699407 | 2904707599 | 301 |
| 830 | iso_pu_bacteria | 2904711408 | 2904719788 | 301 |
| 831 | iso_pu_bacteria | 2906602504 | 2906606518 | 301 |
| 832 | iso_pu_bacteria | 2906610324 | 2906614623 | 301 |
| 833 | iso_pu_bacteria | 2906626472 | 2906631408 | 301 |
| 834 | iso_pu_bacteria | 2906635258 | 2906641968 | 301 |
| 835 | iso_pu_bacteria | 2906660503 | 2906660946 | 301 |
| 836 | iso_pu_bacteria | 2908739725 | 2908746555 | 301 |
| 837 | iso_pu_bacteria | 2908756301 | 2908757336 | 301 |
| 838 | iso_pu_bacteria | 2908775508 | 2908777234 | 301 |
| 839 | iso_pu_bacteria | 2919073203 | 2919077931 | 301 |
| 840 | iso_pu_bacteria | 2922368715 | 2922377395 | 301 |
| 841 | iso_pu_bacteria | 2922386360 | 2922389394 | 301 |
| 842 | iso_pu_bacteria | 2922393267 | 2922398484 | 301 |
| 843 | iso_pu_bacteria | 2922425934 | 2922426484 | 301 |
| 844 | iso_pu_bacteria | 2929615660 | 2929622183 | 301 |
| 845 | iso_pu_bacteria | 2929624759 | 2929630170 | 301 |
| 846 | iso_pu_bacteria | 2932784394 | 2932787901 | 301 |
| 847 | iso_pu_bacteria | 2932794094 | 2932796021 | 301 |
| 848 | iso_pu_bacteria | 2932801729 | 2932807599 | 301 |
| 849 | iso_pu_bacteria | 2932809354 | 2932817627 | 301 |
| 850 | iso_pu_bacteria | 2932818245 | 2932826213 | 301 |
| 851 | iso_pu_bacteria | 2932828146 | 2932835071 | 301 |
| 852 | iso_pu_bacteria | 2933577622 | 2933584202 | 301 |
| 853 | iso_pu_bacteria | 2935608549 | 2935614373 | 301 |
| 854 | iso_pu_bacteria | 2935616580 | 2935620448 | 301 |
| 855 | iso_pu_bacteria | 2935630451 | 2935632825 | 301 |
| 856 | iso_pu_bacteria | 2935638405 | 2935640771 | 301 |
| 857 | iso_pu_bacteria | 2935648319 | 2935649402 | 301 |
| 858 | iso_pu_bacteria | 2935656913 | 2935657826 | 301 |
| 859 | iso_pu_bacteria | 2935665750 | 2935670274 | 301 |
| 860 | iso_pu_bacteria | 2935675223 | 2935679703 | 301 |
| 861 | iso_pu_bacteria | 2935684952 | 2935687272 | 301 |
| 862 | iso_pu_bacteria | 2935694250 | 2935696757 | 301 |
| 863 | iso_pu_bacteria | 2935703347 | 2935709151 | 301 |
| 864 | iso_pu_bacteria | 2935713505 | 2935718731 | 301 |
| 865 | iso_pu_bacteria | 2935722832 | 2935728383 | 301 |
| 866 | iso_pu_bacteria | 2935732158 | 2935737020 | 301 |
| 867 | iso_pu_bacteria | 2935741537 | 2935745977 | 301 |
| 868 | iso_pu_bacteria | 2935750917 | 2935753238 | 301 |
| 869 | iso_pu_bacteria | 2935760218 | 2935766370 | 301 |
| 870 | iso_pu_bacteria | 2935769743 | 2935770238 | 301 |
| 871 | iso_pu_bacteria | 2935777560 | 2935777734 | 301 |
| 872 | iso_pu_bacteria | 2935785616 | 2935786709 | 301 |
| 873 | iso_pu_bacteria | 2935793552 | 2935794763 | 301 |
| 874 | iso_pu_bacteria | 2935801545 | 2935809050 | 301 |
| 875 | iso_pu_bacteria | 2935810662 | 2935813769 | 301 |
| 876 | iso_pu_bacteria | 2935819856 | 2935826591 | 301 |
| 877 | iso_pu_bacteria | 2935827899 | 2935832278 | 301 |
| 878 | iso_pu_bacteria | 2935837841 | 2935843983 | 301 |
| 879 | iso_pu_bacteria | 2935847175 | 2935851115 | 301 |
| 880 | iso_pu_bacteria | 2935855204 | 2935862774 | 301 |
| 881 | iso_pu_bacteria | 2935864058 | 2935864517 | 301 |
| 882 | iso_pu_bacteria | 2935873716 | 2935875131 | 301 |
| 883 | iso_pu_bacteria | 2935883170 | 2935887291 | 301 |
| 884 | iso_pu_bacteria | 2935908558 | 2935913165 | 301 |
| 885 | iso_pu_bacteria | 2935916978 | 2935922587 | 301 |
| 886 | iso_pu_bacteria | 2935926038 | 2935930910 | 301 |
| 887 | iso_pu_bacteria | 2935934488 | 2935939756 | 301 |
| 888 | iso_pu_bacteria | 2935942939 | 2935946705 | 301 |
| 889 | iso_pu_bacteria | 2935951376 | 2935956094 | 301 |
| 890 | iso_pu_bacteria | 2935959822 | 2935964999 | 301 |
| 891 | iso_pu_bacteria | 2935967501 | 2935972887 | 301 |
| 892 | iso_pu_bacteria | 2935975950 | 2935978198 | 301 |
| 893 | iso_pu_bacteria | 2935984226 | 2935985678 | 301 |
| 894 | iso_pu_bacteria | 2935992306 | 2935999250 | 301 |
| 895 | iso_pu_bacteria | 2936002035 | 2936005805 | 301 |
| 896 | iso_pu_bacteria | 2936011229 | 2936012045 | 301 |
| 897 | iso_pu_bacteria | 2936019824 | 2936020874 | 301 |
| 898 | iso_pu_bacteria | 2936028420 | 2936029338 | 301 |
| 899 | iso_pu_bacteria | 2936037263 | 2936039325 | 301 |
| 900 | iso_pu_bacteria | 2936046547 | 2936048338 | 301 |
| 901 | iso_pu_bacteria | 2936055302 | 2936056551 | 301 |
| 902 | iso_pu_bacteria | 2940556831 | 2940559151 | 301 |
| 903 | iso_pu_bacteria | 2941507105 | 2941508511 | 301 |
| 904 | iso_pu_bacteria | 2941515067 | 2941516341 | 301 |
| 905 | iso_pu_bacteria | 2941523033 | 2941524643 | 301 |
| 906 | iso_pu_bacteria | 2941531003 | 2941534564 | 301 |
| 907 | iso_pu_bacteria | 2941538514 | 2941541846 | 301 |
| 908 | iso_pu_bacteria | 3005474847 | 3005475826 | 301 |
| 909 | iso_pu_bacteria | 3005483717 | 3005491096 | 301 |
| 910 | iso_pu_bacteria | 3005506211 | 3005510937 | 301 |
| 911 | iso_pu_bacteria | 3005587118 | 3005592149 | 301 |
| 912 | iso_pu_bacteria | 3005594810 | 3005595898 | 301 |
| 913 | iso_pu_bacteria | 3005710791 | 3005711836 | 301 |
| 914 | iso_pu_bacteria | 3005718088 | 3005719093 | 301 |
| 915 | iso_pu_bacteria | 8006926726 | 8006929736 | 301 |
| 916 | iso_pu_bacteria | 8006933436 | 8006937144 | 301 |
| 917 | iso_pu_bacteria | 8006964411 | 8006966295 | 301 |
| 918 | iso_pu_bacteria | 8006973647 | 8006977154 | 301 |
| 919 | iso_pu_bacteria | 8006984368 | 8006993099 | 301 |
| 920 | iso_pu_bacteria | 8006994254 | 8006996962 | 301 |
| 921 | iso_pu_bacteria | 8016511872 | 8016517236 | 301 |
| 922 | iso_pu_bacteria | 8016530956 | 8016532084 | 301 |
| 923 | iso_pu_bacteria | 8016539877 | 8016545298 | 301 |
| 924 | iso_pu_bacteria | 8016548790 | 8016556791 | 301 |
| 925 | iso_pu_bacteria | 8016566248 | 8016570379 | 301 |
| 926 | iso_pu_bacteria | 8016575299 | 8016582919 | 301 |
| 927 | iso_pu_bacteria | 8016583857 | 8016585382 | 301 |
| 928 | iso_pu_bacteria | 8016595262 | 8016602793 | 301 |
| 929 | iso_pu_bacteria | 8016603502 | 8016605655 | 301 |
| 930 | iso_pu_bacteria | 8016613128 | 8016617569 | 301 |
| 931 | iso_pu_bacteria | 8016622563 | 8016624002 | 301 |
| 932 | iso_pu_bacteria | 8016630954 | 8016634860 | 301 |
| 933 | iso_pu_bacteria | 8017057580 | 8017059357 | 301 |
| 934 | iso_pu_bacteria | 8019530166 | 8019531902 | 301 |
| 935 | iso_pu_bacteria | 8019538911 | 8019539631 | 301 |
| 936 | iso_pu_bacteria | 8019547302 | 8019551027 | 301 |
| 937 | iso_pu_bacteria | 8019555841 | 8019561514 | 301 |
| 938 | iso_pu_bacteria | 8019565922 | 8019571591 | 301 |
| 939 | iso_pu_bacteria | 8019576017 | 8019576263 | 301 |
| 940 | iso_pu_bacteria | 8019586578 | 8019594142 | 301 |
| 941 | iso_pu_bacteria | 8019608314 | 8019611089 | 301 |
| 942 | iso_pu_bacteria | 8019619141 | 8019621937 | 301 |
| 943 | iso_pu_bacteria | 8019629233 | 8019631384 | 301 |
| 944 | iso_pu_bacteria | 8019638758 | 8019639229 | 301 |
| 945 | iso_pu_bacteria | 8019648815 | 8019651377 | 301 |
| 946 | iso_pu_bacteria | 8019659431 | 8019668191 | 301 |
| 947 | iso_pu_bacteria | 8019668869 | 8019677653 | 301 |
| 948 | iso_pu_bacteria | 8019687851 | 8019693271 | 301 |
| 949 | iso_pu_bacteria | 8055742211 | 8055743567 | 301 |
| 950 | iso_pu_bacteria | 8056673599 | 8056678149 | 301 |
| 951 | iso_pu_bacteria | 8056681323 | 8056681641 | 301 |
| 952 | iso_pu_bacteria | 8056689827 | 8056690804 | 301 |
| 953 | iso_pu_bacteria | 8056967851 | 8056974128 | 301 |
| 954 | 3300001979 | JGI24740J21852_10007574 | JGI24740J21852_100075742 | 302 |
| 955 | 3300005336 | Ga0070680_100163929 | Ga0070680_1001639292 | 302 |
| 956 | 3300005356 | Ga0070674_100169637 | Ga0070674_1001696371 | 302 |
| 957 | 3300005434 | Ga0070709_10012306 | Ga0070709_100123063 | 302 |
| 958 | 3300005436 | Ga0070713_100053233 | Ga0070713_1000532331 | 302 |
| 959 | 3300005439 | Ga0070711_100001524 | Ga0070711_1000015241 | 302 |
| 960 | 3300005455 | Ga0070663_100095518 | Ga0070663_1000955182 | 302 |
| 961 | 3300005539 | Ga0068853_100004793 | Ga0068853_1000047933 | 302 |
| 962 | 3300005563 | Ga0068855_100274591 | Ga0068855_1002745911 | 302 |
| 963 | 3300005578 | Ga0068854_100001788 | Ga0068854_1000017886 | 302 |
| 964 | 3300005614 | Ga0068856_100001074 | Ga0068856_1000010749 | 302 |
| 965 | 3300005616 | Ga0068852_100028969 | Ga0068852_1000289694 | 302 |
| 966 | 3300005834 | Ga0068851_10007723 | Ga0068851_100077232 | 302 |
| 967 | 3300005842 | Ga0068858_100136181 | Ga0068858_1001361812 | 302 |
| 968 | 3300005843 | Ga0068860_100517711 | Ga0068860_1005177112 | 302 |
| 969 | 3300009093 | Ga0105240_10011879 | Ga0105240_1001187912 | 302 |
| 970 | 3300009098 | Ga0105245_10430542 | Ga0105245_104305421 | 302 |
| 971 | 3300009174 | Ga0105241_10009922 | Ga0105241_100099223 | 302 |
| 972 | 3300009174 | Ga0105241_10208362 | Ga0105241_102083622 | 302 |
| 973 | 3300009545 | Ga0105237_10064354 | Ga0105237_100643544 | 302 |
| 974 | 3300009545 | Ga0105237_10075396 | Ga0105237_100753963 | 302 |
| 975 | 3300009545 | Ga0105237_10410049 | Ga0105237_104100492 | 302 |
| 976 | 3300009551 | Ga0105238_10004460 | Ga0105238_100044608 | 302 |
| 977 | 3300010375 | Ga0105239_10272337 | Ga0105239_102723372 | 302 |
| 978 | 3300013296 | Ga0157374_10286525 | Ga0157374_102865252 | 302 |
| 979 | 3300013306 | Ga0163162_10133390 | Ga0163162_101333902 | 302 |
| 980 | 3300014325 | Ga0163163_10003826 | Ga0163163_100038263 | 302 |
| 981 | 3300014968 | Ga0157379_10317833 | Ga0157379_103178332 | 302 |
| 982 | 3300021358 | Ga0213873_10017467 | Ga0213873_100174672 | 302 |
| 983 | 3300021384 | Ga0213876_10005309 | Ga0213876_100053096 | 302 |
| 984 | 3300025297 | Ga0209758_1005519 | Ga0209758_10055192 | 302 |
| 985 | 3300025321 | Ga0207656_10128202 | Ga0207656_101282021 | 302 |
| 986 | 3300025898 | Ga0207692_10021767 | Ga0207692_100217672 | 302 |
| 987 | 3300025900 | Ga0207710_10036010 | Ga0207710_100360102 | 302 |
| 988 | 3300025906 | Ga0207699_10028502 | Ga0207699_100285023 | 302 |
| 989 | 3300025911 | Ga0207654_10000201 | Ga0207654_1000020128 | 302 |
| 990 | 3300025911 | Ga0207654_10149180 | Ga0207654_101491802 | 302 |
| 991 | 3300025912 | Ga0207707_10129917 | Ga0207707_101299172 | 302 |
| 992 | 3300025913 | Ga0207695_10000343 | Ga0207695_100003439 | 302 |
| 993 | 3300025914 | Ga0207671_10025913 | Ga0207671_100259133 | 302 |
| 994 | 3300025914 | Ga0207671_10286383 | Ga0207671_102863832 | 302 |
| 995 | 3300025916 | Ga0207663_10002134 | Ga0207663_100021343 | 302 |
| 996 | 3300025916 | Ga0207663_10066009 | Ga0207663_100660092 | 302 |
| 997 | 3300025924 | Ga0207694_10000339 | Ga0207694_1000033941 | 302 |
| 998 | 3300025936 | Ga0207670_10325970 | Ga0207670_103259702 | 302 |
| 999 | 3300025949 | Ga0207667_10008033 | Ga0207667_100080333 | 302 |
| 1000 | 3300026041 | Ga0207639_10017564 | Ga0207639_100175643 | 302 |
| 1001 | 3300026067 | Ga0207678_10136532 | Ga0207678_101365322 | 302 |
| 1002 | 3300026078 | Ga0207702_10000006 | Ga0207702_10000006276 | 302 |
| 1003 | 3300026116 | Ga0207674_10003146 | Ga0207674_1000314613 | 302 |
| 1004 | 3300026142 | Ga0207698_10002272 | Ga0207698_100022723 | 302 |
| 1005 | 3300031507 | Ga0307509_10152637 | Ga0307509_101526373 | 302 |
| 1006 | 3300031616 | Ga0307508_10213311 | Ga0307508_102133112 | 302 |
| 1007 | 3300031730 | Ga0307516_10005964 | Ga0307516_100059642 | 302 |
| 1008 | 3300031730 | Ga0307516_10062855 | Ga0307516_100628553 | 302 |
| 1009 | 3300033179 | Ga0307507_10014168 | Ga0307507_100141683 | 302 |
| 1010 | 3300033180 | Ga0307510_10268887 | Ga0307510_102688872 | 302 |
| 1011 | 3300037068 | Ga0373925_0025701 | Ga0373925_0025701_3169_4143 | 302 |
| 1012 | 3300038443 | Ga0395901_0214633 | Ga0395901_0214633_923_1897 | 302 |
| 1013 | 3300039437 | Ga0436365_0703944 | Ga0436365_0703944_6419_7393 | 302 |
| 1014 | 3300039447 | Ga0436361_0329418 | Ga0436361_0329418_83_1057 | 302 |
| 1015 | 3300039453 | Ga0436362_0675816 | Ga0436362_0675816_1241_2215 | 302 |
| 1016 | 3300041486 | Ga0451807_2628458 | Ga0451807_2628458_264_1238 | 302 |
| 1017 | 3300046557 | Ga0495622_0015444 | Ga0495622_0015444_176_1150 | 302 |
| 1018 | 3300046678 | Ga0495599_0039174 | Ga0495599_0039174_103_1077 | 302 |
| 1019 | 3300047472 | Ga0495686_0092528 | Ga0495686_0092528_182_1159 | 302 |
| 1020 | 3300048905 | Ga0496102_0038136 | Ga0496102_0038136_1129_2103 | 302 |
| 1021 | 3300048907 | Ga0496104_0032583 | Ga0496104_0032583_1358_2332 | 302 |
| 1022 | 3300048909 | Ga0496106_0004011 | Ga0496106_0004011_5812_6786 | 302 |
| 1023 | 3300048912 | Ga0496109_0016035 | Ga0496109_0016035_368_1342 | 302 |
| 1024 | 3300048913 | Ga0496110_0055397 | Ga0496110_0055397_1254_2228 | 302 |
| 1025 | 3300048915 | Ga0496112_0000029 | Ga0496112_0000029_30368_31342 | 302 |
| 1026 | 3300048915 | Ga0496112_0001958 | Ga0496112_0001958_13387_14361 | 302 |
| 1027 | 3300048920 | Ga0496117_0014848 | Ga0496117_0014848_4033_5007 | 302 |
| 1028 | 3300048921 | Ga0496118_0008353 | Ga0496118_0008353_8759_9733 | 302 |
| 1029 | 3300048921 | Ga0496118_0010319 | Ga0496118_0010319_4430_5404 | 302 |
| 1030 | 3300048922 | Ga0496119_0026140 | Ga0496119_0026140_209_1183 | 302 |
| 1031 | 3300048922 | Ga0496119_0116277 | Ga0496119_0116277_386_1360 | 302 |
| 1032 | 3300048924 | Ga0496121_0002294 | Ga0496121_0002294_14908_15882 | 302 |
| 1033 | 3300048924 | Ga0496121_0013124 | Ga0496121_0013124_4335_5309 | 302 |
| 1034 | 3300048927 | Ga0496124_0013819 | Ga0496124_0013819_541_1515 | 302 |
| 1035 | 3300048928 | Ga0496125_0105186 | Ga0496125_0105186_466_1440 | 302 |
| 1036 | 3300048929 | Ga0496126_0262385 | Ga0496126_0262385_215_1189 | 302 |
| 1037 | 3300049568 | Ga0501031_0023266 | Ga0501031_0023266_1504_2481 | 302 |
| 1038 | 3300049569 | Ga0501032_0072007 | Ga0501032_0072007_866_1843 | 302 |
| 1039 | 3300049570 | Ga0501033_0001342 | Ga0501033_0001342_11179_12156 | 302 |
| 1040 | 3300049573 | Ga0501037_0036094 | Ga0501037_0036094_308_1285 | 302 |
| 1041 | 3300049586 | Ga0501070_0128317 | Ga0501070_0128317_855_1832 | 302 |
| 1042 | 3300049822 | Ga0501035_0001311 | Ga0501035_0001311_19758_20735 | 302 |
| 1043 | 3300049822 | Ga0501035_0040499 | Ga0501035_0040499_344_1321 | 302 |
| 1044 | 3300049823 | Ga0501044_0043845 | Ga0501044_0043845_2505_3482 | 302 |
| 1045 | 3300050494 | nmdc:mga06z11_103762_c1 | nmdc:mga06z11_103762_c1_415_1389 | 302 |
| 1046 | 3300053098 | Ga0500650_0036809 | Ga0500650_0036809_1026_2000 | 302 |
| 1047 | 3300053130 | Ga0500642_0002669 | Ga0500642_0002669_124_1098 | 302 |
| 1048 | 3300053140 | Ga0500573_0041265 | Ga0500573_0041265_934_1908 | 302 |
| 1049 | 3300053154 | Ga0500619_057190 | Ga0500619_057190_134_1108 | 302 |
| 1050 | 3300053177 | Ga0500636_0035756 | Ga0500636_0035756_1951_2925 | 302 |
| 1051 | 3300053178 | Ga0500637_0083276 | Ga0500637_0083276_764_1738 | 302 |
| 1052 | 3300053735 | Ga0500596_001012 | Ga0500596_001012_2547_3521 | 302 |
| 1053 | 3300001989 | JGI24739J22299_10008847 | JGI24739J22299_100088473 | 303 |
| 1054 | 3300001990 | JGI24737J22298_10000804 | JGI24737J22298_100008042 | 303 |
| 1055 | 3300002067 | JGI24735J21928_10013308 | JGI24735J21928_100133082 | 303 |
| 1056 | 3300005327 | Ga0070658_10423658 | Ga0070658_104236581 | 303 |
| 1057 | 3300005434 | Ga0070709_10016795 | Ga0070709_100167952 | 303 |
| 1058 | 3300005543 | Ga0070672_100074667 | Ga0070672_1000746672 | 303 |
| 1059 | 3300005578 | Ga0068854_100001506 | Ga0068854_1000015066 | 303 |
| 1060 | 3300005843 | Ga0068860_100000837 | Ga0068860_1000008373 | 303 |
| 1061 | 3300005983 | Ga0081540_1022188 | Ga0081540_10221883 | 303 |
| 1062 | 3300006237 | Ga0097621_100156117 | Ga0097621_1001561172 | 303 |
| 1063 | 3300009093 | Ga0105240_10006068 | Ga0105240_100060686 | 303 |
| 1064 | 3300009101 | Ga0105247_10138362 | Ga0105247_101383622 | 303 |
| 1065 | 3300009551 | Ga0105238_10020882 | Ga0105238_100208826 | 303 |
| 1066 | 3300010375 | Ga0105239_10005955 | Ga0105239_100059553 | 303 |
| 1067 | 3300011119 | Ga0105246_10143818 | Ga0105246_101438182 | 303 |
| 1068 | 3300025904 | Ga0207647_10000764 | Ga0207647_1000076418 | 303 |
| 1069 | 3300025913 | Ga0207695_10017441 | Ga0207695_100174416 | 303 |
| 1070 | 3300025914 | Ga0207671_10079304 | Ga0207671_100793042 | 303 |
| 1071 | 3300025924 | Ga0207694_10032046 | Ga0207694_100320462 | 303 |
| 1072 | 3300025940 | Ga0207691_10239561 | Ga0207691_102395612 | 303 |
| 1073 | 3300025981 | Ga0207640_10031248 | Ga0207640_100312482 | 303 |
| 1074 | 3300026041 | Ga0207639_10015983 | Ga0207639_100159833 | 303 |
| 1075 | 3300026078 | Ga0207702_10005641 | Ga0207702_100056415 | 303 |
| 1076 | 3300026116 | Ga0207674_10002334 | Ga0207674_1000233415 | 303 |
| 1077 | 3300028381 | Ga0268264_10000194 | Ga0268264_10000194120 | 303 |
| 1078 | 3300031238 | Ga0265332_10030913 | Ga0265332_100309132 | 303 |
| 1079 | 3300031616 | Ga0307508_10204919 | Ga0307508_102049191 | 303 |
| 1080 | 3300031730 | Ga0307516_10009187 | Ga0307516_100091878 | 303 |
| 1081 | 3300031730 | Ga0307516_10159719 | Ga0307516_101597192 | 303 |
| 1082 | 3300033180 | Ga0307510_10006595 | Ga0307510_100065955 | 303 |
| 1083 | 3300035086 | Ga0373934_0072251 | Ga0373934_0072251_384_1358 | 303 |
| 1084 | 3300035111 | Ga0373923_0001907 | Ga0373923_0001907_2124_3098 | 303 |
| 1085 | 3300035113 | Ga0373936_0029637 | Ga0373936_0029637_756_1730 | 303 |
| 1086 | 3300035119 | Ga0373956_0004051 | Ga0373956_0004051_44_1018 | 303 |
| 1087 | 3300035120 | Ga0373957_0117227 | Ga0373957_0117227_76_1050 | 303 |
| 1088 | 3300035170 | Ga0373943_0002146 | Ga0373943_0002146_1611_2585 | 303 |
| 1089 | 3300035172 | Ga0373955_0007024 | Ga0373955_0007024_1250_2224 | 303 |
| 1090 | 3300035410 | Ga0373924_0001138 | Ga0373924_0001138_5624_6598 | 303 |
| 1091 | 3300035725 | Ga0373947_0001111 | Ga0373947_0001111_273_1247 | 303 |
| 1092 | 3300036401 | Ga0373937_0053961 | Ga0373937_0053961_754_1728 | 303 |
| 1093 | 3300037068 | Ga0373925_0019299 | Ga0373925_0019299_1540_2514 | 303 |
| 1094 | 3300037418 | Ga0395900_0001496 | Ga0395900_0001496_4035_5009 | 303 |
| 1095 | 3300037466 | Ga0395898_0018464 | Ga0395898_0018464_4266_5240 | 303 |
| 1096 | 3300038443 | Ga0395901_0278811 | Ga0395901_0278811_666_1640 | 303 |
| 1097 | 3300039450 | Ga0436363_0997155 | Ga0436363_0997155_1152_2126 | 303 |
| 1098 | 3300045976 | Ga0466967_0186823 | Ga0466967_0186823_521_1495 | 303 |
| 1099 | 3300046454 | Ga0495592_0067621 | Ga0495592_0067621_65_1039 | 303 |
| 1100 | 3300046455 | Ga0495603_0036309 | Ga0495603_0036309_85_1059 | 303 |
| 1101 | 3300046460 | Ga0495638_0006359 | Ga0495638_0006359_3756_4730 | 303 |
| 1102 | 3300046472 | Ga0495580_0026569 | Ga0495580_0026569_2017_2991 | 303 |
| 1103 | 3300046473 | Ga0495582_0140661 | Ga0495582_0140661_38_1012 | 303 |
| 1104 | 3300046475 | Ga0495639_0007581 | Ga0495639_0007581_1794_2768 | 303 |
| 1105 | 3300046476 | Ga0495662_0014956 | Ga0495662_0014956_1059_2033 | 303 |
| 1106 | 3300046477 | Ga0495664_0038308 | Ga0495664_0038308_423_1397 | 303 |
| 1107 | 3300046491 | Ga0495584_0042279 | Ga0495584_0042279_38_1012 | 303 |
| 1108 | 3300046507 | Ga0495606_0031891 | Ga0495606_0031891_1103_2077 | 303 |
| 1109 | 3300046517 | Ga0495630_0026354 | Ga0495630_0026354_410_1384 | 303 |
| 1110 | 3300046533 | Ga0495640_0007069 | Ga0495640_0007069_1454_2428 | 303 |
| 1111 | 3300046543 | Ga0495645_0038260 | Ga0495645_0038260_766_1740 | 303 |
| 1112 | 3300046642 | Ga0495634_0014131 | Ga0495634_0014131_4735_5709 | 303 |
| 1113 | 3300046663 | Ga0495635_0118597 | Ga0495635_0118597_74_1048 | 303 |
| 1114 | 3300046678 | Ga0495599_0124808 | Ga0495599_0124808_188_1162 | 303 |
| 1115 | 3300046680 | Ga0495646_0058243 | Ga0495646_0058243_95_1069 | 303 |
| 1116 | 3300046681 | Ga0495647_0010961 | Ga0495647_0010961_216_1190 | 303 |
| 1117 | 3300046689 | Ga0495613_0160730 | Ga0495613_0160730_186_1160 | 303 |
| 1118 | 3300047315 | Ga0495581_0038273 | Ga0495581_0038273_1772_2746 | 303 |
| 1119 | 3300047319 | Ga0495674_0003051 | Ga0495674_0003051_12185_13159 | 303 |
| 1120 | 3300047321 | Ga0495676_0058602 | Ga0495676_0058602_750_1724 | 303 |
| 1121 | 3300047471 | Ga0495684_0005571 | Ga0495684_0005571_7084_8058 | 303 |
| 1122 | 3300047472 | Ga0495686_0047246 | Ga0495686_0047246_1667_2641 | 303 |
| 1123 | 3300047472 | Ga0495686_0140550 | Ga0495686_0140550_132_1106 | 303 |
| 1124 | 3300047673 | Ga0495593_0135142 | Ga0495593_0135142_51_1025 | 303 |
| 1125 | 3300048913 | Ga0496110_0054384 | Ga0496110_0054384_552_1532 | 303 |
| 1126 | 3300048921 | Ga0496118_0019326 | Ga0496118_0019326_4238_5212 | 303 |
| 1127 | 3300048923 | Ga0496120_0106434 | Ga0496120_0106434_73_1047 | 303 |
| 1128 | 3300049570 | Ga0501033_0038402 | Ga0501033_0038402_2065_3042 | 303 |
| 1129 | 3300053077 | Ga0495601_0125553 | Ga0495601_0125553_657_1631 | 303 |
| 1130 | 3300053078 | Ga0495612_0008650 | Ga0495612_0008650_333_1307 | 303 |
| 1131 | 3300053087 | Ga0500643_000168 | Ga0500643_000168_45664_46638 | 303 |
| 1132 | 3300053103 | Ga0500555_001077 | Ga0500555_001077_113_1087 | 303 |
| 1133 | 3300053119 | Ga0500595_010866 | Ga0500595_010866_1115_2089 | 303 |
| 1134 | 3300053130 | Ga0500642_0004996 | Ga0500642_0004996_409_1383 | 303 |
| 1135 | 3300053139 | Ga0500568_0012641 | Ga0500568_0012641_2195_3169 | 303 |
| 1136 | 3300053158 | Ga0500627_0022311 | Ga0500627_0022311_929_1903 | 303 |
| 1137 | 3300005366 | Ga0070659_100051244 | Ga0070659_1000512443 | 304 |
| 1138 | 3300005434 | Ga0070709_10003906 | Ga0070709_100039068 | 304 |
| 1139 | 3300005435 | Ga0070714_100162185 | Ga0070714_1001621852 | 304 |
| 1140 | 3300005436 | Ga0070713_100396101 | Ga0070713_1003961011 | 304 |
| 1141 | 3300005437 | Ga0070710_10044041 | Ga0070710_100440413 | 304 |
| 1142 | 3300005439 | Ga0070711_100042930 | Ga0070711_1000429303 | 304 |
| 1143 | 3300005614 | Ga0068856_100334622 | Ga0068856_1003346222 | 304 |
| 1144 | 3300005842 | Ga0068858_100072648 | Ga0068858_1000726482 | 304 |
| 1145 | 3300005937 | Ga0081455_10026840 | Ga0081455_100268403 | 304 |
| 1146 | 3300005983 | Ga0081540_1021769 | Ga0081540_10217694 | 304 |
| 1147 | 3300006163 | Ga0070715_10117130 | Ga0070715_101171301 | 304 |
| 1148 | 3300006175 | Ga0070712_100002194 | Ga0070712_10000219412 | 304 |
| 1149 | 3300025297 | Ga0209758_1002550 | Ga0209758_10025502 | 304 |
| 1150 | 3300025905 | Ga0207685_10082822 | Ga0207685_100828222 | 304 |
| 1151 | 3300025906 | Ga0207699_10261047 | Ga0207699_102610472 | 304 |
| 1152 | 3300025915 | Ga0207693_10001659 | Ga0207693_100016595 | 304 |
| 1153 | 3300025916 | Ga0207663_10231516 | Ga0207663_102315162 | 304 |
| 1154 | 3300025919 | Ga0207657_10038738 | Ga0207657_100387381 | 304 |
| 1155 | 3300025928 | Ga0207700_10169333 | Ga0207700_101693332 | 304 |
| 1156 | 3300025981 | Ga0207640_10111487 | Ga0207640_101114872 | 304 |
| 1157 | 3300026142 | Ga0207698_10068252 | Ga0207698_100682523 | 304 |
| 1158 | 3300031235 | Ga0265330_10040683 | Ga0265330_100406832 | 304 |
| 1159 | 3300031616 | Ga0307508_10000012 | Ga0307508_1000001263 | 304 |
| 1160 | 3300031712 | Ga0265342_10030921 | Ga0265342_100309212 | 304 |
| 1161 | 3300035695 | Ga0373927_0007812 | Ga0373927_0007812_3309_4283 | 304 |
| 1162 | 3300044735 | Ga0466968_0072252 | Ga0466968_0072252_439_1419 | 304 |
| 1163 | 3300045049 | Ga0466959_0013768 | Ga0466959_0013768_4370_5344 | 304 |
| 1164 | 3300046507 | Ga0495606_0001350 | Ga0495606_0001350_2193_3167 | 304 |
| 1165 | 3300046524 | Ga0495648_0004195 | Ga0495648_0004195_433_1407 | 304 |
| 1166 | 3300048909 | Ga0496106_0003366 | Ga0496106_0003366_5410_6384 | 304 |
| 1167 | 3300048910 | Ga0496107_0005653 | Ga0496107_0005653_3377_4351 | 304 |
| 1168 | 3300048911 | Ga0496108_0000891 | Ga0496108_0000891_1182_2156 | 304 |
| 1169 | 3300048914 | Ga0496111_0018373 | Ga0496111_0018373_2860_3834 | 304 |
| 1170 | 3300048915 | Ga0496112_0010230 | Ga0496112_0010230_1437_2411 | 304 |
| 1171 | 3300048916 | Ga0496113_0026554 | Ga0496113_0026554_1374_2348 | 304 |
| 1172 | 3300048924 | Ga0496121_0051307 | Ga0496121_0051307_494_1468 | 304 |
| 1173 | 3300048929 | Ga0496126_0052167 | Ga0496126_0052167_1999_2973 | 304 |
| 1174 | 3300049569 | Ga0501032_0014750 | Ga0501032_0014750_3082_4101 | 304 |
| 1175 | 3300049570 | Ga0501033_0056537 | Ga0501033_0056537_1094_2065 | 304 |
| 1176 | 3300049742 | Ga0501080_0191576 | Ga0501080_0191576_866_1837 | 304 |
| 1177 | 3300053092 | Ga0500583_0002232 | Ga0500583_0002232_2235_3209 | 304 |
| 1178 | 3300053094 | Ga0500566_0000191 | Ga0500566_0000191_18762_19736 | 304 |
| 1179 | 3300053095 | Ga0500640_002832 | Ga0500640_002832_3524_4498 | 304 |
| 1180 | 3300053111 | Ga0500572_000186 | Ga0500572_000186_2171_3145 | 304 |
| 1181 | 3300053122 | Ga0500608_000896 | Ga0500608_000896_91_1065 | 304 |
| 1182 | 3300053123 | Ga0500614_001636 | Ga0500614_001636_113_1087 | 304 |
| 1183 | 3300053136 | Ga0500559_0022199 | Ga0500559_0022199_636_1610 | 304 |
| 1184 | 3300053142 | Ga0500577_0045769 | Ga0500577_0045769_591_1565 | 304 |
| 1185 | 3300053159 | Ga0500630_002217 | Ga0500630_002217_1292_2266 | 304 |
| 1186 | 3300053163 | Ga0500639_000031 | Ga0500639_000031_10615_11589 | 304 |
| 1187 | 3300053163 | Ga0500639_015280 | Ga0500639_015280_286_1257 | 304 |
| 1188 | 3300053725 | Ga0500576_092262 | Ga0500576_092262_254_1228 | 304 |
| 1189 | 3300000549 | LJQas_1005339 | LJQas_10053392 | 305 |
| 1190 | 3300005327 | Ga0070658_10079986 | Ga0070658_100799863 | 305 |
| 1191 | 3300005434 | Ga0070709_10037413 | Ga0070709_100374131 | 305 |
| 1192 | 3300005436 | Ga0070713_100334865 | Ga0070713_1003348652 | 305 |
| 1193 | 3300005437 | Ga0070710_10002918 | Ga0070710_100029184 | 305 |
| 1194 | 3300005616 | Ga0068852_100537531 | Ga0068852_1005375312 | 305 |
| 1195 | 3300006038 | Ga0075365_10040274 | Ga0075365_100402743 | 305 |
| 1196 | 3300006051 | Ga0075364_10074775 | Ga0075364_100747752 | 305 |
| 1197 | 3300006186 | Ga0075369_10116658 | Ga0075369_101166581 | 305 |
| 1198 | 3300007265 | Ga0099794_10003243 | Ga0099794_100032433 | 305 |
| 1199 | 3300007788 | Ga0099795_10044008 | Ga0099795_100440082 | 305 |
| 1200 | 3300009093 | Ga0105240_10193225 | Ga0105240_101932252 | 305 |
| 1201 | 3300021384 | Ga0213876_10114675 | Ga0213876_101146752 | 305 |
| 1202 | 3300025253 | Ga0209677_100388 | Ga0209677_10038810 | 305 |
| 1203 | 3300025261 | Ga0209233_1005842 | Ga0209233_10058422 | 305 |
| 1204 | 3300025272 | Ga0209455_1001976 | Ga0209455_10019766 | 305 |
| 1205 | 3300025272 | Ga0209455_1004752 | Ga0209455_10047522 | 305 |
| 1206 | 3300025295 | Ga0209564_1000477 | Ga0209564_100047717 | 305 |
| 1207 | 3300025295 | Ga0209564_1008490 | Ga0209564_10084904 | 305 |
| 1208 | 3300025898 | Ga0207692_10000717 | Ga0207692_100007172 | 305 |
| 1209 | 3300025906 | Ga0207699_10000122 | Ga0207699_1000012235 | 305 |
| 1210 | 3300025909 | Ga0207705_10051762 | Ga0207705_100517623 | 305 |
| 1211 | 3300025913 | Ga0207695_10165737 | Ga0207695_101657372 | 305 |
| 1212 | 3300025914 | Ga0207671_10110224 | Ga0207671_101102241 | 305 |
| 1213 | 3300025915 | Ga0207693_10167364 | Ga0207693_101673642 | 305 |
| 1214 | 3300025928 | Ga0207700_10292764 | Ga0207700_102927642 | 305 |
| 1215 | 3300025929 | Ga0207664_10020719 | Ga0207664_100207192 | 305 |
| 1216 | 3300025929 | Ga0207664_10330991 | Ga0207664_103309912 | 305 |
| 1217 | 3300025939 | Ga0207665_10003747 | Ga0207665_100037473 | 305 |
| 1218 | 3300028556 | Ga0265337_1002558 | Ga0265337_10025582 | 305 |
| 1219 | 3300028558 | Ga0265326_10002652 | Ga0265326_100026522 | 305 |
| 1220 | 3300028563 | Ga0265319_1003402 | Ga0265319_10034022 | 305 |
| 1221 | 3300028573 | Ga0265334_10001143 | Ga0265334_100011432 | 305 |
| 1222 | 3300028653 | Ga0265323_10000720 | Ga0265323_1000072015 | 305 |
| 1223 | 3300028666 | Ga0265336_10000640 | Ga0265336_100006405 | 305 |
| 1224 | 3300028794 | Ga0307515_10179532 | Ga0307515_101795322 | 305 |
| 1225 | 3300028800 | Ga0265338_10001434 | Ga0265338_1000143438 | 305 |
| 1226 | 3300031456 | Ga0307513_10311219 | Ga0307513_103112191 | 305 |
| 1227 | 3300033180 | Ga0307510_10022895 | Ga0307510_100228955 | 305 |
| 1228 | 3300035111 | Ga0373923_0004211 | Ga0373923_0004211_3621_4595 | 305 |
| 1229 | 3300035117 | Ga0373953_0013110 | Ga0373953_0013110_32_1006 | 305 |
| 1230 | 3300035118 | Ga0373954_0026816 | Ga0373954_0026816_804_1778 | 305 |
| 1231 | 3300035119 | Ga0373956_0033451 | Ga0373956_0033451_153_1127 | 305 |
| 1232 | 3300035120 | Ga0373957_0002595 | Ga0373957_0002595_1531_2505 | 305 |
| 1233 | 3300035172 | Ga0373955_0001659 | Ga0373955_0001659_7915_8889 | 305 |
| 1234 | 3300035172 | Ga0373955_0005485 | Ga0373955_0005485_4501_5484 | 305 |
| 1235 | 3300035410 | Ga0373924_0008500 | Ga0373924_0008500_659_1633 | 305 |
| 1236 | 3300035410 | Ga0373924_0012615 | Ga0373924_0012615_1280_2263 | 305 |
| 1237 | 3300035692 | Ga0373935_0002054 | Ga0373935_0002054_7959_8942 | 305 |
| 1238 | 3300035695 | Ga0373927_0000634 | Ga0373927_0000634_11258_12241 | 305 |
| 1239 | 3300035724 | Ga0373933_0079211 | Ga0373933_0079211_620_1594 | 305 |
| 1240 | 3300035725 | Ga0373947_0006400 | Ga0373947_0006400_1608_2591 | 305 |
| 1241 | 3300036401 | Ga0373937_0016133 | Ga0373937_0016133_4504_5478 | 305 |
| 1242 | 3300036401 | Ga0373937_0018898 | Ga0373937_0018898_242_1225 | 305 |
| 1243 | 3300037068 | Ga0373925_0001281 | Ga0373925_0001281_3818_4801 | 305 |
| 1244 | 3300037466 | Ga0395898_0132794 | Ga0395898_0132794_470_1444 | 305 |
| 1245 | 3300037471 | Ga0395905_0444911 | Ga0395905_0444911_152_1126 | 305 |
| 1246 | 3300038443 | Ga0395901_0139954 | Ga0395901_0139954_264_1238 | 305 |
| 1247 | 3300038443 | Ga0395901_0209917 | Ga0395901_0209917_941_1915 | 305 |
| 1248 | 3300039437 | Ga0436365_1704823 | Ga0436365_1704823_1330_2304 | 305 |
| 1249 | 3300039447 | Ga0436361_0911334 | Ga0436361_0911334_394_1368 | 305 |
| 1250 | 3300045976 | Ga0466967_0015018 | Ga0466967_0015018_4368_5342 | 305 |
| 1251 | 3300046454 | Ga0495592_0004059 | Ga0495592_0004059_1193_2167 | 305 |
| 1252 | 3300046454 | Ga0495592_0020450 | Ga0495592_0020450_2184_3167 | 305 |
| 1253 | 3300046455 | Ga0495603_0000036 | Ga0495603_0000036_25699_26682 | 305 |
| 1254 | 3300046459 | Ga0495629_0000148 | Ga0495629_0000148_34844_35827 | 305 |
| 1255 | 3300046459 | Ga0495629_0000331 | Ga0495629_0000331_27798_28772 | 305 |
| 1256 | 3300046460 | Ga0495638_0049174 | Ga0495638_0049174_217_1191 | 305 |
| 1257 | 3300046461 | Ga0495641_0006132 | Ga0495641_0006132_4958_5941 | 305 |
| 1258 | 3300046462 | Ga0495651_0012599 | Ga0495651_0012599_418_1392 | 305 |
| 1259 | 3300046463 | Ga0495653_0006476 | Ga0495653_0006476_8607_9581 | 305 |
| 1260 | 3300046472 | Ga0495580_0001864 | Ga0495580_0001864_15967_16950 | 305 |
| 1261 | 3300046473 | Ga0495582_0000191 | Ga0495582_0000191_23503_24486 | 305 |
| 1262 | 3300046474 | Ga0495605_0114940 | Ga0495605_0114940_34_1008 | 305 |
| 1263 | 3300046475 | Ga0495639_0000209 | Ga0495639_0000209_10940_11923 | 305 |
| 1264 | 3300046476 | Ga0495662_0000787 | Ga0495662_0000787_2080_3063 | 305 |
| 1265 | 3300046477 | Ga0495664_0010510 | Ga0495664_0010510_2410_3393 | 305 |
| 1266 | 3300046499 | Ga0495594_0001199 | Ga0495594_0001199_718_1701 | 305 |
| 1267 | 3300046501 | Ga0495607_0045280 | Ga0495607_0045280_168_1142 | 305 |
| 1268 | 3300046511 | Ga0495608_0000988 | Ga0495608_0000988_2585_3559 | 305 |
| 1269 | 3300046513 | Ga0495616_0033075 | Ga0495616_0033075_1268_2242 | 305 |
| 1270 | 3300046515 | Ga0495620_0062114 | Ga0495620_0062114_390_1364 | 305 |
| 1271 | 3300046516 | Ga0495628_0020271 | Ga0495628_0020271_491_1474 | 305 |
| 1272 | 3300046516 | Ga0495628_0099374 | Ga0495628_0099374_356_1330 | 305 |
| 1273 | 3300046517 | Ga0495630_0052952 | Ga0495630_0052952_317_1300 | 305 |
| 1274 | 3300046518 | Ga0495631_0053301 | Ga0495631_0053301_145_1119 | 305 |
| 1275 | 3300046522 | Ga0495643_0024248 | Ga0495643_0024248_396_1370 | 305 |
| 1276 | 3300046529 | Ga0495652_0048650 | Ga0495652_0048650_418_1392 | 305 |
| 1277 | 3300046529 | Ga0495652_0082236 | Ga0495652_0082236_1538_2521 | 305 |
| 1278 | 3300046530 | Ga0495654_0012515 | Ga0495654_0012515_807_1781 | 305 |
| 1279 | 3300046531 | Ga0495665_0000118 | Ga0495665_0000118_35018_36001 | 305 |
| 1280 | 3300046533 | Ga0495640_0000577 | Ga0495640_0000577_6702_7685 | 305 |
| 1281 | 3300046533 | Ga0495640_0007374 | Ga0495640_0007374_5420_6394 | 305 |
| 1282 | 3300046536 | Ga0495587_0028191 | Ga0495587_0028191_1039_2013 | 305 |
| 1283 | 3300046543 | Ga0495645_0006263 | Ga0495645_0006263_2059_3033 | 305 |
| 1284 | 3300046557 | Ga0495622_0011977 | Ga0495622_0011977_2391_3365 | 305 |
| 1285 | 3300046557 | Ga0495622_0018516 | Ga0495622_0018516_946_1929 | 305 |
| 1286 | 3300046559 | Ga0495667_0002269 | Ga0495667_0002269_5964_6938 | 305 |
| 1287 | 3300046642 | Ga0495634_0007487 | Ga0495634_0007487_2104_3087 | 305 |
| 1288 | 3300046660 | Ga0495625_0034285 | Ga0495625_0034285_2013_2987 | 305 |
| 1289 | 3300046663 | Ga0495635_0000434 | Ga0495635_0000434_17733_18707 | 305 |
| 1290 | 3300046663 | Ga0495635_0008844 | Ga0495635_0008844_986_1969 | 305 |
| 1291 | 3300046675 | Ga0495657_0021545 | Ga0495657_0021545_1193_2167 | 305 |
| 1292 | 3300046675 | Ga0495657_0055579 | Ga0495657_0055579_1147_2130 | 305 |
| 1293 | 3300046678 | Ga0495599_0122482 | Ga0495599_0122482_23_997 | 305 |
| 1294 | 3300046679 | Ga0495623_0085377 | Ga0495623_0085377_635_1609 | 305 |
| 1295 | 3300046680 | Ga0495646_0009025 | Ga0495646_0009025_1770_2744 | 305 |
| 1296 | 3300046680 | Ga0495646_0022821 | Ga0495646_0022821_1748_2731 | 305 |
| 1297 | 3300046681 | Ga0495647_0001407 | Ga0495647_0001407_4845_5828 | 305 |
| 1298 | 3300046683 | Ga0495658_0000703 | Ga0495658_0000703_16279_17262 | 305 |
| 1299 | 3300046689 | Ga0495613_0001856 | Ga0495613_0001856_11215_12198 | 305 |
| 1300 | 3300046689 | Ga0495613_0026316 | Ga0495613_0026316_1315_2289 | 305 |
| 1301 | 3300046690 | Ga0495624_0006594 | Ga0495624_0006594_2087_3070 | 305 |
| 1302 | 3300046691 | Ga0495670_0028737 | Ga0495670_0028737_1445_2419 | 305 |
| 1303 | 3300046809 | Ga0495600_0011288 | Ga0495600_0011288_1193_2167 | 305 |
| 1304 | 3300046809 | Ga0495600_0182838 | Ga0495600_0182838_115_1089 | 305 |
| 1305 | 3300047315 | Ga0495581_0000313 | Ga0495581_0000313_377_1360 | 305 |
| 1306 | 3300047317 | Ga0495604_0011366 | Ga0495604_0011366_4559_5533 | 305 |
| 1307 | 3300047319 | Ga0495674_0000443 | Ga0495674_0000443_5058_6041 | 305 |
| 1308 | 3300047319 | Ga0495674_0022928 | Ga0495674_0022928_4119_5093 | 305 |
| 1309 | 3300047320 | Ga0495672_0010289 | Ga0495672_0010289_3782_4759 | 305 |
| 1310 | 3300047322 | Ga0495680_0041645 | Ga0495680_0041645_2259_3233 | 305 |
| 1311 | 3300047323 | Ga0495683_0075237 | Ga0495683_0075237_239_1213 | 305 |
| 1312 | 3300047444 | Ga0495675_0063796 | Ga0495675_0063796_1334_2308 | 305 |
| 1313 | 3300047469 | Ga0495673_0011793 | Ga0495673_0011793_1396_2379 | 305 |
| 1314 | 3300047471 | Ga0495684_0000842 | Ga0495684_0000842_14880_15854 | 305 |
| 1315 | 3300047471 | Ga0495684_0039380 | Ga0495684_0039380_1894_2877 | 305 |
| 1316 | 3300047472 | Ga0495686_0004839 | Ga0495686_0004839_934_1908 | 305 |
| 1317 | 3300047673 | Ga0495593_0000039 | Ga0495593_0000039_25735_26718 | 305 |
| 1318 | 3300047673 | Ga0495593_0002371 | Ga0495593_0002371_2125_3099 | 305 |
| 1319 | 3300048088 | Ga0495602_0021472 | Ga0495602_0021472_748_1722 | 305 |
| 1320 | 3300048089 | Ga0495614_0042233 | Ga0495614_0042233_740_1723 | 305 |
| 1321 | 3300048919 | Ga0496116_0002462 | Ga0496116_0002462_1966_2940 | 305 |
| 1322 | 3300048920 | Ga0496117_0070520 | Ga0496117_0070520_620_1594 | 305 |
| 1323 | 3300048920 | Ga0496117_0082796 | Ga0496117_0082796_766_1740 | 305 |
| 1324 | 3300048921 | Ga0496118_0003033 | Ga0496118_0003033_11599_12573 | 305 |
| 1325 | 3300048921 | Ga0496118_0143091 | Ga0496118_0143091_14_988 | 305 |
| 1326 | 3300048921 | Ga0496118_0230413 | Ga0496118_0230413_72_1046 | 305 |
| 1327 | 3300048922 | Ga0496119_0036885 | Ga0496119_0036885_1330_2304 | 305 |
| 1328 | 3300048923 | Ga0496120_0011735 | Ga0496120_0011735_4511_5485 | 305 |
| 1329 | 3300048924 | Ga0496121_0021406 | Ga0496121_0021406_3601_4575 | 305 |
| 1330 | 3300048924 | Ga0496121_0051853 | Ga0496121_0051853_2413_3387 | 305 |
| 1331 | 3300048924 | Ga0496121_0064894 | Ga0496121_0064894_1059_2033 | 305 |
| 1332 | 3300048924 | Ga0496121_0133331 | Ga0496121_0133331_622_1596 | 305 |
| 1333 | 3300048925 | Ga0496122_0108857 | Ga0496122_0108857_680_1654 | 305 |
| 1334 | 3300048928 | Ga0496125_0010748 | Ga0496125_0010748_7189_8163 | 305 |
| 1335 | 3300048928 | Ga0496125_0062913 | Ga0496125_0062913_409_1383 | 305 |
| 1336 | 3300048928 | Ga0496125_0098173 | Ga0496125_0098173_961_1935 | 305 |
| 1337 | 3300048929 | Ga0496126_0022314 | Ga0496126_0022314_2502_3476 | 305 |
| 1338 | 3300048929 | Ga0496126_0182054 | Ga0496126_0182054_540_1514 | 305 |
| 1339 | 3300048929 | Ga0496126_0217044 | Ga0496126_0217044_465_1439 | 305 |
| 1340 | 3300049570 | Ga0501033_0205260 | Ga0501033_0205260_165_1139 | 305 |
| 1341 | 3300049571 | Ga0501034_0032366 | Ga0501034_0032366_2444_3421 | 305 |
| 1342 | 3300049581 | Ga0501047_0282564 | Ga0501047_0282564_110_1084 | 305 |
| 1343 | 3300049822 | Ga0501035_0096777 | Ga0501035_0096777_984_1958 | 305 |
| 1344 | 3300049823 | Ga0501044_0168165 | Ga0501044_0168165_747_1718 | 305 |
| 1345 | 3300049823 | Ga0501044_0326674 | Ga0501044_0326674_29_1003 | 305 |
| 1346 | 3300049823 | Ga0501044_0329376 | Ga0501044_0329376_404_1378 | 305 |
| 1347 | 3300050492 | nmdc:mga0yw44_33722_c1 | nmdc:mga0yw44_33722_c1_177_1151 | 305 |
| 1348 | 3300053077 | Ga0495601_0055598 | Ga0495601_0055598_875_1849 | 305 |
| 1349 | 3300053078 | Ga0495612_0017970 | Ga0495612_0017970_707_1681 | 305 |
| 1350 | 3300053080 | Ga0500635_0002159 | Ga0500635_0002159_2973_3947 | 305 |
| 1351 | 3300053084 | Ga0495595_0000869 | Ga0495595_0000869_4624_5598 | 305 |
| 1352 | 3300053085 | Ga0495619_0000617 | Ga0495619_0000617_620_1594 | 305 |
| 1353 | 3300053087 | Ga0500643_012952 | Ga0500643_012952_1710_2684 | 305 |
| 1354 | 3300053093 | Ga0500651_0088282 | Ga0500651_0088282_355_1329 | 305 |
| 1355 | 3300053094 | Ga0500566_0011660 | Ga0500566_0011660_3289_4263 | 305 |
| 1356 | 3300053096 | Ga0500641_0007929 | Ga0500641_0007929_2527_3501 | 305 |
| 1357 | 3300053098 | Ga0500650_0005221 | Ga0500650_0005221_348_1322 | 305 |
| 1358 | 3300053104 | Ga0500556_0000047 | Ga0500556_0000047_26423_27397 | 305 |
| 1359 | 3300053111 | Ga0500572_000153 | Ga0500572_000153_14661_15635 | 305 |
| 1360 | 3300053116 | Ga0500592_010161 | Ga0500592_010161_155_1129 | 305 |
| 1361 | 3300053122 | Ga0500608_000229 | Ga0500608_000229_9135_10109 | 305 |
| 1362 | 3300053130 | Ga0500642_0000142 | Ga0500642_0000142_21649_22623 | 305 |
| 1363 | 3300053131 | Ga0500652_001091 | Ga0500652_001091_4212_5186 | 305 |
| 1364 | 3300053136 | Ga0500559_0000105 | Ga0500559_0000105_11927_12901 | 305 |
| 1365 | 3300053136 | Ga0500559_0001758 | Ga0500559_0001758_6785_7759 | 305 |
| 1366 | 3300053139 | Ga0500568_0004453 | Ga0500568_0004453_25_999 | 305 |
| 1367 | 3300053142 | Ga0500577_0039956 | Ga0500577_0039956_365_1339 | 305 |
| 1368 | 3300053150 | Ga0500603_002116 | Ga0500603_002116_2057_3031 | 305 |
| 1369 | 3300053153 | Ga0500616_0000784 | Ga0500616_0000784_9068_10042 | 305 |
| 1370 | 3300053154 | Ga0500619_033075 | Ga0500619_033075_263_1237 | 305 |
| 1371 | 3300053156 | Ga0500622_0005469 | Ga0500622_0005469_3001_3975 | 305 |
| 1372 | 3300053163 | Ga0500639_044784 | Ga0500639_044784_112_1086 | 305 |
| 1373 | 3300053177 | Ga0500636_0003222 | Ga0500636_0003222_7143_8117 | 305 |
| 1374 | 3300053178 | Ga0500637_0000519 | Ga0500637_0000519_8152_9126 | 305 |
| 1375 | 3300053178 | Ga0500637_0005808 | Ga0500637_0005808_4337_5311 | 305 |
| 1376 | 3300053178 | Ga0500637_0025159 | Ga0500637_0025159_1371_2345 | 305 |
| 1377 | 3300053730 | Ga0500645_009851 | Ga0500645_009851_1389_2363 | 305 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2vmb-assembly2.cif.gz_B | the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae | 0.8058 | 159 | 272 |
| 5nbg-assembly1.cif.gz_B | structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system | 0.7991 | 159 | 269 |
| 5nbg-assembly1.cif.gz_B | structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system | 0.7739 | 159 | 269 |
| 2vmb-assembly2.cif.gz_B | the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae | 0.7515 | 159 | 272 |
| 2ezk-assembly1.cif.gz_A | solution nmr structure of the ibeta subdomain of the mu end dna binding domain of phage mu transposase, regularized mean structure | 0.5177 | 155 | 226 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O69625_45_175_1.20.81.30 | Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F | 0.7131 | 166 | 288 | 1.20.81.30 |
| af_O69625_45_175_1.20.81.30 | Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F | 0.6704 | 166 | 288 | 1.20.81.30 |
| 2ezkA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.5177 | 155 | 226 | 1.10.10.60 |
| af_Q9BIC4_29_113_1.10.225.10 | Mainly Alpha;Orthogonal Bundle;NK-Lysin;Saposin-like | 0.494 | 157 | 225 | 1.10.225.10 |
| af_Q9BIC4_29_113_1.10.225.10 | Mainly Alpha;Orthogonal Bundle;NK-Lysin;Saposin-like | 0.4044 | 157 | 225 | 1.10.225.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529HLZ7-F1-model_v4 | Type II secretion system F family protein | 0.922 | 122 | 243 |
GO:0005886
|
| AF-A0A529Q458-F1-model_v4 | Type II secretion system F family protein | 0.9134 | 122 | 258 |
GO:0005886
|
| AF-A0A529ZM01-F1-model_v4 | Type II secretion system F family protein | 0.8963 | 43 | 224 |
GO:0016020
|
| AF-A0A5R2N1Y6-F1-model_v4 | Type II secretion system F family protein | 0.885 | 145 | 284 |
GO:0005886
|
| AF-A0A529Q458-F1-model_v4 | Type II secretion system F family protein | 0.8715 | 122 | 258 |
GO:0005886
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar