F493489

General Info

Members Datasets Scaffolds Average Seq Length
1377 674 1153 304

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0029657|Ga0496105_0029657_1225_2349
Length 350
Sequence MVEFLVSKLHDVRFMTMLLAAIAASATVYTLVMPLFAGEGLAKRMKAVASEKQVVSRVVEDFNLTKWLAQEAARDKLIMAGYRGQAPYITFLFARMVAPLVLFVGSIIYVFLIAHMQQSMPIKIGICIGAAYLGLQAPMLFLKNAISKRQLSIKRAFPDALDLLLICIESGMSVEMAFRKVATEIVGQSIALSEEFTLTTAELSYLQDRKVAYENLARRTGLEGVKSVCLALQQAERYGTPLGHSLRVMAQENRDMRMNEAEKKAAALPPKLTVPMILFFLPVLFVVILGPTGIKISELQLLLDADRARSAGSFRIARSGSDQSGWLSEATGVRFGAPRGASLRLSISLR

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
6 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
7 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
8 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
9 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
10 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
15 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
16 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
17 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
18 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
19 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
20 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
21 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
22 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
23 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
24 2643221651 Afipia sp. Root123D2 Isolate Unclassified
25 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
26 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
27 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
28 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
29 2791355199
30 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
31 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
32 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
33 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
34 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
35 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
36 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
37 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
38 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
39 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
40 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
41 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
42 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
43 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
44 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
45 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
46 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
47 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
48 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
49 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
50 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
51 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
52 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
53 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
54 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
55 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
56 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
57 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
58 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
59 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
60 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
61 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
62 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
63 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
64 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
65 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
66 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
67 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
68 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
69 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
70 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
71 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
72 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
73 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
74 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
75 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
76 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
77 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
78 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
79 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
80 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
81 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
82 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
83 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
84 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
85 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
86 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
87 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
88 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
89 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
90 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
91 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
92 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
93 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
94 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
95 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
96 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
97 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
98 2904699407
99 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
100 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
101 2906610324
102 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
103 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
104 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
105 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
106 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
107 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
108 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
109 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
110 2922368715
111 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
112 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
113 2922425934
114 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
115 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
116 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
117 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
118 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
119 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
120 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
121 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
122 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
123 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
124 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
125 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
126 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
127 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
128 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
129 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
130 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
131 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
132 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
133 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
134 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
135 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
136 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
137 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
138 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
139 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
140 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
141 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
142 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
143 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
144 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
145 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
146 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
147 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
148 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
149 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
150 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
151 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
152 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
153 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
154 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
155 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
156 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
157 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
158 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
159 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
160 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
161 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
162 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
163 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
164 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
165 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
166 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
167 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
168 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
169 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
170 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
171 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
172 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
173 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
174 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
175 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
176 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
177 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
178 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
179 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
180 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
181 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
182 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
183 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
184 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
185 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
186 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
187 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
188 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
189 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
190 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
191 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
192 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
193 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
194 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
195 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
196 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
197 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
198 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
199 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
200 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
201 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
202 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
203 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
204 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
205 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
206 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
207 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
208 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
209 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
210 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
211 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
212 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
213 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
214 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
215 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
216 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
217 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
218 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
219 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
220 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
221 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
222 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
223 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
224 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
225 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
226 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
227 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
228 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
229 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
230 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
231 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
232 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
233 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
234 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
235 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
236 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
237 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
238 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
239 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
240 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
241 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
242 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
243 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
244 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
245 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
246 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
247 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
248 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
249 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
250 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
251 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
252 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
253 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
254 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
255 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
256 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
257 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
258 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
259 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
260 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
261 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
262 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
263 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
264 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
265 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
266 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
267 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
268 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
269 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
270 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
271 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
272 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
273 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
274 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
275 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
276 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
277 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
278 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
279 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
280 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
281 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
282 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
283 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
284 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
285 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
286 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
287 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
288 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
289 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
290 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
291 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
292 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
293 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
294 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
295 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
296 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
297 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
298 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
299 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
300 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
301 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
302 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
303 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
304 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
305 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
307 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
308 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
309 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
310 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
311 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
312 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
313 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
314 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
373 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
374 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
375 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
376 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
381 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
382 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
383 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
384 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
385 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
386 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
387 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
388 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
389 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
390 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
391 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
392 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
393 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
394 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
395 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
396 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
397 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
398 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
399 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
400 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
401 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
402 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
403 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
404 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
405 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
406 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
407 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
408 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
409 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
410 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
411 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
412 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
413 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
414 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
415 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
416 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
417 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
418 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
419 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
420 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
421 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
422 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
423 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
424 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
425 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
426 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
427 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
428 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
429 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
430 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
431 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
432 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
433 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
434 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
435 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
436 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
437 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
438 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
439 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
440 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
441 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
442 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
443 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
444 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
445 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
446 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
447 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
448 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
449 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
450 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
451 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
452 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
453 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
454 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
455 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
456 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
457 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
458 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
459 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
460 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
461 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
462 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
463 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
464 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
465 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
466 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
467 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
468 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
469 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
470 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
471 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
472 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
473 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
474 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
475 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
476 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
477 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
478 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
479 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
480 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
481 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
482 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
483 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
484 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
485 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
486 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
487 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
488 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
489 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
490 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
491 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
492 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
493 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
494 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
495 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
496 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
497 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
498 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
499 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
500 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
501 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
502 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
503 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
504 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
505 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
506 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
507 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
508 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
509 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
510 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
511 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
512 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
513 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
514 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
515 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
516 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
517 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
518 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
519 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
520 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
521 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
522 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
523 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
524 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
525 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
526 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
527 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
528 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
529 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
530 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
531 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
532 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
533 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
534 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
535 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
536 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
537 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
538 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
539 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
540 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
541 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
542 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
543 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
544 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
545 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
546 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
547 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
548 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
549 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
550 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
551 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
552 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
553 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
554 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
555 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
556 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
557 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
558 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
559 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
560 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
561 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
562 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
563 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
564 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
565 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
566 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
567 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
568 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
569 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
570 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
571 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
572 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
573 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
574 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
575 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
576 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
577 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
578 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
579 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
580 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
581 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
582 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
583 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
584 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
585 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
586 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
587 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
588 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
589 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
590 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
591 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
592 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
593 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
594 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
595 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
596 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
597 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
598 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
599 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
600 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
601 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
602 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
603 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
604 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
605 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
606 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
607 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
608 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
609 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
610 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
611 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
612 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
613 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
614 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
615 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
616 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
617 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
618 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
619 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
620 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
621 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
622 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
623 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
624 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
625 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
626 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
627 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
628 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
629 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
630 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
631 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
632 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
633 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
634 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
635 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
636 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
637 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
638 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
639 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
640 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
641 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
642 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
643 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
644 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
645 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
646 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
647 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
648 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
649 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
650 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
651 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
652 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
653 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
654 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
655 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
656 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
657 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
658 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
659 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
660 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
661 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
662 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
663 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
664 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
665 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
666 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
667 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
668 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
669 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
670 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
671 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
672 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
673 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
674 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.04
Metatranscriptomes 0
Isolates 15.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.97
Nodule 12.42
Rhizoplane 5.45
Rhizosphere 60.06
Stem 0
Stem Tuber 0
Unclassified 11.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1005339 3300000549 Bacteria 1636
2 JGI24740J21852_10007574 3300001979 Bacteria 4399
3 JGI24739J22299_10008847 3300001989 Bacteria 3754
4 JGI24737J22298_10000804 3300001990 Bacteria 11129
5 JGI24735J21928_10013308 3300002067 Bacteria 2588
6 JGI24750J21931_1003837 3300002070 Bacteria 1809
7 JGI24742J22300_10002754 3300002244 Bacteria 2831
8 JGI25406J46586_10000012 3300003203 Bacteria 102438
9 JGI25165J46597_1004140 3300003214 Bacteria 3227
10 JGI25153J46596_10004406 3300003215 Bacteria 7599
11 JGI25153J46596_10005221 3300003215 Bacteria 6835
12 JGI25153J46596_10005329 3300003215 Bacteria 6758
13 JGI25153J46596_10010431 3300003215 Bacteria 4202
14 JGI25160J50197_1002246 3300003354 Bacteria 9074
15 JGI25404J52841_10007705 3300003659 Bacteria 2283
16 JGI25404J52841_10009784 3300003659 Bacteria 2055
17 Ga0055531_10002655 3300003794 Bacteria 11794
18 Ga0055543_1001363 3300004625 Bacteria 9855
19 Ga0065165_1000982 3300005262 Bacteria 35331
20 Ga0070658_10068350 3300005327 Bacteria 2904
21 Ga0070658_10079986 3300005327 Bacteria 2684
22 Ga0070658_10423658 3300005327 Bacteria 1145
23 Ga0070683_100047292 3300005329 Bacteria 3975
24 Ga0070683_100102927 3300005329 Bacteria 2690
25 Ga0070683_100106272 3300005329 Bacteria 2646
26 Ga0070666_10064994 3300005335 Bacteria 2475
27 Ga0070680_100037092 3300005336 Bacteria 3939
28 Ga0070680_100163929 3300005336 Bacteria 1868
29 Ga0068868_100009313 3300005338 Bacteria 7060
30 Ga0068868_100048804 3300005338 Bacteria 3321
31 Ga0070660_100398703 3300005339 Bacteria 1137
32 Ga0070689_100017900 3300005340 Bacteria 5209
33 Ga0070691_10059080 3300005341 Bacteria 1842
34 Ga0070661_100120947 3300005344 Bacteria 1961
35 Ga0070668_100091738 3300005347 Bacteria 2395
36 Ga0070669_100110039 3300005353 Bacteria 2089
37 Ga0070671_100001845 3300005355 Bacteria 16138
38 Ga0070671_100043091 3300005355 Bacteria 3751
39 Ga0070674_100169637 3300005356 Bacteria 1662
40 Ga0070673_100002424 3300005364 Bacteria 11361
41 Ga0070688_100200220 3300005365 Bacteria 1397
42 Ga0070659_100051244 3300005366 Bacteria 3245
43 Ga0070659_100069509 3300005366 Bacteria 2795
44 Ga0070659_100126238 3300005366 Bacteria 2075
45 Ga0070659_100153950 3300005366 Bacteria 1876
46 Ga0070659_100231343 3300005366 Bacteria 1528
47 Ga0070659_100275573 3300005366 Bacteria 1399
48 Ga0070667_100019427 3300005367 Bacteria 5637
49 Ga0070667_100138512 3300005367 Bacteria 2129
50 Ga0070709_10003906 3300005434 Bacteria 8038
51 Ga0070709_10004543 3300005434 Bacteria 7491
52 Ga0070709_10012306 3300005434 Bacteria 4786
53 Ga0070709_10016795 3300005434 Bacteria 4186
54 Ga0070709_10037413 3300005434 Bacteria 2963
55 Ga0070714_100002945 3300005435 Bacteria 12607
56 Ga0070714_100106715 3300005435 Bacteria 2475
57 Ga0070714_100162185 3300005435 Bacteria 2023
58 Ga0070714_100207719 3300005435 Bacteria 1794
59 Ga0070713_100053233 3300005436 Bacteria 3353
60 Ga0070713_100334865 3300005436 Bacteria 1401
61 Ga0070713_100396101 3300005436 Bacteria 1289
62 Ga0070710_10000251 3300005437 Bacteria 25319
63 Ga0070710_10002918 3300005437 Bacteria 8129
64 Ga0070710_10044041 3300005437 Bacteria 2474
65 Ga0070711_100000261 3300005439 Bacteria 27019
66 Ga0070711_100001524 3300005439 Bacteria 12774
67 Ga0070711_100006208 3300005439 Bacteria 7190
68 Ga0070711_100042930 3300005439 Bacteria 3060
69 Ga0070705_100157962 3300005440 Bacteria 1512
70 Ga0070700_100026245 3300005441 Bacteria 3438
71 Ga0070694_100068491 3300005444 Bacteria 2439
72 Ga0070663_100022555 3300005455 Bacteria 4210
73 Ga0070663_100079217 3300005455 Bacteria 2410
74 Ga0070663_100095518 3300005455 Bacteria 2210
75 Ga0070663_100257304 3300005455 Bacteria 1384
76 Ga0070678_100008171 3300005456 Bacteria 6254
77 Ga0070678_100227861 3300005456 Bacteria 1552
78 Ga0070662_100049507 3300005457 Bacteria 3030
79 Ga0070681_10077923 3300005458 Bacteria 3271
80 Ga0070681_10098406 3300005458 Bacteria 2871
81 Ga0070681_10115483 3300005458 Bacteria 2622
82 Ga0070681_10408946 3300005458 Bacteria 1269
83 Ga0070681_10494262 3300005458 Bacteria 1136
84 Ga0070706_100303288 3300005467 Bacteria 1490
85 Ga0070707_100362581 3300005468 Bacteria 1408
86 Ga0070698_100073038 3300005471 Bacteria 3438
87 Ga0070699_100169809 3300005518 Bacteria 1932
88 Ga0070699_100525571 3300005518 Bacteria 1076
89 Ga0070679_100024224 3300005530 Bacteria 5947
90 Ga0070679_100040368 3300005530 Bacteria 4643
91 Ga0070679_100057989 3300005530 Bacteria 3859
92 Ga0070679_100121093 3300005530 Bacteria 2601
93 Ga0070684_100010714 3300005535 Bacteria 7274
94 Ga0070684_100129222 3300005535 Bacteria 2278
95 Ga0068853_100004793 3300005539 Bacteria 10521
96 Ga0068853_100076182 3300005539 Bacteria 2929
97 Ga0068853_100099554 3300005539 Bacteria 2568
98 Ga0070672_100074667 3300005543 Bacteria 2705
99 Ga0070672_100193157 3300005543 Bacteria 1700
100 Ga0070686_100050421 3300005544 Bacteria 2645
101 Ga0070665_100009999 3300005548 Bacteria 9598
102 Ga0070665_100033056 3300005548 Bacteria 5204
103 Ga0070665_100043790 3300005548 Bacteria 4497
104 Ga0070665_100080134 3300005548 Bacteria 3270
105 Ga0070665_100103205 3300005548 Bacteria 2854
106 Ga0068855_100032380 3300005563 Bacteria 6243
107 Ga0068855_100087063 3300005563 Bacteria 3611
108 Ga0068855_100138815 3300005563 Bacteria 2772
109 Ga0068855_100274591 3300005563 Bacteria 1873
110 Ga0070664_100043519 3300005564 Bacteria 3788
111 Ga0068854_100001506 3300005578 Bacteria 14100
112 Ga0068854_100001788 3300005578 Bacteria 13097
113 Ga0068854_100360369 3300005578 Bacteria 1193
114 Ga0068856_100000137 3300005614 Bacteria 73762
115 Ga0068856_100001074 3300005614 Bacteria 28942
116 Ga0068856_100081807 3300005614 Bacteria 3204
117 Ga0068856_100240006 3300005614 Bacteria 1828
118 Ga0068856_100334622 3300005614 Bacteria 1532
119 Ga0068856_100428682 3300005614 Bacteria 1343
120 Ga0068852_100028969 3300005616 Bacteria 4541
121 Ga0068852_100057592 3300005616 Bacteria 3363
122 Ga0068852_100182296 3300005616 Bacteria 1975
123 Ga0068852_100537531 3300005616 Bacteria 1168
124 Ga0068859_100583281 3300005617 Bacteria 1212
125 Ga0068864_100129831 3300005618 Bacteria 2262
126 Ga0068866_10021348 3300005718 Bacteria 2981
127 Ga0068866_10059241 3300005718 Bacteria 1980
128 Ga0068861_100109122 3300005719 Bacteria 2215
129 Ga0068861_100119117 3300005719 Bacteria 2127
130 Ga0068851_10007723 3300005834 Bacteria 4946
131 Ga0068851_10055527 3300005834 Bacteria 2018
132 Ga0068863_100109668 3300005841 Bacteria 2628
133 Ga0068858_100072648 3300005842 Bacteria 3192
134 Ga0068858_100078409 3300005842 Bacteria 3070
135 Ga0068858_100136181 3300005842 Bacteria 2304
136 Ga0068858_100303077 3300005842 Bacteria 1525
137 Ga0068860_100000837 3300005843 Bacteria 34452
138 Ga0068860_100517711 3300005843 Bacteria 1193
139 Ga0081455_10018080 3300005937 Bacteria 6731
140 Ga0081455_10026840 3300005937 Bacteria 5289
141 Ga0081455_10034630 3300005937 Bacteria 4523
142 Ga0081455_10042185 3300005937 Bacteria 4005
143 Ga0081455_10079511 3300005937 Bacteria 2692
144 Ga0081538_10032966 3300005981 Bacteria 3458
145 Ga0081540_1000721 3300005983 Bacteria 30491
146 Ga0081540_1002063 3300005983 Bacteria 16750
147 Ga0081540_1010031 3300005983 Bacteria 6449
148 Ga0081540_1021769 3300005983 Bacteria 3806
149 Ga0081540_1022188 3300005983 Bacteria 3752
150 Ga0081540_1024847 3300005983 Bacteria 3466
151 Ga0081540_1035426 3300005983 Bacteria 2676
152 Ga0081540_1062350 3300005983 Bacteria 1771
153 Ga0081540_1100765 3300005983 Bacteria 1245
154 Ga0081539_10000040 3300005985 Bacteria 292753
155 Ga0081539_10000157 3300005985 Bacteria 158278
156 Ga0081539_10033396 3300005985 Bacteria 3135
157 Ga0070717_10007408 3300006028 Bacteria 8149
158 Ga0070717_10037586 3300006028 Bacteria 3932
159 Ga0075365_10014233 3300006038 Bacteria 4781
160 Ga0075365_10021213 3300006038 Bacteria 4048
161 Ga0075365_10040274 3300006038 Bacteria 3047
162 Ga0075365_10070752 3300006038 Bacteria 2347
163 Ga0075363_100105108 3300006048 Bacteria 1566
164 Ga0075364_10067575 3300006051 Bacteria 2349
165 Ga0075364_10074775 3300006051 Bacteria 2235
166 Ga0070715_10000749 3300006163 Bacteria 8767
167 Ga0070715_10117130 3300006163 Bacteria 1265
168 Ga0070712_100002194 3300006175 Bacteria 12004
169 Ga0070712_100128675 3300006175 Bacteria 1916
170 Ga0070712_100178765 3300006175 Bacteria 1652
171 Ga0070712_100305098 3300006175 Bacteria 1290
172 Ga0075369_10078004 3300006186 Bacteria 1466
173 Ga0075369_10116658 3300006186 Bacteria 1206
174 Ga0075366_10036589 3300006195 Bacteria 2894
175 Ga0075366_10089529 3300006195 Bacteria 1843
176 Ga0097621_100156117 3300006237 Bacteria 1959
177 Ga0075370_10013631 3300006353 Bacteria 4326
178 Ga0075429_100269386 3300006880 Bacteria 1491
179 Ga0097620_100583269 3300006931 Bacteria 1212
180 Ga0075435_100045113 3300007076 Bacteria 3532
181 Ga0075435_100061823 3300007076 Bacteria 3038
182 Ga0099794_10003243 3300007265 Bacteria 6167
183 Ga0099794_10081608 3300007265 Bacteria 1595
184 Ga0099795_10004122 3300007788 Bacteria 3708
185 Ga0099795_10012627 3300007788 Bacteria 2568
186 Ga0099795_10044008 3300007788 Bacteria 1599
187 Ga0105240_10004694 3300009093 Bacteria 20654
188 Ga0105240_10006068 3300009093 Bacteria 17849
189 Ga0105240_10011324 3300009093 Bacteria 12425
190 Ga0105240_10011879 3300009093 Bacteria 12083
191 Ga0105240_10046776 3300009093 Bacteria 5480
192 Ga0105240_10067164 3300009093 Bacteria 4445
193 Ga0105240_10193225 3300009093 Bacteria 2392
194 Ga0105240_10389828 3300009093 Bacteria 1571
195 Ga0105240_10753321 3300009093 Bacteria 1059
196 Ga0111539_10123838 3300009094 Bacteria 3030
197 Ga0111539_10331660 3300009094 Bacteria 1771
198 Ga0105245_10074417 3300009098 Bacteria 3091
199 Ga0105245_10430542 3300009098 Bacteria 1324
200 Ga0105247_10138362 3300009101 Bacteria 1593
201 Ga0105247_10219484 3300009101 Bacteria 1286
202 Ga0105243_10346994 3300009148 Bacteria 1362
203 Ga0105241_10009922 3300009174 Bacteria 6998
204 Ga0105241_10011272 3300009174 Bacteria 6554
205 Ga0105241_10057927 3300009174 Bacteria 2974
206 Ga0105241_10109572 3300009174 Bacteria 2208
207 Ga0105241_10208362 3300009174 Bacteria 1637
208 Ga0105248_10091835 3300009177 Bacteria 3419
209 Ga0105248_10237689 3300009177 Bacteria 2051
210 Ga0105237_10002118 3300009545 Bacteria 25049
211 Ga0105237_10023062 3300009545 Bacteria 6382
212 Ga0105237_10064354 3300009545 Bacteria 3664
213 Ga0105237_10075396 3300009545 Bacteria 3365
214 Ga0105237_10111021 3300009545 Bacteria 2733
215 Ga0105237_10154200 3300009545 Bacteria 2293
216 Ga0105237_10272808 3300009545 Bacteria 1694
217 Ga0105237_10319612 3300009545 Bacteria 1556
218 Ga0105237_10410049 3300009545 Bacteria 1360
219 Ga0105237_10539498 3300009545 Bacteria 1173
220 Ga0105238_10004460 3300009551 Bacteria 13879
221 Ga0105238_10017095 3300009551 Bacteria 7362
222 Ga0105238_10020882 3300009551 Bacteria 6671
223 Ga0105238_10043133 3300009551 Bacteria 4564
224 Ga0105238_10261492 3300009551 Bacteria 1710
225 Ga0105238_10299492 3300009551 Bacteria 1591
226 Ga0105249_10258761 3300009553 Bacteria 1728
227 Ga0099796_10016174 3300010159 Bacteria 2198
228 Ga0105239_10005955 3300010375 Bacteria 14187
229 Ga0105239_10015728 3300010375 Bacteria 8375
230 Ga0105239_10020720 3300010375 Bacteria 7253
231 Ga0105239_10065937 3300010375 Bacteria 3978
232 Ga0105239_10086632 3300010375 Bacteria 3452
233 Ga0105239_10091614 3300010375 Bacteria 3355
234 Ga0105239_10100157 3300010375 Bacteria 3205
235 Ga0105239_10133631 3300010375 Bacteria 2761
236 Ga0105239_10272337 3300010375 Bacteria 1904
237 Ga0105246_10011111 3300011119 Bacteria 5579
238 Ga0105246_10056087 3300011119 Bacteria 2722
239 Ga0105246_10143818 3300011119 Bacteria 1797
240 Ga0105246_10249314 3300011119 Bacteria 1408
241 Ga0157371_10046519 3300013102 Bacteria 3086
242 Ga0157370_10011688 3300013104 Bacteria 9163
243 Ga0157370_10071396 3300013104 Bacteria 3275
244 Ga0157370_10109493 3300013104 Bacteria 2582
245 Ga0157369_10002281 3300013105 Bacteria 23076
246 Ga0157369_10003351 3300013105 Bacteria 19026
247 Ga0157369_10023959 3300013105 Bacteria 6791
248 Ga0157374_10052418 3300013296 Bacteria 3800
249 Ga0157374_10166903 3300013296 Bacteria 2146
250 Ga0157374_10286525 3300013296 Bacteria 1627
251 Ga0157374_10321590 3300013296 Bacteria 1533
252 Ga0157378_10118327 3300013297 Bacteria 2439
253 Ga0163162_10038773 3300013306 Bacteria 4756
254 Ga0163162_10045055 3300013306 Bacteria 4419
255 Ga0163162_10092404 3300013306 Bacteria 3109
256 Ga0163162_10133390 3300013306 Bacteria 2593
257 Ga0163162_10271476 3300013306 Bacteria 1828
258 Ga0157372_10178769 3300013307 Bacteria 2456
259 Ga0157372_10219310 3300013307 Bacteria 2205
260 Ga0157372_10399237 3300013307 Bacteria 1602
261 Ga0157372_10560699 3300013307 Bacteria 1332
262 Ga0157375_10251039 3300013308 Bacteria 1930
263 Ga0157375_10385441 3300013308 Bacteria 1568
264 Ga0163163_10003826 3300014325 Bacteria 12814
265 Ga0163163_10020851 3300014325 Bacteria 6178
266 Ga0163163_10029087 3300014325 Bacteria 5313
267 Ga0163163_10288974 3300014325 Bacteria 1692
268 Ga0163163_10313023 3300014325 Bacteria 1623
269 Ga0157377_10083982 3300014745 Bacteria 1867
270 Ga0157379_10025262 3300014968 Bacteria 5276
271 Ga0157379_10317833 3300014968 Bacteria 1421
272 Ga0157379_10380867 3300014968 Bacteria 1294
273 Ga0157376_10018180 3300014969 Bacteria 5381
274 Ga0214544_1000011 3300021320 Bacteria 262952
275 Ga0214542_1000009 3300021321 Bacteria 262861
276 Ga0214545_1000007 3300021324 Bacteria 262984
277 Ga0214543_1000020 3300021327 Bacteria 262861
278 Ga0213873_10017467 3300021358 Bacteria 1637
279 Ga0213872_10044001 3300021361 Bacteria 2033
280 Ga0213876_10005309 3300021384 Bacteria 7092
281 Ga0213876_10029749 3300021384 Bacteria 2878
282 Ga0213876_10040722 3300021384 Bacteria 2455
283 Ga0213876_10095749 3300021384 Bacteria 1573
284 Ga0213876_10114675 3300021384 Bacteria 1430
285 Ga0209563_100776 3300025230 Bacteria 9652
286 Ga0207425_1017907 3300025245 Bacteria 1547
287 Ga0209677_100388 3300025253 Bacteria 26746
288 Ga0209677_100400 3300025253 Bacteria 26165
289 Ga0209148_1000321 3300025254 Bacteria 66604
290 Ga0209233_1005842 3300025261 Bacteria 4041
291 Ga0209233_1008676 3300025261 Bacteria 3128
292 Ga0209233_1008776 3300025261 Bacteria 3105
293 Ga0209233_1008870 3300025261 Bacteria 3083
294 Ga0209455_1001351 3300025272 Bacteria 11271
295 Ga0209455_1001976 3300025272 Bacteria 8424
296 Ga0209455_1004752 3300025272 Bacteria 4359
297 Ga0209564_1000477 3300025295 Bacteria 66843
298 Ga0209564_1006461 3300025295 Bacteria 6312
299 Ga0209564_1008490 3300025295 Bacteria 5059
300 Ga0209758_1000206 3300025297 Bacteria 130177
301 Ga0209758_1000536 3300025297 Bacteria 60374
302 Ga0209758_1001992 3300025297 Bacteria 22001
303 Ga0209758_1002275 3300025297 Bacteria 19895
304 Ga0209758_1002550 3300025297 Bacteria 18367
305 Ga0209758_1003319 3300025297 Bacteria 14823
306 Ga0209758_1005044 3300025297 Bacteria 10495
307 Ga0209758_1005519 3300025297 Bacteria 9666
308 Ga0209256_1009447 3300025299 Bacteria 4274
309 Ga0207426_1000773 3300025302 Bacteria 35199
310 Ga0207426_1001183 3300025302 Bacteria 23298
311 Ga0207426_1008206 3300025302 Bacteria 4252
312 Ga0207426_1013106 3300025302 Bacteria 3086
313 Ga0209257_1000394 3300025304 Bacteria 86654
314 Ga0209257_1032679 3300025304 Bacteria 1646
315 Ga0207697_10049588 3300025315 Bacteria 1733
316 Ga0207656_10044269 3300025321 Bacteria 1900
317 Ga0207656_10128202 3300025321 Bacteria 1186
318 Ga0207692_10000717 3300025898 Bacteria 11668
319 Ga0207692_10021767 3300025898 Bacteria 2939
320 Ga0207692_10032232 3300025898 Bacteria 2517
321 Ga0207642_10071949 3300025899 Bacteria 1649
322 Ga0207710_10036010 3300025900 Bacteria 2180
323 Ga0207710_10099970 3300025900 Bacteria 1367
324 Ga0207688_10046505 3300025901 Bacteria 2423
325 Ga0207680_10056509 3300025903 Bacteria 2370
326 Ga0207647_10000764 3300025904 Bacteria 25126
327 Ga0207647_10010156 3300025904 Bacteria 6653
328 Ga0207647_10184968 3300025904 Bacteria 1209
329 Ga0207685_10000368 3300025905 Bacteria 7391
330 Ga0207685_10082822 3300025905 Bacteria 1332
331 Ga0207699_10000122 3300025906 Bacteria 55116
332 Ga0207699_10000967 3300025906 Bacteria 13702
333 Ga0207699_10028502 3300025906 Bacteria 3104
334 Ga0207699_10261047 3300025906 Bacteria 1197
335 Ga0207645_10029692 3300025907 Bacteria 3524
336 Ga0207645_10164429 3300025907 Bacteria 1452
337 Ga0207705_10051762 3300025909 Bacteria 2955
338 Ga0207684_10097971 3300025910 Bacteria 2504
339 Ga0207654_10000201 3300025911 Bacteria 36898
340 Ga0207654_10027667 3300025911 Bacteria 3084
341 Ga0207654_10149180 3300025911 Bacteria 1499
342 Ga0207707_10000515 3300025912 Bacteria 39696
343 Ga0207707_10000706 3300025912 Bacteria 33199
344 Ga0207707_10007092 3300025912 Bacteria 9765
345 Ga0207707_10024841 3300025912 Bacteria 5240
346 Ga0207707_10129917 3300025912 Bacteria 2203
347 Ga0207695_10000006 3300025913 Bacteria 1135309
348 Ga0207695_10000343 3300025913 Bacteria 107739
349 Ga0207695_10017441 3300025913 Bacteria 8356
350 Ga0207695_10044192 3300025913 Bacteria 4741
351 Ga0207695_10165737 3300025913 Bacteria 2138
352 Ga0207671_10025726 3300025914 Bacteria 4418
353 Ga0207671_10025913 3300025914 Bacteria 4400
354 Ga0207671_10079304 3300025914 Bacteria 2460
355 Ga0207671_10110224 3300025914 Bacteria 2094
356 Ga0207671_10199660 3300025914 Bacteria 1562
357 Ga0207671_10286383 3300025914 Bacteria 1300
358 Ga0207693_10001659 3300025915 Bacteria 19621
359 Ga0207693_10003226 3300025915 Bacteria 14002
360 Ga0207693_10026017 3300025915 Bacteria 4634
361 Ga0207693_10051991 3300025915 Bacteria 3213
362 Ga0207693_10157712 3300025915 Bacteria 1785
363 Ga0207693_10167364 3300025915 Bacteria 1731
364 Ga0207663_10000161 3300025916 Bacteria 30665
365 Ga0207663_10002134 3300025916 Bacteria 9435
366 Ga0207663_10026504 3300025916 Bacteria 3365
367 Ga0207663_10042512 3300025916 Bacteria 2777
368 Ga0207663_10066009 3300025916 Bacteria 2315
369 Ga0207663_10231516 3300025916 Bacteria 1350
370 Ga0207663_10260013 3300025916 Bacteria 1281
371 Ga0207662_10176548 3300025918 Bacteria 1373
372 Ga0207657_10038738 3300025919 Bacteria 4240
373 Ga0207649_10148779 3300025920 Bacteria 1610
374 Ga0207652_10001458 3300025921 Bacteria 20929
375 Ga0207652_10049105 3300025921 Bacteria 3610
376 Ga0207652_10065919 3300025921 Bacteria 3137
377 Ga0207681_10099713 3300025923 Bacteria 2092
378 Ga0207694_10000339 3300025924 Bacteria 44198
379 Ga0207694_10023031 3300025924 Bacteria 4727
380 Ga0207694_10032046 3300025924 Bacteria 4021
381 Ga0207694_10078416 3300025924 Bacteria 2589
382 Ga0207687_10051832 3300025927 Bacteria 2862
383 Ga0207700_10013500 3300025928 Bacteria 5318
384 Ga0207700_10042747 3300025928 Bacteria 3324
385 Ga0207700_10115258 3300025928 Bacteria 2169
386 Ga0207700_10169333 3300025928 Bacteria 1821
387 Ga0207700_10292764 3300025928 Bacteria 1404
388 Ga0207664_10008456 3300025929 Bacteria 7181
389 Ga0207664_10020719 3300025929 Bacteria 4880
390 Ga0207664_10182276 3300025929 Bacteria 1803
391 Ga0207664_10203364 3300025929 Bacteria 1711
392 Ga0207664_10330991 3300025929 Bacteria 1345
393 Ga0207644_10005690 3300025931 Bacteria 8114
394 Ga0207644_10077679 3300025931 Bacteria 2445
395 Ga0207644_10253037 3300025931 Bacteria 1406
396 Ga0207706_10170125 3300025933 Bacteria 1915
397 Ga0207686_10037403 3300025934 Bacteria 2929
398 Ga0207709_10057528 3300025935 Bacteria 2412
399 Ga0207709_10206519 3300025935 Bacteria 1407
400 Ga0207670_10012710 3300025936 Bacteria 4934
401 Ga0207670_10325970 3300025936 Bacteria 1210
402 Ga0207670_10361656 3300025936 Bacteria 1152
403 Ga0207669_10020230 3300025937 Bacteria 3484
404 Ga0207704_10056141 3300025938 Bacteria 2411
405 Ga0207665_10000183 3300025939 Bacteria 41938
406 Ga0207665_10003747 3300025939 Bacteria 10153
407 Ga0207665_10027066 3300025939 Bacteria 3788
408 Ga0207691_10239561 3300025940 Bacteria 1569
409 Ga0207711_10112309 3300025941 Bacteria 2425
410 Ga0207711_10352832 3300025941 Bacteria 1362
411 Ga0207711_10537562 3300025941 Bacteria 1090
412 Ga0207689_10174330 3300025942 Bacteria 1773
413 Ga0207661_10000828 3300025944 Bacteria 20288
414 Ga0207679_10064390 3300025945 Bacteria 2740
415 Ga0207667_10006413 3300025949 Bacteria 14251
416 Ga0207667_10008033 3300025949 Bacteria 12586
417 Ga0207667_10123190 3300025949 Bacteria 2671
418 Ga0207667_10194358 3300025949 Bacteria 2082
419 Ga0207667_10214888 3300025949 Bacteria 1971
420 Ga0207651_10106993 3300025960 Bacteria 2089
421 Ga0207651_10441719 3300025960 Bacteria 1115
422 Ga0207712_10094480 3300025961 Bacteria 2209
423 Ga0207668_10027989 3300025972 Bacteria 3679
424 Ga0207668_10069284 3300025972 Bacteria 2511
425 Ga0207640_10031248 3300025981 Bacteria 3288
426 Ga0207640_10111487 3300025981 Bacteria 1940
427 Ga0207677_10012235 3300026023 Bacteria 4924
428 Ga0207677_10034462 3300026023 Bacteria 3278
429 Ga0207703_10057392 3300026035 Bacteria 3174
430 Ga0207703_10059969 3300026035 Bacteria 3109
431 Ga0207703_10116608 3300026035 Bacteria 2287
432 Ga0207639_10006655 3300026041 Bacteria 7859
433 Ga0207639_10015983 3300026041 Bacteria 5301
434 Ga0207639_10017564 3300026041 Bacteria 5073
435 Ga0207678_10026769 3300026067 Bacteria 5030
436 Ga0207678_10039422 3300026067 Bacteria 4100
437 Ga0207678_10062086 3300026067 Bacteria 3213
438 Ga0207678_10121298 3300026067 Bacteria 2231
439 Ga0207678_10136532 3300026067 Bacteria 2092
440 Ga0207678_10418352 3300026067 Bacteria 1162
441 Ga0207678_10513520 3300026067 Bacteria 1045
442 Ga0207708_10021890 3300026075 Bacteria 4824
443 Ga0207708_10126365 3300026075 Bacteria 1996
444 Ga0207702_10000006 3300026078 Bacteria 346370
445 Ga0207702_10000063 3300026078 Bacteria 123034
446 Ga0207702_10005641 3300026078 Bacteria 10914
447 Ga0207702_10123853 3300026078 Bacteria 2317
448 Ga0207702_10621278 3300026078 Bacteria 1061
449 Ga0207641_10155908 3300026088 Bacteria 2072
450 Ga0207648_10058331 3300026089 Bacteria 3367
451 Ga0207674_10002334 3300026116 Bacteria 24007
452 Ga0207674_10003146 3300026116 Bacteria 20343
453 Ga0207674_10040962 3300026116 Bacteria 4794
454 Ga0207674_10043341 3300026116 Bacteria 4640
455 Ga0207674_10213110 3300026116 Bacteria 1880
456 Ga0207675_100133979 3300026118 Bacteria 2350
457 Ga0207683_10012826 3300026121 Bacteria 7154
458 Ga0207698_10002272 3300026142 Bacteria 11377
459 Ga0207698_10068252 3300026142 Bacteria 2807
460 Ga0207698_10082645 3300026142 Bacteria 2597
461 Ga0207698_10581656 3300026142 Bacteria 1102
462 Ga0209389_1000034 3300027296 Bacteria 127289
463 Ga0209389_1000039 3300027296 Bacteria 124545
464 Ga0209589_1000038 3300027357 Bacteria 127285
465 Ga0209589_1000055 3300027357 Bacteria 111890
466 Ga0209489_100023 3300027361 Bacteria 198829
467 Ga0209489_100087 3300027361 Bacteria 124545
468 Ga0209489_100128 3300027361 Bacteria 111890
469 Ga0209700_100090 3300027363 Bacteria 124545
470 Ga0209700_100137 3300027363 Bacteria 111890
471 Ga0209179_1013565 3300027512 Bacteria 1482
472 Ga0209179_1018494 3300027512 Bacteria 1332
473 Ga0209179_1026845 3300027512 Bacteria 1158
474 Ga0268266_10002818 3300028379 Bacteria 18134
475 Ga0268266_10003102 3300028379 Bacteria 16930
476 Ga0268266_10008468 3300028379 Bacteria 9143
477 Ga0268266_10046002 3300028379 Bacteria 3735
478 Ga0268266_10064786 3300028379 Bacteria 3158
479 Ga0268266_10081068 3300028379 Bacteria 2828
480 Ga0268266_10107480 3300028379 Bacteria 2467
481 Ga0268265_10068850 3300028380 Bacteria 2746
482 Ga0268265_10188346 3300028380 Bacteria 1779
483 Ga0268264_10000194 3300028381 Bacteria 125395
484 Ga0268264_10034068 3300028381 Bacteria 4187
485 Ga0268264_10056082 3300028381 Bacteria 3293
486 Ga0265337_1002558 3300028556 Bacteria 8273
487 Ga0265326_10002652 3300028558 Bacteria 5990
488 Ga0265319_1003402 3300028563 Bacteria 8315
489 Ga0265334_10001143 3300028573 Bacteria 12967
490 Ga0265323_10000720 3300028653 Bacteria 17903
491 Ga0265336_10000640 3300028666 Bacteria 19119
492 Ga0307517_10002317 3300028786 Bacteria 30737
493 Ga0307517_10105494 3300028786 Bacteria 2186
494 Ga0307517_10121559 3300028786 Bacteria 1928
495 Ga0307515_10012851 3300028794 Bacteria 15710
496 Ga0307515_10179532 3300028794 Bacteria 2073
497 Ga0265338_10001434 3300028800 Bacteria 38730
498 Ga0265330_10014639 3300031235 Bacteria 3638
499 Ga0265330_10040683 3300031235 Bacteria 2063
500 Ga0265332_10016892 3300031238 Bacteria 3219
501 Ga0265332_10030913 3300031238 Bacteria 2337
502 Ga0265340_10028634 3300031247 Bacteria 2801
503 Ga0265339_10000281 3300031249 Bacteria 41044
504 Ga0265331_10013782 3300031250 Bacteria 4335
505 Ga0307513_10085319 3300031456 Bacteria 3241
506 Ga0307513_10311219 3300031456 Bacteria 1337
507 Ga0307509_10152637 3300031507 Bacteria 2221
508 Ga0307408_100131833 3300031548 Bacteria 1951
509 Ga0307408_100256759 3300031548 Bacteria 1444
510 Ga0265313_10054318 3300031595 Bacteria 1903
511 Ga0307508_10000012 3300031616 Bacteria 243167
512 Ga0307508_10204919 3300031616 Bacteria 1573
513 Ga0307508_10213311 3300031616 Bacteria 1530
514 Ga0265314_10018837 3300031711 Bacteria 5363
515 Ga0265314_10075804 3300031711 Bacteria 2237
516 Ga0265342_10004319 3300031712 Bacteria 11250
517 Ga0265342_10030921 3300031712 Bacteria 3314
518 Ga0265342_10033828 3300031712 Bacteria 3139
519 Ga0307516_10005964 3300031730 Bacteria 14402
520 Ga0307516_10009187 3300031730 Bacteria 11066
521 Ga0307516_10062855 3300031730 Bacteria 3596
522 Ga0307516_10159719 3300031730 Bacteria 2005
523 Ga0307405_10064526 3300031731 Bacteria 2328
524 Ga0307413_10038316 3300031824 Bacteria 2777
525 Ga0307410_10255565 3300031852 Bacteria 1364
526 Ga0307407_10156931 3300031903 Bacteria 1485
527 Ga0307412_10065284 3300031911 Bacteria 2463
528 Ga0307409_100127681 3300031995 Bacteria 2166
529 Ga0307409_100145191 3300031995 Bacteria 2051
530 Ga0307416_100161927 3300032002 Bacteria 2069
531 Ga0307415_100067532 3300032126 Bacteria 2499
532 Ga0307415_100235560 3300032126 Bacteria 1477
533 Ga0307415_100255907 3300032126 Bacteria 1425
534 Ga0307507_10014168 3300033179 Bacteria 9545
535 Ga0307510_10006595 3300033180 Bacteria 13844
536 Ga0307510_10019169 3300033180 Bacteria 8027
537 Ga0307510_10022895 3300033180 Bacteria 7247
538 Ga0307510_10268887 3300033180 Bacteria 1182
539 Ga0315911_1000005 3300033442 Bacteria 426255
540 Ga0373934_0001556 3300035086 Bacteria 8416
541 Ga0373934_0072251 3300035086 Bacteria 1381
542 Ga0373923_0001907 3300035111 Bacteria 6227
543 Ga0373923_0004211 3300035111 Bacteria 4749
544 Ga0373923_0012481 3300035111 Bacteria 3141
545 Ga0373932_0013293 3300035112 Bacteria 2044
546 Ga0373936_0029637 3300035113 Bacteria 2155
547 Ga0373953_0004296 3300035117 Bacteria 4528
548 Ga0373953_0013110 3300035117 Bacteria 2952
549 Ga0373954_0001461 3300035118 Bacteria 9600
550 Ga0373954_0026816 3300035118 Bacteria 2642
551 Ga0373956_0004051 3300035119 Bacteria 5883
552 Ga0373956_0033451 3300035119 Bacteria 2260
553 Ga0373956_0050751 3300035119 Bacteria 1863
554 Ga0373957_0002595 3300035120 Bacteria 5183
555 Ga0373957_0021723 3300035120 Bacteria 2281
556 Ga0373957_0117227 3300035120 Bacteria 1076
557 Ga0373943_0002146 3300035170 Bacteria 8966
558 Ga0373955_0001659 3300035172 Bacteria 9523
559 Ga0373955_0003672 3300035172 Bacteria 6760
560 Ga0373955_0005485 3300035172 Bacteria 5704
561 Ga0373955_0007024 3300035172 Bacteria 5155
562 Ga0373924_0001138 3300035410 Bacteria 8551
563 Ga0373924_0003160 3300035410 Bacteria 5630
564 Ga0373924_0008500 3300035410 Bacteria 3734
565 Ga0373924_0012615 3300035410 Bacteria 3160
566 Ga0373931_0003491 3300035691 Bacteria 7072
567 Ga0373931_0057983 3300035691 Bacteria 2078
568 Ga0373935_0002054 3300035692 Bacteria 11396
569 Ga0373935_0150356 3300035692 Bacteria 1580
570 Ga0373927_0000634 3300035695 Bacteria 26631
571 Ga0373927_0007812 3300035695 Bacteria 7238
572 Ga0373933_0000105 3300035724 Bacteria 53488
573 Ga0373933_0060127 3300035724 Bacteria 2290
574 Ga0373933_0079211 3300035724 Bacteria 2011
575 Ga0373947_0001111 3300035725 Bacteria 16509
576 Ga0373947_0006400 3300035725 Bacteria 6842
577 Ga0373937_0016133 3300036401 Bacteria 6627
578 Ga0373937_0018898 3300036401 Bacteria 6160
579 Ga0373937_0042762 3300036401 Bacteria 4134
580 Ga0373937_0053961 3300036401 Bacteria 3687
581 Ga0373937_0310831 3300036401 Bacteria 1490
582 Ga0373925_0001281 3300037068 Bacteria 22164
583 Ga0373925_0019299 3300037068 Bacteria 4958
584 Ga0373925_0025701 3300037068 Bacteria 4305
585 Ga0373925_0285739 3300037068 Bacteria 1329
586 Ga0395900_0001496 3300037418 Bacteria 27775
587 Ga0395900_0047303 3300037418 Bacteria 4429
588 Ga0395900_0518763 3300037418 Bacteria 1140
589 Ga0395898_0013732 3300037466 Bacteria 8330
590 Ga0395898_0018464 3300037466 Bacteria 7110
591 Ga0395898_0083135 3300037466 Bacteria 3086
592 Ga0395898_0132794 3300037466 Bacteria 2383
593 Ga0395905_0001273 3300037471 Bacteria 31107
594 Ga0395905_0258497 3300037471 Bacteria 1626
595 Ga0395905_0444911 3300037471 Bacteria 1193
596 Ga0436364_1544624 3300037853 Bacteria 3931
597 Ga0395901_0010282 3300038443 Bacteria 9478
598 Ga0395901_0139954 3300038443 Bacteria 2544
599 Ga0395901_0209917 3300038443 Bacteria 2038
600 Ga0395901_0214633 3300038443 Bacteria 2013
601 Ga0395901_0278811 3300038443 Bacteria 1737
602 Ga0436365_0353256 3300039437 Bacteria 3541
603 Ga0436365_0703944 3300039437 Bacteria 21999
604 Ga0436365_1233391 3300039437 Bacteria 4497
605 Ga0436365_1704823 3300039437 Bacteria 3185
606 Ga0436360_0133086 3300039438 Bacteria 1727
607 Ga0436360_0432344 3300039438 Bacteria 2522
608 Ga0436361_0329418 3300039447 Bacteria 1283
609 Ga0436361_0911334 3300039447 Bacteria 1406
610 Ga0436363_0997155 3300039450 Bacteria 2170
611 Ga0436362_0516204 3300039453 Bacteria 1591
612 Ga0436362_0675816 3300039453 Bacteria 5239
613 Ga0451807_2628458 3300041486 Bacteria 1413
614 Ga0466969_0083139 3300044656 Bacteria 1525
615 Ga0466972_0000053 3300044658 Bacteria 112876
616 Ga0466972_0031207 3300044658 Bacteria 2622
617 Ga0466966_0000322 3300044684 Bacteria 30928
618 Ga0466966_0076811 3300044684 Bacteria 2085
619 Ga0466961_0000227 3300044693 Bacteria 38175
620 Ga0466968_0008614 3300044735 Bacteria 3909
621 Ga0466968_0072252 3300044735 Bacteria 1504
622 Ga0466957_0036799 3300044842 Bacteria 2944
623 Ga0466959_0013768 3300045049 Bacteria 5872
624 Ga0466959_0048682 3300045049 Bacteria 3115
625 Ga0466959_0213159 3300045049 Bacteria 1341
626 Ga0466967_0015018 3300045976 Bacteria 6057
627 Ga0466967_0024100 3300045976 Bacteria 4998
628 Ga0466967_0186823 3300045976 Bacteria 1957
629 Ga0495592_0004059 3300046454 Bacteria 10646
630 Ga0495592_0008007 3300046454 Bacteria 7931
631 Ga0495592_0020450 3300046454 Bacteria 5034
632 Ga0495592_0058954 3300046454 Bacteria 2829
633 Ga0495592_0067621 3300046454 Bacteria 2610
634 Ga0495603_0000036 3300046455 Bacteria 57443
635 Ga0495603_0017687 3300046455 Bacteria 4314
636 Ga0495603_0031308 3300046455 Bacteria 3202
637 Ga0495603_0036309 3300046455 Bacteria 2959
638 Ga0495629_0000148 3300046459 Bacteria 61440
639 Ga0495629_0000331 3300046459 Bacteria 40528
640 Ga0495629_0006986 3300046459 Bacteria 8320
641 Ga0495638_0006359 3300046460 Bacteria 8603
642 Ga0495638_0049174 3300046460 Bacteria 2637
643 Ga0495641_0006132 3300046461 Bacteria 7873
644 Ga0495641_0026182 3300046461 Bacteria 2850
645 Ga0495651_0005847 3300046462 Bacteria 9380
646 Ga0495651_0010973 3300046462 Bacteria 6971
647 Ga0495651_0012599 3300046462 Bacteria 6525
648 Ga0495651_0028754 3300046462 Bacteria 4332
649 Ga0495651_0053752 3300046462 Bacteria 3099
650 Ga0495651_0083973 3300046462 Bacteria 2400
651 Ga0495653_0006476 3300046463 Bacteria 9603
652 Ga0495653_0032452 3300046463 Bacteria 4145
653 Ga0495580_0001864 3300046472 Bacteria 18543
654 Ga0495580_0026569 3300046472 Bacteria 4220
655 Ga0495580_0227117 3300046472 Bacteria 1282
656 Ga0495582_0000191 3300046473 Bacteria 33824
657 Ga0495582_0080994 3300046473 Bacteria 1803
658 Ga0495582_0140661 3300046473 Bacteria 1367
659 Ga0495605_0114940 3300046474 Bacteria 1225
660 Ga0495639_0000209 3300046475 Bacteria 30154
661 Ga0495639_0007581 3300046475 Bacteria 4663
662 Ga0495662_0000787 3300046476 Bacteria 15382
663 Ga0495662_0014956 3300046476 Bacteria 3770
664 Ga0495664_0005407 3300046477 Bacteria 7013
665 Ga0495664_0010510 3300046477 Bacteria 5194
666 Ga0495664_0038308 3300046477 Bacteria 2830
667 Ga0495584_0042279 3300046491 Bacteria 2300
668 Ga0495594_0001199 3300046499 Bacteria 13572
669 Ga0495596_0067221 3300046500 Bacteria 1393
670 Ga0495607_0045280 3300046501 Bacteria 2589
671 Ga0495607_0103065 3300046501 Bacteria 1525
672 Ga0495606_0001350 3300046507 Bacteria 33317
673 Ga0495606_0031891 3300046507 Bacteria 3658
674 Ga0495608_0000988 3300046511 Bacteria 20058
675 Ga0495608_0021075 3300046511 Bacteria 4476
676 Ga0495608_0035589 3300046511 Bacteria 3357
677 Ga0495610_0131250 3300046512 Bacteria 1087
678 Ga0495616_0033075 3300046513 Bacteria 2697
679 Ga0495616_0069543 3300046513 Bacteria 1706
680 Ga0495616_0120015 3300046513 Bacteria 1215
681 Ga0495618_0016909 3300046514 Bacteria 4470
682 Ga0495618_0017038 3300046514 Bacteria 4452
683 Ga0495620_0062114 3300046515 Bacteria 1552
684 Ga0495628_0008438 3300046516 Bacteria 8837
685 Ga0495628_0020271 3300046516 Bacteria 5488
686 Ga0495628_0099374 3300046516 Bacteria 2247
687 Ga0495630_0026354 3300046517 Bacteria 4303
688 Ga0495630_0052952 3300046517 Bacteria 3038
689 Ga0495630_0108945 3300046517 Bacteria 2098
690 Ga0495631_0053301 3300046518 Bacteria 1765
691 Ga0495632_0146819 3300046519 Bacteria 1092
692 Ga0495643_0008913 3300046522 Bacteria 6305
693 Ga0495643_0024248 3300046522 Bacteria 3443
694 Ga0495643_0054168 3300046522 Bacteria 2149
695 Ga0495648_0000310 3300046524 Bacteria 53884
696 Ga0495648_0004195 3300046524 Bacteria 12378
697 Ga0495648_0065576 3300046524 Bacteria 2134
698 Ga0495652_0048650 3300046529 Bacteria 3631
699 Ga0495652_0082236 3300046529 Bacteria 2655
700 Ga0495652_0098568 3300046529 Bacteria 2375
701 Ga0495652_0301196 3300046529 Bacteria 1165
702 Ga0495654_0012515 3300046530 Bacteria 4554
703 Ga0495665_0000118 3300046531 Bacteria 37731
704 Ga0495665_0093347 3300046531 Bacteria 1582
705 Ga0495640_0000577 3300046533 Bacteria 27019
706 Ga0495640_0007069 3300046533 Bacteria 8837
707 Ga0495640_0007374 3300046533 Bacteria 8656
708 Ga0495640_0029434 3300046533 Bacteria 3944
709 Ga0495640_0174689 3300046533 Bacteria 1372
710 Ga0495587_0028191 3300046536 Bacteria 3416
711 Ga0495587_0069695 3300046536 Bacteria 2047
712 Ga0495587_0106991 3300046536 Bacteria 1608
713 Ga0495598_0000848 3300046537 Bacteria 5865
714 Ga0495645_0001885 3300046543 Bacteria 14254
715 Ga0495645_0006263 3300046543 Bacteria 8248
716 Ga0495645_0007903 3300046543 Bacteria 7400
717 Ga0495645_0038260 3300046543 Bacteria 3499
718 Ga0495645_0044351 3300046543 Bacteria 3244
719 Ga0495622_0011977 3300046557 Bacteria 4012
720 Ga0495622_0015444 3300046557 Bacteria 3550
721 Ga0495622_0018516 3300046557 Bacteria 3244
722 Ga0495622_0024799 3300046557 Bacteria 2800
723 Ga0495667_0002269 3300046559 Bacteria 12874
724 Ga0495667_0174073 3300046559 Bacteria 1382
725 Ga0495668_0028353 3300046616 Bacteria 3166
726 Ga0495668_0098966 3300046616 Bacteria 1596
727 Ga0495634_0007487 3300046642 Bacteria 8189
728 Ga0495634_0014131 3300046642 Bacteria 5764
729 Ga0495634_0043947 3300046642 Bacteria 3026
730 Ga0495625_0034285 3300046660 Bacteria 3747
731 Ga0495625_0161209 3300046660 Bacteria 1502
732 Ga0495635_0000434 3300046663 Bacteria 26421
733 Ga0495635_0008844 3300046663 Bacteria 7030
734 Ga0495635_0014396 3300046663 Bacteria 5533
735 Ga0495635_0053086 3300046663 Bacteria 2792
736 Ga0495635_0118597 3300046663 Bacteria 1805
737 Ga0495588_0011770 3300046674 Bacteria 4115
738 Ga0495588_0017042 3300046674 Bacteria 3520
739 Ga0495657_0005590 3300046675 Bacteria 9917
740 Ga0495657_0021545 3300046675 Bacteria 4623
741 Ga0495657_0030444 3300046675 Bacteria 3779
742 Ga0495657_0055579 3300046675 Bacteria 2640
743 Ga0495657_0074400 3300046675 Bacteria 2211
744 Ga0495599_0012640 3300046678 Bacteria 5206
745 Ga0495599_0039174 3300046678 Bacteria 2978
746 Ga0495599_0122482 3300046678 Bacteria 1616
747 Ga0495599_0124808 3300046678 Bacteria 1600
748 Ga0495623_0016473 3300046679 Bacteria 4775
749 Ga0495623_0027226 3300046679 Bacteria 3676
750 Ga0495623_0085377 3300046679 Bacteria 1946
751 Ga0495646_0009025 3300046680 Bacteria 6324
752 Ga0495646_0022497 3300046680 Bacteria 3976
753 Ga0495646_0022821 3300046680 Bacteria 3942
754 Ga0495646_0028374 3300046680 Bacteria 3505
755 Ga0495646_0058243 3300046680 Bacteria 2310
756 Ga0495647_0001407 3300046681 Bacteria 7427
757 Ga0495647_0010961 3300046681 Bacteria 3098
758 Ga0495647_0044778 3300046681 Bacteria 1698
759 Ga0495658_0000703 3300046683 Bacteria 18118
760 Ga0495658_0011805 3300046683 Bacteria 4405
761 Ga0495669_0022157 3300046684 Bacteria 2759
762 Ga0495613_0001856 3300046689 Bacteria 16097
763 Ga0495613_0021992 3300046689 Bacteria 4755
764 Ga0495613_0026316 3300046689 Bacteria 4335
765 Ga0495613_0160730 3300046689 Bacteria 1598
766 Ga0495624_0006594 3300046690 Bacteria 8220
767 Ga0495670_0028737 3300046691 Bacteria 2756
768 Ga0495671_0029736 3300046692 Bacteria 2802
769 Ga0495649_0010519 3300046694 Bacteria 5454
770 Ga0495649_0131635 3300046694 Bacteria 1320
771 Ga0495649_0216680 3300046694 Bacteria 991
772 Ga0495600_0003449 3300046809 Bacteria 9298
773 Ga0495600_0011288 3300046809 Bacteria 5563
774 Ga0495600_0112567 3300046809 Bacteria 1772
775 Ga0495600_0182838 3300046809 Bacteria 1351
776 Ga0495581_0000313 3300047315 Bacteria 23828
777 Ga0495581_0038273 3300047315 Bacteria 2775
778 Ga0495581_0276731 3300047315 Bacteria 981
779 Ga0495604_0003918 3300047317 Bacteria 11850
780 Ga0495604_0011366 3300047317 Bacteria 7064
781 Ga0495604_0044487 3300047317 Bacteria 3468
782 Ga0495604_0080997 3300047317 Bacteria 2431
783 Ga0495674_0000443 3300047319 Bacteria 37259
784 Ga0495674_0003051 3300047319 Bacteria 16285
785 Ga0495674_0022928 3300047319 Bacteria 5752
786 Ga0495674_0035111 3300047319 Bacteria 4526
787 Ga0495674_0125709 3300047319 Bacteria 2164
788 Ga0495674_0140116 3300047319 Bacteria 2033
789 Ga0495674_0147836 3300047319 Bacteria 1972
790 Ga0495672_0010289 3300047320 Bacteria 6682
791 Ga0495676_0027033 3300047321 Bacteria 4928
792 Ga0495676_0058602 3300047321 Bacteria 3029
793 Ga0495676_0074951 3300047321 Bacteria 2589
794 Ga0495680_0012949 3300047322 Bacteria 7306
795 Ga0495680_0041645 3300047322 Bacteria 3650
796 Ga0495680_0063164 3300047322 Bacteria 2844
797 Ga0495683_0034943 3300047323 Bacteria 2555
798 Ga0495683_0075237 3300047323 Bacteria 1654
799 Ga0495683_0111720 3300047323 Bacteria 1304
800 Ga0495683_0113852 3300047323 Bacteria 1289
801 Ga0495687_014616 3300047443 Bacteria 4029
802 Ga0495675_0011557 3300047444 Bacteria 5542
803 Ga0495675_0063796 3300047444 Bacteria 2330
804 Ga0495679_029272 3300047446 Bacteria 1798
805 Ga0495673_0011793 3300047469 Bacteria 4675
806 Ga0495673_0061998 3300047469 Bacteria 1599
807 Ga0495684_0000842 3300047471 Bacteria 24799
808 Ga0495684_0005571 3300047471 Bacteria 9807
809 Ga0495684_0019738 3300047471 Bacteria 5194
810 Ga0495684_0039380 3300047471 Bacteria 3623
811 Ga0495686_0004839 3300047472 Bacteria 10865
812 Ga0495686_0022543 3300047472 Bacteria 4167
813 Ga0495686_0047246 3300047472 Bacteria 2719
814 Ga0495686_0092528 3300047472 Bacteria 1834
815 Ga0495686_0140550 3300047472 Bacteria 1425
816 Ga0495593_0000039 3300047673 Bacteria 53005
817 Ga0495593_0002371 3300047673 Bacteria 11319
818 Ga0495593_0033283 3300047673 Bacteria 2807
819 Ga0495593_0135142 3300047673 Bacteria 1250
820 Ga0495602_0014899 3300048088 Bacteria 7869
821 Ga0495602_0021472 3300048088 Bacteria 6353
822 Ga0495602_0054330 3300048088 Bacteria 3537
823 Ga0495602_0057593 3300048088 Bacteria 3407
824 Ga0495614_0042233 3300048089 Bacteria 1955
825 Ga0495615_0005324 3300048090 Bacteria 2306
826 Ga0496101_0079128 3300048904 Bacteria 2427
827 Ga0496101_0138677 3300048904 Bacteria 1852
828 Ga0496102_0016408 3300048905 Bacteria 6468
829 Ga0496102_0038136 3300048905 Bacteria 4336
830 Ga0496102_0043325 3300048905 Bacteria 4080
831 Ga0496102_0046430 3300048905 Bacteria 3945
832 Ga0496102_0076234 3300048905 Bacteria 3084
833 Ga0496102_0104675 3300048905 Bacteria 2632
834 Ga0496102_0136685 3300048905 Bacteria 2297
835 Ga0496102_0415362 3300048905 Bacteria 1264
836 Ga0496103_0080164 3300048906 Bacteria 2052
837 Ga0496103_0138932 3300048906 Bacteria 1553
838 Ga0496103_0142946 3300048906 Bacteria 1531
839 Ga0496104_0002225 3300048907 Bacteria 16743
840 Ga0496104_0021761 3300048907 Bacteria 5889
841 Ga0496104_0032583 3300048907 Bacteria 4851
842 Ga0496104_0039609 3300048907 Bacteria 4412
843 Ga0496104_0054214 3300048907 Bacteria 3790
844 Ga0496104_0054726 3300048907 Bacteria 3772
845 Ga0496104_0154363 3300048907 Bacteria 2203
846 Ga0496104_0445928 3300048907 Bacteria 1206
847 Ga0496105_0001134 3300048908 Bacteria 18563
848 Ga0496105_0003701 3300048908 Bacteria 11378
849 Ga0496105_0029657 3300048908 Bacteria 4478
850 Ga0496105_0055063 3300048908 Bacteria 3284
851 Ga0496105_0097045 3300048908 Bacteria 2434
852 Ga0496106_0003366 3300048909 Bacteria 11919
853 Ga0496106_0004011 3300048909 Bacteria 11005
854 Ga0496106_0022335 3300048909 Bacteria 4699
855 Ga0496106_0060011 3300048909 Bacteria 2883
856 Ga0496106_0222247 3300048909 Bacteria 1506
857 Ga0496107_0005653 3300048910 Bacteria 8564
858 Ga0496107_0059138 3300048910 Bacteria 2773
859 Ga0496107_0156884 3300048910 Bacteria 1685
860 Ga0496108_0000891 3300048911 Bacteria 23254
861 Ga0496108_0039396 3300048911 Bacteria 3939
862 Ga0496108_0122922 3300048911 Bacteria 2227
863 Ga0496108_0165214 3300048911 Bacteria 1913
864 Ga0496109_0005103 3300048912 Bacteria 10964
865 Ga0496109_0016035 3300048912 Bacteria 6549
866 Ga0496109_0035249 3300048912 Bacteria 4512
867 Ga0496110_0054384 3300048913 Bacteria 3521
868 Ga0496110_0055397 3300048913 Bacteria 3489
869 Ga0496110_0073535 3300048913 Bacteria 3033
870 Ga0496110_0083400 3300048913 Bacteria 2851
871 Ga0496110_0093580 3300048913 Bacteria 2690
872 Ga0496110_0116184 3300048913 Bacteria 2409
873 Ga0496111_0005854 3300048914 Bacteria 7929
874 Ga0496111_0009495 3300048914 Bacteria 6497
875 Ga0496111_0018373 3300048914 Bacteria 4844
876 Ga0496111_0021273 3300048914 Bacteria 4527
877 Ga0496111_0188475 3300048914 Bacteria 1533
878 Ga0496112_0000029 3300048915 Bacteria 122291
879 Ga0496112_0001958 3300048915 Bacteria 16269
880 Ga0496112_0010230 3300048915 Bacteria 8504
881 Ga0496112_0021877 3300048915 Bacteria 6085
882 Ga0496112_0083180 3300048915 Bacteria 3165
883 Ga0496112_0156714 3300048915 Bacteria 2244
884 Ga0496112_0218641 3300048915 Bacteria 1861
885 Ga0496112_0292219 3300048915 Bacteria 1575
886 Ga0496113_0005191 3300048916 Bacteria 8099
887 Ga0496113_0013457 3300048916 Bacteria 5546
888 Ga0496113_0021994 3300048916 Bacteria 4504
889 Ga0496113_0026554 3300048916 Bacteria 4141
890 Ga0496113_0061879 3300048916 Bacteria 2825
891 Ga0496113_0132999 3300048916 Bacteria 1953
892 Ga0496114_0070227 3300048917 Bacteria 2941
893 Ga0496114_0135771 3300048917 Bacteria 2127
894 Ga0496115_0000295 3300048918 Bacteria 42998
895 Ga0496115_0057368 3300048918 Bacteria 3132
896 Ga0496115_0170190 3300048918 Bacteria 1802
897 Ga0496115_0296966 3300048918 Bacteria 1324
898 Ga0496116_0002462 3300048919 Bacteria 19411
899 Ga0496116_0037092 3300048919 Bacteria 3403
900 Ga0496117_0014848 3300048920 Bacteria 6683
901 Ga0496117_0064612 3300048920 Bacteria 2494
902 Ga0496117_0070520 3300048920 Bacteria 2346
903 Ga0496117_0082796 3300048920 Bacteria 2100
904 Ga0496118_0003033 3300048921 Bacteria 21657
905 Ga0496118_0008353 3300048921 Bacteria 10714
906 Ga0496118_0010319 3300048921 Bacteria 9262
907 Ga0496118_0019326 3300048921 Bacteria 6093
908 Ga0496118_0056974 3300048921 Bacteria 2933
909 Ga0496118_0143091 3300048921 Bacteria 1511
910 Ga0496118_0230413 3300048921 Bacteria 1069
911 Ga0496119_0004887 3300048922 Bacteria 13119
912 Ga0496119_0026140 3300048922 Bacteria 4056
913 Ga0496119_0036885 3300048922 Bacteria 3184
914 Ga0496119_0059377 3300048922 Bacteria 2298
915 Ga0496119_0116277 3300048922 Bacteria 1476
916 Ga0496120_0006736 3300048923 Bacteria 8730
917 Ga0496120_0011735 3300048923 Bacteria 6006
918 Ga0496120_0106434 3300048923 Bacteria 1472
919 Ga0496121_0002294 3300048924 Bacteria 29707
920 Ga0496121_0002330 3300048924 Bacteria 29336
921 Ga0496121_0013124 3300048924 Bacteria 8937
922 Ga0496121_0013885 3300048924 Bacteria 8613
923 Ga0496121_0021406 3300048924 Bacteria 6333
924 Ga0496121_0037884 3300048924 Bacteria 4278
925 Ga0496121_0047408 3300048924 Bacteria 3666
926 Ga0496121_0047766 3300048924 Bacteria 3648
927 Ga0496121_0051307 3300048924 Bacteria 3475
928 Ga0496121_0051853 3300048924 Bacteria 3452
929 Ga0496121_0064894 3300048924 Bacteria 2974
930 Ga0496121_0133331 3300048924 Bacteria 1855
931 Ga0496122_0108857 3300048925 Bacteria 1826
932 Ga0496124_0013819 3300048927 Bacteria 7852
933 Ga0496125_0001204 3300048928 Bacteria 38897
934 Ga0496125_0010748 3300048928 Bacteria 9221
935 Ga0496125_0062913 3300048928 Bacteria 2963
936 Ga0496125_0070496 3300048928 Bacteria 2736
937 Ga0496125_0078461 3300048928 Bacteria 2538
938 Ga0496125_0098173 3300048928 Bacteria 2167
939 Ga0496125_0105186 3300048928 Bacteria 2064
940 Ga0496125_0189618 3300048928 Bacteria 1359
941 Ga0496126_0004033 3300048929 Bacteria 17863
942 Ga0496126_0011553 3300048929 Bacteria 9119
943 Ga0496126_0022314 3300048929 Bacteria 6162
944 Ga0496126_0025463 3300048929 Bacteria 5692
945 Ga0496126_0034144 3300048929 Bacteria 4781
946 Ga0496126_0044111 3300048929 Bacteria 4109
947 Ga0496126_0052167 3300048929 Bacteria 3719
948 Ga0496126_0058202 3300048929 Bacteria 3484
949 Ga0496126_0086233 3300048929 Bacteria 2767
950 Ga0496126_0133903 3300048929 Bacteria 2139
951 Ga0496126_0154305 3300048929 Bacteria 1966
952 Ga0496126_0159952 3300048929 Bacteria 1925
953 Ga0496126_0182054 3300048929 Bacteria 1784
954 Ga0496126_0217044 3300048929 Bacteria 1609
955 Ga0496126_0262385 3300048929 Bacteria 1436
956 Ga0495682_0015605 3300049460 Bacteria 2878
957 Ga0501031_0000511 3300049568 Bacteria 22716
958 Ga0501031_0006718 3300049568 Bacteria 7503
959 Ga0501031_0023266 3300049568 Bacteria 4039
960 Ga0501032_0000073 3300049569 Bacteria 85584
961 Ga0501032_0014750 3300049569 Bacteria 5531
962 Ga0501032_0072007 3300049569 Bacteria 2303
963 Ga0501032_0204740 3300049569 Bacteria 1287
964 Ga0501033_0001342 3300049570 Bacteria 21886
965 Ga0501033_0001845 3300049570 Bacteria 18448
966 Ga0501033_0038402 3300049570 Bacteria 3579
967 Ga0501033_0056537 3300049570 Bacteria 2899
968 Ga0501033_0127481 3300049570 Bacteria 1845
969 Ga0501033_0205260 3300049570 Bacteria 1407
970 Ga0501034_0000251 3300049571 Bacteria 99406
971 Ga0501034_0032366 3300049571 Bacteria 5311
972 Ga0501034_0040843 3300049571 Bacteria 4694
973 Ga0501034_0151321 3300049571 Bacteria 2296
974 Ga0501034_0174718 3300049571 Bacteria 2114
975 Ga0501034_0392577 3300049571 Bacteria 1311
976 Ga0501036_0000036 3300049572 Bacteria 87244
977 Ga0501036_0156208 3300049572 Bacteria 1924
978 Ga0501037_0000040 3300049573 Bacteria 119364
979 Ga0501037_0020880 3300049573 Bacteria 4835
980 Ga0501037_0036094 3300049573 Bacteria 3643
981 Ga0501037_0323002 3300049573 Bacteria 1068
982 Ga0501038_0000150 3300049574 Bacteria 59508
983 Ga0501038_0005621 3300049574 Bacteria 11634
984 Ga0501038_0013948 3300049574 Bacteria 7324
985 Ga0501038_0041771 3300049574 Bacteria 3998
986 Ga0501038_0134241 3300049574 Bacteria 2029
987 Ga0501039_0001837 3300049575 Bacteria 15670
988 Ga0501039_0081341 3300049575 Bacteria 2522
989 Ga0501039_0327821 3300049575 Bacteria 1203
990 Ga0501042_0010937 3300049578 Bacteria 6110
991 Ga0501043_0000464 3300049579 Bacteria 36232
992 Ga0501043_0008498 3300049579 Bacteria 8082
993 Ga0501043_0023171 3300049579 Bacteria 4870
994 Ga0501046_0000398 3300049580 Bacteria 43497
995 Ga0501046_0184273 3300049580 Bacteria 1559
996 Ga0501046_0274822 3300049580 Bacteria 1235
997 Ga0501047_0000656 3300049581 Bacteria 36126
998 Ga0501047_0257098 3300049581 Bacteria 1594
999 Ga0501047_0282564 3300049581 Bacteria 1504
1000 Ga0501048_0002054 3300049582 Bacteria 15303
1001 Ga0501048_0161366 3300049582 Bacteria 1586
1002 Ga0501067_0000192 3300049583 Bacteria 34520
1003 Ga0501068_0008599 3300049584 Bacteria 5688
1004 Ga0501070_0002215 3300049586 Bacteria 17070
1005 Ga0501070_0128317 3300049586 Bacteria 2096
1006 Ga0501070_0174733 3300049586 Bacteria 1769
1007 Ga0501071_0101717 3300049587 Bacteria 2119
1008 Ga0501072_0001038 3300049588 Bacteria 20561
1009 Ga0501073_0000037 3300049589 Bacteria 87345
1010 Ga0501073_0004501 3300049589 Bacteria 10471
1011 Ga0501073_0143128 3300049589 Bacteria 1657
1012 Ga0501074_0000212 3300049590 Bacteria 31886
1013 Ga0501079_0002283 3300049741 Bacteria 13852
1014 Ga0501079_0012536 3300049741 Bacteria 6471
1015 Ga0501080_0000054 3300049742 Bacteria 74316
1016 Ga0501080_0114479 3300049742 Bacteria 2500
1017 Ga0501080_0188750 3300049742 Bacteria 1894
1018 Ga0501080_0191576 3300049742 Bacteria 1879
1019 Ga0501083_0001153 3300049744 Bacteria 17779
1020 Ga0501083_0006025 3300049744 Bacteria 8589
1021 Ga0501035_0000142 3300049822 Bacteria 87561
1022 Ga0501035_0001311 3300049822 Bacteria 25709
1023 Ga0501035_0040499 3300049822 Bacteria 4210
1024 Ga0501035_0096777 3300049822 Bacteria 2593
1025 Ga0501035_0106232 3300049822 Bacteria 2461
1026 Ga0501035_0186285 3300049822 Bacteria 1786
1027 Ga0501044_0000985 3300049823 Bacteria 34233
1028 Ga0501044_0005451 3300049823 Bacteria 14137
1029 Ga0501044_0043845 3300049823 Bacteria 4645
1030 Ga0501044_0090036 3300049823 Bacteria 3096
1031 Ga0501044_0168165 3300049823 Bacteria 2165
1032 Ga0501044_0326674 3300049823 Bacteria 1457
1033 Ga0501044_0329376 3300049823 Bacteria 1450
1034 Ga0501045_0008122 3300049824 Bacteria 7311
1035 Ga0501045_0009166 3300049824 Bacteria 6915
1036 nmdc:mga03683_54928_c1 3300050489 Bacteria 1671
1037 nmdc:mga03n38_31193_c1 3300050490 Bacteria 2247
1038 nmdc:mga03n38_63825_c1 3300050490 Bacteria 1684
1039 nmdc:mga00v17_114807_c1 3300050491 Bacteria 1711
1040 nmdc:mga00v17_39602_c1 3300050491 Bacteria 2823
1041 nmdc:mga00v17_52913_c1 3300050491 Bacteria 2473
1042 nmdc:mga0yw44_31040_c1 3300050492 Bacteria 3104
1043 nmdc:mga0yw44_33722_c1 3300050492 Bacteria 2994
1044 nmdc:mga0yw44_35154_c1 3300050492 Bacteria 2943
1045 nmdc:mga0k408_53176_c1 3300050493 Bacteria 2347
1046 nmdc:mga06z11_103762_c1 3300050494 Bacteria 1564
1047 nmdc:mga06z11_24305_c1 3300050494 Bacteria 2857
1048 nmdc:mga06z11_5094_c1 3300050494 Bacteria 5236
1049 nmdc:mga07m45_44572_c2 3300050496 Bacteria 2324
1050 nmdc:mga07m45_69723_c1 3300050496 Bacteria 1999
1051 nmdc:mga07m45_8273_c1 3300050496 Bacteria 5339
1052 nmdc:mga07m45_95405_c1 3300050496 Bacteria 1706
1053 nmdc:mga05p37_96716_c1 3300050507 Bacteria 3638
1054 nmdc:mga0n895_3593_c1 3300050512 Bacteria 12539
1055 nmdc:mga0n895_98808_c1 3300050512 Bacteria 2926
1056 nmdc:mga0rr50_12738_c1 3300050513 Bacteria 5448
1057 nmdc:mga0rr50_518829_c1 3300050513 Bacteria 1014
1058 nmdc:mga0sz30_22385_c2 3300050516 Bacteria 1412
1059 Ga0495601_0022363 3300053077 Bacteria 3880
1060 Ga0495601_0055598 3300053077 Bacteria 2506
1061 Ga0495601_0125553 3300053077 Bacteria 1669
1062 Ga0495612_0008650 3300053078 Bacteria 4128
1063 Ga0495612_0017970 3300053078 Bacteria 2830
1064 Ga0495612_0018844 3300053078 Bacteria 2763
1065 Ga0500635_0002159 3300053080 Bacteria 4839
1066 Ga0495595_0000869 3300053084 Bacteria 11590
1067 Ga0495619_0000617 3300053085 Bacteria 23526
1068 Ga0495619_0320311 3300053085 Bacteria 1073
1069 Ga0500643_000168 3300053087 Bacteria 64858
1070 Ga0500643_012650 3300053087 Bacteria 3015
1071 Ga0500643_012952 3300053087 Bacteria 2968
1072 Ga0500583_0002232 3300053092 Bacteria 5760
1073 Ga0500651_0041562 3300053093 Bacteria 2898
1074 Ga0500651_0088282 3300053093 Bacteria 1912
1075 Ga0500566_0000191 3300053094 Bacteria 31941
1076 Ga0500566_0004238 3300053094 Bacteria 8556
1077 Ga0500566_0011660 3300053094 Bacteria 5175
1078 Ga0500566_0055812 3300053094 Bacteria 2248
1079 Ga0500640_002832 3300053095 Bacteria 5864
1080 Ga0500641_0007929 3300053096 Bacteria 3787
1081 Ga0500641_0064727 3300053096 Bacteria 1528
1082 Ga0500650_0005221 3300053098 Bacteria 4809
1083 Ga0500650_0036809 3300053098 Bacteria 2247
1084 Ga0500555_001077 3300053103 Bacteria 9158
1085 Ga0500556_0000047 3300053104 Bacteria 126199
1086 Ga0500556_0002685 3300053104 Bacteria 5524
1087 Ga0500556_0041476 3300053104 Bacteria 1623
1088 Ga0500557_000032 3300053105 Bacteria 74032
1089 Ga0500569_056872 3300053109 Bacteria 1197
1090 Ga0500572_000153 3300053111 Bacteria 23968
1091 Ga0500572_000186 3300053111 Bacteria 21909
1092 Ga0500572_014382 3300053111 Bacteria 1976
1093 Ga0500592_010161 3300053116 Bacteria 1498
1094 Ga0500595_001727 3300053119 Bacteria 11395
1095 Ga0500595_002174 3300053119 Bacteria 9960
1096 Ga0500595_010866 3300053119 Bacteria 3593
1097 Ga0500607_046171 3300053121 Bacteria 2335
1098 Ga0500608_000229 3300053122 Bacteria 22140
1099 Ga0500608_000896 3300053122 Bacteria 10739
1100 Ga0500614_001636 3300053123 Bacteria 5280
1101 Ga0500642_0000142 3300053130 Bacteria 32016
1102 Ga0500642_0000197 3300053130 Bacteria 24598
1103 Ga0500642_0002669 3300053130 Bacteria 5272
1104 Ga0500642_0004996 3300053130 Bacteria 4228
1105 Ga0500652_001091 3300053131 Bacteria 8752
1106 Ga0500559_0000105 3300053136 Bacteria 65809
1107 Ga0500559_0001758 3300053136 Bacteria 11888
1108 Ga0500559_0006740 3300053136 Bacteria 5159
1109 Ga0500559_0022199 3300053136 Bacteria 2692
1110 Ga0500559_0031101 3300053136 Bacteria 2289
1111 Ga0500561_0012590 3300053137 Bacteria 1808
1112 Ga0500564_017343 3300053138 Bacteria 3271
1113 Ga0500568_0004453 3300053139 Bacteria 7481
1114 Ga0500568_0012641 3300053139 Bacteria 3876
1115 Ga0500568_0057381 3300053139 Bacteria 1515
1116 Ga0500573_0041265 3300053140 Bacteria 2663
1117 Ga0500577_0039956 3300053142 Bacteria 1703
1118 Ga0500577_0045769 3300053142 Bacteria 1618
1119 Ga0500577_0069803 3300053142 Bacteria 1375
1120 Ga0500590_045744 3300053148 Bacteria 2239
1121 Ga0500590_099125 3300053148 Bacteria 1402
1122 Ga0500603_002116 3300053150 Bacteria 4398
1123 Ga0500604_0014548 3300053151 Bacteria 2144
1124 Ga0500616_0000038 3300053153 Bacteria 386801
1125 Ga0500616_0000784 3300053153 Bacteria 36530
1126 Ga0500616_0006953 3300053153 Bacteria 7287
1127 Ga0500619_033075 3300053154 Bacteria 1589
1128 Ga0500619_057190 3300053154 Bacteria 1276
1129 Ga0500622_0005469 3300053156 Bacteria 7625
1130 Ga0500622_0012272 3300053156 Bacteria 4645
1131 Ga0500624_006620 3300053157 Bacteria 1572
1132 Ga0500627_0022311 3300053158 Bacteria 2566
1133 Ga0500630_002217 3300053159 Bacteria 9399
1134 Ga0500638_001436 3300053162 Bacteria 7473
1135 Ga0500638_131217 3300053162 Bacteria 1135
1136 Ga0500639_000031 3300053163 Bacteria 69938
1137 Ga0500639_015280 3300053163 Unclassified 4041
1138 Ga0500639_044784 3300053163 Bacteria 2317
1139 Ga0500636_0000990 3300053177 Bacteria 15245
1140 Ga0500636_0003222 3300053177 Bacteria 9139
1141 Ga0500636_0035756 3300053177 Bacteria 2938
1142 Ga0500637_0000519 3300053178 Bacteria 15026
1143 Ga0500637_0005808 3300053178 Bacteria 6011
1144 Ga0500637_0025159 3300053178 Bacteria 3269
1145 Ga0500637_0083276 3300053178 Bacteria 1848
1146 Ga0500576_092262 3300053725 Bacteria 1255
1147 Ga0500625_015418 3300053729 Bacteria 3545
1148 Ga0500645_009851 3300053730 Bacteria 3193
1149 Ga0500596_001012 3300053735 Bacteria 5632
1150 Ga0501084_0007428 3300054114 Bacteria 9034
1151 Ga0501084_0011305 3300054114 Bacteria 7391
1152 Ga0501082_0004487 3300060353 Bacteria 12195
1153 Ga0501082_0012051 3300060353 Bacteria 7429

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8019678201 8019687292 269
2 3300049580 Ga0501046_0274822 Ga0501046_0274822_161_1087 273
3 3300046455 Ga0495603_0017687 Ga0495603_0017687_1490_2452 277
4 3300046529 Ga0495652_0301196 Ga0495652_0301196_10_987 278
5 3300005435 Ga0070714_100207719 Ga0070714_1002077192 282
6 3300006175 Ga0070712_100178765 Ga0070712_1001787652 282
7 3300025929 Ga0207664_10203364 Ga0207664_102033641 282
8 3300037418 Ga0395900_0518763 Ga0395900_0518763_19_951 283
9 3300046512 Ga0495610_0131250 Ga0495610_0131250_137_1069 283
10 3300046533 Ga0495640_0029434 Ga0495640_0029434_2975_3907 283
11 3300046557 Ga0495622_0024799 Ga0495622_0024799_1848_2780 283
12 3300047673 Ga0495593_0033283 Ga0495593_0033283_1863_2795 283
13 3300053136 Ga0500559_0006740 Ga0500559_0006740_17_949 283
14 3300005329 Ga0070683_100106272 Ga0070683_1001062722 284
15 3300005535 Ga0070684_100129222 Ga0070684_1001292222 284
16 3300046694 Ga0495649_0216680 Ga0495649_0216680_26_958 284
17 3300053105 Ga0500557_000032 Ga0500557_000032_34876_35802 284
18 3300053109 Ga0500569_056872 Ga0500569_056872_247_1179 284
19 3300053729 Ga0500625_015418 Ga0500625_015418_2079_3005 284
20 3300003659 JGI25404J52841_10009784 JGI25404J52841_100097841 285
21 3300005983 Ga0081540_1002063 Ga0081540_10020635 285
22 3300046694 Ga0495649_0131635 Ga0495649_0131635_359_1291 285
23 3300047315 Ga0495581_0276731 Ga0495581_0276731_23_955 285
24 3300049822 Ga0501035_0106232 Ga0501035_0106232_27_962 285
25 3300005455 Ga0070663_100257304 Ga0070663_1002573042 286
26 3300007788 Ga0099795_10004122 Ga0099795_100041223 286
27 3300010159 Ga0099796_10016174 Ga0099796_100161741 286
28 3300026067 Ga0207678_10062086 Ga0207678_100620862 286
29 3300027512 Ga0209179_1013565 Ga0209179_10135652 286
30 3300046501 Ga0495607_0103065 Ga0495607_0103065_556_1488 286
31 3300047469 Ga0495673_0061998 Ga0495673_0061998_640_1572 286
32 3300048928 Ga0496125_0189618 Ga0496125_0189618_21_953 286
33 3300045049 Ga0466959_0213159 Ga0466959_0213159_173_1147 287
34 iso_pu_bacteria 2824600985 2824603652 287
35 iso_pu_bacteria 2824609381 2824610762 287
36 iso_pu_bacteria 2824653114 2824660505 287
37 iso_pu_bacteria 2824661429 2824667370 287
38 iso_pu_bacteria 2888419890 2888421204 287
39 iso_pu_bacteria 2893066018 2893066359 287
40 iso_pu_bacteria 2906643746 2906646755 287
41 3300013307 Ga0157372_10399237 Ga0157372_103992372 288
42 3300046616 Ga0495668_0028353 Ga0495668_0028353_1444_2367 288
43 3300048929 Ga0496126_0159952 Ga0496126_0159952_19_951 288
44 3300053085 Ga0495619_0320311 Ga0495619_0320311_22_978 288
45 3300046454 Ga0495592_0058954 Ga0495592_0058954_1456_2412 289
46 3300046462 Ga0495651_0083973 Ga0495651_0083973_874_1830 289
47 3300046531 Ga0495665_0093347 Ga0495665_0093347_614_1546 289
48 3300047317 Ga0495604_0080997 Ga0495604_0080997_390_1346 289
49 3300048922 Ga0496119_0059377 Ga0496119_0059377_19_969 289
50 3300053104 Ga0500556_0002685 Ga0500556_0002685_3761_4693 289
51 3300053142 Ga0500577_0069803 Ga0500577_0069803_187_1119 289
52 3300053153 Ga0500616_0006953 Ga0500616_0006953_3989_4921 289
53 3300053156 Ga0500622_0012272 Ga0500622_0012272_1311_2243 289
54 3300025924 Ga0207694_10023031 Ga0207694_100230313 293
55 3300031247 Ga0265340_10028634 Ga0265340_100286342 293
56 3300031249 Ga0265339_10000281 Ga0265339_1000028123 293
57 3300048929 Ga0496126_0154305 Ga0496126_0154305_401_1363 293
58 3300049570 Ga0501033_0127481 Ga0501033_0127481_608_1585 293
59 3300049571 Ga0501034_0040843 Ga0501034_0040843_2587_3564 293
60 3300049574 Ga0501038_0134241 Ga0501038_0134241_72_1049 293
61 3300049575 Ga0501039_0081341 Ga0501039_0081341_1166_2143 293
62 3300049581 Ga0501047_0257098 Ga0501047_0257098_383_1360 293
63 3300049586 Ga0501070_0174733 Ga0501070_0174733_117_1094 293
64 3300053119 Ga0500595_001727 Ga0500595_001727_8408_9370 293
65 3300053162 Ga0500638_001436 Ga0500638_001436_6056_7018 293
66 3300021384 Ga0213876_10040722 Ga0213876_100407222 294
67 3300037068 Ga0373925_0285739 Ga0373925_0285739_14_988 294
68 3300039438 Ga0436360_0432344 Ga0436360_0432344_1285_2259 294
69 3300039453 Ga0436362_0516204 Ga0436362_0516204_389_1363 294
70 3300046473 Ga0495582_0080994 Ga0495582_0080994_163_1137 294
71 3300046681 Ga0495647_0044778 Ga0495647_0044778_67_1041 294
72 3300046683 Ga0495658_0011805 Ga0495658_0011805_1747_2721 294
73 3300053148 Ga0500590_099125 Ga0500590_099125_372_1334 294
74 3300035691 Ga0373931_0057983 Ga0373931_0057983_165_1142 295
75 3300046462 Ga0495651_0010973 Ga0495651_0010973_1792_2766 295
76 3300046675 Ga0495657_0074400 Ga0495657_0074400_1057_2031 295
77 3300005458 Ga0070681_10077923 Ga0070681_100779233 296
78 3300011119 Ga0105246_10249314 Ga0105246_102493142 296
79 3300031250 Ga0265331_10013782 Ga0265331_100137823 296
80 3300031711 Ga0265314_10075804 Ga0265314_100758041 296
81 3300031712 Ga0265342_10004319 Ga0265342_100043198 296
82 3300039437 Ga0436365_1233391 Ga0436365_1233391_3505_4479 296
83 3300044684 Ga0466966_0076811 Ga0466966_0076811_155_1129 296
84 3300044842 Ga0466957_0036799 Ga0466957_0036799_1242_2216 296
85 3300045049 Ga0466959_0048682 Ga0466959_0048682_630_1604 296
86 3300048915 Ga0496112_0156714 Ga0496112_0156714_1258_2232 296
87 3300048929 Ga0496126_0086233 Ga0496126_0086233_1044_2018 296
88 3300003215 JGI25153J46596_10005221 JGI25153J46596_100052216 297
89 3300003215 JGI25153J46596_10005329 JGI25153J46596_100053293 297
90 3300003354 JGI25160J50197_1002246 JGI25160J50197_10022463 297
91 3300003794 Ga0055531_10002655 Ga0055531_100026554 297
92 3300005329 Ga0070683_100047292 Ga0070683_1000472923 297
93 3300005335 Ga0070666_10064994 Ga0070666_100649942 297
94 3300005340 Ga0070689_100017900 Ga0070689_1000179004 297
95 3300005353 Ga0070669_100110039 Ga0070669_1001100392 297
96 3300005355 Ga0070671_100001845 Ga0070671_1000018458 297
97 3300005355 Ga0070671_100043091 Ga0070671_1000430913 297
98 3300005364 Ga0070673_100002424 Ga0070673_10000242410 297
99 3300005365 Ga0070688_100200220 Ga0070688_1002002202 297
100 3300005366 Ga0070659_100126238 Ga0070659_1001262382 297
101 3300005367 Ga0070667_100019427 Ga0070667_1000194275 297
102 3300005434 Ga0070709_10004543 Ga0070709_100045434 297
103 3300005435 Ga0070714_100002945 Ga0070714_10000294511 297
104 3300005437 Ga0070710_10000251 Ga0070710_100002515 297
105 3300005439 Ga0070711_100000261 Ga0070711_10000026120 297
106 3300005439 Ga0070711_100006208 Ga0070711_1000062086 297
107 3300005456 Ga0070678_100227861 Ga0070678_1002278612 297
108 3300005457 Ga0070662_100049507 Ga0070662_1000495072 297
109 3300005458 Ga0070681_10494262 Ga0070681_104942622 297
110 3300005530 Ga0070679_100040368 Ga0070679_1000403684 297
111 3300005530 Ga0070679_100057989 Ga0070679_1000579893 297
112 3300005539 Ga0068853_100076182 Ga0068853_1000761822 297
113 3300005539 Ga0068853_100099554 Ga0068853_1000995542 297
114 3300005543 Ga0070672_100193157 Ga0070672_1001931572 297
115 3300005548 Ga0070665_100009999 Ga0070665_1000099997 297
116 3300005548 Ga0070665_100080134 Ga0070665_1000801343 297
117 3300005563 Ga0068855_100032380 Ga0068855_1000323803 297
118 3300005563 Ga0068855_100138815 Ga0068855_1001388153 297
119 3300005614 Ga0068856_100240006 Ga0068856_1002400062 297
120 3300005718 Ga0068866_10059241 Ga0068866_100592412 297
121 3300005842 Ga0068858_100078409 Ga0068858_1000784091 297
122 3300005937 Ga0081455_10018080 Ga0081455_100180806 297
123 3300005937 Ga0081455_10042185 Ga0081455_100421853 297
124 3300005937 Ga0081455_10079511 Ga0081455_100795112 297
125 3300005981 Ga0081538_10032966 Ga0081538_100329662 297
126 3300005983 Ga0081540_1024847 Ga0081540_10248472 297
127 3300005985 Ga0081539_10000157 Ga0081539_100001573 297
128 3300005985 Ga0081539_10033396 Ga0081539_100333963 297
129 3300006028 Ga0070717_10007408 Ga0070717_100074084 297
130 3300006048 Ga0075363_100105108 Ga0075363_1001051082 297
131 3300006163 Ga0070715_10000749 Ga0070715_100007492 297
132 3300006175 Ga0070712_100128675 Ga0070712_1001286752 297
133 3300006195 Ga0075366_10036589 Ga0075366_100365892 297
134 3300009093 Ga0105240_10011324 Ga0105240_100113248 297
135 3300009094 Ga0111539_10331660 Ga0111539_103316602 297
136 3300009098 Ga0105245_10074417 Ga0105245_100744173 297
137 3300009101 Ga0105247_10219484 Ga0105247_102194841 297
138 3300009174 Ga0105241_10057927 Ga0105241_100579272 297
139 3300009174 Ga0105241_10109572 Ga0105241_101095723 297
140 3300009177 Ga0105248_10091835 Ga0105248_100918353 297
141 3300009545 Ga0105237_10002118 Ga0105237_1000211812 297
142 3300009545 Ga0105237_10023062 Ga0105237_100230625 297
143 3300009545 Ga0105237_10154200 Ga0105237_101542002 297
144 3300009545 Ga0105237_10319612 Ga0105237_103196122 297
145 3300009551 Ga0105238_10043133 Ga0105238_100431334 297
146 3300009551 Ga0105238_10261492 Ga0105238_102614922 297
147 3300009553 Ga0105249_10258761 Ga0105249_102587612 297
148 3300010375 Ga0105239_10065937 Ga0105239_100659373 297
149 3300010375 Ga0105239_10086632 Ga0105239_100866322 297
150 3300010375 Ga0105239_10091614 Ga0105239_100916142 297
151 3300010375 Ga0105239_10133631 Ga0105239_101336313 297
152 3300011119 Ga0105246_10011111 Ga0105246_100111113 297
153 3300013105 Ga0157369_10023959 Ga0157369_100239592 297
154 3300013296 Ga0157374_10166903 Ga0157374_101669032 297
155 3300013306 Ga0163162_10271476 Ga0163162_102714762 297
156 3300013307 Ga0157372_10178769 Ga0157372_101787692 297
157 3300013308 Ga0157375_10251039 Ga0157375_102510392 297
158 3300014325 Ga0163163_10029087 Ga0163163_100290872 297
159 3300014325 Ga0163163_10313023 Ga0163163_103130231 297
160 3300021384 Ga0213876_10095749 Ga0213876_100957492 297
161 3300025245 Ga0207425_1017907 Ga0207425_10179072 297
162 3300025261 Ga0209233_1008776 Ga0209233_10087762 297
163 3300025297 Ga0209758_1000206 Ga0209758_100020622 297
164 3300025297 Ga0209758_1000536 Ga0209758_100053620 297
165 3300025297 Ga0209758_1003319 Ga0209758_100331915 297
166 3300025299 Ga0209256_1009447 Ga0209256_10094473 297
167 3300025302 Ga0207426_1001183 Ga0207426_10011839 297
168 3300025302 Ga0207426_1008206 Ga0207426_10082063 297
169 3300025302 Ga0207426_1013106 Ga0207426_10131062 297
170 3300025304 Ga0209257_1000394 Ga0209257_100039422 297
171 3300025900 Ga0207710_10099970 Ga0207710_100999701 297
172 3300025903 Ga0207680_10056509 Ga0207680_100565092 297
173 3300025904 Ga0207647_10010156 Ga0207647_100101567 297
174 3300025905 Ga0207685_10000368 Ga0207685_100003683 297
175 3300025906 Ga0207699_10000967 Ga0207699_100009674 297
176 3300025907 Ga0207645_10164429 Ga0207645_101644292 297
177 3300025912 Ga0207707_10007092 Ga0207707_100070927 297
178 3300025912 Ga0207707_10024841 Ga0207707_100248413 297
179 3300025913 Ga0207695_10000006 Ga0207695_10000006600 297
180 3300025914 Ga0207671_10025726 Ga0207671_100257263 297
181 3300025915 Ga0207693_10003226 Ga0207693_100032265 297
182 3300025915 Ga0207693_10026017 Ga0207693_100260174 297
183 3300025916 Ga0207663_10000161 Ga0207663_1000016118 297
184 3300025916 Ga0207663_10042512 Ga0207663_100425122 297
185 3300025921 Ga0207652_10049105 Ga0207652_100491052 297
186 3300025928 Ga0207700_10013500 Ga0207700_100135002 297
187 3300025928 Ga0207700_10115258 Ga0207700_101152582 297
188 3300025929 Ga0207664_10008456 Ga0207664_100084564 297
189 3300025931 Ga0207644_10005690 Ga0207644_100056904 297
190 3300025931 Ga0207644_10077679 Ga0207644_100776791 297
191 3300025931 Ga0207644_10253037 Ga0207644_102530371 297
192 3300025933 Ga0207706_10170125 Ga0207706_101701251 297
193 3300025936 Ga0207670_10012710 Ga0207670_100127102 297
194 3300025936 Ga0207670_10361656 Ga0207670_103616562 297
195 3300025939 Ga0207665_10000183 Ga0207665_1000018323 297
196 3300025949 Ga0207667_10123190 Ga0207667_101231903 297
197 3300025949 Ga0207667_10214888 Ga0207667_102148882 297
198 3300025960 Ga0207651_10106993 Ga0207651_101069932 297
199 3300025972 Ga0207668_10069284 Ga0207668_100692843 297
200 3300026035 Ga0207703_10116608 Ga0207703_101166082 297
201 3300026075 Ga0207708_10126365 Ga0207708_101263652 297
202 3300026078 Ga0207702_10621278 Ga0207702_106212781 297
203 3300027296 Ga0209389_1000034 Ga0209389_100003498 297
204 3300027296 Ga0209389_1000039 Ga0209389_100003998 297
205 3300027357 Ga0209589_1000038 Ga0209589_100003822 297
206 3300027361 Ga0209489_100023 Ga0209489_100023171 297
207 3300027361 Ga0209489_100087 Ga0209489_10008798 297
208 3300027363 Ga0209700_100090 Ga0209700_10009018 297
209 3300028379 Ga0268266_10008468 Ga0268266_1000846810 297
210 3300028786 Ga0307517_10002317 Ga0307517_1000231719 297
211 3300028794 Ga0307515_10012851 Ga0307515_100128515 297
212 3300031731 Ga0307405_10064526 Ga0307405_100645263 297
213 3300031824 Ga0307413_10038316 Ga0307413_100383163 297
214 3300031852 Ga0307410_10255565 Ga0307410_102555651 297
215 3300031903 Ga0307407_10156931 Ga0307407_101569312 297
216 3300031911 Ga0307412_10065284 Ga0307412_100652843 297
217 3300031995 Ga0307409_100127681 Ga0307409_1001276811 297
218 3300032002 Ga0307416_100161927 Ga0307416_1001619272 297
219 3300032126 Ga0307415_100235560 Ga0307415_1002355602 297
220 3300032126 Ga0307415_100255907 Ga0307415_1002559072 297
221 3300033180 Ga0307510_10019169 Ga0307510_100191692 297
222 3300035112 Ga0373932_0013293 Ga0373932_0013293_278_1258 297
223 3300035120 Ga0373957_0021723 Ga0373957_0021723_281_1255 297
224 3300035691 Ga0373931_0003491 Ga0373931_0003491_4309_5289 297
225 3300037471 Ga0395905_0001273 Ga0395905_0001273_28922_29896 297
226 3300037853 Ga0436364_1544624 Ga0436364_1544624_2245_3219 297
227 3300044658 Ga0466972_0000053 Ga0466972_0000053_22343_23317 297
228 3300046459 Ga0495629_0006986 Ga0495629_0006986_4010_4984 297
229 3300046461 Ga0495641_0026182 Ga0495641_0026182_491_1465 297
230 3300046462 Ga0495651_0005847 Ga0495651_0005847_6867_7841 297
231 3300046500 Ga0495596_0067221 Ga0495596_0067221_86_1060 297
232 3300046511 Ga0495608_0035589 Ga0495608_0035589_2184_3158 297
233 3300046514 Ga0495618_0016909 Ga0495618_0016909_1709_2683 297
234 3300046522 Ga0495643_0008913 Ga0495643_0008913_2715_3689 297
235 3300046536 Ga0495587_0069695 Ga0495587_0069695_265_1239 297
236 3300046543 Ga0495645_0007903 Ga0495645_0007903_6381_7355 297
237 3300046660 Ga0495625_0161209 Ga0495625_0161209_303_1277 297
238 3300046663 Ga0495635_0014396 Ga0495635_0014396_1708_2682 297
239 3300046675 Ga0495657_0030444 Ga0495657_0030444_2210_3184 297
240 3300046679 Ga0495623_0016473 Ga0495623_0016473_354_1328 297
241 3300046680 Ga0495646_0028374 Ga0495646_0028374_370_1344 297
242 3300046692 Ga0495671_0029736 Ga0495671_0029736_367_1341 297
243 3300046809 Ga0495600_0112567 Ga0495600_0112567_194_1168 297
244 3300047317 Ga0495604_0003918 Ga0495604_0003918_4010_4984 297
245 3300047319 Ga0495674_0035111 Ga0495674_0035111_1964_2938 297
246 3300047319 Ga0495674_0125709 Ga0495674_0125709_419_1399 297
247 3300047321 Ga0495676_0027033 Ga0495676_0027033_1437_2411 297
248 3300047322 Ga0495680_0063164 Ga0495680_0063164_1701_2675 297
249 3300047323 Ga0495683_0034943 Ga0495683_0034943_853_1827 297
250 3300047323 Ga0495683_0113852 Ga0495683_0113852_46_1020 297
251 3300047444 Ga0495675_0011557 Ga0495675_0011557_1736_2710 297
252 3300047446 Ga0495679_029272 Ga0495679_029272_184_1158 297
253 3300048088 Ga0495602_0014899 Ga0495602_0014899_6597_7571 297
254 3300048088 Ga0495602_0054330 Ga0495602_0054330_506_1480 297
255 3300048904 Ga0496101_0138677 Ga0496101_0138677_264_1244 297
256 3300048905 Ga0496102_0043325 Ga0496102_0043325_1723_2697 297
257 3300048905 Ga0496102_0046430 Ga0496102_0046430_733_1713 297
258 3300048905 Ga0496102_0136685 Ga0496102_0136685_1258_2229 297
259 3300048906 Ga0496103_0080164 Ga0496103_0080164_733_1707 297
260 3300048907 Ga0496104_0002225 Ga0496104_0002225_7554_8528 297
261 3300048907 Ga0496104_0054214 Ga0496104_0054214_200_1174 297
262 3300048907 Ga0496104_0054726 Ga0496104_0054726_1347_2318 297
263 3300048907 Ga0496104_0445928 Ga0496104_0445928_134_1108 297
264 3300048908 Ga0496105_0001134 Ga0496105_0001134_2127_3101 297
265 3300048908 Ga0496105_0055063 Ga0496105_0055063_707_1687 297
266 3300048911 Ga0496108_0039396 Ga0496108_0039396_856_1836 297
267 3300048911 Ga0496108_0122922 Ga0496108_0122922_940_1914 297
268 3300048913 Ga0496110_0073535 Ga0496110_0073535_1359_2333 297
269 3300048913 Ga0496110_0093580 Ga0496110_0093580_328_1308 297
270 3300048913 Ga0496110_0116184 Ga0496110_0116184_673_1644 297
271 3300048914 Ga0496111_0009495 Ga0496111_0009495_2230_3210 297
272 3300048915 Ga0496112_0021877 Ga0496112_0021877_4341_5321 297
273 3300048915 Ga0496112_0083180 Ga0496112_0083180_982_1953 297
274 3300048916 Ga0496113_0013457 Ga0496113_0013457_3929_4909 297
275 3300048916 Ga0496113_0061879 Ga0496113_0061879_881_1855 297
276 3300048917 Ga0496114_0135771 Ga0496114_0135771_100_1074 297
277 3300048918 Ga0496115_0057368 Ga0496115_0057368_1988_2959 297
278 3300048918 Ga0496115_0170190 Ga0496115_0170190_700_1674 297
279 3300048920 Ga0496117_0064612 Ga0496117_0064612_1500_2474 297
280 3300048921 Ga0496118_0056974 Ga0496118_0056974_1712_2686 297
281 3300048922 Ga0496119_0004887 Ga0496119_0004887_9970_10944 297
282 3300048923 Ga0496120_0006736 Ga0496120_0006736_2650_3624 297
283 3300048924 Ga0496121_0037884 Ga0496121_0037884_1865_2839 297
284 3300048928 Ga0496125_0070496 Ga0496125_0070496_693_1667 297
285 3300048928 Ga0496125_0078461 Ga0496125_0078461_1433_2407 297
286 3300048929 Ga0496126_0058202 Ga0496126_0058202_2100_3074 297
287 3300049571 Ga0501034_0151321 Ga0501034_0151321_1046_2023 297
288 3300049575 Ga0501039_0327821 Ga0501039_0327821_57_1031 297
289 3300049579 Ga0501043_0008498 Ga0501043_0008498_1529_2506 297
290 3300050489 nmdc:mga03683_54928_c1 nmdc:mga03683_54928_c1_90_1064 297
291 3300050490 nmdc:mga03n38_63825_c1 nmdc:mga03n38_63825_c1_326_1300 297
292 3300050492 nmdc:mga0yw44_35154_c1 nmdc:mga0yw44_35154_c1_1159_2133 297
293 3300050496 nmdc:mga07m45_8273_c1 nmdc:mga07m45_8273_c1_2738_3712 297
294 3300050496 nmdc:mga07m45_95405_c1 nmdc:mga07m45_95405_c1_181_1155 297
295 3300053093 Ga0500651_0041562 Ga0500651_0041562_146_1120 297
296 3300053096 Ga0500641_0064727 Ga0500641_0064727_192_1166 297
297 3300053137 Ga0500561_0012590 Ga0500561_0012590_665_1639 297
298 3300053151 Ga0500604_0014548 Ga0500604_0014548_577_1551 297
299 3300053153 Ga0500616_0000038 Ga0500616_0000038_328480_329457 297
300 3300002070 JGI24750J21931_1003837 JGI24750J21931_10038372 298
301 3300002244 JGI24742J22300_10002754 JGI24742J22300_100027542 298
302 3300003214 JGI25165J46597_1004140 JGI25165J46597_10041403 298
303 3300003215 JGI25153J46596_10004406 JGI25153J46596_100044061 298
304 3300004625 Ga0055543_1001363 Ga0055543_10013634 298
305 3300005262 Ga0065165_1000982 Ga0065165_100098219 298
306 3300005329 Ga0070683_100102927 Ga0070683_1001029271 298
307 3300005366 Ga0070659_100069509 Ga0070659_1000695093 298
308 3300005435 Ga0070714_100106715 Ga0070714_1001067153 298
309 3300005441 Ga0070700_100026245 Ga0070700_1000262452 298
310 3300005455 Ga0070663_100022555 Ga0070663_1000225553 298
311 3300005467 Ga0070706_100303288 Ga0070706_1003032882 298
312 3300005468 Ga0070707_100362581 Ga0070707_1003625812 298
313 3300005518 Ga0070699_100525571 Ga0070699_1005255711 298
314 3300005544 Ga0070686_100050421 Ga0070686_1000504213 298
315 3300005548 Ga0070665_100043790 Ga0070665_1000437903 298
316 3300005548 Ga0070665_100103205 Ga0070665_1001032052 298
317 3300005614 Ga0068856_100000137 Ga0068856_10000013769 298
318 3300005718 Ga0068866_10021348 Ga0068866_100213483 298
319 3300005719 Ga0068861_100119117 Ga0068861_1001191172 298
320 3300005983 Ga0081540_1035426 Ga0081540_10354262 298
321 3300005983 Ga0081540_1062350 Ga0081540_10623501 298
322 3300006038 Ga0075365_10021213 Ga0075365_100212133 298
323 3300006051 Ga0075364_10067575 Ga0075364_100675752 298
324 3300006186 Ga0075369_10078004 Ga0075369_100780042 298
325 3300006195 Ga0075366_10089529 Ga0075366_100895292 298
326 3300006353 Ga0075370_10013631 Ga0075370_100136313 298
327 3300007265 Ga0099794_10081608 Ga0099794_100816082 298
328 3300009093 Ga0105240_10046776 Ga0105240_100467763 298
329 3300009093 Ga0105240_10067164 Ga0105240_100671643 298
330 3300011119 Ga0105246_10056087 Ga0105246_100560873 298
331 3300013104 Ga0157370_10109493 Ga0157370_101094933 298
332 3300013105 Ga0157369_10003351 Ga0157369_1000335118 298
333 3300013297 Ga0157378_10118327 Ga0157378_101183272 298
334 3300013306 Ga0163162_10092404 Ga0163162_100924042 298
335 3300013307 Ga0157372_10560699 Ga0157372_105606992 298
336 3300021384 Ga0213876_10029749 Ga0213876_100297492 298
337 3300025254 Ga0209148_1000321 Ga0209148_100032136 298
338 3300025261 Ga0209233_1008676 Ga0209233_10086763 298
339 3300025261 Ga0209233_1008870 Ga0209233_10088703 298
340 3300025272 Ga0209455_1001351 Ga0209455_10013519 298
341 3300025297 Ga0209758_1005044 Ga0209758_100504411 298
342 3300025907 Ga0207645_10029692 Ga0207645_100296923 298
343 3300025913 Ga0207695_10044192 Ga0207695_100441923 298
344 3300025915 Ga0207693_10051991 Ga0207693_100519912 298
345 3300025918 Ga0207662_10176548 Ga0207662_101765481 298
346 3300025921 Ga0207652_10065919 Ga0207652_100659192 298
347 3300025923 Ga0207681_10099713 Ga0207681_100997132 298
348 3300025927 Ga0207687_10051832 Ga0207687_100518323 298
349 3300025928 Ga0207700_10042747 Ga0207700_100427475 298
350 3300025934 Ga0207686_10037403 Ga0207686_100374032 298
351 3300025935 Ga0207709_10206519 Ga0207709_102065192 298
352 3300025937 Ga0207669_10020230 Ga0207669_100202302 298
353 3300025938 Ga0207704_10056141 Ga0207704_100561413 298
354 3300025941 Ga0207711_10352832 Ga0207711_103528321 298
355 3300025944 Ga0207661_10000828 Ga0207661_1000082816 298
356 3300025949 Ga0207667_10194358 Ga0207667_101943581 298
357 3300026067 Ga0207678_10121298 Ga0207678_101212982 298
358 3300026075 Ga0207708_10021890 Ga0207708_100218903 298
359 3300026078 Ga0207702_10000063 Ga0207702_1000006366 298
360 3300026088 Ga0207641_10155908 Ga0207641_101559082 298
361 3300026142 Ga0207698_10082645 Ga0207698_100826452 298
362 3300026142 Ga0207698_10581656 Ga0207698_105816561 298
363 3300028379 Ga0268266_10002818 Ga0268266_1000281813 298
364 3300028379 Ga0268266_10064786 Ga0268266_100647863 298
365 3300028379 Ga0268266_10107480 Ga0268266_101074803 298
366 3300028380 Ga0268265_10188346 Ga0268265_101883462 298
367 3300028381 Ga0268264_10056082 Ga0268264_100560823 298
368 3300031548 Ga0307408_100131833 Ga0307408_1001318332 298
369 3300031995 Ga0307409_100145191 Ga0307409_1001451912 298
370 3300035086 Ga0373934_0001556 Ga0373934_0001556_4161_5135 298
371 3300035111 Ga0373923_0012481 Ga0373923_0012481_923_1897 298
372 3300035117 Ga0373953_0004296 Ga0373953_0004296_2004_2978 298
373 3300035118 Ga0373954_0001461 Ga0373954_0001461_6040_7014 298
374 3300035119 Ga0373956_0050751 Ga0373956_0050751_258_1232 298
375 3300035172 Ga0373955_0003672 Ga0373955_0003672_677_1651 298
376 3300035410 Ga0373924_0003160 Ga0373924_0003160_3531_4505 298
377 3300035724 Ga0373933_0000105 Ga0373933_0000105_48965_49939 298
378 3300035724 Ga0373933_0060127 Ga0373933_0060127_422_1396 298
379 3300036401 Ga0373937_0310831 Ga0373937_0310831_495_1469 298
380 3300037418 Ga0395900_0047303 Ga0395900_0047303_1703_2677 298
381 3300037466 Ga0395898_0013732 Ga0395898_0013732_1989_2963 298
382 3300038443 Ga0395901_0010282 Ga0395901_0010282_4225_5199 298
383 3300039437 Ga0436365_0353256 Ga0436365_0353256_830_1804 298
384 3300046454 Ga0495592_0008007 Ga0495592_0008007_6110_7084 298
385 3300046462 Ga0495651_0053752 Ga0495651_0053752_895_1869 298
386 3300046463 Ga0495653_0032452 Ga0495653_0032452_1471_2445 298
387 3300046477 Ga0495664_0005407 Ga0495664_0005407_5763_6737 298
388 3300046511 Ga0495608_0021075 Ga0495608_0021075_99_1073 298
389 3300046514 Ga0495618_0017038 Ga0495618_0017038_779_1753 298
390 3300046516 Ga0495628_0008438 Ga0495628_0008438_2020_2994 298
391 3300046517 Ga0495630_0108945 Ga0495630_0108945_19_993 298
392 3300046519 Ga0495632_0146819 Ga0495632_0146819_89_1063 298
393 3300046524 Ga0495648_0000310 Ga0495648_0000310_44801_45775 298
394 3300046529 Ga0495652_0098568 Ga0495652_0098568_1082_2056 298
395 3300046533 Ga0495640_0174689 Ga0495640_0174689_254_1228 298
396 3300046536 Ga0495587_0106991 Ga0495587_0106991_495_1469 298
397 3300046543 Ga0495645_0001885 Ga0495645_0001885_5648_6622 298
398 3300046559 Ga0495667_0174073 Ga0495667_0174073_295_1269 298
399 3300046642 Ga0495634_0043947 Ga0495634_0043947_1226_2200 298
400 3300046663 Ga0495635_0053086 Ga0495635_0053086_895_1869 298
401 3300046675 Ga0495657_0005590 Ga0495657_0005590_2703_3677 298
402 3300046678 Ga0495599_0012640 Ga0495599_0012640_3531_4505 298
403 3300046679 Ga0495623_0027226 Ga0495623_0027226_594_1568 298
404 3300046680 Ga0495646_0022497 Ga0495646_0022497_173_1147 298
405 3300046689 Ga0495613_0021992 Ga0495613_0021992_2083_3057 298
406 3300046809 Ga0495600_0003449 Ga0495600_0003449_8009_8983 298
407 3300047317 Ga0495604_0044487 Ga0495604_0044487_1319_2293 298
408 3300047319 Ga0495674_0140116 Ga0495674_0140116_723_1697 298
409 3300047322 Ga0495680_0012949 Ga0495680_0012949_5496_6470 298
410 3300047443 Ga0495687_014616 Ga0495687_014616_2015_2989 298
411 3300047471 Ga0495684_0019738 Ga0495684_0019738_2457_3431 298
412 3300048088 Ga0495602_0057593 Ga0495602_0057593_2084_3058 298
413 3300048905 Ga0496102_0415362 Ga0496102_0415362_219_1193 298
414 3300048916 Ga0496113_0132999 Ga0496113_0132999_189_1163 298
415 3300048917 Ga0496114_0070227 Ga0496114_0070227_1945_2919 298
416 3300048929 Ga0496126_0133903 Ga0496126_0133903_256_1230 298
417 3300050490 nmdc:mga03n38_31193_c1 nmdc:mga03n38_31193_c1_309_1283 298
418 3300050491 nmdc:mga00v17_39602_c1 nmdc:mga00v17_39602_c1_1344_2318 298
419 3300050494 nmdc:mga06z11_5094_c1 nmdc:mga06z11_5094_c1_2056_3030 298
420 3300050496 nmdc:mga07m45_44572_c2 nmdc:mga07m45_44572_c2_1266_2240 298
421 3300050516 nmdc:mga0sz30_22385_c2 nmdc:mga0sz30_22385_c2_141_1115 298
422 3300053077 Ga0495601_0022363 Ga0495601_0022363_309_1283 298
423 3300053078 Ga0495612_0018844 Ga0495612_0018844_20_994 298
424 3300003203 JGI25406J46586_10000012 JGI25406J46586_1000001262 299
425 3300005327 Ga0070658_10068350 Ga0070658_100683504 299
426 3300005338 Ga0068868_100009313 Ga0068868_1000093138 299
427 3300005339 Ga0070660_100398703 Ga0070660_1003987031 299
428 3300005341 Ga0070691_10059080 Ga0070691_100590802 299
429 3300005344 Ga0070661_100120947 Ga0070661_1001209472 299
430 3300005366 Ga0070659_100153950 Ga0070659_1001539502 299
431 3300005366 Ga0070659_100231343 Ga0070659_1002313432 299
432 3300005367 Ga0070667_100138512 Ga0070667_1001385121 299
433 3300005440 Ga0070705_100157962 Ga0070705_1001579621 299
434 3300005455 Ga0070663_100079217 Ga0070663_1000792173 299
435 3300005456 Ga0070678_100008171 Ga0070678_1000081713 299
436 3300005458 Ga0070681_10115483 Ga0070681_101154833 299
437 3300005471 Ga0070698_100073038 Ga0070698_1000730383 299
438 3300005518 Ga0070699_100169809 Ga0070699_1001698092 299
439 3300005530 Ga0070679_100121093 Ga0070679_1001210933 299
440 3300005535 Ga0070684_100010714 Ga0070684_1000107142 299
441 3300005548 Ga0070665_100033056 Ga0070665_1000330563 299
442 3300005563 Ga0068855_100087063 Ga0068855_1000870632 299
443 3300005564 Ga0070664_100043519 Ga0070664_1000435193 299
444 3300005614 Ga0068856_100081807 Ga0068856_1000818072 299
445 3300005614 Ga0068856_100428682 Ga0068856_1004286821 299
446 3300005616 Ga0068852_100057592 Ga0068852_1000575923 299
447 3300005616 Ga0068852_100182296 Ga0068852_1001822962 299
448 3300005618 Ga0068864_100129831 Ga0068864_1001298312 299
449 3300005834 Ga0068851_10055527 Ga0068851_100555272 299
450 3300005985 Ga0081539_10000040 Ga0081539_10000040227 299
451 3300006028 Ga0070717_10037586 Ga0070717_100375862 299
452 3300006038 Ga0075365_10070752 Ga0075365_100707522 299
453 3300006175 Ga0070712_100305098 Ga0070712_1003050982 299
454 3300007076 Ga0075435_100045113 Ga0075435_1000451133 299
455 3300007076 Ga0075435_100061823 Ga0075435_1000618232 299
456 3300009093 Ga0105240_10004694 Ga0105240_1000469410 299
457 3300009093 Ga0105240_10389828 Ga0105240_103898282 299
458 3300009094 Ga0111539_10123838 Ga0111539_101238381 299
459 3300009174 Ga0105241_10011272 Ga0105241_100112725 299
460 3300009545 Ga0105237_10111021 Ga0105237_101110211 299
461 3300009545 Ga0105237_10272808 Ga0105237_102728082 299
462 3300009551 Ga0105238_10017095 Ga0105238_100170955 299
463 3300009551 Ga0105238_10299492 Ga0105238_102994921 299
464 3300010375 Ga0105239_10015728 Ga0105239_100157285 299
465 3300010375 Ga0105239_10020720 Ga0105239_100207207 299
466 3300013102 Ga0157371_10046519 Ga0157371_100465192 299
467 3300013104 Ga0157370_10011688 Ga0157370_100116886 299
468 3300013104 Ga0157370_10071396 Ga0157370_100713962 299
469 3300013105 Ga0157369_10002281 Ga0157369_1000228115 299
470 3300013296 Ga0157374_10052418 Ga0157374_100524182 299
471 3300013296 Ga0157374_10321590 Ga0157374_103215901 299
472 3300013306 Ga0163162_10038773 Ga0163162_100387735 299
473 3300013307 Ga0157372_10219310 Ga0157372_102193103 299
474 3300013308 Ga0157375_10385441 Ga0157375_103854412 299
475 3300014325 Ga0163163_10020851 Ga0163163_100208512 299
476 3300014325 Ga0163163_10288974 Ga0163163_102889742 299
477 3300014745 Ga0157377_10083982 Ga0157377_100839821 299
478 3300014968 Ga0157379_10025262 Ga0157379_100252626 299
479 3300014969 Ga0157376_10018180 Ga0157376_100181804 299
480 3300021320 Ga0214544_1000011 Ga0214544_1000011133 299
481 3300021321 Ga0214542_1000009 Ga0214542_1000009109 299
482 3300021324 Ga0214545_1000007 Ga0214545_1000007133 299
483 3300021327 Ga0214543_1000020 Ga0214543_1000020109 299
484 3300021361 Ga0213872_10044001 Ga0213872_100440012 299
485 3300025230 Ga0209563_100776 Ga0209563_10077610 299
486 3300025253 Ga0209677_100400 Ga0209677_10040024 299
487 3300025297 Ga0209758_1001992 Ga0209758_10019929 299
488 3300025315 Ga0207697_10049588 Ga0207697_100495881 299
489 3300025321 Ga0207656_10044269 Ga0207656_100442692 299
490 3300025898 Ga0207692_10032232 Ga0207692_100322321 299
491 3300025899 Ga0207642_10071949 Ga0207642_100719491 299
492 3300025910 Ga0207684_10097971 Ga0207684_100979711 299
493 3300025911 Ga0207654_10027667 Ga0207654_100276673 299
494 3300025912 Ga0207707_10000706 Ga0207707_1000070635 299
495 3300025914 Ga0207671_10199660 Ga0207671_101996601 299
496 3300025915 Ga0207693_10157712 Ga0207693_101577122 299
497 3300025916 Ga0207663_10026504 Ga0207663_100265043 299
498 3300025916 Ga0207663_10260013 Ga0207663_102600132 299
499 3300025920 Ga0207649_10148779 Ga0207649_101487792 299
500 3300025921 Ga0207652_10001458 Ga0207652_1000145820 299
501 3300025924 Ga0207694_10078416 Ga0207694_100784162 299
502 3300025929 Ga0207664_10182276 Ga0207664_101822762 299
503 3300025939 Ga0207665_10027066 Ga0207665_100270663 299
504 3300025941 Ga0207711_10112309 Ga0207711_101123093 299
505 3300025941 Ga0207711_10537562 Ga0207711_105375622 299
506 3300025945 Ga0207679_10064390 Ga0207679_100643903 299
507 3300025949 Ga0207667_10006413 Ga0207667_100064135 299
508 3300025960 Ga0207651_10441719 Ga0207651_104417191 299
509 3300026023 Ga0207677_10012235 Ga0207677_100122357 299
510 3300026023 Ga0207677_10034462 Ga0207677_100344622 299
511 3300026035 Ga0207703_10057392 Ga0207703_100573921 299
512 3300026041 Ga0207639_10006655 Ga0207639_100066553 299
513 3300026067 Ga0207678_10039422 Ga0207678_100394224 299
514 3300026067 Ga0207678_10418352 Ga0207678_104183522 299
515 3300026067 Ga0207678_10513520 Ga0207678_105135201 299
516 3300026078 Ga0207702_10123853 Ga0207702_101238532 299
517 3300026116 Ga0207674_10040962 Ga0207674_100409625 299
518 3300026116 Ga0207674_10043341 Ga0207674_100433412 299
519 3300026121 Ga0207683_10012826 Ga0207683_100128268 299
520 3300027357 Ga0209589_1000055 Ga0209589_100005572 299
521 3300027361 Ga0209489_100128 Ga0209489_10012872 299
522 3300027363 Ga0209700_100137 Ga0209700_10013772 299
523 3300027512 Ga0209179_1026845 Ga0209179_10268452 299
524 3300028379 Ga0268266_10046002 Ga0268266_100460023 299
525 3300028379 Ga0268266_10081068 Ga0268266_100810682 299
526 3300031235 Ga0265330_10014639 Ga0265330_100146392 299
527 3300031595 Ga0265313_10054318 Ga0265313_100543182 299
528 3300031711 Ga0265314_10018837 Ga0265314_100188374 299
529 3300031712 Ga0265342_10033828 Ga0265342_100338281 299
530 3300033442 Ga0315911_1000005 Ga0315911_100000532 299
531 3300035692 Ga0373935_0150356 Ga0373935_0150356_350_1324 299
532 3300036401 Ga0373937_0042762 Ga0373937_0042762_2678_3652 299
533 3300037466 Ga0395898_0083135 Ga0395898_0083135_1880_2854 299
534 3300046455 Ga0495603_0031308 Ga0495603_0031308_933_1907 299
535 3300046462 Ga0495651_0028754 Ga0495651_0028754_2603_3583 299
536 3300046472 Ga0495580_0227117 Ga0495580_0227117_192_1166 299
537 3300046513 Ga0495616_0069543 Ga0495616_0069543_672_1646 299
538 3300046537 Ga0495598_0000848 Ga0495598_0000848_4699_5673 299
539 3300046543 Ga0495645_0044351 Ga0495645_0044351_734_1708 299
540 3300046616 Ga0495668_0098966 Ga0495668_0098966_468_1442 299
541 3300046674 Ga0495588_0017042 Ga0495588_0017042_1462_2436 299
542 3300046684 Ga0495669_0022157 Ga0495669_0022157_1639_2613 299
543 3300047319 Ga0495674_0147836 Ga0495674_0147836_152_1126 299
544 3300047321 Ga0495676_0074951 Ga0495676_0074951_703_1677 299
545 3300048090 Ga0495615_0005324 Ga0495615_0005324_596_1570 299
546 3300048904 Ga0496101_0079128 Ga0496101_0079128_901_1881 299
547 3300048905 Ga0496102_0016408 Ga0496102_0016408_1266_2246 299
548 3300048905 Ga0496102_0104675 Ga0496102_0104675_315_1289 299
549 3300048906 Ga0496103_0138932 Ga0496103_0138932_557_1531 299
550 3300048906 Ga0496103_0142946 Ga0496103_0142946_31_1005 299
551 3300048907 Ga0496104_0021761 Ga0496104_0021761_2413_3387 299
552 3300048907 Ga0496104_0154363 Ga0496104_0154363_666_1646 299
553 3300048908 Ga0496105_0003701 Ga0496105_0003701_4175_5155 299
554 3300048908 Ga0496105_0097045 Ga0496105_0097045_1038_2012 299
555 3300048909 Ga0496106_0022335 Ga0496106_0022335_506_1486 299
556 3300048910 Ga0496107_0156884 Ga0496107_0156884_126_1100 299
557 3300048911 Ga0496108_0165214 Ga0496108_0165214_14_988 299
558 3300048912 Ga0496109_0005103 Ga0496109_0005103_4370_5350 299
559 3300048912 Ga0496109_0035249 Ga0496109_0035249_3352_4326 299
560 3300048913 Ga0496110_0083400 Ga0496110_0083400_1830_2804 299
561 3300048914 Ga0496111_0005854 Ga0496111_0005854_4787_5767 299
562 3300048914 Ga0496111_0188475 Ga0496111_0188475_43_1017 299
563 3300048915 Ga0496112_0218641 Ga0496112_0218641_479_1453 299
564 3300048915 Ga0496112_0292219 Ga0496112_0292219_217_1197 299
565 3300048916 Ga0496113_0005191 Ga0496113_0005191_6032_7012 299
566 3300048916 Ga0496113_0021994 Ga0496113_0021994_2098_3072 299
567 3300048918 Ga0496115_0000295 Ga0496115_0000295_24311_25291 299
568 3300048918 Ga0496115_0296966 Ga0496115_0296966_17_994 299
569 3300048929 Ga0496126_0004033 Ga0496126_0004033_14145_15119 299
570 3300049568 Ga0501031_0000511 Ga0501031_0000511_7310_8287 299
571 3300049568 Ga0501031_0006718 Ga0501031_0006718_435_1412 299
572 3300049569 Ga0501032_0000073 Ga0501032_0000073_33009_33986 299
573 3300049570 Ga0501033_0001845 Ga0501033_0001845_13355_14332 299
574 3300049571 Ga0501034_0000251 Ga0501034_0000251_13585_14562 299
575 3300049571 Ga0501034_0174718 Ga0501034_0174718_57_1034 299
576 3300049572 Ga0501036_0000036 Ga0501036_0000036_74952_75929 299
577 3300049573 Ga0501037_0000040 Ga0501037_0000040_39436_40413 299
578 3300049573 Ga0501037_0020880 Ga0501037_0020880_1008_1985 299
579 3300049574 Ga0501038_0000150 Ga0501038_0000150_19746_20723 299
580 3300049574 Ga0501038_0041771 Ga0501038_0041771_2115_3092 299
581 3300049575 Ga0501039_0001837 Ga0501039_0001837_8323_9300 299
582 3300049578 Ga0501042_0010937 Ga0501042_0010937_4812_5789 299
583 3300049579 Ga0501043_0000464 Ga0501043_0000464_29328_30305 299
584 3300049580 Ga0501046_0000398 Ga0501046_0000398_13119_14096 299
585 3300049580 Ga0501046_0184273 Ga0501046_0184273_383_1360 299
586 3300049581 Ga0501047_0000656 Ga0501047_0000656_13355_14332 299
587 3300049582 Ga0501048_0002054 Ga0501048_0002054_10213_11190 299
588 3300049582 Ga0501048_0161366 Ga0501048_0161366_56_1033 299
589 3300049583 Ga0501067_0000192 Ga0501067_0000192_5200_6177 299
590 3300049584 Ga0501068_0008599 Ga0501068_0008599_2858_3835 299
591 3300049586 Ga0501070_0002215 Ga0501070_0002215_2601_3578 299
592 3300049587 Ga0501071_0101717 Ga0501071_0101717_809_1786 299
593 3300049588 Ga0501072_0001038 Ga0501072_0001038_11944_12921 299
594 3300049589 Ga0501073_0000037 Ga0501073_0000037_11344_12321 299
595 3300049589 Ga0501073_0004501 Ga0501073_0004501_9466_10443 299
596 3300049590 Ga0501074_0000212 Ga0501074_0000212_13295_14272 299
597 3300049741 Ga0501079_0002283 Ga0501079_0002283_5802_6779 299
598 3300049741 Ga0501079_0012536 Ga0501079_0012536_845_1822 299
599 3300049742 Ga0501080_0000054 Ga0501080_0000054_48427_49404 299
600 3300049742 Ga0501080_0114479 Ga0501080_0114479_1288_2265 299
601 3300049744 Ga0501083_0001153 Ga0501083_0001153_15046_16023 299
602 3300049744 Ga0501083_0006025 Ga0501083_0006025_1952_2929 299
603 3300049822 Ga0501035_0000142 Ga0501035_0000142_73000_73977 299
604 3300049823 Ga0501044_0000985 Ga0501044_0000985_13585_14562 299
605 3300049823 Ga0501044_0005451 Ga0501044_0005451_1443_2420 299
606 3300049824 Ga0501045_0008122 Ga0501045_0008122_3561_4538 299
607 3300049824 Ga0501045_0009166 Ga0501045_0009166_4453_5430 299
608 3300050493 nmdc:mga0k408_53176_c1 nmdc:mga0k408_53176_c1_293_1267 299
609 3300050494 nmdc:mga06z11_24305_c1 nmdc:mga06z11_24305_c1_431_1405 299
610 3300050512 nmdc:mga0n895_3593_c1 nmdc:mga0n895_3593_c1_5030_6004 299
611 3300050513 nmdc:mga0rr50_12738_c1 nmdc:mga0rr50_12738_c1_3448_4422 299
612 3300050513 nmdc:mga0rr50_518829_c1 nmdc:mga0rr50_518829_c1_20_994 299
613 3300053087 Ga0500643_012650 Ga0500643_012650_1964_2938 299
614 3300053130 Ga0500642_0000197 Ga0500642_0000197_22862_23836 299
615 3300054114 Ga0501084_0007428 Ga0501084_0007428_2257_3234 299
616 3300054114 Ga0501084_0011305 Ga0501084_0011305_990_1967 299
617 3300060353 Ga0501082_0004487 Ga0501082_0004487_6778_7755 299
618 3300060353 Ga0501082_0012051 Ga0501082_0012051_1614_2591 299
619 3300003659 JGI25404J52841_10007705 JGI25404J52841_100077052 300
620 3300005336 Ga0070680_100037092 Ga0070680_1000370922 300
621 3300005338 Ga0068868_100048804 Ga0068868_1000488042 300
622 3300005347 Ga0070668_100091738 Ga0070668_1000917383 300
623 3300005366 Ga0070659_100275573 Ga0070659_1002755732 300
624 3300005444 Ga0070694_100068491 Ga0070694_1000684912 300
625 3300005458 Ga0070681_10098406 Ga0070681_100984063 300
626 3300005458 Ga0070681_10408946 Ga0070681_104089461 300
627 3300005530 Ga0070679_100024224 Ga0070679_1000242242 300
628 3300005617 Ga0068859_100583281 Ga0068859_1005832812 300
629 3300005719 Ga0068861_100109122 Ga0068861_1001091222 300
630 3300005841 Ga0068863_100109668 Ga0068863_1001096682 300
631 3300005842 Ga0068858_100303077 Ga0068858_1003030771 300
632 3300005983 Ga0081540_1010031 Ga0081540_10100313 300
633 3300005983 Ga0081540_1100765 Ga0081540_11007651 300
634 3300006880 Ga0075429_100269386 Ga0075429_1002693862 300
635 3300006931 Ga0097620_100583269 Ga0097620_1005832692 300
636 3300009093 Ga0105240_10753321 Ga0105240_107533211 300
637 3300009148 Ga0105243_10346994 Ga0105243_103469942 300
638 3300009177 Ga0105248_10237689 Ga0105248_102376892 300
639 3300009545 Ga0105237_10539498 Ga0105237_105394982 300
640 3300010375 Ga0105239_10100157 Ga0105239_101001573 300
641 3300013306 Ga0163162_10045055 Ga0163162_100450552 300
642 3300014968 Ga0157379_10380867 Ga0157379_103808672 300
643 3300025302 Ga0207426_1000773 Ga0207426_100077331 300
644 3300025901 Ga0207688_10046505 Ga0207688_100465051 300
645 3300025904 Ga0207647_10184968 Ga0207647_101849681 300
646 3300025912 Ga0207707_10000515 Ga0207707_1000051529 300
647 3300025935 Ga0207709_10057528 Ga0207709_100575282 300
648 3300025942 Ga0207689_10174330 Ga0207689_101743302 300
649 3300025961 Ga0207712_10094480 Ga0207712_100944801 300
650 3300025972 Ga0207668_10027989 Ga0207668_100279892 300
651 3300026035 Ga0207703_10059969 Ga0207703_100599693 300
652 3300026067 Ga0207678_10026769 Ga0207678_100267692 300
653 3300026089 Ga0207648_10058331 Ga0207648_100583312 300
654 3300026116 Ga0207674_10213110 Ga0207674_102131102 300
655 3300026118 Ga0207675_100133979 Ga0207675_1001339793 300
656 3300028379 Ga0268266_10003102 Ga0268266_1000310211 300
657 3300028380 Ga0268265_10068850 Ga0268265_100688503 300
658 3300028381 Ga0268264_10034068 Ga0268264_100340683 300
659 3300028786 Ga0307517_10105494 Ga0307517_101054942 300
660 3300028786 Ga0307517_10121559 Ga0307517_101215592 300
661 3300031238 Ga0265332_10016892 Ga0265332_100168922 300
662 3300031548 Ga0307408_100256759 Ga0307408_1002567591 300
663 3300032126 Ga0307415_100067532 Ga0307415_1000675323 300
664 3300039438 Ga0436360_0133086 Ga0436360_0133086_31_1005 300
665 3300044656 Ga0466969_0083139 Ga0466969_0083139_225_1199 300
666 3300044658 Ga0466972_0031207 Ga0466972_0031207_581_1555 300
667 3300044684 Ga0466966_0000322 Ga0466966_0000322_13384_14358 300
668 3300044693 Ga0466961_0000227 Ga0466961_0000227_2821_3795 300
669 3300044735 Ga0466968_0008614 Ga0466968_0008614_547_1521 300
670 3300046513 Ga0495616_0120015 Ga0495616_0120015_211_1185 300
671 3300046522 Ga0495643_0054168 Ga0495643_0054168_1121_2095 300
672 3300046524 Ga0495648_0065576 Ga0495648_0065576_502_1476 300
673 3300046674 Ga0495588_0011770 Ga0495588_0011770_786_1760 300
674 3300046694 Ga0495649_0010519 Ga0495649_0010519_3955_4929 300
675 3300047323 Ga0495683_0111720 Ga0495683_0111720_183_1157 300
676 3300047472 Ga0495686_0022543 Ga0495686_0022543_1560_2534 300
677 3300048905 Ga0496102_0076234 Ga0496102_0076234_1452_2426 300
678 3300048907 Ga0496104_0039609 Ga0496104_0039609_1892_2866 300
679 3300048908 Ga0496105_0029657 Ga0496105_0029657_1225_2349 300
680 3300048909 Ga0496106_0060011 Ga0496106_0060011_1841_2815 300
681 3300048909 Ga0496106_0222247 Ga0496106_0222247_397_1371 300
682 3300048910 Ga0496107_0059138 Ga0496107_0059138_1406_2380 300
683 3300048914 Ga0496111_0021273 Ga0496111_0021273_1034_2008 300
684 3300048919 Ga0496116_0037092 Ga0496116_0037092_1825_2799 300
685 3300048924 Ga0496121_0002330 Ga0496121_0002330_23076_24050 300
686 3300048924 Ga0496121_0013885 Ga0496121_0013885_2276_3250 300
687 3300048924 Ga0496121_0047408 Ga0496121_0047408_2473_3447 300
688 3300048924 Ga0496121_0047766 Ga0496121_0047766_2339_3313 300
689 3300048929 Ga0496126_0011553 Ga0496126_0011553_2897_3871 300
690 3300048929 Ga0496126_0034144 Ga0496126_0034144_79_1053 300
691 3300048929 Ga0496126_0044111 Ga0496126_0044111_1890_2867 300
692 3300049460 Ga0495682_0015605 Ga0495682_0015605_1703_2677 300
693 3300050491 nmdc:mga00v17_114807_c1 nmdc:mga00v17_114807_c1_673_1647 300
694 3300050491 nmdc:mga00v17_52913_c1 nmdc:mga00v17_52913_c1_224_1198 300
695 3300050492 nmdc:mga0yw44_31040_c1 nmdc:mga0yw44_31040_c1_1887_2861 300
696 3300050496 nmdc:mga07m45_69723_c1 nmdc:mga07m45_69723_c1_557_1531 300
697 3300050507 nmdc:mga05p37_96716_c1 nmdc:mga05p37_96716_c1_1568_2542 300
698 3300050512 nmdc:mga0n895_98808_c1 nmdc:mga0n895_98808_c1_627_1601 300
699 3300053094 Ga0500566_0004238 Ga0500566_0004238_2457_3431 300
700 3300053104 Ga0500556_0041476 Ga0500556_0041476_587_1561 300
701 3300053119 Ga0500595_002174 Ga0500595_002174_4415_5389 300
702 3300053139 Ga0500568_0057381 Ga0500568_0057381_258_1232 300
703 3300003215 JGI25153J46596_10010431 JGI25153J46596_100104313 301
704 3300005578 Ga0068854_100360369 Ga0068854_1003603691 301
705 3300005937 Ga0081455_10034630 Ga0081455_100346303 301
706 3300005983 Ga0081540_1000721 Ga0081540_10007213 301
707 3300006038 Ga0075365_10014233 Ga0075365_100142332 301
708 3300007788 Ga0099795_10012627 Ga0099795_100126272 301
709 3300025295 Ga0209564_1006461 Ga0209564_10064614 301
710 3300025297 Ga0209758_1002275 Ga0209758_100227517 301
711 3300025304 Ga0209257_1032679 Ga0209257_10326792 301
712 3300027512 Ga0209179_1018494 Ga0209179_10184942 301
713 3300031456 Ga0307513_10085319 Ga0307513_100853193 301
714 3300037471 Ga0395905_0258497 Ga0395905_0258497_563_1537 301
715 3300045976 Ga0466967_0024100 Ga0466967_0024100_3477_4451 301
716 3300048928 Ga0496125_0001204 Ga0496125_0001204_1841_2815 301
717 3300048929 Ga0496126_0025463 Ga0496126_0025463_2204_3181 301
718 3300049569 Ga0501032_0204740 Ga0501032_0204740_260_1237 301
719 3300049571 Ga0501034_0392577 Ga0501034_0392577_177_1154 301
720 3300049572 Ga0501036_0156208 Ga0501036_0156208_166_1143 301
721 3300049573 Ga0501037_0323002 Ga0501037_0323002_11_988 301
722 3300049574 Ga0501038_0005621 Ga0501038_0005621_9990_10967 301
723 3300049574 Ga0501038_0013948 Ga0501038_0013948_6063_7040 301
724 3300049579 Ga0501043_0023171 Ga0501043_0023171_1271_2248 301
725 3300049589 Ga0501073_0143128 Ga0501073_0143128_179_1156 301
726 3300049742 Ga0501080_0188750 Ga0501080_0188750_694_1668 301
727 3300049822 Ga0501035_0186285 Ga0501035_0186285_399_1376 301
728 3300049823 Ga0501044_0090036 Ga0501044_0090036_336_1310 301
729 3300053094 Ga0500566_0055812 Ga0500566_0055812_615_1589 301
730 3300053111 Ga0500572_014382 Ga0500572_014382_232_1206 301
731 3300053121 Ga0500607_046171 Ga0500607_046171_531_1505 301
732 3300053136 Ga0500559_0031101 Ga0500559_0031101_14_988 301
733 3300053138 Ga0500564_017343 Ga0500564_017343_1879_2853 301
734 3300053148 Ga0500590_045744 Ga0500590_045744_463_1437 301
735 3300053157 Ga0500624_006620 Ga0500624_006620_513_1487 301
736 3300053162 Ga0500638_131217 Ga0500638_131217_112_1086 301
737 3300053177 Ga0500636_0000990 Ga0500636_0000990_1089_2063 301
738 iso_pu_bacteria 2508501009 2508540137 301
739 iso_pu_bacteria 2508501042 2508696211 301
740 iso_pu_bacteria 2508501128 2509148141 301
741 iso_pu_bacteria 2511231028 2511395837 301
742 iso_pu_bacteria 2513237095 2513649146 301
743 iso_pu_bacteria 2513237096 2513657485 301
744 iso_pu_bacteria 2513237098 2513674963 301
745 iso_pu_bacteria 2513237102 2513700211 301
746 iso_pu_bacteria 2513237104 2513716118 301
747 iso_pu_bacteria 2513237137 2513861187 301
748 iso_pu_bacteria 2513237139 2513877222 301
749 iso_pu_bacteria 2513237145 2513916738 301
750 iso_pu_bacteria 2513237161 2514014591 301
751 iso_pu_bacteria 2515154112 2515628509 301
752 iso_pu_bacteria 2517093001 2517103135 301
753 iso_pu_bacteria 2517572143 2517889646 301
754 iso_pu_bacteria 2524023205 2524440813 301
755 iso_pu_bacteria 2524023210 2524465279 301
756 iso_pu_bacteria 2524023228 2524533185 301
757 iso_pu_bacteria 2528768022 2528850717 301
758 iso_pu_bacteria 2602042107 2603857140 301
759 iso_pu_bacteria 2617270735 2617347831 301
760 iso_pu_bacteria 2617270741 2617374753 301
761 iso_pu_bacteria 2643221651 2644290474 301
762 iso_pu_bacteria 2667528175 2671119497 301
763 iso_pu_bacteria 2744054633 2745076054 301
764 iso_pu_bacteria 2791355196 2793061517 301
765 iso_pu_bacteria 2791355197 2793070374 301
766 iso_pu_bacteria 2791355199 2793080128 301
767 iso_pu_bacteria 2802429603 2805916178 301
768 iso_pu_bacteria 2816332527 2818240537 301
769 iso_pu_bacteria 2824617872 2824623222 301
770 iso_pu_bacteria 2824626560 2824632180 301
771 iso_pu_bacteria 2824635225 2824640827 301
772 iso_pu_bacteria 2824644064 2824647979 301
773 iso_pu_bacteria 2824671348 2824675034 301
774 iso_pu_bacteria 2824679649 2824684460 301
775 iso_pu_bacteria 2824687955 2824695845 301
776 iso_pu_bacteria 2824696289 2824701048 301
777 iso_pu_bacteria 2824714736 2824723437 301
778 iso_pu_bacteria 2824723954 2824732679 301
779 iso_pu_bacteria 2824732956 2824737050 301
780 iso_pu_bacteria 2824746037 2824750830 301
781 iso_pu_bacteria 2824753945 2824761986 301
782 iso_pu_bacteria 2824763712 2824772387 301
783 iso_pu_bacteria 2824773399 2824775686 301
784 iso_pu_bacteria 2838122688 2838125061 301
785 iso_pu_bacteria 2841941048 2841945800 301
786 iso_pu_bacteria 2841949485 2841956899 301
787 iso_pu_bacteria 2841957949 2841963977 301
788 iso_pu_bacteria 2841966195 2841973541 301
789 iso_pu_bacteria 2841974524 2841981981 301
790 iso_pu_bacteria 2841983080 2841989429 301
791 iso_pu_bacteria 2842038055 2842044414 301
792 iso_pu_bacteria 2842045827 2842051597 301
793 iso_pu_bacteria 2844315083 2844316287 301
794 iso_pu_bacteria 2847930680 2847939410 301
795 iso_pu_bacteria 2847939898 2847941169 301
796 iso_pu_bacteria 2849076700 2849082158 301
797 iso_pu_bacteria 2857509624 2857513367 301
798 iso_pu_bacteria 2857524615 2857530855 301
799 iso_pu_bacteria 2874590934 2874596316 301
800 iso_pu_bacteria 2874604998 2874610112 301
801 iso_pu_bacteria 2874612657 2874616483 301
802 iso_pu_bacteria 2874620515 2874622501 301
803 iso_pu_bacteria 2874628541 2874633409 301
804 iso_pu_bacteria 2874645413 2874650303 301
805 iso_pu_bacteria 2876761206 2876763712 301
806 iso_pu_bacteria 2876771140 2876776781 301
807 iso_pu_bacteria 2876808645 2876811119 301
808 iso_pu_bacteria 2876818435 2876824571 301
809 iso_pu_bacteria 2879074833 2879080918 301
810 iso_pu_bacteria 2879083081 2879087083 301
811 iso_pu_bacteria 2879099564 2879104413 301
812 iso_pu_bacteria 2879110137 2879116978 301
813 iso_pu_bacteria 2879127579 2879133763 301
814 iso_pu_bacteria 2879142872 2879148265 301
815 iso_pu_bacteria 2881364244 2881369574 301
816 iso_pu_bacteria 2881665667 2881669709 301
817 iso_pu_bacteria 2885366525 2885367779 301
818 iso_pu_bacteria 2885374607 2885380874 301
819 iso_pu_bacteria 2885383462 2885391716 301
820 iso_pu_bacteria 2885409591 2885418868 301
821 iso_pu_bacteria 2888378607 2888387214 301
822 iso_pu_bacteria 2888388044 2888389906 301
823 iso_pu_bacteria 2889033259 2889036423 301
824 iso_pu_bacteria 2903727486 2903728378 301
825 iso_pu_bacteria 2903748898 2903756099 301
826 iso_pu_bacteria 2903768456 2903774694 301
827 iso_pu_bacteria 2904666416 2904671492 301
828 iso_pu_bacteria 2904690495 2904692057 301
829 iso_pu_bacteria 2904699407 2904707599 301
830 iso_pu_bacteria 2904711408 2904719788 301
831 iso_pu_bacteria 2906602504 2906606518 301
832 iso_pu_bacteria 2906610324 2906614623 301
833 iso_pu_bacteria 2906626472 2906631408 301
834 iso_pu_bacteria 2906635258 2906641968 301
835 iso_pu_bacteria 2906660503 2906660946 301
836 iso_pu_bacteria 2908739725 2908746555 301
837 iso_pu_bacteria 2908756301 2908757336 301
838 iso_pu_bacteria 2908775508 2908777234 301
839 iso_pu_bacteria 2919073203 2919077931 301
840 iso_pu_bacteria 2922368715 2922377395 301
841 iso_pu_bacteria 2922386360 2922389394 301
842 iso_pu_bacteria 2922393267 2922398484 301
843 iso_pu_bacteria 2922425934 2922426484 301
844 iso_pu_bacteria 2929615660 2929622183 301
845 iso_pu_bacteria 2929624759 2929630170 301
846 iso_pu_bacteria 2932784394 2932787901 301
847 iso_pu_bacteria 2932794094 2932796021 301
848 iso_pu_bacteria 2932801729 2932807599 301
849 iso_pu_bacteria 2932809354 2932817627 301
850 iso_pu_bacteria 2932818245 2932826213 301
851 iso_pu_bacteria 2932828146 2932835071 301
852 iso_pu_bacteria 2933577622 2933584202 301
853 iso_pu_bacteria 2935608549 2935614373 301
854 iso_pu_bacteria 2935616580 2935620448 301
855 iso_pu_bacteria 2935630451 2935632825 301
856 iso_pu_bacteria 2935638405 2935640771 301
857 iso_pu_bacteria 2935648319 2935649402 301
858 iso_pu_bacteria 2935656913 2935657826 301
859 iso_pu_bacteria 2935665750 2935670274 301
860 iso_pu_bacteria 2935675223 2935679703 301
861 iso_pu_bacteria 2935684952 2935687272 301
862 iso_pu_bacteria 2935694250 2935696757 301
863 iso_pu_bacteria 2935703347 2935709151 301
864 iso_pu_bacteria 2935713505 2935718731 301
865 iso_pu_bacteria 2935722832 2935728383 301
866 iso_pu_bacteria 2935732158 2935737020 301
867 iso_pu_bacteria 2935741537 2935745977 301
868 iso_pu_bacteria 2935750917 2935753238 301
869 iso_pu_bacteria 2935760218 2935766370 301
870 iso_pu_bacteria 2935769743 2935770238 301
871 iso_pu_bacteria 2935777560 2935777734 301
872 iso_pu_bacteria 2935785616 2935786709 301
873 iso_pu_bacteria 2935793552 2935794763 301
874 iso_pu_bacteria 2935801545 2935809050 301
875 iso_pu_bacteria 2935810662 2935813769 301
876 iso_pu_bacteria 2935819856 2935826591 301
877 iso_pu_bacteria 2935827899 2935832278 301
878 iso_pu_bacteria 2935837841 2935843983 301
879 iso_pu_bacteria 2935847175 2935851115 301
880 iso_pu_bacteria 2935855204 2935862774 301
881 iso_pu_bacteria 2935864058 2935864517 301
882 iso_pu_bacteria 2935873716 2935875131 301
883 iso_pu_bacteria 2935883170 2935887291 301
884 iso_pu_bacteria 2935908558 2935913165 301
885 iso_pu_bacteria 2935916978 2935922587 301
886 iso_pu_bacteria 2935926038 2935930910 301
887 iso_pu_bacteria 2935934488 2935939756 301
888 iso_pu_bacteria 2935942939 2935946705 301
889 iso_pu_bacteria 2935951376 2935956094 301
890 iso_pu_bacteria 2935959822 2935964999 301
891 iso_pu_bacteria 2935967501 2935972887 301
892 iso_pu_bacteria 2935975950 2935978198 301
893 iso_pu_bacteria 2935984226 2935985678 301
894 iso_pu_bacteria 2935992306 2935999250 301
895 iso_pu_bacteria 2936002035 2936005805 301
896 iso_pu_bacteria 2936011229 2936012045 301
897 iso_pu_bacteria 2936019824 2936020874 301
898 iso_pu_bacteria 2936028420 2936029338 301
899 iso_pu_bacteria 2936037263 2936039325 301
900 iso_pu_bacteria 2936046547 2936048338 301
901 iso_pu_bacteria 2936055302 2936056551 301
902 iso_pu_bacteria 2940556831 2940559151 301
903 iso_pu_bacteria 2941507105 2941508511 301
904 iso_pu_bacteria 2941515067 2941516341 301
905 iso_pu_bacteria 2941523033 2941524643 301
906 iso_pu_bacteria 2941531003 2941534564 301
907 iso_pu_bacteria 2941538514 2941541846 301
908 iso_pu_bacteria 3005474847 3005475826 301
909 iso_pu_bacteria 3005483717 3005491096 301
910 iso_pu_bacteria 3005506211 3005510937 301
911 iso_pu_bacteria 3005587118 3005592149 301
912 iso_pu_bacteria 3005594810 3005595898 301
913 iso_pu_bacteria 3005710791 3005711836 301
914 iso_pu_bacteria 3005718088 3005719093 301
915 iso_pu_bacteria 8006926726 8006929736 301
916 iso_pu_bacteria 8006933436 8006937144 301
917 iso_pu_bacteria 8006964411 8006966295 301
918 iso_pu_bacteria 8006973647 8006977154 301
919 iso_pu_bacteria 8006984368 8006993099 301
920 iso_pu_bacteria 8006994254 8006996962 301
921 iso_pu_bacteria 8016511872 8016517236 301
922 iso_pu_bacteria 8016530956 8016532084 301
923 iso_pu_bacteria 8016539877 8016545298 301
924 iso_pu_bacteria 8016548790 8016556791 301
925 iso_pu_bacteria 8016566248 8016570379 301
926 iso_pu_bacteria 8016575299 8016582919 301
927 iso_pu_bacteria 8016583857 8016585382 301
928 iso_pu_bacteria 8016595262 8016602793 301
929 iso_pu_bacteria 8016603502 8016605655 301
930 iso_pu_bacteria 8016613128 8016617569 301
931 iso_pu_bacteria 8016622563 8016624002 301
932 iso_pu_bacteria 8016630954 8016634860 301
933 iso_pu_bacteria 8017057580 8017059357 301
934 iso_pu_bacteria 8019530166 8019531902 301
935 iso_pu_bacteria 8019538911 8019539631 301
936 iso_pu_bacteria 8019547302 8019551027 301
937 iso_pu_bacteria 8019555841 8019561514 301
938 iso_pu_bacteria 8019565922 8019571591 301
939 iso_pu_bacteria 8019576017 8019576263 301
940 iso_pu_bacteria 8019586578 8019594142 301
941 iso_pu_bacteria 8019608314 8019611089 301
942 iso_pu_bacteria 8019619141 8019621937 301
943 iso_pu_bacteria 8019629233 8019631384 301
944 iso_pu_bacteria 8019638758 8019639229 301
945 iso_pu_bacteria 8019648815 8019651377 301
946 iso_pu_bacteria 8019659431 8019668191 301
947 iso_pu_bacteria 8019668869 8019677653 301
948 iso_pu_bacteria 8019687851 8019693271 301
949 iso_pu_bacteria 8055742211 8055743567 301
950 iso_pu_bacteria 8056673599 8056678149 301
951 iso_pu_bacteria 8056681323 8056681641 301
952 iso_pu_bacteria 8056689827 8056690804 301
953 iso_pu_bacteria 8056967851 8056974128 301
954 3300001979 JGI24740J21852_10007574 JGI24740J21852_100075742 302
955 3300005336 Ga0070680_100163929 Ga0070680_1001639292 302
956 3300005356 Ga0070674_100169637 Ga0070674_1001696371 302
957 3300005434 Ga0070709_10012306 Ga0070709_100123063 302
958 3300005436 Ga0070713_100053233 Ga0070713_1000532331 302
959 3300005439 Ga0070711_100001524 Ga0070711_1000015241 302
960 3300005455 Ga0070663_100095518 Ga0070663_1000955182 302
961 3300005539 Ga0068853_100004793 Ga0068853_1000047933 302
962 3300005563 Ga0068855_100274591 Ga0068855_1002745911 302
963 3300005578 Ga0068854_100001788 Ga0068854_1000017886 302
964 3300005614 Ga0068856_100001074 Ga0068856_1000010749 302
965 3300005616 Ga0068852_100028969 Ga0068852_1000289694 302
966 3300005834 Ga0068851_10007723 Ga0068851_100077232 302
967 3300005842 Ga0068858_100136181 Ga0068858_1001361812 302
968 3300005843 Ga0068860_100517711 Ga0068860_1005177112 302
969 3300009093 Ga0105240_10011879 Ga0105240_1001187912 302
970 3300009098 Ga0105245_10430542 Ga0105245_104305421 302
971 3300009174 Ga0105241_10009922 Ga0105241_100099223 302
972 3300009174 Ga0105241_10208362 Ga0105241_102083622 302
973 3300009545 Ga0105237_10064354 Ga0105237_100643544 302
974 3300009545 Ga0105237_10075396 Ga0105237_100753963 302
975 3300009545 Ga0105237_10410049 Ga0105237_104100492 302
976 3300009551 Ga0105238_10004460 Ga0105238_100044608 302
977 3300010375 Ga0105239_10272337 Ga0105239_102723372 302
978 3300013296 Ga0157374_10286525 Ga0157374_102865252 302
979 3300013306 Ga0163162_10133390 Ga0163162_101333902 302
980 3300014325 Ga0163163_10003826 Ga0163163_100038263 302
981 3300014968 Ga0157379_10317833 Ga0157379_103178332 302
982 3300021358 Ga0213873_10017467 Ga0213873_100174672 302
983 3300021384 Ga0213876_10005309 Ga0213876_100053096 302
984 3300025297 Ga0209758_1005519 Ga0209758_10055192 302
985 3300025321 Ga0207656_10128202 Ga0207656_101282021 302
986 3300025898 Ga0207692_10021767 Ga0207692_100217672 302
987 3300025900 Ga0207710_10036010 Ga0207710_100360102 302
988 3300025906 Ga0207699_10028502 Ga0207699_100285023 302
989 3300025911 Ga0207654_10000201 Ga0207654_1000020128 302
990 3300025911 Ga0207654_10149180 Ga0207654_101491802 302
991 3300025912 Ga0207707_10129917 Ga0207707_101299172 302
992 3300025913 Ga0207695_10000343 Ga0207695_100003439 302
993 3300025914 Ga0207671_10025913 Ga0207671_100259133 302
994 3300025914 Ga0207671_10286383 Ga0207671_102863832 302
995 3300025916 Ga0207663_10002134 Ga0207663_100021343 302
996 3300025916 Ga0207663_10066009 Ga0207663_100660092 302
997 3300025924 Ga0207694_10000339 Ga0207694_1000033941 302
998 3300025936 Ga0207670_10325970 Ga0207670_103259702 302
999 3300025949 Ga0207667_10008033 Ga0207667_100080333 302
1000 3300026041 Ga0207639_10017564 Ga0207639_100175643 302
1001 3300026067 Ga0207678_10136532 Ga0207678_101365322 302
1002 3300026078 Ga0207702_10000006 Ga0207702_10000006276 302
1003 3300026116 Ga0207674_10003146 Ga0207674_1000314613 302
1004 3300026142 Ga0207698_10002272 Ga0207698_100022723 302
1005 3300031507 Ga0307509_10152637 Ga0307509_101526373 302
1006 3300031616 Ga0307508_10213311 Ga0307508_102133112 302
1007 3300031730 Ga0307516_10005964 Ga0307516_100059642 302
1008 3300031730 Ga0307516_10062855 Ga0307516_100628553 302
1009 3300033179 Ga0307507_10014168 Ga0307507_100141683 302
1010 3300033180 Ga0307510_10268887 Ga0307510_102688872 302
1011 3300037068 Ga0373925_0025701 Ga0373925_0025701_3169_4143 302
1012 3300038443 Ga0395901_0214633 Ga0395901_0214633_923_1897 302
1013 3300039437 Ga0436365_0703944 Ga0436365_0703944_6419_7393 302
1014 3300039447 Ga0436361_0329418 Ga0436361_0329418_83_1057 302
1015 3300039453 Ga0436362_0675816 Ga0436362_0675816_1241_2215 302
1016 3300041486 Ga0451807_2628458 Ga0451807_2628458_264_1238 302
1017 3300046557 Ga0495622_0015444 Ga0495622_0015444_176_1150 302
1018 3300046678 Ga0495599_0039174 Ga0495599_0039174_103_1077 302
1019 3300047472 Ga0495686_0092528 Ga0495686_0092528_182_1159 302
1020 3300048905 Ga0496102_0038136 Ga0496102_0038136_1129_2103 302
1021 3300048907 Ga0496104_0032583 Ga0496104_0032583_1358_2332 302
1022 3300048909 Ga0496106_0004011 Ga0496106_0004011_5812_6786 302
1023 3300048912 Ga0496109_0016035 Ga0496109_0016035_368_1342 302
1024 3300048913 Ga0496110_0055397 Ga0496110_0055397_1254_2228 302
1025 3300048915 Ga0496112_0000029 Ga0496112_0000029_30368_31342 302
1026 3300048915 Ga0496112_0001958 Ga0496112_0001958_13387_14361 302
1027 3300048920 Ga0496117_0014848 Ga0496117_0014848_4033_5007 302
1028 3300048921 Ga0496118_0008353 Ga0496118_0008353_8759_9733 302
1029 3300048921 Ga0496118_0010319 Ga0496118_0010319_4430_5404 302
1030 3300048922 Ga0496119_0026140 Ga0496119_0026140_209_1183 302
1031 3300048922 Ga0496119_0116277 Ga0496119_0116277_386_1360 302
1032 3300048924 Ga0496121_0002294 Ga0496121_0002294_14908_15882 302
1033 3300048924 Ga0496121_0013124 Ga0496121_0013124_4335_5309 302
1034 3300048927 Ga0496124_0013819 Ga0496124_0013819_541_1515 302
1035 3300048928 Ga0496125_0105186 Ga0496125_0105186_466_1440 302
1036 3300048929 Ga0496126_0262385 Ga0496126_0262385_215_1189 302
1037 3300049568 Ga0501031_0023266 Ga0501031_0023266_1504_2481 302
1038 3300049569 Ga0501032_0072007 Ga0501032_0072007_866_1843 302
1039 3300049570 Ga0501033_0001342 Ga0501033_0001342_11179_12156 302
1040 3300049573 Ga0501037_0036094 Ga0501037_0036094_308_1285 302
1041 3300049586 Ga0501070_0128317 Ga0501070_0128317_855_1832 302
1042 3300049822 Ga0501035_0001311 Ga0501035_0001311_19758_20735 302
1043 3300049822 Ga0501035_0040499 Ga0501035_0040499_344_1321 302
1044 3300049823 Ga0501044_0043845 Ga0501044_0043845_2505_3482 302
1045 3300050494 nmdc:mga06z11_103762_c1 nmdc:mga06z11_103762_c1_415_1389 302
1046 3300053098 Ga0500650_0036809 Ga0500650_0036809_1026_2000 302
1047 3300053130 Ga0500642_0002669 Ga0500642_0002669_124_1098 302
1048 3300053140 Ga0500573_0041265 Ga0500573_0041265_934_1908 302
1049 3300053154 Ga0500619_057190 Ga0500619_057190_134_1108 302
1050 3300053177 Ga0500636_0035756 Ga0500636_0035756_1951_2925 302
1051 3300053178 Ga0500637_0083276 Ga0500637_0083276_764_1738 302
1052 3300053735 Ga0500596_001012 Ga0500596_001012_2547_3521 302
1053 3300001989 JGI24739J22299_10008847 JGI24739J22299_100088473 303
1054 3300001990 JGI24737J22298_10000804 JGI24737J22298_100008042 303
1055 3300002067 JGI24735J21928_10013308 JGI24735J21928_100133082 303
1056 3300005327 Ga0070658_10423658 Ga0070658_104236581 303
1057 3300005434 Ga0070709_10016795 Ga0070709_100167952 303
1058 3300005543 Ga0070672_100074667 Ga0070672_1000746672 303
1059 3300005578 Ga0068854_100001506 Ga0068854_1000015066 303
1060 3300005843 Ga0068860_100000837 Ga0068860_1000008373 303
1061 3300005983 Ga0081540_1022188 Ga0081540_10221883 303
1062 3300006237 Ga0097621_100156117 Ga0097621_1001561172 303
1063 3300009093 Ga0105240_10006068 Ga0105240_100060686 303
1064 3300009101 Ga0105247_10138362 Ga0105247_101383622 303
1065 3300009551 Ga0105238_10020882 Ga0105238_100208826 303
1066 3300010375 Ga0105239_10005955 Ga0105239_100059553 303
1067 3300011119 Ga0105246_10143818 Ga0105246_101438182 303
1068 3300025904 Ga0207647_10000764 Ga0207647_1000076418 303
1069 3300025913 Ga0207695_10017441 Ga0207695_100174416 303
1070 3300025914 Ga0207671_10079304 Ga0207671_100793042 303
1071 3300025924 Ga0207694_10032046 Ga0207694_100320462 303
1072 3300025940 Ga0207691_10239561 Ga0207691_102395612 303
1073 3300025981 Ga0207640_10031248 Ga0207640_100312482 303
1074 3300026041 Ga0207639_10015983 Ga0207639_100159833 303
1075 3300026078 Ga0207702_10005641 Ga0207702_100056415 303
1076 3300026116 Ga0207674_10002334 Ga0207674_1000233415 303
1077 3300028381 Ga0268264_10000194 Ga0268264_10000194120 303
1078 3300031238 Ga0265332_10030913 Ga0265332_100309132 303
1079 3300031616 Ga0307508_10204919 Ga0307508_102049191 303
1080 3300031730 Ga0307516_10009187 Ga0307516_100091878 303
1081 3300031730 Ga0307516_10159719 Ga0307516_101597192 303
1082 3300033180 Ga0307510_10006595 Ga0307510_100065955 303
1083 3300035086 Ga0373934_0072251 Ga0373934_0072251_384_1358 303
1084 3300035111 Ga0373923_0001907 Ga0373923_0001907_2124_3098 303
1085 3300035113 Ga0373936_0029637 Ga0373936_0029637_756_1730 303
1086 3300035119 Ga0373956_0004051 Ga0373956_0004051_44_1018 303
1087 3300035120 Ga0373957_0117227 Ga0373957_0117227_76_1050 303
1088 3300035170 Ga0373943_0002146 Ga0373943_0002146_1611_2585 303
1089 3300035172 Ga0373955_0007024 Ga0373955_0007024_1250_2224 303
1090 3300035410 Ga0373924_0001138 Ga0373924_0001138_5624_6598 303
1091 3300035725 Ga0373947_0001111 Ga0373947_0001111_273_1247 303
1092 3300036401 Ga0373937_0053961 Ga0373937_0053961_754_1728 303
1093 3300037068 Ga0373925_0019299 Ga0373925_0019299_1540_2514 303
1094 3300037418 Ga0395900_0001496 Ga0395900_0001496_4035_5009 303
1095 3300037466 Ga0395898_0018464 Ga0395898_0018464_4266_5240 303
1096 3300038443 Ga0395901_0278811 Ga0395901_0278811_666_1640 303
1097 3300039450 Ga0436363_0997155 Ga0436363_0997155_1152_2126 303
1098 3300045976 Ga0466967_0186823 Ga0466967_0186823_521_1495 303
1099 3300046454 Ga0495592_0067621 Ga0495592_0067621_65_1039 303
1100 3300046455 Ga0495603_0036309 Ga0495603_0036309_85_1059 303
1101 3300046460 Ga0495638_0006359 Ga0495638_0006359_3756_4730 303
1102 3300046472 Ga0495580_0026569 Ga0495580_0026569_2017_2991 303
1103 3300046473 Ga0495582_0140661 Ga0495582_0140661_38_1012 303
1104 3300046475 Ga0495639_0007581 Ga0495639_0007581_1794_2768 303
1105 3300046476 Ga0495662_0014956 Ga0495662_0014956_1059_2033 303
1106 3300046477 Ga0495664_0038308 Ga0495664_0038308_423_1397 303
1107 3300046491 Ga0495584_0042279 Ga0495584_0042279_38_1012 303
1108 3300046507 Ga0495606_0031891 Ga0495606_0031891_1103_2077 303
1109 3300046517 Ga0495630_0026354 Ga0495630_0026354_410_1384 303
1110 3300046533 Ga0495640_0007069 Ga0495640_0007069_1454_2428 303
1111 3300046543 Ga0495645_0038260 Ga0495645_0038260_766_1740 303
1112 3300046642 Ga0495634_0014131 Ga0495634_0014131_4735_5709 303
1113 3300046663 Ga0495635_0118597 Ga0495635_0118597_74_1048 303
1114 3300046678 Ga0495599_0124808 Ga0495599_0124808_188_1162 303
1115 3300046680 Ga0495646_0058243 Ga0495646_0058243_95_1069 303
1116 3300046681 Ga0495647_0010961 Ga0495647_0010961_216_1190 303
1117 3300046689 Ga0495613_0160730 Ga0495613_0160730_186_1160 303
1118 3300047315 Ga0495581_0038273 Ga0495581_0038273_1772_2746 303
1119 3300047319 Ga0495674_0003051 Ga0495674_0003051_12185_13159 303
1120 3300047321 Ga0495676_0058602 Ga0495676_0058602_750_1724 303
1121 3300047471 Ga0495684_0005571 Ga0495684_0005571_7084_8058 303
1122 3300047472 Ga0495686_0047246 Ga0495686_0047246_1667_2641 303
1123 3300047472 Ga0495686_0140550 Ga0495686_0140550_132_1106 303
1124 3300047673 Ga0495593_0135142 Ga0495593_0135142_51_1025 303
1125 3300048913 Ga0496110_0054384 Ga0496110_0054384_552_1532 303
1126 3300048921 Ga0496118_0019326 Ga0496118_0019326_4238_5212 303
1127 3300048923 Ga0496120_0106434 Ga0496120_0106434_73_1047 303
1128 3300049570 Ga0501033_0038402 Ga0501033_0038402_2065_3042 303
1129 3300053077 Ga0495601_0125553 Ga0495601_0125553_657_1631 303
1130 3300053078 Ga0495612_0008650 Ga0495612_0008650_333_1307 303
1131 3300053087 Ga0500643_000168 Ga0500643_000168_45664_46638 303
1132 3300053103 Ga0500555_001077 Ga0500555_001077_113_1087 303
1133 3300053119 Ga0500595_010866 Ga0500595_010866_1115_2089 303
1134 3300053130 Ga0500642_0004996 Ga0500642_0004996_409_1383 303
1135 3300053139 Ga0500568_0012641 Ga0500568_0012641_2195_3169 303
1136 3300053158 Ga0500627_0022311 Ga0500627_0022311_929_1903 303
1137 3300005366 Ga0070659_100051244 Ga0070659_1000512443 304
1138 3300005434 Ga0070709_10003906 Ga0070709_100039068 304
1139 3300005435 Ga0070714_100162185 Ga0070714_1001621852 304
1140 3300005436 Ga0070713_100396101 Ga0070713_1003961011 304
1141 3300005437 Ga0070710_10044041 Ga0070710_100440413 304
1142 3300005439 Ga0070711_100042930 Ga0070711_1000429303 304
1143 3300005614 Ga0068856_100334622 Ga0068856_1003346222 304
1144 3300005842 Ga0068858_100072648 Ga0068858_1000726482 304
1145 3300005937 Ga0081455_10026840 Ga0081455_100268403 304
1146 3300005983 Ga0081540_1021769 Ga0081540_10217694 304
1147 3300006163 Ga0070715_10117130 Ga0070715_101171301 304
1148 3300006175 Ga0070712_100002194 Ga0070712_10000219412 304
1149 3300025297 Ga0209758_1002550 Ga0209758_10025502 304
1150 3300025905 Ga0207685_10082822 Ga0207685_100828222 304
1151 3300025906 Ga0207699_10261047 Ga0207699_102610472 304
1152 3300025915 Ga0207693_10001659 Ga0207693_100016595 304
1153 3300025916 Ga0207663_10231516 Ga0207663_102315162 304
1154 3300025919 Ga0207657_10038738 Ga0207657_100387381 304
1155 3300025928 Ga0207700_10169333 Ga0207700_101693332 304
1156 3300025981 Ga0207640_10111487 Ga0207640_101114872 304
1157 3300026142 Ga0207698_10068252 Ga0207698_100682523 304
1158 3300031235 Ga0265330_10040683 Ga0265330_100406832 304
1159 3300031616 Ga0307508_10000012 Ga0307508_1000001263 304
1160 3300031712 Ga0265342_10030921 Ga0265342_100309212 304
1161 3300035695 Ga0373927_0007812 Ga0373927_0007812_3309_4283 304
1162 3300044735 Ga0466968_0072252 Ga0466968_0072252_439_1419 304
1163 3300045049 Ga0466959_0013768 Ga0466959_0013768_4370_5344 304
1164 3300046507 Ga0495606_0001350 Ga0495606_0001350_2193_3167 304
1165 3300046524 Ga0495648_0004195 Ga0495648_0004195_433_1407 304
1166 3300048909 Ga0496106_0003366 Ga0496106_0003366_5410_6384 304
1167 3300048910 Ga0496107_0005653 Ga0496107_0005653_3377_4351 304
1168 3300048911 Ga0496108_0000891 Ga0496108_0000891_1182_2156 304
1169 3300048914 Ga0496111_0018373 Ga0496111_0018373_2860_3834 304
1170 3300048915 Ga0496112_0010230 Ga0496112_0010230_1437_2411 304
1171 3300048916 Ga0496113_0026554 Ga0496113_0026554_1374_2348 304
1172 3300048924 Ga0496121_0051307 Ga0496121_0051307_494_1468 304
1173 3300048929 Ga0496126_0052167 Ga0496126_0052167_1999_2973 304
1174 3300049569 Ga0501032_0014750 Ga0501032_0014750_3082_4101 304
1175 3300049570 Ga0501033_0056537 Ga0501033_0056537_1094_2065 304
1176 3300049742 Ga0501080_0191576 Ga0501080_0191576_866_1837 304
1177 3300053092 Ga0500583_0002232 Ga0500583_0002232_2235_3209 304
1178 3300053094 Ga0500566_0000191 Ga0500566_0000191_18762_19736 304
1179 3300053095 Ga0500640_002832 Ga0500640_002832_3524_4498 304
1180 3300053111 Ga0500572_000186 Ga0500572_000186_2171_3145 304
1181 3300053122 Ga0500608_000896 Ga0500608_000896_91_1065 304
1182 3300053123 Ga0500614_001636 Ga0500614_001636_113_1087 304
1183 3300053136 Ga0500559_0022199 Ga0500559_0022199_636_1610 304
1184 3300053142 Ga0500577_0045769 Ga0500577_0045769_591_1565 304
1185 3300053159 Ga0500630_002217 Ga0500630_002217_1292_2266 304
1186 3300053163 Ga0500639_000031 Ga0500639_000031_10615_11589 304
1187 3300053163 Ga0500639_015280 Ga0500639_015280_286_1257 304
1188 3300053725 Ga0500576_092262 Ga0500576_092262_254_1228 304
1189 3300000549 LJQas_1005339 LJQas_10053392 305
1190 3300005327 Ga0070658_10079986 Ga0070658_100799863 305
1191 3300005434 Ga0070709_10037413 Ga0070709_100374131 305
1192 3300005436 Ga0070713_100334865 Ga0070713_1003348652 305
1193 3300005437 Ga0070710_10002918 Ga0070710_100029184 305
1194 3300005616 Ga0068852_100537531 Ga0068852_1005375312 305
1195 3300006038 Ga0075365_10040274 Ga0075365_100402743 305
1196 3300006051 Ga0075364_10074775 Ga0075364_100747752 305
1197 3300006186 Ga0075369_10116658 Ga0075369_101166581 305
1198 3300007265 Ga0099794_10003243 Ga0099794_100032433 305
1199 3300007788 Ga0099795_10044008 Ga0099795_100440082 305
1200 3300009093 Ga0105240_10193225 Ga0105240_101932252 305
1201 3300021384 Ga0213876_10114675 Ga0213876_101146752 305
1202 3300025253 Ga0209677_100388 Ga0209677_10038810 305
1203 3300025261 Ga0209233_1005842 Ga0209233_10058422 305
1204 3300025272 Ga0209455_1001976 Ga0209455_10019766 305
1205 3300025272 Ga0209455_1004752 Ga0209455_10047522 305
1206 3300025295 Ga0209564_1000477 Ga0209564_100047717 305
1207 3300025295 Ga0209564_1008490 Ga0209564_10084904 305
1208 3300025898 Ga0207692_10000717 Ga0207692_100007172 305
1209 3300025906 Ga0207699_10000122 Ga0207699_1000012235 305
1210 3300025909 Ga0207705_10051762 Ga0207705_100517623 305
1211 3300025913 Ga0207695_10165737 Ga0207695_101657372 305
1212 3300025914 Ga0207671_10110224 Ga0207671_101102241 305
1213 3300025915 Ga0207693_10167364 Ga0207693_101673642 305
1214 3300025928 Ga0207700_10292764 Ga0207700_102927642 305
1215 3300025929 Ga0207664_10020719 Ga0207664_100207192 305
1216 3300025929 Ga0207664_10330991 Ga0207664_103309912 305
1217 3300025939 Ga0207665_10003747 Ga0207665_100037473 305
1218 3300028556 Ga0265337_1002558 Ga0265337_10025582 305
1219 3300028558 Ga0265326_10002652 Ga0265326_100026522 305
1220 3300028563 Ga0265319_1003402 Ga0265319_10034022 305
1221 3300028573 Ga0265334_10001143 Ga0265334_100011432 305
1222 3300028653 Ga0265323_10000720 Ga0265323_1000072015 305
1223 3300028666 Ga0265336_10000640 Ga0265336_100006405 305
1224 3300028794 Ga0307515_10179532 Ga0307515_101795322 305
1225 3300028800 Ga0265338_10001434 Ga0265338_1000143438 305
1226 3300031456 Ga0307513_10311219 Ga0307513_103112191 305
1227 3300033180 Ga0307510_10022895 Ga0307510_100228955 305
1228 3300035111 Ga0373923_0004211 Ga0373923_0004211_3621_4595 305
1229 3300035117 Ga0373953_0013110 Ga0373953_0013110_32_1006 305
1230 3300035118 Ga0373954_0026816 Ga0373954_0026816_804_1778 305
1231 3300035119 Ga0373956_0033451 Ga0373956_0033451_153_1127 305
1232 3300035120 Ga0373957_0002595 Ga0373957_0002595_1531_2505 305
1233 3300035172 Ga0373955_0001659 Ga0373955_0001659_7915_8889 305
1234 3300035172 Ga0373955_0005485 Ga0373955_0005485_4501_5484 305
1235 3300035410 Ga0373924_0008500 Ga0373924_0008500_659_1633 305
1236 3300035410 Ga0373924_0012615 Ga0373924_0012615_1280_2263 305
1237 3300035692 Ga0373935_0002054 Ga0373935_0002054_7959_8942 305
1238 3300035695 Ga0373927_0000634 Ga0373927_0000634_11258_12241 305
1239 3300035724 Ga0373933_0079211 Ga0373933_0079211_620_1594 305
1240 3300035725 Ga0373947_0006400 Ga0373947_0006400_1608_2591 305
1241 3300036401 Ga0373937_0016133 Ga0373937_0016133_4504_5478 305
1242 3300036401 Ga0373937_0018898 Ga0373937_0018898_242_1225 305
1243 3300037068 Ga0373925_0001281 Ga0373925_0001281_3818_4801 305
1244 3300037466 Ga0395898_0132794 Ga0395898_0132794_470_1444 305
1245 3300037471 Ga0395905_0444911 Ga0395905_0444911_152_1126 305
1246 3300038443 Ga0395901_0139954 Ga0395901_0139954_264_1238 305
1247 3300038443 Ga0395901_0209917 Ga0395901_0209917_941_1915 305
1248 3300039437 Ga0436365_1704823 Ga0436365_1704823_1330_2304 305
1249 3300039447 Ga0436361_0911334 Ga0436361_0911334_394_1368 305
1250 3300045976 Ga0466967_0015018 Ga0466967_0015018_4368_5342 305
1251 3300046454 Ga0495592_0004059 Ga0495592_0004059_1193_2167 305
1252 3300046454 Ga0495592_0020450 Ga0495592_0020450_2184_3167 305
1253 3300046455 Ga0495603_0000036 Ga0495603_0000036_25699_26682 305
1254 3300046459 Ga0495629_0000148 Ga0495629_0000148_34844_35827 305
1255 3300046459 Ga0495629_0000331 Ga0495629_0000331_27798_28772 305
1256 3300046460 Ga0495638_0049174 Ga0495638_0049174_217_1191 305
1257 3300046461 Ga0495641_0006132 Ga0495641_0006132_4958_5941 305
1258 3300046462 Ga0495651_0012599 Ga0495651_0012599_418_1392 305
1259 3300046463 Ga0495653_0006476 Ga0495653_0006476_8607_9581 305
1260 3300046472 Ga0495580_0001864 Ga0495580_0001864_15967_16950 305
1261 3300046473 Ga0495582_0000191 Ga0495582_0000191_23503_24486 305
1262 3300046474 Ga0495605_0114940 Ga0495605_0114940_34_1008 305
1263 3300046475 Ga0495639_0000209 Ga0495639_0000209_10940_11923 305
1264 3300046476 Ga0495662_0000787 Ga0495662_0000787_2080_3063 305
1265 3300046477 Ga0495664_0010510 Ga0495664_0010510_2410_3393 305
1266 3300046499 Ga0495594_0001199 Ga0495594_0001199_718_1701 305
1267 3300046501 Ga0495607_0045280 Ga0495607_0045280_168_1142 305
1268 3300046511 Ga0495608_0000988 Ga0495608_0000988_2585_3559 305
1269 3300046513 Ga0495616_0033075 Ga0495616_0033075_1268_2242 305
1270 3300046515 Ga0495620_0062114 Ga0495620_0062114_390_1364 305
1271 3300046516 Ga0495628_0020271 Ga0495628_0020271_491_1474 305
1272 3300046516 Ga0495628_0099374 Ga0495628_0099374_356_1330 305
1273 3300046517 Ga0495630_0052952 Ga0495630_0052952_317_1300 305
1274 3300046518 Ga0495631_0053301 Ga0495631_0053301_145_1119 305
1275 3300046522 Ga0495643_0024248 Ga0495643_0024248_396_1370 305
1276 3300046529 Ga0495652_0048650 Ga0495652_0048650_418_1392 305
1277 3300046529 Ga0495652_0082236 Ga0495652_0082236_1538_2521 305
1278 3300046530 Ga0495654_0012515 Ga0495654_0012515_807_1781 305
1279 3300046531 Ga0495665_0000118 Ga0495665_0000118_35018_36001 305
1280 3300046533 Ga0495640_0000577 Ga0495640_0000577_6702_7685 305
1281 3300046533 Ga0495640_0007374 Ga0495640_0007374_5420_6394 305
1282 3300046536 Ga0495587_0028191 Ga0495587_0028191_1039_2013 305
1283 3300046543 Ga0495645_0006263 Ga0495645_0006263_2059_3033 305
1284 3300046557 Ga0495622_0011977 Ga0495622_0011977_2391_3365 305
1285 3300046557 Ga0495622_0018516 Ga0495622_0018516_946_1929 305
1286 3300046559 Ga0495667_0002269 Ga0495667_0002269_5964_6938 305
1287 3300046642 Ga0495634_0007487 Ga0495634_0007487_2104_3087 305
1288 3300046660 Ga0495625_0034285 Ga0495625_0034285_2013_2987 305
1289 3300046663 Ga0495635_0000434 Ga0495635_0000434_17733_18707 305
1290 3300046663 Ga0495635_0008844 Ga0495635_0008844_986_1969 305
1291 3300046675 Ga0495657_0021545 Ga0495657_0021545_1193_2167 305
1292 3300046675 Ga0495657_0055579 Ga0495657_0055579_1147_2130 305
1293 3300046678 Ga0495599_0122482 Ga0495599_0122482_23_997 305
1294 3300046679 Ga0495623_0085377 Ga0495623_0085377_635_1609 305
1295 3300046680 Ga0495646_0009025 Ga0495646_0009025_1770_2744 305
1296 3300046680 Ga0495646_0022821 Ga0495646_0022821_1748_2731 305
1297 3300046681 Ga0495647_0001407 Ga0495647_0001407_4845_5828 305
1298 3300046683 Ga0495658_0000703 Ga0495658_0000703_16279_17262 305
1299 3300046689 Ga0495613_0001856 Ga0495613_0001856_11215_12198 305
1300 3300046689 Ga0495613_0026316 Ga0495613_0026316_1315_2289 305
1301 3300046690 Ga0495624_0006594 Ga0495624_0006594_2087_3070 305
1302 3300046691 Ga0495670_0028737 Ga0495670_0028737_1445_2419 305
1303 3300046809 Ga0495600_0011288 Ga0495600_0011288_1193_2167 305
1304 3300046809 Ga0495600_0182838 Ga0495600_0182838_115_1089 305
1305 3300047315 Ga0495581_0000313 Ga0495581_0000313_377_1360 305
1306 3300047317 Ga0495604_0011366 Ga0495604_0011366_4559_5533 305
1307 3300047319 Ga0495674_0000443 Ga0495674_0000443_5058_6041 305
1308 3300047319 Ga0495674_0022928 Ga0495674_0022928_4119_5093 305
1309 3300047320 Ga0495672_0010289 Ga0495672_0010289_3782_4759 305
1310 3300047322 Ga0495680_0041645 Ga0495680_0041645_2259_3233 305
1311 3300047323 Ga0495683_0075237 Ga0495683_0075237_239_1213 305
1312 3300047444 Ga0495675_0063796 Ga0495675_0063796_1334_2308 305
1313 3300047469 Ga0495673_0011793 Ga0495673_0011793_1396_2379 305
1314 3300047471 Ga0495684_0000842 Ga0495684_0000842_14880_15854 305
1315 3300047471 Ga0495684_0039380 Ga0495684_0039380_1894_2877 305
1316 3300047472 Ga0495686_0004839 Ga0495686_0004839_934_1908 305
1317 3300047673 Ga0495593_0000039 Ga0495593_0000039_25735_26718 305
1318 3300047673 Ga0495593_0002371 Ga0495593_0002371_2125_3099 305
1319 3300048088 Ga0495602_0021472 Ga0495602_0021472_748_1722 305
1320 3300048089 Ga0495614_0042233 Ga0495614_0042233_740_1723 305
1321 3300048919 Ga0496116_0002462 Ga0496116_0002462_1966_2940 305
1322 3300048920 Ga0496117_0070520 Ga0496117_0070520_620_1594 305
1323 3300048920 Ga0496117_0082796 Ga0496117_0082796_766_1740 305
1324 3300048921 Ga0496118_0003033 Ga0496118_0003033_11599_12573 305
1325 3300048921 Ga0496118_0143091 Ga0496118_0143091_14_988 305
1326 3300048921 Ga0496118_0230413 Ga0496118_0230413_72_1046 305
1327 3300048922 Ga0496119_0036885 Ga0496119_0036885_1330_2304 305
1328 3300048923 Ga0496120_0011735 Ga0496120_0011735_4511_5485 305
1329 3300048924 Ga0496121_0021406 Ga0496121_0021406_3601_4575 305
1330 3300048924 Ga0496121_0051853 Ga0496121_0051853_2413_3387 305
1331 3300048924 Ga0496121_0064894 Ga0496121_0064894_1059_2033 305
1332 3300048924 Ga0496121_0133331 Ga0496121_0133331_622_1596 305
1333 3300048925 Ga0496122_0108857 Ga0496122_0108857_680_1654 305
1334 3300048928 Ga0496125_0010748 Ga0496125_0010748_7189_8163 305
1335 3300048928 Ga0496125_0062913 Ga0496125_0062913_409_1383 305
1336 3300048928 Ga0496125_0098173 Ga0496125_0098173_961_1935 305
1337 3300048929 Ga0496126_0022314 Ga0496126_0022314_2502_3476 305
1338 3300048929 Ga0496126_0182054 Ga0496126_0182054_540_1514 305
1339 3300048929 Ga0496126_0217044 Ga0496126_0217044_465_1439 305
1340 3300049570 Ga0501033_0205260 Ga0501033_0205260_165_1139 305
1341 3300049571 Ga0501034_0032366 Ga0501034_0032366_2444_3421 305
1342 3300049581 Ga0501047_0282564 Ga0501047_0282564_110_1084 305
1343 3300049822 Ga0501035_0096777 Ga0501035_0096777_984_1958 305
1344 3300049823 Ga0501044_0168165 Ga0501044_0168165_747_1718 305
1345 3300049823 Ga0501044_0326674 Ga0501044_0326674_29_1003 305
1346 3300049823 Ga0501044_0329376 Ga0501044_0329376_404_1378 305
1347 3300050492 nmdc:mga0yw44_33722_c1 nmdc:mga0yw44_33722_c1_177_1151 305
1348 3300053077 Ga0495601_0055598 Ga0495601_0055598_875_1849 305
1349 3300053078 Ga0495612_0017970 Ga0495612_0017970_707_1681 305
1350 3300053080 Ga0500635_0002159 Ga0500635_0002159_2973_3947 305
1351 3300053084 Ga0495595_0000869 Ga0495595_0000869_4624_5598 305
1352 3300053085 Ga0495619_0000617 Ga0495619_0000617_620_1594 305
1353 3300053087 Ga0500643_012952 Ga0500643_012952_1710_2684 305
1354 3300053093 Ga0500651_0088282 Ga0500651_0088282_355_1329 305
1355 3300053094 Ga0500566_0011660 Ga0500566_0011660_3289_4263 305
1356 3300053096 Ga0500641_0007929 Ga0500641_0007929_2527_3501 305
1357 3300053098 Ga0500650_0005221 Ga0500650_0005221_348_1322 305
1358 3300053104 Ga0500556_0000047 Ga0500556_0000047_26423_27397 305
1359 3300053111 Ga0500572_000153 Ga0500572_000153_14661_15635 305
1360 3300053116 Ga0500592_010161 Ga0500592_010161_155_1129 305
1361 3300053122 Ga0500608_000229 Ga0500608_000229_9135_10109 305
1362 3300053130 Ga0500642_0000142 Ga0500642_0000142_21649_22623 305
1363 3300053131 Ga0500652_001091 Ga0500652_001091_4212_5186 305
1364 3300053136 Ga0500559_0000105 Ga0500559_0000105_11927_12901 305
1365 3300053136 Ga0500559_0001758 Ga0500559_0001758_6785_7759 305
1366 3300053139 Ga0500568_0004453 Ga0500568_0004453_25_999 305
1367 3300053142 Ga0500577_0039956 Ga0500577_0039956_365_1339 305
1368 3300053150 Ga0500603_002116 Ga0500603_002116_2057_3031 305
1369 3300053153 Ga0500616_0000784 Ga0500616_0000784_9068_10042 305
1370 3300053154 Ga0500619_033075 Ga0500619_033075_263_1237 305
1371 3300053156 Ga0500622_0005469 Ga0500622_0005469_3001_3975 305
1372 3300053163 Ga0500639_044784 Ga0500639_044784_112_1086 305
1373 3300053177 Ga0500636_0003222 Ga0500636_0003222_7143_8117 305
1374 3300053178 Ga0500637_0000519 Ga0500637_0000519_8152_9126 305
1375 3300053178 Ga0500637_0005808 Ga0500637_0005808_4337_5311 305
1376 3300053178 Ga0500637_0025159 Ga0500637_0025159_1371_2345 305
1377 3300053730 Ga0500645_009851 Ga0500645_009851_1389_2363 305

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

160

290

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vmb-assembly2.cif.gz_B the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8058 159 272
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.7991 159 269
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.7739 159 269
2vmb-assembly2.cif.gz_B the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.7515 159 272
2ezk-assembly1.cif.gz_A solution nmr structure of the ibeta subdomain of the mu end dna binding domain of phage mu transposase, regularized mean structure 0.5177 155 226
ID Description Score Start End Superfamily
af_O69625_45_175_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7131 166 288 1.20.81.30
af_O69625_45_175_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.6704 166 288 1.20.81.30
2ezkA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.5177 155 226 1.10.10.60
af_Q9BIC4_29_113_1.10.225.10 Mainly Alpha;Orthogonal Bundle;NK-Lysin;Saposin-like 0.494 157 225 1.10.225.10
af_Q9BIC4_29_113_1.10.225.10 Mainly Alpha;Orthogonal Bundle;NK-Lysin;Saposin-like 0.4044 157 225 1.10.225.10
ID Description Score Start End GO Terms
AF-A0A529HLZ7-F1-model_v4 Type II secretion system F family protein 0.922 122 243 GO:0005886
AF-A0A529Q458-F1-model_v4 Type II secretion system F family protein 0.9134 122 258 GO:0005886
AF-A0A529ZM01-F1-model_v4 Type II secretion system F family protein 0.8963 43 224 GO:0016020
AF-A0A5R2N1Y6-F1-model_v4 Type II secretion system F family protein 0.885 145 284 GO:0005886
AF-A0A529Q458-F1-model_v4 Type II secretion system F family protein 0.8715 122 258 GO:0005886

Feature Viewer

pLDDT pTM Quality
76.01 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map