F493181

General Info

Members Datasets Scaffolds Average Seq Length
1344 1052 545 380

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2513237088|2513596396
Length 454
Sequence SSLRTIRCADTQHRTACTITFDLSRPAAPLADCAIAELAIDPTRGLETREASAQFPCDPQFGRIFRVAYVRRILPSRSTMQFAPQQDEALKAVSKWLKEGRSPLFRLFGYAGTGKTTLARHFAEHVDGEVLFAAFTGKAAQVLRSRGASNAKTIHSLIYRPRGEEAVEDEETGKTSIAPMFTINRQSPVAKAALIIVDECSMVDEALGKDLMSFGTPILVLGDPGQLPPVSGGGYFTNQEPDYLLTDIHRQARDNPIIKLAMQVREGNEIMYGDYGAAQVISKNEVNQSLVLDADQVLVGTNRTRRRYNQRLRELKGFTAEYPQTGDKLVCLRNDPAKGLLNGSLWQVMTSSRETTKPGINLLIRPEDDDMDRGAAKIKLLKQAFEDVEGEIPWNTRKRYDEFDYGYALTVHKAQGSQWNNVVLFDESWAFRDTRERWLYTAITRAAETLTIVR

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276019 Ensifer aridi TW10 Isolate Nodule
6 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
7 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
8 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
9 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
10 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
11 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
12 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
13 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
14 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
15 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
16 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
17 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
18 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
19 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
20 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
21 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
22 2512875024 Mesorhizobium loti R88b Isolate Nodule
23 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
24 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
25 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
26 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
27 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
28 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
29 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
30 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
31 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
32 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
33 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
34 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
35 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
36 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
37 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
38 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
39 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
40 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
41 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
42 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
43 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
44 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
45 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
46 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
47 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
48 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
49 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
50 2516143018 Ensifer sp. BR816 Isolate Nodule
51 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
52 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
53 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
54 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
55 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
56 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
57 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
58 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
59 2534681786 Brucella suis 92/29 Isolate Unclassified
60 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
61 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
62 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
63 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
64 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
65 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
66 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
67 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
68 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
69 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
70 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
71 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
72 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
73 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
74 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
75 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
76 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
77 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
78 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
79 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
80 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
81 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
82 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
83 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
84 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
85 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
86 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
87 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
88 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
89 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
90 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
91 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
92 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
93 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
94 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
95 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
96 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
97 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
98 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
99 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
100 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
101 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
102 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
103 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
104 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
105 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
106 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
107 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
108 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
109 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
110 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
111 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
112 2643221557 Ensifer sp. Root558 Isolate Unclassified
113 2643221558 Rhizobium sp. Root149 Isolate Unclassified
114 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
115 2643221568 Rhizobium sp. Root564 Isolate Unclassified
116 2643221582 Rhizobium sp. Root651 Isolate Unclassified
117 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
118 2643221599 Rhizobium sp. Root708 Isolate Unclassified
119 2643221610 Ensifer sp. Root74 Isolate Unclassified
120 2643221618 Ensifer sp. Root231 Isolate Unclassified
121 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
122 2643221626 Ensifer sp. Root31 Isolate Unclassified
123 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
124 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
125 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
126 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
127 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
128 2643221655 Ensifer sp. Root1252 Isolate Unclassified
129 2643221659 Ensifer sp. Root127 Isolate Unclassified
130 2643221668 Ensifer sp. Root423 Isolate Unclassified
131 2643221675 Ensifer sp. Root1298 Isolate Unclassified
132 2643221680 Ensifer sp. Root1312 Isolate Unclassified
133 2643221693 Rhizobium sp. Root491 Isolate Unclassified
134 2643221698 Ensifer sp. Root142 Isolate Unclassified
135 2643221712 Ensifer sp. Root258 Isolate Unclassified
136 2643221718 Rhizobium sp. Root268 Isolate Unclassified
137 2643221719 Rhizobium sp. Root274 Isolate Unclassified
138 2643221723 Ensifer sp. Root278 Isolate Unclassified
139 2643221726 Ensifer sp. Root954 Isolate Unclassified
140 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
141 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
142 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
143 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
144 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
145 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
146 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
147 2718217882 Rhizobium sp. N741 Isolate Nodule
148 2718217927 Rhizobium sp. N324 Isolate Nodule
149 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
150 2718218009 Rhizobium sp. N561 Isolate Nodule
151 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
152 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
153 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
154 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
155 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
156 2718218363 Rhizobium sp. N113 Isolate Nodule
157 2718218365 Rhizobium sp. N731 Isolate Nodule
158 2718218366 Rhizobium sp. N621 Isolate Nodule
159 2718218423 Rhizobium sp. N941 Isolate Nodule
160 2721755514 Rhizobium sp. N6212 Isolate Nodule
161 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
162 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
163 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
164 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
165 2721755809 Rhizobium sp. N541 Isolate Nodule
166 2721755810 Rhizobium sp. N871 Isolate Nodule
167 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
168 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
169 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
170 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
171 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
172 2728369365 Rhizobium sp. N1341 Isolate Nodule
173 2728369397 Rhizobium sp. N1314 Isolate Nodule
174 2738541293 Rhizobium sp. GV031 Isolate Unclassified
175 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
176 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
177 2738543024 Aminobacter sp. AP02 Isolate Unclassified
178 2751185800 Brucella pituitosa AA2 Isolate Unclassified
179 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
180 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
181 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
182 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
183 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
184 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
185 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
186 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
187 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
188 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
189 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
190 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
191 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
192 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
193 2791355256 Rhizobium sp. M10 Isolate Nodule
194 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
195 2791355260 Rhizobium sp. L9 Isolate Nodule
196 2791355261 Rhizobium sp. J15 Isolate Nodule
197 2791355262 Rhizobium sp. M1 Isolate Nodule
198 2791355263 Rhizobium chutanense C5 Isolate Nodule
199 2791355264 Rhizobium sp. S9 Isolate Nodule
200 2791355265 Rhizobium sp. H4 Isolate Nodule
201 2791355266 Rhizobium sp. L43 Isolate Nodule
202 2791355267 Rhizobium sp. L18 Isolate Nodule
203 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
204 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
205 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
206 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
207 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
208 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
209 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
210 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
211 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
212 2802429633 Rhizobium anhuiense J3 Isolate Nodule
213 2802429634 Rhizobium anhuiense S10 Isolate Nodule
214 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
215 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
216 2802429637 Rhizobium anhuiense C15 Isolate Nodule
217 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
218 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
219 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
220 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
221 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
222 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
223 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
224 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
225 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
226 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
227 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
228 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
229 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
230 2838048938 Rhizobium pisi 27/80 Isolate Nodule
231 2838061910 Rhizobium phaseoli L15 Isolate Nodule
232 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
233 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
234 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
235 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
236 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
237 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
238 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
239 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
240 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
241 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
242 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
243 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
244 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
245 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
246 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
247 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
248 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
249 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
250 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
251 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
252 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
253 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
254 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
255 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
256 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
257 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
258 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
259 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
260 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
261 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
262 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
263 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
264 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
265 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
266 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
267 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
268 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
269 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
270 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
271 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
272 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
273 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
274 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
275 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
276 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
277 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
278 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
279 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
280 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
281 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
282 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
283 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
284 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
285 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
286 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
287 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
288 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
289 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
290 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
291 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
292 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
293 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
294 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
295 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
296 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
297 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
298 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
299 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
300 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
301 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
302 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
303 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
304 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
305 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
306 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
307 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
308 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
309 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
310 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
311 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
312 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
313 2844163670 Ensifer sp. 1H6 Isolate Unclassified
314 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
315 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
316 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
317 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
318 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
319 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
320 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
321 2854911287 Brucella lupini LUP21 Isolate Unclassified
322 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
323 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
324 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
325 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
326 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
327 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
328 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
329 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
330 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
331 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
332 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
333 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
334 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
335 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
336 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
337 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
338 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
339 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
340 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
341 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
342 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
343 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
344 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
345 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
346 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
347 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
348 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
349 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
350 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
351 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
352 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
353 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
354 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
355 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
356 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
357 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
358 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
359 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
360 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
361 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
362 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
363 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
364 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
365 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
366 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
367 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
368 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
369 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
370 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
371 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
372 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
373 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
374 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
375 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
376 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
377 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
378 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
379 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
380 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
381 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
382 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
383 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
384 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
385 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
386 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
387 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
388 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
389 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
390 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
391 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
392 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
393 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
394 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
395 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
396 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
397 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
398 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
399 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
400 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
401 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
402 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
403 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
404 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
405 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
406 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
407 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
408 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
409 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
410 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
411 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
412 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
413 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
414 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
415 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
416 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
417 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
418 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
419 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
420 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
421 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
422 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
423 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
424 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
425 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
426 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
427 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
428 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
429 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
430 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
431 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
432 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
433 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
434 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
435 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
436 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
437 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
438 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
439 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
440 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
441 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
442 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
443 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
444 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
445 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
446 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
447 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
448 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
449 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
450 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
451 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
452 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
453 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
454 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
455 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
456 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
457 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
458 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
459 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
460 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
461 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
462 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
463 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
464 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
465 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
466 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
467 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
468 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
469 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
470 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
471 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
472 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
473 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
474 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
475 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
476 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
477 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
478 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
479 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
480 2933599457 Rhizobium phaseoli M3 Isolate Nodule
481 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
482 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
483 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
484 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
485 2936381700 Rhizobium chutanense C16 Isolate Unclassified
486 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
487 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
488 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
489 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
490 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
491 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
492 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
493 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
494 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
495 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
496 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
497 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
498 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
499 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
500 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
501 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
502 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
503 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
504 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
505 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
506 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
507 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
508 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
509 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
510 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
511 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
512 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
513 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
514 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
515 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
516 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
517 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
518 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
519 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
520 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
521 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
522 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
523 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
524 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
525 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
526 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
527 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
528 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
529 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
530 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
531 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
532 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
533 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
534 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
535 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
536 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
537 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
538 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
539 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
540 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
541 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
542 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
543 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
544 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
545 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
546 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
547 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
548 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
549 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
550 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
551 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
552 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
553 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
554 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
555 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
556 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
557 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
558 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
559 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
560 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
561 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
562 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
563 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
564 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
565 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
566 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
567 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
568 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
569 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
570 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
571 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
572 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
573 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
574 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
575 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
576 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
577 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
578 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
579 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
580 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
581 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
582 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
583 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
584 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
585 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
586 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
587 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
588 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
589 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
590 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
591 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
592 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
593 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
594 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
595 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
596 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
597 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
598 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
599 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
600 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
601 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
602 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
603 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
604 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
605 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
606 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
607 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
608 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
609 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
610 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
611 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
612 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
613 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
614 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
615 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
616 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
617 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
618 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
619 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
620 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
621 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
622 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
623 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
624 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
625 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
626 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
627 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
628 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
629 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
630 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
631 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
632 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
633 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
634 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
635 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
636 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
637 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
638 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
639 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
640 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
641 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
642 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
643 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
644 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
645 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
646 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
647 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
648 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
649 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
650 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
651 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
652 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
653 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
654 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
655 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
656 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
657 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
658 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
659 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
660 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
661 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
662 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
663 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
664 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
665 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
666 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
667 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
668 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
669 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
670 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
671 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
672 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
673 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
674 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
675 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
676 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
677 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
678 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
679 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
680 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
681 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
682 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
683 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
684 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
685 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
686 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
687 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
688 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
689 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
690 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
691 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
692 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
693 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
694 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
695 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
696 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
697 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
698 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
699 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
700 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
701 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
702 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
703 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
704 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
705 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
706 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
707 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
708 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
709 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
710 2996887358 Rhizobium sp. R711 Isolate Nodule
711 2996893221 Rhizobium sp. R635 Isolate Nodule
712 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
713 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
714 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
715 3004167301 Mesorhizobium loti 582 Isolate Unclassified
716 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
717 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
718 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
719 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
720 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
721 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
722 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
723 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
724 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
725 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
726 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
727 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
728 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
729 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
730 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
731 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
732 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
733 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
734 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
735 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
736 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
737 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
738 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
739 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
740 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
741 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
742 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
743 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
744 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
745 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
746 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
747 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
748 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
749 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
750 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
751 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
752 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
753 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
754 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
755 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
756 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
757 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
758 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
759 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
760 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
761 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
762 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
763 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
764 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
765 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
766 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
767 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
768 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
769 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
770 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
771 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
772 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
773 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
774 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
775 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
776 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
777 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
778 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
779 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
780 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
781 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
782 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
783 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
784 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
785 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
786 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
787 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
788 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
789 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
790 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
791 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
792 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
793 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
794 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
795 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
796 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
797 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
798 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
799 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
800 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
801 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
802 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
803 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
804 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
805 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
806 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
807 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
808 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
809 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
810 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
811 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
812 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
813 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
814 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
815 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
816 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
817 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
818 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
819 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
820 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
821 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
822 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
823 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
824 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
825 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
826 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
827 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
828 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
829 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
830 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
831 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
832 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
833 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
834 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
835 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
836 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
837 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
838 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
839 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
840 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
841 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
842 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
843 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
844 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
845 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
846 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
847 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
848 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
849 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
850 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
851 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
852 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
853 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
854 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
855 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
856 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
857 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
858 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
859 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
860 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
861 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
862 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
863 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
864 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
865 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
866 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
867 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
868 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
869 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
870 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
871 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
872 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
873 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
874 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
875 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
876 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
877 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
878 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
879 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
880 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
881 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
882 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
883 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
884 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
885 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
886 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
887 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
888 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
889 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
890 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
891 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
892 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
893 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
894 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
895 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
896 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
897 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
898 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
899 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
900 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
901 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
902 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
903 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
904 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
905 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
906 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
907 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
908 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
909 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
910 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
911 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
912 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
913 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
914 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
915 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
916 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
917 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
918 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
919 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
920 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
921 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
922 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
923 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
924 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
925 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
926 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
927 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
928 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
929 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
930 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
931 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
932 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
933 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
934 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
935 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
936 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
937 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
938 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
939 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
940 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
941 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
942 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
943 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
944 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
945 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
946 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
947 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
948 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
949 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
950 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
951 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
952 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
953 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
954 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
955 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
956 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
957 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
958 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
959 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
960 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
961 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
962 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
963 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
964 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
965 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
966 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
967 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
968 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
969 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
970 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
971 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
972 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
973 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
974 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
975 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
976 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
977 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
978 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
979 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
980 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
981 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
982 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
983 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
984 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
985 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
986 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
987 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
988 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
989 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
990 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
991 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
992 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
993 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
994 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
995 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
996 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
997 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
998 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
999 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1000 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1001 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1002 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1003 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1004 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1005 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1006 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1007 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1008 8005258706 Rhizobium sp. R693 Isolate Nodule
1009 8005275841 Rhizobium sp. N4311 Isolate Nodule
1010 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1011 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1012 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1013 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1014 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1015 8005321885 Rhizobium sp. R72 Isolate Nodule
1016 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1017 8005382845 Rhizobium sp. R634 Isolate Nodule
1018 8005395548 Rhizobium sp. R339 Isolate Nodule
1019 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1020 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1021 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1022 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1023 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1024 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1025 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1026 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1027 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1028 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1029 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1030 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1031 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1032 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1033 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1034 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1035 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1036 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1037 8018176218 Rhizobium sp. N122 Isolate Nodule
1038 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1039 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1040 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1041 8024501048 Rhizobium sp. H4 Isolate Nodule
1042 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
1043 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1044 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1045 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1046 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1047 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1048 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1049 8056382006 Rhizobium croatiense 13T Isolate Nodule
1050 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1051 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1052 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 40.48
Metatranscriptomes 0.07
Isolates 59.45

Biome Distribution

Category Percentage (%)
Aerial Root 0.37
Bulb 0
Endosphere 13.84
Nodule 45.91
Rhizoplane 1.71
Rhizosphere 22.54
Stem 0
Stem Tuber 0
Unclassified 15.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10031325 3300001979 Bacteria 1717
2 JGI25155J39150_1000001 3300002704 Bacteria 354543
3 JGI25156J39149_1000001 3300002705 Bacteria 354557
4 JGI25162J39368_1000380 3300002737 Bacteria 37780
5 JGI25162J39368_1000534 3300002737 Bacteria 28340
6 JGI25154J39366_1000011 3300002738 Bacteria 296007
7 JGI25158J39367_1000129 3300002739 Bacteria 17721
8 JGI25157J39369_1000079 3300002741 Bacteria 86111
9 JGI25157J39369_1000237 3300002741 Bacteria 42496
10 JGI25152J39213_1000826 3300002773 Bacteria 15432
11 JGI25152J39213_1003179 3300002773 Bacteria 5718
12 JGI25152J39213_1007411 3300002773 Bacteria 2844
13 JGI25150J39212_1000165 3300002774 Bacteria 37364
14 JGI25150J39212_1000307 3300002774 Bacteria 24463
15 JGI25150J39212_1007748 3300002774 Bacteria 2141
16 JGI25159J45721_1000040 3300002987 Bacteria 68143
17 JGI25159J45721_1000613 3300002987 Bacteria 15891
18 JGI25159J45721_1001660 3300002987 Bacteria 9022
19 JGI25151J46595_10000329 3300003187 Bacteria 51364
20 JGI25151J46595_10011722 3300003187 Bacteria 4017
21 JGI25151J46595_10027067 3300003187 Bacteria 2305
22 JGI25165J46597_1000015 3300003214 Bacteria 380891
23 JGI25165J46597_1000422 3300003214 Bacteria 43957
24 JGI25165J46597_1001018 3300003214 Bacteria 18487
25 JGI25165J46597_1002237 3300003214 Bacteria 6736
26 JGI25165J46597_1004651 3300003214 Bacteria 2873
27 JGI25153J46596_10001789 3300003215 Bacteria 12751
28 JGI25153J46596_10003058 3300003215 Bacteria 9445
29 JGI25153J46596_10003631 3300003215 Bacteria 8560
30 rootL2_10016257 3300003322 Bacteria 18880
31 rootL2_10035682 3300003322 Bacteria 24737
32 JGI25160J50197_1000001 3300003354 Bacteria 782301
33 JGI25160J50197_1000128 3300003354 Bacteria 68143
34 JGI25160J50197_1000397 3300003354 Bacteria 28201
35 JGI25161J50226_1000001 3300003374 Bacteria 655036
36 JGI25161J50226_1000099 3300003374 Bacteria 70186
37 JGI25161J50226_1000140 3300003374 Bacteria 50175
38 JGI25161J50226_1000921 3300003374 Bacteria 10544
39 Ga0006562J51391_1019610 3300003578 Bacteria 2300
40 Ga0055542_1000519 3300003762 Bacteria 34751
41 Ga0055529_1002792 3300003763 Bacteria 3165
42 Ga0055526_1000484 3300003771 Bacteria 31547
43 Ga0055526_1009798 3300003771 Bacteria 4553
44 Ga0055526_1010515 3300003771 Bacteria 4291
45 Ga0055526_1013767 3300003771 Bacteria 3390
46 Ga0055524_1001085 3300003775 Bacteria 16634
47 Ga0055524_1003087 3300003775 Bacteria 8223
48 Ga0055524_1007173 3300003775 Bacteria 4769
49 Ga0055524_1019611 3300003775 Bacteria 2305
50 Ga0055524_1028804 3300003775 Bacteria 1657
51 Ga0055536_1006588 3300003781 Bacteria 5373
52 Ga0055528_1000962 3300003790 Bacteria 19094
53 Ga0055528_1001865 3300003790 Bacteria 12000
54 Ga0055528_1002431 3300003790 Bacteria 9980
55 Ga0055528_1012566 3300003790 Bacteria 3277
56 Ga0055540_1000283 3300003792 Bacteria 45546
57 Ga0055540_1001971 3300003792 Bacteria 11472
58 Ga0055540_1002778 3300003792 Bacteria 8963
59 Ga0055540_1028922 3300003792 Bacteria 1304
60 Ga0058692_1001129 3300003856 Bacteria 10338
61 Ga0058692_1003154 3300003856 Bacteria 5224
62 Ga0055543_1000003 3300004625 Bacteria 358656
63 Ga0055543_1000128 3300004625 Bacteria 63029
64 Ga0055543_1000130 3300004625 Bacteria 62045
65 Ga0055543_1000438 3300004625 Bacteria 25752
66 Ga0065165_1000013 3300005262 Bacteria 301887
67 Ga0065165_1000068 3300005262 Bacteria 170609
68 Ga0065165_1003952 3300005262 Bacteria 9730
69 Ga0065165_1007614 3300005262 Bacteria 5273
70 Ga0065165_1011139 3300005262 Bacteria 3793
71 Ga0065165_1015958 3300005262 Bacteria 2837
72 Ga0070670_100004125 3300005331 Bacteria 12142
73 Ga0070660_100016320 3300005339 Bacteria 5388
74 Ga0070668_100016609 3300005347 Bacteria 5502
75 Ga0070669_100079852 3300005353 Bacteria 2434
76 Ga0070663_100020865 3300005455 Bacteria 4345
77 Ga0070681_10164431 3300005458 Bacteria 2142
78 Ga0068867_100134879 3300005459 Bacteria 1923
79 Ga0068853_100013344 3300005539 Bacteria 6708
80 Ga0070665_100062656 3300005548 Bacteria 3728
81 Ga0070665_100143222 3300005548 Bacteria 2393
82 Ga0070665_100209938 3300005548 Bacteria 1948
83 Ga0068855_100080060 3300005563 Bacteria 3788
84 Ga0068856_100000396 3300005614 Bacteria 47717
85 Ga0068856_100025945 3300005614 Bacteria 5715
86 Ga0068856_100097085 3300005614 Bacteria 2935
87 Ga0068858_100231704 3300005842 Bacteria 1751
88 Ga0081540_1032190 3300005983 Bacteria 2868
89 Ga0081539_10009861 3300005985 Bacteria 7879
90 Ga0075365_10003238 3300006038 Bacteria 8336
91 Ga0075365_10005895 3300006038 Bacteria 6670
92 Ga0075365_10022146 3300006038 Bacteria 3977
93 Ga0075365_10024459 3300006038 Bacteria 3811
94 Ga0075365_10035692 3300006038 Bacteria 3218
95 Ga0075365_10091646 3300006038 Bacteria 2071
96 Ga0075363_100040032 3300006048 Bacteria 2469
97 Ga0075364_10000201 3300006051 Bacteria 27803
98 Ga0075364_10020218 3300006051 Bacteria 4187
99 Ga0075364_10061726 3300006051 Bacteria 2459
100 Ga0075364_10152495 3300006051 Bacteria 1558
101 Ga0075367_10015244 3300006178 Bacteria 4172
102 Ga0075367_10023023 3300006178 Bacteria 3501
103 Ga0075367_10043918 3300006178 Bacteria 2618
104 Ga0075369_10000132 3300006186 Bacteria 20799
105 Ga0075369_10001343 3300006186 Bacteria 8357
106 Ga0075369_10004049 3300006186 Bacteria 5386
107 Ga0075369_10014342 3300006186 Bacteria 3164
108 Ga0075366_10008456 3300006195 Bacteria 5724
109 Ga0075366_10039554 3300006195 Bacteria 2788
110 Ga0075370_10011704 3300006353 Bacteria 4618
111 Ga0075370_10130222 3300006353 Bacteria 1468
112 Ga0068865_100241105 3300006881 Bacteria 1423
113 Ga0079104_1000193 3300006946 Bacteria 85489
114 Ga0079104_1005344 3300006946 Bacteria 5157
115 Ga0099826_10001077 3300006948 Bacteria 15493
116 Ga0099826_10001302 3300006948 Bacteria 14710
117 Ga0105244_10094727 3300009036 Bacteria 1465
118 Ga0105250_10063915 3300009092 Bacteria 1482
119 Ga0105240_10000076 3300009093 Bacteria 198848
120 Ga0105243_10010781 3300009148 Bacteria 6918
121 Ga0105243_10136372 3300009148 Bacteria 2088
122 Ga0105241_10047868 3300009174 Bacteria 3252
123 Ga0105248_10258531 3300009177 Bacteria 1960
124 Ga0105237_10011962 3300009545 Bacteria 9171
125 Ga0105237_10099343 3300009545 Bacteria 2902
126 Ga0105238_10005101 3300009551 Bacteria 12985
127 Ga0123341_1000032 3300009765 Bacteria 62527
128 Ga0123342_1005565 3300009766 Bacteria 18132
129 Ga0123342_1027673 3300009766 Bacteria 3145
130 Ga0105239_10016340 3300010375 Bacteria 8208
131 Ga0105239_10170562 3300010375 Bacteria 2433
132 Ga0105239_10178087 3300010375 Bacteria 2378
133 Ga0157318_1000561 3300012482 Unclassified 1629
134 Ga0157373_10050627 3300013100 Bacteria 2958
135 Ga0157371_10000908 3300013102 Bacteria 33346
136 Ga0157371_10053052 3300013102 Bacteria 2879
137 Ga0157370_10000282 3300013104 Bacteria 64601
138 Ga0157370_10000351 3300013104 Bacteria 58496
139 Ga0157369_10068419 3300013105 Bacteria 3815
140 Ga0171463_1003 3300013249 Bacteria 695693
141 Ga0157378_10112084 3300013297 Bacteria 2502
142 Ga0157372_10410434 3300013307 Bacteria 1578
143 Ga0182007_10005359 3300015262 Bacteria 5651
144 Ga0182005_1005134 3300015265 Bacteria 4124
145 Ga0183363_1104 3300015690 Bacteria 24110
146 Ga0214544_1000161 3300021320 Bacteria 101808
147 Ga0214542_1000012 3300021321 Bacteria 235800
148 Ga0214542_1022883 3300021321 Bacteria 3887
149 Ga0214543_1000024 3300021327 Bacteria 235745
150 Ga0214543_1000038 3300021327 Bacteria 182106
151 Ga0228711_1000008 3300022739 Bacteria 169893
152 Ga0228710_1000009 3300022740 Bacteria 169770
153 Ga0209435_100012 3300025206 Bacteria 401621
154 Ga0209436_100029 3300025208 Bacteria 85964
155 Ga0209436_100478 3300025208 Bacteria 17685
156 Ga0209436_103096 3300025208 Bacteria 4583
157 Ga0209672_106122 3300025228 Bacteria 1989
158 Ga0209437_100047 3300025233 Bacteria 405163
159 Ga0209437_100242 3300025233 Bacteria 89060
160 Ga0207425_1000024 3300025245 Bacteria 328978
161 Ga0207425_1012717 3300025245 Bacteria 1963
162 Ga0209646_1000026 3300025246 Bacteria 401621
163 Ga0209026_1000014 3300025250 Bacteria 401621
164 Ga0209026_1000025 3300025250 Bacteria 352548
165 Ga0209677_102528 3300025253 Bacteria 6783
166 Ga0209148_1000128 3300025254 Bacteria 179154
167 Ga0209759_1000012 3300025256 Bacteria 401621
168 Ga0209759_1000057 3300025256 Bacteria 205181
169 Ga0209129_1000146 3300025258 Bacteria 115180
170 Ga0209129_1000161 3300025258 Bacteria 102017
171 Ga0209129_1000384 3300025258 Bacteria 35556
172 Ga0209129_1005814 3300025258 Bacteria 4207
173 Ga0209233_1000010 3300025261 Bacteria 1194329
174 Ga0209233_1000048 3300025261 Bacteria 453669
175 Ga0209233_1000069 3300025261 Bacteria 367639
176 Ga0209233_1000260 3300025261 Bacteria 79607
177 Ga0209233_1011159 3300025261 Bacteria 2656
178 Ga0209455_1000492 3300025272 Bacteria 28972
179 Ga0209673_1000010 3300025273 Bacteria 596656
180 Ga0209673_1000384 3300025273 Bacteria 79540
181 Ga0209673_1000977 3300025273 Bacteria 35281
182 Ga0209673_1001611 3300025273 Bacteria 19722
183 Ga0209673_1004894 3300025273 Bacteria 6978
184 Ga0209673_1008652 3300025273 Bacteria 4507
185 Ga0209673_1020948 3300025273 Bacteria 2299
186 Ga0209130_1000003 3300025284 Bacteria 677988
187 Ga0209130_1000020 3300025284 Bacteria 379297
188 Ga0209130_1000034 3300025284 Bacteria 302439
189 Ga0209676_1014384 3300025292 Bacteria 2978
190 Ga0209025_1000050 3300025294 Bacteria 331531
191 Ga0209025_1000058 3300025294 Bacteria 311398
192 Ga0209025_1000140 3300025294 Bacteria 184765
193 Ga0209025_1000216 3300025294 Bacteria 138307
194 Ga0209025_1000405 3300025294 Bacteria 87670
195 Ga0209025_1006154 3300025294 Bacteria 9440
196 Ga0209564_1000013 3300025295 Bacteria 775755
197 Ga0209564_1000388 3300025295 Bacteria 79331
198 Ga0209564_1000512 3300025295 Bacteria 63708
199 Ga0209564_1001530 3300025295 Bacteria 22948
200 Ga0209564_1006762 3300025295 Bacteria 6081
201 Ga0209564_1011654 3300025295 Bacteria 3915
202 Ga0209758_1000083 3300025297 Bacteria 257283
203 Ga0209758_1000642 3300025297 Bacteria 53219
204 Ga0209758_1002719 3300025297 Bacteria 17418
205 Ga0209758_1003069 3300025297 Bacteria 15878
206 Ga0209758_1003364 3300025297 Bacteria 14653
207 Ga0209758_1018176 3300025297 Bacteria 3461
208 Ga0209050_1002400 3300025298 Bacteria 16206
209 Ga0209050_1004042 3300025298 Bacteria 10298
210 Ga0209050_1010948 3300025298 Bacteria 4383
211 Ga0209256_1000442 3300025299 Bacteria 63395
212 Ga0209256_1000738 3300025299 Bacteria 42913
213 Ga0209256_1001584 3300025299 Bacteria 22294
214 Ga0209256_1004887 3300025299 Bacteria 8069
215 Ga0209256_1006190 3300025299 Bacteria 6454
216 Ga0209256_1020856 3300025299 Bacteria 2031
217 Ga0207426_1000006 3300025302 Bacteria 1025969
218 Ga0207426_1000008 3300025302 Bacteria 848730
219 Ga0207426_1000011 3300025302 Bacteria 791203
220 Ga0207426_1000221 3300025302 Bacteria 134756
221 Ga0207426_1002076 3300025302 Bacteria 13895
222 Ga0209051_1000308 3300025303 Bacteria 76477
223 Ga0209051_1008939 3300025303 Bacteria 5231
224 Ga0209051_1011377 3300025303 Bacteria 4398
225 Ga0209051_1024303 3300025303 Bacteria 2494
226 Ga0209051_1029576 3300025303 Bacteria 2141
227 Ga0209051_1030731 3300025303 Bacteria 2079
228 Ga0209257_1000853 3300025304 Bacteria 43617
229 Ga0209257_1019949 3300025304 Bacteria 2500
230 Ga0209257_1027599 3300025304 Bacteria 1888
231 Ga0207654_10019351 3300025911 Bacteria 3593
232 Ga0207695_10000011 3300025913 Bacteria 910221
233 Ga0207695_10179849 3300025913 Bacteria 2036
234 Ga0207671_10000093 3300025914 Bacteria 138939
235 Ga0207657_10000483 3300025919 Bacteria 42060
236 Ga0207681_10030629 3300025923 Bacteria 3509
237 Ga0207694_10023427 3300025924 Viruses 4686
238 Ga0207650_10012844 3300025925 Bacteria 5787
239 Ga0207704_10223982 3300025938 Bacteria 1394
240 Ga0207667_10006604 3300025949 Bacteria 14025
241 Ga0207668_10007707 3300025972 Bacteria 6405
242 Ga0207639_10028714 3300026041 Bacteria 4064
243 Ga0207678_10254862 3300026067 Bacteria 1503
244 Ga0207702_10000423 3300026078 Bacteria 48508
245 Ga0207702_10018061 3300026078 Bacteria 5835
246 Ga0207648_10107359 3300026089 Bacteria 2450
247 Ga0209281_1000034 3300027111 Bacteria 382562
248 Ga0209281_1000106 3300027111 Bacteria 219666
249 Ga0209281_1000426 3300027111 Bacteria 62651
250 Ga0209371_1000022 3300027312 Bacteria 536342
251 Ga0209371_1003118 3300027312 Bacteria 8450
252 Ga0209282_1000024 3300027666 Bacteria 170348
253 Ga0209282_1000646 3300027666 Bacteria 17203
254 Ga0268266_10023807 3300028379 Bacteria 5212
255 Ga0268266_10128965 3300028379 Bacteria 2260
256 Ga0268266_10131348 3300028379 Bacteria 2240
257 Ga0268266_10168964 3300028379 Bacteria 1984
258 Ga0265336_10005821 3300028666 Bacteria 4508
259 Ga0307515_10000307 3300028794 Bacteria 121172
260 Ga0307515_10000788 3300028794 Bacteria 72975
261 Ga0307515_10109955 3300028794 Bacteria 3231
262 Ga0268256_1000019 3300030500 Bacteria 587949
263 Ga0268256_1005962 3300030500 Bacteria 4650
264 Ga0265328_10001732 3300031239 Bacteria 9995
265 Ga0307513_10086474 3300031456 Bacteria 3213
266 Ga0316579_10044926 3300031691 Bacteria 2059
267 Ga0307405_10001398 3300031731 Bacteria 10146
268 Ga0307406_10011163 3300031901 Bacteria 5091
269 Ga0307412_10008584 3300031911 Bacteria 5839
270 Ga0315914_1000012 3300031967 Bacteria 169896
271 Ga0307409_100215038 3300031995 Bacteria 1731
272 Ga0307409_100284723 3300031995 Bacteria 1530
273 Ga0315913_1000006 3300033430 Bacteria 169893
274 Ga0315915_1000010 3300033464 Bacteria 240214
275 Ga0373941_0027699 3300035115 Bacteria 1657
276 Ga0373953_0024208 3300035117 Bacteria 2306
277 Ga0373961_0032165 3300035241 Bacteria 1469
278 Ga0373927_0000810 3300035695 Bacteria 23917
279 Ga0373937_0015885 3300036401 Bacteria 6676
280 Ga0316582_0099393 3300036647 Bacteria 1925
281 Ga0373925_0006321 3300037068 Bacteria 8727
282 Ga0373925_0016891 3300037068 Bacteria 5284
283 Ga0395899_0000117 3300037312 Bacteria 130159
284 Ga0395900_0000020 3300037418 Bacteria 353500
285 Ga0395900_0154508 3300037418 Bacteria 2344
286 Ga0395898_0000259 3300037466 Bacteria 130131
287 Ga0395898_0094818 3300037466 Bacteria 2868
288 Ga0395905_0000019 3300037471 Bacteria 353500
289 Ga0395905_0000736 3300037471 Bacteria 43138
290 Ga0395905_0052490 3300037471 Bacteria 3816
291 Ga0395901_0000016 3300038443 Bacteria 354008
292 Ga0395901_0011547 3300038443 Bacteria 8951
293 Ga0400488_06315 3300038741 Bacteria 1581
294 Ga0439465_0033772 3300041413 Bacteria 1636
295 Ga0451791_1138375 3300041451 Bacteria 1970
296 Ga0451800_1271145 3300041459 Unclassified 1842
297 Ga0451833_1236258 3300041491 Bacteria 1223
298 Ga0451835_0039587 3300041492 Bacteria 1891
299 Ga0451845_0826072 3300041501 Bacteria 4063
300 Ga0451849_1373232 3300041505 Bacteria 2064
301 Ga0451843_0297013 3300041509 Bacteria 3239
302 Ga0439432_026057 3300042006 Bacteria 1915
303 Ga0439435_0001675 3300042436 Bacteria 4171
304 Ga0439435_0040162 3300042436 Bacteria 1306
305 Ga0466972_0020643 3300044658 Bacteria 3291
306 Ga0453684_0035183 3300044712 Bacteria 6928
307 Ga0495638_0000195 3300046460 Bacteria 88030
308 Ga0495638_0013713 3300046460 Bacteria 5506
309 Ga0495638_0032072 3300046460 Bacteria 3370
310 Ga0495585_0006794 3300046492 Bacteria 7061
311 Ga0495585_0017651 3300046492 Bacteria 4120
312 Ga0495596_0049578 3300046500 Bacteria 1646
313 Ga0495583_0001630 3300046506 Bacteria 21886
314 Ga0495583_0064007 3300046506 Bacteria 1633
315 Ga0495606_0002164 3300046507 Bacteria 23646
316 Ga0495606_0007242 3300046507 Bacteria 9996
317 Ga0495606_0010798 3300046507 Bacteria 7526
318 Ga0495606_0062004 3300046507 Bacteria 2389
319 Ga0495610_0001253 3300046512 Bacteria 22804
320 Ga0495610_0016243 3300046512 Bacteria 4295
321 Ga0495620_0028851 3300046515 Bacteria 2575
322 Ga0495630_0080599 3300046517 Bacteria 2456
323 Ga0495630_0116728 3300046517 Bacteria 2023
324 Ga0495631_0001628 3300046518 Bacteria 13398
325 Ga0495631_0012959 3300046518 Bacteria 4060
326 Ga0495632_0001015 3300046519 Bacteria 24284
327 Ga0495643_0013532 3300046522 Bacteria 4877
328 Ga0495643_0014825 3300046522 Bacteria 4628
329 Ga0495654_0000254 3300046530 Bacteria 48831
330 Ga0495654_0016736 3300046530 Bacteria 3867
331 Ga0495654_0063661 3300046530 Bacteria 1765
332 Ga0495609_0067269 3300046538 Bacteria 1578
333 Ga0495633_0007773 3300046558 Bacteria 6127
334 Ga0495656_0009496 3300046615 Bacteria 3499
335 Ga0495668_0020849 3300046616 Bacteria 3764
336 Ga0495611_0013209 3300046648 Bacteria 3514
337 Ga0495625_0000621 3300046660 Bacteria 51568
338 Ga0495613_0052683 3300046689 Bacteria 2996
339 Ga0495613_0169814 3300046689 Bacteria 1548
340 Ga0495670_0024091 3300046691 Bacteria 3006
341 Ga0495670_0031057 3300046691 Bacteria 2654
342 Ga0495671_0141849 3300046692 Bacteria 1171
343 Ga0495604_0012101 3300047317 Bacteria 6860
344 Ga0495672_0005251 3300047320 Bacteria 10318
345 Ga0495685_024882 3300047447 Bacteria 2061
346 Ga0495681_0006193 3300047470 Bacteria 7891
347 Ga0495686_0000316 3300047472 Bacteria 80803
348 Ga0495686_0003045 3300047472 Bacteria 14859
349 Ga0495686_0067244 3300047472 Bacteria 2212
350 Ga0495615_0007978 3300048090 Bacteria 2030
351 Ga0495626_0018872 3300048091 Bacteria 3454
352 Ga0496106_0000578 3300048909 Bacteria 26182
353 Ga0496109_0283369 3300048912 Bacteria 1562
354 Ga0496110_0084685 3300048913 Bacteria 2830
355 Ga0496110_0289290 3300048913 Bacteria 1492
356 Ga0496111_0000592 3300048914 Bacteria 19050
357 Ga0496112_0003167 3300048915 Bacteria 13516
358 Ga0496113_0045574 3300048916 Bacteria 3253
359 Ga0496114_0131600 3300048917 Bacteria 2161
360 Ga0496115_0197362 3300048918 Bacteria 1663
361 Ga0496116_0004831 3300048919 Bacteria 12714
362 Ga0496116_0048900 3300048919 Bacteria 2833
363 Ga0496116_0054750 3300048919 Bacteria 2625
364 Ga0496116_0079230 3300048919 Bacteria 2045
365 Ga0496116_0083005 3300048919 Bacteria 1980
366 Ga0496116_0110382 3300048919 Bacteria 1618
367 Ga0496117_0000002 3300048920 Bacteria 2483758
368 Ga0496117_0005629 3300048920 Bacteria 13083
369 Ga0496117_0010714 3300048920 Bacteria 8293
370 Ga0496117_0033555 3300048920 Bacteria 3879
371 Ga0496118_0000087 3300048921 Bacteria 176693
372 Ga0496118_0015216 3300048921 Bacteria 7141
373 Ga0496119_0040491 3300048922 Bacteria 2979
374 Ga0496120_0000180 3300048923 Bacteria 107518
375 Ga0496120_0000621 3300048923 Bacteria 53511
376 Ga0496120_0053060 3300048923 Bacteria 2305
377 Ga0496120_0099445 3300048923 Bacteria 1540
378 Ga0496121_0000003 3300048924 Bacteria 1191431
379 Ga0496121_0000059 3300048924 Bacteria 278177
380 Ga0496121_0000363 3300048924 Bacteria 93101
381 Ga0496121_0004088 3300048924 Bacteria 20038
382 Ga0496121_0005561 3300048924 Bacteria 16097
383 Ga0496121_0009569 3300048924 Bacteria 11104
384 Ga0496121_0086868 3300048924 Bacteria 2456
385 Ga0496121_0249946 3300048924 Bacteria 1230
386 Ga0496122_0000004 3300048925 Bacteria 645283
387 Ga0496122_0000190 3300048925 Bacteria 140376
388 Ga0496122_0000369 3300048925 Bacteria 96672
389 Ga0496122_0005937 3300048925 Bacteria 14292
390 Ga0496122_0025840 3300048925 Bacteria 5084
391 Ga0496122_0047231 3300048925 Bacteria 3325
392 Ga0496122_0097344 3300048925 Bacteria 1980
393 Ga0496123_0000007 3300048926 Bacteria 645283
394 Ga0496123_0000054 3300048926 Bacteria 234046
395 Ga0496123_0001159 3300048926 Bacteria 39083
396 Ga0496123_0007309 3300048926 Bacteria 10471
397 Ga0496123_0011197 3300048926 Bacteria 7806
398 Ga0496123_0028380 3300048926 Bacteria 4144
399 Ga0496123_0076217 3300048926 Bacteria 2065
400 Ga0496124_0000308 3300048927 Bacteria 90566
401 Ga0496124_0001702 3300048927 Bacteria 31109
402 Ga0496124_0005097 3300048927 Bacteria 14961
403 Ga0496124_0005246 3300048927 Bacteria 14679
404 Ga0496124_0006525 3300048927 Bacteria 12691
405 Ga0496124_0025248 3300048927 Bacteria 5384
406 Ga0496124_0025497 3300048927 Bacteria 5354
407 Ga0496124_0064161 3300048927 Bacteria 3067
408 Ga0496124_0162235 3300048927 Bacteria 1741
409 Ga0496125_0000039 3300048928 Bacteria 318665
410 Ga0496125_0000273 3300048928 Bacteria 104663
411 Ga0496125_0019255 3300048928 Bacteria 6446
412 Ga0496125_0028736 3300048928 Bacteria 5013
413 Ga0496125_0100336 3300048928 Bacteria 2134
414 Ga0496125_0178773 3300048928 Bacteria 1416
415 Ga0496126_0000589 3300048929 Bacteria 68753
416 Ga0496126_0001008 3300048929 Bacteria 47974
417 Ga0496126_0148441 3300048929 Bacteria 2011
418 Ga0495678_008838 3300049459 Bacteria 5037
419 Ga0495678_070245 3300049459 Bacteria 1286
420 Ga0495682_0058718 3300049460 Bacteria 1391
421 Ga0501031_0019611 3300049568 Bacteria 4404
422 Ga0501031_0021184 3300049568 Bacteria 4240
423 Ga0501031_0030492 3300049568 Bacteria 3518
424 Ga0501031_0102466 3300049568 Bacteria 1868
425 Ga0501032_0000031 3300049569 Bacteria 130204
426 Ga0501032_0000201 3300049569 Bacteria 49742
427 Ga0501032_0005441 3300049569 Bacteria 9451
428 Ga0501032_0053525 3300049569 Bacteria 2718
429 Ga0501033_0000050 3300049570 Bacteria 111819
430 Ga0501033_0000132 3300049570 Bacteria 72558
431 Ga0501033_0000779 3300049570 Bacteria 29299
432 Ga0501033_0001161 3300049570 Bacteria 23830
433 Ga0501033_0051885 3300049570 Bacteria 3040
434 Ga0501033_0253578 3300049570 Bacteria 1246
435 Ga0501034_0000005 3300049571 Bacteria 367512
436 Ga0501034_0000064 3300049571 Bacteria 189461
437 Ga0501034_0006650 3300049571 Bacteria 12404
438 Ga0501034_0075936 3300049571 Bacteria 3367
439 Ga0501034_0084426 3300049571 Bacteria 3177
440 Ga0501034_0113265 3300049571 Bacteria 2702
441 Ga0501034_0193804 3300049571 Bacteria 1993
442 Ga0501036_0000005 3300049572 Bacteria 246420
443 Ga0501036_0000563 3300049572 Bacteria 26668
444 Ga0501036_0005458 3300049572 Bacteria 10305
445 Ga0501036_0273621 3300049572 Bacteria 1413
446 Ga0501037_0000045 3300049573 Bacteria 117148
447 Ga0501037_0000077 3300049573 Bacteria 91081
448 Ga0501037_0000132 3300049573 Bacteria 69775
449 Ga0501037_0005351 3300049573 Bacteria 9336
450 Ga0501038_0000001 3300049574 Bacteria 375481
451 Ga0501038_0000055 3300049574 Bacteria 93761
452 Ga0501038_0001140 3300049574 Bacteria 24106
453 Ga0501038_0061894 3300049574 Bacteria 3200
454 Ga0501039_0000007 3300049575 Bacteria 277831
455 Ga0501039_0000045 3300049575 Bacteria 104513
456 Ga0501039_0035466 3300049575 Bacteria 3849
457 Ga0501039_0141729 3300049575 Bacteria 1888
458 Ga0501043_0000015 3300049579 Bacteria 175932
459 Ga0501043_0000104 3300049579 Bacteria 78808
460 Ga0501043_0000333 3300049579 Bacteria 42740
461 Ga0501043_0003831 3300049579 Bacteria 12371
462 Ga0501043_0091800 3300049579 Bacteria 2387
463 Ga0501046_0037003 3300049580 Bacteria 3923
464 Ga0501046_0150282 3300049580 Bacteria 1757
465 Ga0501047_0012373 3300049581 Bacteria 8078
466 Ga0501047_0019278 3300049581 Bacteria 6545
467 Ga0501048_0008140 3300049582 Bacteria 7932
468 Ga0501048_0103466 3300049582 Bacteria 2009
469 Ga0501067_0017298 3300049583 Bacteria 3984
470 Ga0501068_0004105 3300049584 Bacteria 7895
471 Ga0501069_0000016 3300049585 Bacteria 142565
472 Ga0501069_0036416 3300049585 Bacteria 2713
473 Ga0501069_0072483 3300049585 Bacteria 1931
474 Ga0501070_0000048 3300049586 Bacteria 105951
475 Ga0501070_0000812 3300049586 Bacteria 28368
476 Ga0501070_0021850 3300049586 Bacteria 5361
477 Ga0501070_0028549 3300049586 Bacteria 4680
478 Ga0501070_0080511 3300049586 Bacteria 2695
479 Ga0501071_0010145 3300049587 Bacteria 6302
480 Ga0501071_0056683 3300049587 Bacteria 2831
481 Ga0501072_0077657 3300049588 Bacteria 2629
482 Ga0501073_0014561 3300049589 Bacteria 5715
483 Ga0501073_0170114 3300049589 Bacteria 1508
484 Ga0501074_0001884 3300049590 Bacteria 14398
485 Ga0501074_0064010 3300049590 Bacteria 2648
486 Ga0501079_0239388 3300049741 Bacteria 1418
487 Ga0501080_0000270 3300049742 Bacteria 39305
488 Ga0501080_0001902 3300049742 Bacteria 17987
489 Ga0501080_0002829 3300049742 Bacteria 15254
490 Ga0501080_0026963 3300049742 Bacteria 5342
491 Ga0501080_0176279 3300049742 Bacteria 1969
492 Ga0501083_0000069 3300049744 Bacteria 68635
493 Ga0501035_0000008 3300049822 Bacteria 313425
494 Ga0501035_0000048 3300049822 Bacteria 146466
495 Ga0501035_0000306 3300049822 Bacteria 57505
496 Ga0501035_0003062 3300049822 Bacteria 16037
497 Ga0501035_0004314 3300049822 Bacteria 13514
498 Ga0501035_0023011 3300049822 Bacteria 5719
499 Ga0501035_0024962 3300049822 Bacteria 5480
500 Ga0501035_0029453 3300049822 Bacteria 5006
501 Ga0501044_0000001 3300049823 Bacteria 418087
502 Ga0501044_0000003 3300049823 Bacteria 345647
503 Ga0501044_0010525 3300049823 Bacteria 10038
504 Ga0501044_0021795 3300049823 Bacteria 6832
505 Ga0501044_0051990 3300049823 Bacteria 4224
506 Ga0501044_0068556 3300049823 Bacteria 3613
507 Ga0501044_0162287 3300049823 Bacteria 2210
508 Ga0501045_0051240 3300049824 Bacteria 3012
509 nmdc:mga03683_23701_c1 3300050489 Bacteria 2394
510 nmdc:mga00v17_109_c1 3300050491 Bacteria 49123
511 nmdc:mga00v17_12_c1 3300050491 Bacteria 129050
512 nmdc:mga0yw44_140341_c1 3300050492 Bacteria 1570
513 nmdc:mga0yw44_1670_c2 3300050492 Bacteria 8399
514 nmdc:mga0yw44_31979_c1 3300050492 Bacteria 3064
515 nmdc:mga0yw44_47732_c1 3300050492 Bacteria 2579
516 nmdc:mga04h51_13930_c1 3300050495 Bacteria 2288
517 nmdc:mga0sz30_240_c1 3300050516 Bacteria 21031
518 nmdc:mga0sz30_3440_c1 3300050516 Bacteria 3912
519 Ga0500610_0002329 3300053079 Bacteria 6948
520 Ga0500578_0088087 3300053086 Bacteria 1971
521 Ga0500643_015830 3300053087 Bacteria 2575
522 Ga0500557_000324 3300053105 Bacteria 6271
523 Ga0500618_000361 3300053125 Bacteria 31600
524 Ga0500618_001657 3300053125 Bacteria 9570
525 Ga0500618_016697 3300053125 Bacteria 1833
526 Ga0500658_0000529 3300053134 Bacteria 16130
527 Ga0500559_0017106 3300053136 Bacteria 3062
528 Ga0500561_0000126 3300053137 Bacteria 14808
529 Ga0500573_0000585 3300053140 Bacteria 16001
530 Ga0500616_0002961 3300053153 Bacteria 13495
531 Ga0500616_0011965 3300053153 Bacteria 5097
532 Ga0500616_0030818 3300053153 Bacteria 2942
533 Ga0500620_000067 3300053155 Bacteria 20011
534 Ga0500622_0000697 3300053156 Bacteria 29561
535 Ga0500622_0000899 3300053156 Bacteria 25323
536 Ga0500624_001069 3300053157 Bacteria 5287
537 Ga0500634_0004429 3300053161 Bacteria 6490
538 Ga0500634_0008929 3300053161 Bacteria 5037
539 Ga0500636_0000021 3300053177 Bacteria 96861
540 Ga0500636_0004647 3300053177 Bacteria 7790
541 Ga0501084_0108695 3300054114 Bacteria 2330
542 Ga0501084_0309798 3300054114 Bacteria 1333
543 Ga0501082_0000036 3300060353 Bacteria 95930
544 Ga0501082_0017101 3300060353 Bacteria 6248
545 Ga0501082_0065523 3300060353 Bacteria 3129

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003214 JGI25165J46597_1002237 JGI25165J46597_10022375 295
2 3300048913 Ga0496110_0084685 Ga0496110_0084685_1152_2093 307
3 3300025923 Ga0207681_10030629 Ga0207681_100306294 333
4 3300012482 Ga0157318_1000561 Ga0157318_10005612 345
5 3300035117 Ga0373953_0024208 Ga0373953_0024208_25_1224 345
6 3300054114 Ga0501084_0309798 Ga0501084_0309798_108_1256 355
7 3300005842 Ga0068858_100231704 Ga0068858_1002317042 356
8 3300060353 Ga0501082_0000036 Ga0501082_0000036_64916_66121 356
9 3300005339 Ga0070660_100016320 Ga0070660_1000163205 357
10 3300005563 Ga0068855_100080060 Ga0068855_1000800603 357
11 3300006051 Ga0075364_10152495 Ga0075364_101524952 357
12 3300006881 Ga0068865_100241105 Ga0068865_1002411052 357
13 3300025919 Ga0207657_10000483 Ga0207657_100004833 357
14 3300025938 Ga0207704_10223982 Ga0207704_102239822 357
15 3300025949 Ga0207667_10006604 Ga0207667_100066044 357
16 3300035115 Ga0373941_0027699 Ga0373941_0027699_397_1506 357
17 3300035241 Ga0373961_0032165 Ga0373961_0032165_27_1136 357
18 3300042436 Ga0439435_0040162 Ga0439435_0040162_59_1204 357
19 3300028666 Ga0265336_10005821 Ga0265336_100058212 358
20 3300042006 Ga0439432_026057 Ga0439432_026057_692_1795 358
21 3300048924 Ga0496121_0000059 Ga0496121_0000059_208087_209247 358
22 iso_pu_bacteria 2582581315 2585323541 358
23 3300044712 Ga0453684_0035183 Ga0453684_0035183_3126_4247 359
24 3300005614 Ga0068856_100000396 Ga0068856_1000003965 360
25 3300026078 Ga0207702_10000423 Ga0207702_1000042341 360
26 3300046648 Ga0495611_0013209 Ga0495611_0013209_1211_2326 360
27 3300041459 Ga0451800_1271145 Ga0451800_1271145_534_1721 361
28 3300046689 Ga0495613_0169814 Ga0495613_0169814_53_1159 361
29 3300046507 Ga0495606_0010798 Ga0495606_0010798_681_1793 364
30 3300046692 Ga0495671_0141849 Ga0495671_0141849_55_1149 364
31 3300025924 Ga0207694_10023427 Ga0207694_100234272 365
32 3300031239 Ga0265328_10001732 Ga0265328_100017328 365
33 iso_pu_bacteria 2671180139 2671693313 366
34 3300003322 rootL2_10035682 rootL2_1003568227 367
35 3300005458 Ga0070681_10164431 Ga0070681_101644313 368
36 3300041491 Ga0451833_1236258 Ga0451833_1236258_92_1198 368
37 3300048091 Ga0495626_0018872 Ga0495626_0018872_39_1145 368
38 3300013297 Ga0157378_10112084 Ga0157378_101120843 369
39 3300036401 Ga0373937_0015885 Ga0373937_0015885_4276_5559 369
40 3300037068 Ga0373925_0016891 Ga0373925_0016891_1082_2365 369
41 3300046517 Ga0495630_0116728 Ga0495630_0116728_418_1701 369
42 3300046689 Ga0495613_0052683 Ga0495613_0052683_335_1618 369
43 3300048917 Ga0496114_0131600 Ga0496114_0131600_453_1739 369
44 3300049568 Ga0501031_0019611 Ga0501031_0019611_2601_3881 369
45 3300049569 Ga0501032_0005441 Ga0501032_0005441_2702_3982 369
46 3300049570 Ga0501033_0051885 Ga0501033_0051885_733_2013 369
47 3300049571 Ga0501034_0113265 Ga0501034_0113265_195_1475 369
48 3300049572 Ga0501036_0005458 Ga0501036_0005458_1092_2372 369
49 3300049573 Ga0501037_0005351 Ga0501037_0005351_5774_7054 369
50 3300049574 Ga0501038_0001140 Ga0501038_0001140_2601_3881 369
51 3300049575 Ga0501039_0035466 Ga0501039_0035466_1903_3183 369
52 3300049581 Ga0501047_0012373 Ga0501047_0012373_5197_6477 369
53 3300049582 Ga0501048_0008140 Ga0501048_0008140_1092_2372 369
54 3300049583 Ga0501067_0017298 Ga0501067_0017298_771_2051 369
55 3300049589 Ga0501073_0014561 Ga0501073_0014561_1804_3084 369
56 3300049742 Ga0501080_0002829 Ga0501080_0002829_13650_14930 369
57 3300049823 Ga0501044_0021795 Ga0501044_0021795_2601_3881 369
58 3300054114 Ga0501084_0108695 Ga0501084_0108695_455_1735 369
59 3300060353 Ga0501082_0065523 Ga0501082_0065523_1803_3083 369
60 iso_pu_bacteria 2534681786 2535485090 369
61 iso_pu_bacteria 2854911287 2854912360 369
62 iso_pu_bacteria 2899259804 2899260714 369
63 iso_pu_bacteria 2915650412 2915653100 369
64 3300042436 Ga0439435_0001675 Ga0439435_0001675_372_1499 370
65 3300046517 Ga0495630_0080599 Ga0495630_0080599_900_2138 370
66 3300049571 Ga0501034_0084426 Ga0501034_0084426_1171_2292 370
67 3300049589 Ga0501073_0170114 Ga0501073_0170114_244_1365 370
68 3300049742 Ga0501080_0026963 Ga0501080_0026963_1261_2382 370
69 iso_pu_bacteria 2510917026 2511172477 370
70 iso_pu_bacteria 2585427633 2585996117 370
71 iso_pu_bacteria 2585427634 2586000732 370
72 iso_pu_bacteria 2599185236 2599721980 370
73 iso_pu_bacteria 2600254933 2600374424 370
74 iso_pu_bacteria 2643221558 2643811591 370
75 iso_pu_bacteria 2818991461 2819684828 370
76 iso_pu_bacteria 2821123053 2821127554 370
77 iso_pu_bacteria 2838736955 2838738077 370
78 iso_pu_bacteria 2841840854 2841841554 370
79 iso_pu_bacteria 2842140634 2842141332 370
80 iso_pu_bacteria 2854896431 2854899213 370
81 iso_pu_bacteria 2854916844 2854918758 370
82 iso_pu_bacteria 2857531043 2857536434 370
83 iso_pu_bacteria 2919171160 2919174785 370
84 iso_pu_bacteria 8018150411 8018153157 370
85 iso_pu_bacteria 2503198000 2503201676 371
86 iso_pu_bacteria 2508501123 2509118844 371
87 iso_pu_bacteria 2508501127 2509144839 371
88 iso_pu_bacteria 2509276021 2509392148 371
89 iso_pu_bacteria 2509276022 2509396441 371
90 iso_pu_bacteria 2509276033 2509445793 371
91 iso_pu_bacteria 2509276033 2509446905 371
92 iso_pu_bacteria 2510065019 2510133860 371
93 iso_pu_bacteria 2510065059 2510315363 371
94 iso_pu_bacteria 2510461069 2510840072 371
95 iso_pu_bacteria 2510461076 2510895280 371
96 iso_pu_bacteria 2510917022 2511135311 371
97 iso_pu_bacteria 2510917028 2511186975 371
98 iso_pu_bacteria 2510917030 2511196066 371
99 iso_pu_bacteria 2511231027 2511389776 371
100 iso_pu_bacteria 2512047086 2512533536 371
101 iso_pu_bacteria 2512875016 2512931354 371
102 iso_pu_bacteria 2512875026 2512970789 371
103 iso_pu_bacteria 2513237084 2513573665 371
104 iso_pu_bacteria 2513237085 2513576850 371
105 iso_pu_bacteria 2513237089 2513604168 371
106 iso_pu_bacteria 2513237090 2513613258 371
107 iso_pu_bacteria 2513237093 2513629493 371
108 iso_pu_bacteria 2513237103 2513708143 371
109 iso_pu_bacteria 2513237138 2513865517 371
110 iso_pu_bacteria 2513237144 2513909197 371
111 iso_pu_bacteria 2513237146 2513925465 371
112 iso_pu_bacteria 2513237156 2513985309 371
113 iso_pu_bacteria 2513237160 2514006483 371
114 iso_pu_bacteria 2513237162 2514020101 371
115 iso_pu_bacteria 2513237305 2514421622 371
116 iso_pu_bacteria 2513237351 2514589146 371
117 iso_pu_bacteria 2515075009 2515112905 371
118 iso_pu_bacteria 2515154107 2515608937 371
119 iso_pu_bacteria 2515154113 2515636416 371
120 iso_pu_bacteria 2515154114 2515640868 371
121 iso_pu_bacteria 2515154116 2515655449 371
122 iso_pu_bacteria 2515154134 2515739389 371
123 iso_pu_bacteria 2516653077 2517036607 371
124 iso_pu_bacteria 2516653085 2517076969 371
125 iso_pu_bacteria 2517093000 2517095739 371
126 iso_pu_bacteria 2517287029 2517407306 371
127 iso_pu_bacteria 2517487022 2517570240 371
128 iso_pu_bacteria 2524023209 2524459508 371
129 iso_pu_bacteria 2529292951 2530646048 371
130 iso_pu_bacteria 2534681796 2535516789 371
131 iso_pu_bacteria 2537561587 2537875631 371
132 iso_pu_bacteria 2554235003 2554248153 371
133 iso_pu_bacteria 2558860242 2559295269 371
134 iso_pu_bacteria 2558860983 2561468987 371
135 iso_pu_bacteria 2582581294 2585200526 371
136 iso_pu_bacteria 2582581298 2585222736 371
137 iso_pu_bacteria 2582581299 2585232757 371
138 iso_pu_bacteria 2582581304 2585255003 371
139 iso_pu_bacteria 2582581308 2585277400 371
140 iso_pu_bacteria 2582581315 2585323426 371
141 iso_pu_bacteria 2582581316 2585331558 371
142 iso_pu_bacteria 2582581867 2585402480 371
143 iso_pu_bacteria 2585427526 2585527349 371
144 iso_pu_bacteria 2585427527 2585535027 371
145 iso_pu_bacteria 2585427528 2585538091 371
146 iso_pu_bacteria 2585427529 2585545319 371
147 iso_pu_bacteria 2585427530 2585555875 371
148 iso_pu_bacteria 2585427590 2585822832 371
149 iso_pu_bacteria 2585427593 2585836039 371
150 iso_pu_bacteria 2585427594 2585843088 371
151 iso_pu_bacteria 2588253730 2588517184 371
152 iso_pu_bacteria 2597489875 2597813613 371
153 iso_pu_bacteria 2599185170 2599417381 371
154 iso_pu_bacteria 2599185210 2599601585 371
155 iso_pu_bacteria 2599185301 2599936627 371
156 iso_pu_bacteria 2599185352 2600194287 371
157 iso_pu_bacteria 2600255279 2601610154 371
158 iso_pu_bacteria 2600255308 2601746928 371
159 iso_pu_bacteria 2615840624 2616293450 371
160 iso_pu_bacteria 2615840626 2616308875 371
161 iso_pu_bacteria 2615840698 2616556914 371
162 iso_pu_bacteria 2617270742 2617385963 371
163 iso_pu_bacteria 2643221550 2643773015 371
164 iso_pu_bacteria 2643221551 2643775989 371
165 iso_pu_bacteria 2643221555 2643794436 371
166 iso_pu_bacteria 2643221557 2643803206 371
167 iso_pu_bacteria 2643221564 2643840106 371
168 iso_pu_bacteria 2643221568 2643856845 371
169 iso_pu_bacteria 2643221582 2643920421 371
170 iso_pu_bacteria 2643221595 2643984534 371
171 iso_pu_bacteria 2643221599 2644003236 371
172 iso_pu_bacteria 2643221610 2644063571 371
173 iso_pu_bacteria 2643221623 2644129277 371
174 iso_pu_bacteria 2643221627 2644153390 371
175 iso_pu_bacteria 2643221634 2644193422 371
176 iso_pu_bacteria 2643221637 2644210101 371
177 iso_pu_bacteria 2643221653 2644298594 371
178 iso_pu_bacteria 2643221668 2644374851 371
179 iso_pu_bacteria 2643221675 2644414334 371
180 iso_pu_bacteria 2643221680 2644447862 371
181 iso_pu_bacteria 2643221693 2644522037 371
182 iso_pu_bacteria 2643221718 2644653653 371
183 iso_pu_bacteria 2643221719 2644656823 371
184 iso_pu_bacteria 2643221723 2644676189 371
185 iso_pu_bacteria 2643221726 2644690335 371
186 iso_pu_bacteria 2667528174 2671111525 371
187 iso_pu_bacteria 2687453392 2688598587 371
188 iso_pu_bacteria 2690316117 2692315622 371
189 iso_pu_bacteria 2693429783 2694633044 371
190 iso_pu_bacteria 2693429784 2694635921 371
191 iso_pu_bacteria 2718217882 2719181721 371
192 iso_pu_bacteria 2718217927 2719386245 371
193 iso_pu_bacteria 2718217997 2719666065 371
194 iso_pu_bacteria 2718218009 2719732385 371
195 iso_pu_bacteria 2718218199 2720492485 371
196 iso_pu_bacteria 2718218232 2720613923 371
197 iso_pu_bacteria 2718218233 2720620727 371
198 iso_pu_bacteria 2718218235 2720632050 371
199 iso_pu_bacteria 2718218269 2720775778 371
200 iso_pu_bacteria 2718218363 2721147812 371
201 iso_pu_bacteria 2718218365 2721159261 371
202 iso_pu_bacteria 2718218366 2721164648 371
203 iso_pu_bacteria 2718218423 2721400027 371
204 iso_pu_bacteria 2721755514 2722840818 371
205 iso_pu_bacteria 2721755556 2723027385 371
206 iso_pu_bacteria 2721755684 2723561004 371
207 iso_pu_bacteria 2721755685 2723567597 371
208 iso_pu_bacteria 2721755686 2723575523 371
209 iso_pu_bacteria 2721755809 2724038840 371
210 iso_pu_bacteria 2721755810 2724045141 371
211 iso_pu_bacteria 2721755819 2724090385 371
212 iso_pu_bacteria 2721755822 2724104862 371
213 iso_pu_bacteria 2721755823 2724110666 371
214 iso_pu_bacteria 2724679232 2725952654 371
215 iso_pu_bacteria 2728369352 2730108321 371
216 iso_pu_bacteria 2728369365 2730164956 371
217 iso_pu_bacteria 2728369397 2730298893 371
218 iso_pu_bacteria 2738541293 2738799999 371
219 iso_pu_bacteria 2738541317 2738948869 371
220 iso_pu_bacteria 2738541333 2739032748 371
221 iso_pu_bacteria 2738543024 2739307276 371
222 iso_pu_bacteria 2756170246 2756675330 371
223 iso_pu_bacteria 2765235802 2765464704 371
224 iso_pu_bacteria 2765235942 2766065773 371
225 iso_pu_bacteria 2767802442 2770195365 371
226 iso_pu_bacteria 2775506902 2776270693 371
227 iso_pu_bacteria 2775506904 2776280484 371
228 iso_pu_bacteria 2775507049 2776913848 371
229 iso_pu_bacteria 2775507266 2778175336 371
230 iso_pu_bacteria 2791355091 2792620855 371
231 iso_pu_bacteria 2791355092 2792626215 371
232 iso_pu_bacteria 2791355094 2792639153 371
233 iso_pu_bacteria 2791355123 2792749378 371
234 iso_pu_bacteria 2791355256 2793294527 371
235 iso_pu_bacteria 2791355259 2793314629 371
236 iso_pu_bacteria 2791355260 2793320455 371
237 iso_pu_bacteria 2791355261 2793330530 371
238 iso_pu_bacteria 2791355262 2793336820 371
239 iso_pu_bacteria 2791355263 2793339112 371
240 iso_pu_bacteria 2791355264 2793348795 371
241 iso_pu_bacteria 2791355265 2793351922 371
242 iso_pu_bacteria 2791355266 2793363607 371
243 iso_pu_bacteria 2791355267 2793370267 371
244 iso_pu_bacteria 2802428858 2802719935 371
245 iso_pu_bacteria 2802428859 2802727133 371
246 iso_pu_bacteria 2802428860 2802731867 371
247 iso_pu_bacteria 2802428861 2802739197 371
248 iso_pu_bacteria 2802428862 2802745823 371
249 iso_pu_bacteria 2802428863 2802752425 371
250 iso_pu_bacteria 2802429268 2804752641 371
251 iso_pu_bacteria 2802429605 2805931391 371
252 iso_pu_bacteria 2802429606 2805937411 371
253 iso_pu_bacteria 2802429633 2806043728 371
254 iso_pu_bacteria 2802429634 2806050340 371
255 iso_pu_bacteria 2802429635 2806057157 371
256 iso_pu_bacteria 2802429636 2806064539 371
257 iso_pu_bacteria 2802429637 2806071806 371
258 iso_pu_bacteria 2808606387 2808987997 371
259 iso_pu_bacteria 2818991439 2819558990 371
260 iso_pu_bacteria 2818991448 2819609060 371
261 iso_pu_bacteria 2818991453 2819637709 371
262 iso_pu_bacteria 2837651117 2837653155 371
263 iso_pu_bacteria 2837678835 2837681387 371
264 iso_pu_bacteria 2838016132 2838017744 371
265 iso_pu_bacteria 2838022645 2838028382 371
266 iso_pu_bacteria 2838029111 2838029895 371
267 iso_pu_bacteria 2838035591 2838038416 371
268 iso_pu_bacteria 2838042994 2838043875 371
269 iso_pu_bacteria 2838048938 2838051963 371
270 iso_pu_bacteria 2838061910 2838067420 371
271 iso_pu_bacteria 2838068647 2838070237 371
272 iso_pu_bacteria 2838661181 2838661674 371
273 iso_pu_bacteria 2838668709 2838670271 371
274 iso_pu_bacteria 2838675328 2838675851 371
275 iso_pu_bacteria 2838680041 2838681703 371
276 iso_pu_bacteria 2838686498 2838687149 371
277 iso_pu_bacteria 2838694306 2838696275 371
278 iso_pu_bacteria 2838701080 2838702642 371
279 iso_pu_bacteria 2838707686 2838710486 371
280 iso_pu_bacteria 2838714209 2838714733 371
281 iso_pu_bacteria 2838719591 2838721466 371
282 iso_pu_bacteria 2838724970 2838725493 371
283 iso_pu_bacteria 2838729681 2838729878 371
284 iso_pu_bacteria 2838742623 2838743107 371
285 iso_pu_bacteria 2839993093 2839996956 371
286 iso_pu_bacteria 2840764183 2840767490 371
287 iso_pu_bacteria 2841846520 2841848418 371
288 iso_pu_bacteria 2841851746 2841852593 371
289 iso_pu_bacteria 2841859092 2841862048 371
290 iso_pu_bacteria 2841864319 2841869890 371
291 iso_pu_bacteria 2842077413 2842078660 371
292 iso_pu_bacteria 2842110456 2842114886 371
293 iso_pu_bacteria 2842118031 2842118831 371
294 iso_pu_bacteria 2842124991 2842125551 371
295 iso_pu_bacteria 2842130223 2842130746 371
296 iso_pu_bacteria 2842146304 2842148100 371
297 iso_pu_bacteria 2842152218 2842154084 371
298 iso_pu_bacteria 2842156927 2842157947 371
299 iso_pu_bacteria 2842163707 2842167503 371
300 iso_pu_bacteria 2842170452 2842170977 371
301 iso_pu_bacteria 2842175837 2842177704 371
302 iso_pu_bacteria 2842180545 2842181566 371
303 iso_pu_bacteria 2842187318 2842187842 371
304 iso_pu_bacteria 2842198810 2842204487 371
305 iso_pu_bacteria 2842211629 2842212153 371
306 iso_pu_bacteria 2842217011 2842217838 371
307 iso_pu_bacteria 2842224351 2842226228 371
308 iso_pu_bacteria 2842229732 2842230383 371
309 iso_pu_bacteria 2842237096 2842239898 371
310 iso_pu_bacteria 2842243621 2842244285 371
311 iso_pu_bacteria 2842250916 2842253166 371
312 iso_pu_bacteria 2842257432 2842257629 371
313 iso_pu_bacteria 2842264693 2842266172 371
314 iso_pu_bacteria 2842271015 2842271313 371
315 iso_pu_bacteria 2842285085 2842285690 371
316 iso_pu_bacteria 2842291075 2842292322 371
317 iso_pu_bacteria 2842298080 2842301288 371
318 iso_pu_bacteria 2842304105 2842304943 371
319 iso_pu_bacteria 2842311132 2842315005 371
320 iso_pu_bacteria 2842317721 2842320618 371
321 iso_pu_bacteria 2842341865 2842346364 371
322 iso_pu_bacteria 2842357229 2842357825 371
323 iso_pu_bacteria 2842363717 2842369056 371
324 iso_pu_bacteria 2842370503 2842372270 371
325 iso_pu_bacteria 2842377471 2842378719 371
326 iso_pu_bacteria 2842384541 2842385341 371
327 iso_pu_bacteria 2842395702 2842399974 371
328 iso_pu_bacteria 2842402390 2842403050 371
329 iso_pu_bacteria 2842409023 2842409578 371
330 iso_pu_bacteria 2842415677 2842416229 371
331 iso_pu_bacteria 2842422224 2842423851 371
332 iso_pu_bacteria 2842428310 2842430635 371
333 iso_pu_bacteria 2842434925 2842437378 371
334 iso_pu_bacteria 2842441272 2842443748 371
335 iso_pu_bacteria 2842447887 2842453126 371
336 iso_pu_bacteria 2842462802 2842464778 371
337 iso_pu_bacteria 2842469257 2842471996 371
338 iso_pu_bacteria 2842475841 2842476820 371
339 iso_pu_bacteria 2842482326 2842484645 371
340 iso_pu_bacteria 2842489311 2842491888 371
341 iso_pu_bacteria 2842495871 2842496918 371
342 iso_pu_bacteria 2842502639 2842503423 371
343 iso_pu_bacteria 2842509118 2842511216 371
344 iso_pu_bacteria 2842515876 2842518832 371
345 iso_pu_bacteria 2842871566 2842871873 371
346 iso_pu_bacteria 2844002411 2844007287 371
347 iso_pu_bacteria 2844009547 2844013840 371
348 iso_pu_bacteria 2844454524 2844458516 371
349 iso_pu_bacteria 2847417321 2847419318 371
350 iso_pu_bacteria 2847686936 2847692371 371
351 iso_pu_bacteria 2848992105 2848994338 371
352 iso_pu_bacteria 2852387548 2852390126 371
353 iso_pu_bacteria 2855872281 2855876143 371
354 iso_pu_bacteria 2856320880 2856325385 371
355 iso_pu_bacteria 2856328259 2856331237 371
356 iso_pu_bacteria 2856334872 2856338269 371
357 iso_pu_bacteria 2856342000 2856347388 371
358 iso_pu_bacteria 2857349434 2857351025 371
359 iso_pu_bacteria 2857367948 2857371480 371
360 iso_pu_bacteria 2857516855 2857517532 371
361 iso_pu_bacteria 2869162929 2869167124 371
362 iso_pu_bacteria 2869169390 2869174344 371
363 iso_pu_bacteria 2869234852 2869236149 371
364 iso_pu_bacteria 2869256925 2869262685 371
365 iso_pu_bacteria 2869264136 2869270192 371
366 iso_pu_bacteria 2869271264 2869277799 371
367 iso_pu_bacteria 2869278585 2869285072 371
368 iso_pu_bacteria 2871444079 2871449782 371
369 iso_pu_bacteria 2871451962 2871455890 371
370 iso_pu_bacteria 2871459585 2871465413 371
371 iso_pu_bacteria 2871474448 2871479539 371
372 iso_pu_bacteria 2871481445 2871481939 371
373 iso_pu_bacteria 2874102143 2874105756 371
374 iso_pu_bacteria 2874109183 2874109858 371
375 iso_pu_bacteria 2874116593 2874119108 371
376 iso_pu_bacteria 2874139085 2874146012 371
377 iso_pu_bacteria 2874146452 2874149697 371
378 iso_pu_bacteria 2874162495 2874165613 371
379 iso_pu_bacteria 2874168670 2874174670 371
380 iso_pu_bacteria 2876363079 2876369415 371
381 iso_pu_bacteria 2876386047 2876389543 371
382 iso_pu_bacteria 2876399893 2876401453 371
383 iso_pu_bacteria 2876406927 2876413254 371
384 iso_pu_bacteria 2878730984 2878735065 371
385 iso_pu_bacteria 2878774303 2878778092 371
386 iso_pu_bacteria 2878781027 2878788470 371
387 iso_pu_bacteria 2881147464 2881151642 371
388 iso_pu_bacteria 2881161766 2881167662 371
389 iso_pu_bacteria 2882632389 2882636408 371
390 iso_pu_bacteria 2885305155 2885309554 371
391 iso_pu_bacteria 2888337043 2888339561 371
392 iso_pu_bacteria 2888350351 2888355893 371
393 iso_pu_bacteria 2889010040 2889010830 371
394 iso_pu_bacteria 2889016732 2889017474 371
395 iso_pu_bacteria 2889790730 2889793909 371
396 iso_pu_bacteria 2889914905 2889916870 371
397 iso_pu_bacteria 2891048133 2891052151 371
398 iso_pu_bacteria 2891373044 2891373262 371
399 iso_pu_bacteria 2894652903 2894656066 371
400 iso_pu_bacteria 2894817345 2894820308 371
401 iso_pu_bacteria 2899792073 2899796130 371
402 iso_pu_bacteria 2899803654 2899807357 371
403 iso_pu_bacteria 2899845264 2899850714 371
404 iso_pu_bacteria 2903448605 2903451467 371
405 iso_pu_bacteria 2903521522 2903522978 371
406 iso_pu_bacteria 2903528002 2903534562 371
407 iso_pu_bacteria 2904578770 2904580695 371
408 iso_pu_bacteria 2906328253 2906329893 371
409 iso_pu_bacteria 2906354277 2906357988 371
410 iso_pu_bacteria 2906370794 2906371519 371
411 iso_pu_bacteria 2906401398 2906402168 371
412 iso_pu_bacteria 2906408224 2906413924 371
413 iso_pu_bacteria 2913308742 2913313718 371
414 iso_pu_bacteria 2915980308 2915981345 371
415 iso_pu_bacteria 2916061851 2916064261 371
416 iso_pu_bacteria 2919100787 2919106621 371
417 iso_pu_bacteria 2919114240 2919114772 371
418 iso_pu_bacteria 2919119836 2919121591 371
419 iso_pu_bacteria 2919166419 2919169168 371
420 iso_pu_bacteria 2919408235 2919409895 371
421 iso_pu_bacteria 2920822456 2920825117 371
422 iso_pu_bacteria 2921250672 2921251992 371
423 iso_pu_bacteria 2922130491 2922138293 371
424 iso_pu_bacteria 2922151315 2922157230 371
425 iso_pu_bacteria 2922158528 2922158790 371
426 iso_pu_bacteria 2922172374 2922172601 371
427 iso_pu_bacteria 2922178524 2922181717 371
428 iso_pu_bacteria 2922185730 2922193311 371
429 iso_pu_bacteria 2923556063 2923558488 371
430 iso_pu_bacteria 2924710171 2924714009 371
431 iso_pu_bacteria 2924718760 2924723771 371
432 iso_pu_bacteria 2924726620 2924727822 371
433 iso_pu_bacteria 2924733363 2924733537 371
434 iso_pu_bacteria 2924741084 2924741530 371
435 iso_pu_bacteria 2924748358 2924749810 371
436 iso_pu_bacteria 2926754445 2926755788 371
437 iso_pu_bacteria 2926760298 2926762909 371
438 iso_pu_bacteria 2928521798 2928523804 371
439 iso_pu_bacteria 2929138655 2929140787 371
440 iso_pu_bacteria 2933006813 2933008729 371
441 iso_pu_bacteria 2933011516 2933014994 371
442 iso_pu_bacteria 2933016740 2933017495 371
443 iso_pu_bacteria 2933570622 2933570751 371
444 iso_pu_bacteria 2933586486 2933591258 371
445 iso_pu_bacteria 2933594066 2933596673 371
446 iso_pu_bacteria 2933599457 2933601043 371
447 iso_pu_bacteria 2935894831 2935900719 371
448 iso_pu_bacteria 2935901341 2935902053 371
449 iso_pu_bacteria 2936367885 2936372139 371
450 iso_pu_bacteria 2936375103 2936381057 371
451 iso_pu_bacteria 2936381700 2936382985 371
452 iso_pu_bacteria 2936996657 2936999696 371
453 iso_pu_bacteria 2937029754 2937030191 371
454 iso_pu_bacteria 2937036028 2937042571 371
455 iso_pu_bacteria 2937078374 2937080372 371
456 iso_pu_bacteria 2937084907 2937085550 371
457 iso_pu_bacteria 2937836603 2937838100 371
458 iso_pu_bacteria 2937848649 2937853045 371
459 iso_pu_bacteria 2937861824 2937863373 371
460 iso_pu_bacteria 2937868953 2937875148 371
461 iso_pu_bacteria 2937891427 2937893761 371
462 iso_pu_bacteria 2937972304 2937978448 371
463 iso_pu_bacteria 2937980651 2937980755 371
464 iso_pu_bacteria 2954011201 2954016089 371
465 iso_pu_bacteria 2957375807 2957376479 371
466 iso_pu_bacteria 2957437181 2957437643 371
467 iso_pu_bacteria 2958034702 2958040774 371
468 iso_pu_bacteria 2958041894 2958056856 371
469 iso_pu_bacteria 2958064165 2958064169 371
470 iso_pu_bacteria 2958100919 2958102493 371
471 iso_pu_bacteria 2958108152 2958114020 371
472 iso_pu_bacteria 2958115193 2958118573 371
473 iso_pu_bacteria 2958122699 2958126767 371
474 iso_pu_bacteria 2958158011 2958163878 371
475 iso_pu_bacteria 2958172287 2958178595 371
476 iso_pu_bacteria 2960591022 2960591990 371
477 iso_pu_bacteria 2960631154 2960631951 371
478 iso_pu_bacteria 2960680706 2960681526 371
479 iso_pu_bacteria 2960693952 2960698109 371
480 iso_pu_bacteria 2961114664 2961120124 371
481 iso_pu_bacteria 2961170736 2961175916 371
482 iso_pu_bacteria 2961183825 2961188893 371
483 iso_pu_bacteria 2963644680 2963647861 371
484 iso_pu_bacteria 2965025482 2965031414 371
485 iso_pu_bacteria 2965032056 2965036681 371
486 iso_pu_bacteria 2965040258 2965041092 371
487 iso_pu_bacteria 2965102966 2965105362 371
488 iso_pu_bacteria 2965110997 2965113589 371
489 iso_pu_bacteria 2967686174 2967688874 371
490 iso_pu_bacteria 2967728569 2967729092 371
491 iso_pu_bacteria 2967996073 2968001804 371
492 iso_pu_bacteria 2968003550 2968009172 371
493 iso_pu_bacteria 2968083720 2968085984 371
494 iso_pu_bacteria 2968091066 2968093260 371
495 iso_pu_bacteria 2968097103 2968102834 371
496 iso_pu_bacteria 2968110612 2968116481 371
497 iso_pu_bacteria 2968138860 2968141817 371
498 iso_pu_bacteria 2970026789 2970030346 371
499 iso_pu_bacteria 2970122695 2970127019 371
500 iso_pu_bacteria 2970143518 2970146198 371
501 iso_pu_bacteria 2970489779 2970492277 371
502 iso_pu_bacteria 2970503327 2970508581 371
503 iso_pu_bacteria 2970510686 2970513728 371
504 iso_pu_bacteria 2970547951 2970554682 371
505 iso_pu_bacteria 2970593180 2970599686 371
506 iso_pu_bacteria 2970619444 2970623441 371
507 iso_pu_bacteria 2970627176 2970627920 371
508 iso_pu_bacteria 2977530762 2977534338 371
509 iso_pu_bacteria 2977544691 2977547705 371
510 iso_pu_bacteria 2977821940 2977827545 371
511 iso_pu_bacteria 2977828996 2977835260 371
512 iso_pu_bacteria 2977851361 2977851425 371
513 iso_pu_bacteria 2977858184 2977861871 371
514 iso_pu_bacteria 2977864932 2977866964 371
515 iso_pu_bacteria 2977872689 2977876828 371
516 iso_pu_bacteria 2977907340 2977911942 371
517 iso_pu_bacteria 2977915119 2977921553 371
518 iso_pu_bacteria 2977935797 2977939586 371
519 iso_pu_bacteria 2977950692 2977956176 371
520 iso_pu_bacteria 2977986579 2977991539 371
521 iso_pu_bacteria 2978969890 2978974544 371
522 iso_pu_bacteria 2979089926 2979094599 371
523 iso_pu_bacteria 2979095461 2979100836 371
524 iso_pu_bacteria 2979100975 2979103840 371
525 iso_pu_bacteria 2979710463 2979711367 371
526 iso_pu_bacteria 2979742915 2979747633 371
527 iso_pu_bacteria 2979764755 2979769779 371
528 iso_pu_bacteria 2979779861 2979782735 371
529 iso_pu_bacteria 2979793036 2979797358 371
530 iso_pu_bacteria 2979808191 2979811770 371
531 iso_pu_bacteria 2984509177 2984511593 371
532 iso_pu_bacteria 2984518228 2984522046 371
533 iso_pu_bacteria 2984537506 2984541344 371
534 iso_pu_bacteria 2984587000 2984589862 371
535 iso_pu_bacteria 2984601300 2984603621 371
536 iso_pu_bacteria 2987652177 2987655066 371
537 iso_pu_bacteria 2987673487 2987679276 371
538 iso_pu_bacteria 2989349275 2989349564 371
539 iso_pu_bacteria 2995392953 2995393356 371
540 iso_pu_bacteria 2996336353 2996340486 371
541 iso_pu_bacteria 2996386984 2996388168 371
542 iso_pu_bacteria 2996887358 2996889120 371
543 iso_pu_bacteria 2996893221 2996896448 371
544 iso_pu_bacteria 3000135777 3000140523 371
545 iso_pu_bacteria 3002141150 3002144686 371
546 iso_pu_bacteria 3003930520 3003933932 371
547 iso_pu_bacteria 3004167301 3004169047 371
548 iso_pu_bacteria 3004188549 3004193950 371
549 iso_pu_bacteria 3004232784 3004235998 371
550 iso_pu_bacteria 3004239961 3004246043 371
551 iso_pu_bacteria 3004248173 3004250278 371
552 iso_pu_bacteria 3004268573 3004273646 371
553 iso_pu_bacteria 3004334049 3004334196 371
554 iso_pu_bacteria 3005409236 3005414711 371
555 iso_pu_bacteria 3005416602 3005419904 371
556 iso_pu_bacteria 3005445848 3005448347 371
557 iso_pu_bacteria 3005452660 3005454553 371
558 iso_pu_bacteria 637000159 637074458 371
559 iso_pu_bacteria 639633055 639649098 371
560 iso_pu_bacteria 643692032 643826204 371
561 iso_pu_bacteria 649633066 649873105 371
562 iso_pu_bacteria 650716007 650740478 371
563 iso_pu_bacteria 8003570095 8003571545 371
564 iso_pu_bacteria 8003999396 8004001701 371
565 iso_pu_bacteria 8004300914 8004303291 371
566 iso_pu_bacteria 8004312739 8004313248 371
567 iso_pu_bacteria 8004361976 8004362077 371
568 iso_pu_bacteria 8004374579 8004380526 371
569 iso_pu_bacteria 8004445564 8004451397 371
570 iso_pu_bacteria 8004633249 8004638295 371
571 iso_pu_bacteria 8004640170 8004640683 371
572 iso_pu_bacteria 8004695233 8004702267 371
573 iso_pu_bacteria 8004703790 8004709475 371
574 iso_pu_bacteria 8004727605 8004730314 371
575 iso_pu_bacteria 8005246636 8005248691 371
576 iso_pu_bacteria 8005258706 8005262273 371
577 iso_pu_bacteria 8005275841 8005281036 371
578 iso_pu_bacteria 8005282627 8005283353 371
579 iso_pu_bacteria 8005289223 8005293545 371
580 iso_pu_bacteria 8005301065 8005303029 371
581 iso_pu_bacteria 8005307578 8005312736 371
582 iso_pu_bacteria 8005314921 8005316855 371
583 iso_pu_bacteria 8005321885 8005323647 371
584 iso_pu_bacteria 8005376324 8005380831 371
585 iso_pu_bacteria 8005382845 8005385298 371
586 iso_pu_bacteria 8005395548 8005396216 371
587 iso_pu_bacteria 8005430974 8005435061 371
588 iso_pu_bacteria 8005460587 8005463582 371
589 iso_pu_bacteria 8005484373 8005485342 371
590 iso_pu_bacteria 8005497431 8005500800 371
591 iso_pu_bacteria 8005542996 8005545515 371
592 iso_pu_bacteria 8005556819 8005557111 371
593 iso_pu_bacteria 8005563573 8005567894 371
594 iso_pu_bacteria 8005570704 8005573560 371
595 iso_pu_bacteria 8005619151 8005622176 371
596 iso_pu_bacteria 8005626139 8005632347 371
597 iso_pu_bacteria 8005645114 8005649668 371
598 iso_pu_bacteria 8005668836 8005672218 371
599 iso_pu_bacteria 8005682033 8005682978 371
600 iso_pu_bacteria 8005688590 8005692201 371
601 iso_pu_bacteria 8005695170 8005697306 371
602 iso_pu_bacteria 8018127388 8018134001 371
603 iso_pu_bacteria 8018163183 8018163851 371
604 iso_pu_bacteria 8018176218 8018181416 371
605 iso_pu_bacteria 8023680758 8023683265 371
606 iso_pu_bacteria 8024479707 8024482963 371
607 iso_pu_bacteria 8024486573 8024487940 371
608 iso_pu_bacteria 8024501048 8024504267 371
609 iso_pu_bacteria 8045864390 8045864657 371
610 iso_pu_bacteria 8046767195 8046772260 371
611 iso_pu_bacteria 8054460903 8054462901 371
612 iso_pu_bacteria 8056375014 8056378435 371
613 iso_pu_bacteria 8056382006 8056386632 371
614 iso_pu_bacteria 8056875544 8056877369 371
615 iso_pu_bacteria 8057575449 8057575826 371
616 iso_pu_bacteria 8057874678 8057877336 371
617 3300003578 Ga0006562J51391_1019610 Ga0006562J51391_10196102 373
618 3300006038 Ga0075365_10003238 Ga0075365_100032384 373
619 3300050492 nmdc:mga0yw44_1670_c2 nmdc:mga0yw44_1670_c2_4556_5773 373
620 iso_pu_bacteria 2751185800 2753359712 373
621 3300003792 Ga0055540_1002778 Ga0055540_100277811 374
622 3300005262 Ga0065165_1003952 Ga0065165_10039526 374
623 3300005548 Ga0070665_100062656 Ga0070665_1000626562 374
624 3300006051 Ga0075364_10000201 Ga0075364_1000020112 374
625 3300006946 Ga0079104_1000193 Ga0079104_10001936 374
626 3300025297 Ga0209758_1000642 Ga0209758_100064244 374
627 3300025298 Ga0209050_1002400 Ga0209050_10024002 374
628 3300025303 Ga0209051_1030731 Ga0209051_10307312 374
629 3300025304 Ga0209257_1019949 Ga0209257_10199492 374
630 3300027111 Ga0209281_1000034 Ga0209281_10000346 374
631 3300028379 Ga0268266_10128965 Ga0268266_101289651 374
632 3300046530 Ga0495654_0000254 Ga0495654_0000254_45473_46597 374
633 3300048913 Ga0496110_0289290 Ga0496110_0289290_29_1153 374
634 3300048914 Ga0496111_0000592 Ga0496111_0000592_2781_3905 374
635 3300048924 Ga0496121_0000363 Ga0496121_0000363_19156_20340 374
636 3300048925 Ga0496122_0000369 Ga0496122_0000369_2677_3801 374
637 3300048925 Ga0496122_0047231 Ga0496122_0047231_640_1764 374
638 3300048926 Ga0496123_0000054 Ga0496123_0000054_60993_62117 374
639 3300048926 Ga0496123_0011197 Ga0496123_0011197_4636_5760 374
640 3300050491 nmdc:mga00v17_109_c1 nmdc:mga00v17_109_c1_17046_18170 374
641 3300053125 Ga0500618_000361 Ga0500618_000361_17135_18259 374
642 3300053125 Ga0500618_001657 Ga0500618_001657_2611_3735 374
643 3300053125 Ga0500618_016697 Ga0500618_016697_637_1761 374
644 3300001979 JGI24740J21852_10031325 JGI24740J21852_100313251 375
645 3300002704 JGI25155J39150_1000001 JGI25155J39150_1000001209 375
646 3300002705 JGI25156J39149_1000001 JGI25156J39149_1000001124 375
647 3300002737 JGI25162J39368_1000380 JGI25162J39368_100038022 375
648 3300002737 JGI25162J39368_1000534 JGI25162J39368_10005343 375
649 3300002738 JGI25154J39366_1000011 JGI25154J39366_1000011260 375
650 3300002739 JGI25158J39367_1000129 JGI25158J39367_100012910 375
651 3300002741 JGI25157J39369_1000079 JGI25157J39369_100007979 375
652 3300002741 JGI25157J39369_1000237 JGI25157J39369_100023733 375
653 3300002773 JGI25152J39213_1000826 JGI25152J39213_10008263 375
654 3300002773 JGI25152J39213_1003179 JGI25152J39213_10031794 375
655 3300002773 JGI25152J39213_1007411 JGI25152J39213_10074112 375
656 3300002774 JGI25150J39212_1000165 JGI25150J39212_100016511 375
657 3300002774 JGI25150J39212_1000307 JGI25150J39212_100030725 375
658 3300002774 JGI25150J39212_1007748 JGI25150J39212_10077482 375
659 3300002987 JGI25159J45721_1000040 JGI25159J45721_100004022 375
660 3300002987 JGI25159J45721_1000613 JGI25159J45721_100061316 375
661 3300002987 JGI25159J45721_1001660 JGI25159J45721_10016606 375
662 3300003187 JGI25151J46595_10000329 JGI25151J46595_1000032925 375
663 3300003187 JGI25151J46595_10011722 JGI25151J46595_100117222 375
664 3300003187 JGI25151J46595_10027067 JGI25151J46595_100270672 375
665 3300003214 JGI25165J46597_1000015 JGI25165J46597_100001546 375
666 3300003214 JGI25165J46597_1000422 JGI25165J46597_100042220 375
667 3300003214 JGI25165J46597_1001018 JGI25165J46597_100101814 375
668 3300003214 JGI25165J46597_1004651 JGI25165J46597_10046511 375
669 3300003215 JGI25153J46596_10001789 JGI25153J46596_100017898 375
670 3300003215 JGI25153J46596_10003058 JGI25153J46596_1000305811 375
671 3300003215 JGI25153J46596_10003631 JGI25153J46596_1000363111 375
672 3300003322 rootL2_10016257 rootL2_100162578 375
673 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001735 375
674 3300003354 JGI25160J50197_1000128 JGI25160J50197_100012859 375
675 3300003354 JGI25160J50197_1000397 JGI25160J50197_100039724 375
676 3300003374 JGI25161J50226_1000001 JGI25161J50226_100000115 375
677 3300003374 JGI25161J50226_1000099 JGI25161J50226_100009915 375
678 3300003374 JGI25161J50226_1000140 JGI25161J50226_100014038 375
679 3300003374 JGI25161J50226_1000921 JGI25161J50226_10009215 375
680 3300003762 Ga0055542_1000519 Ga0055542_100051930 375
681 3300003763 Ga0055529_1002792 Ga0055529_10027923 375
682 3300003771 Ga0055526_1000484 Ga0055526_100048420 375
683 3300003771 Ga0055526_1009798 Ga0055526_10097982 375
684 3300003771 Ga0055526_1010515 Ga0055526_10105155 375
685 3300003771 Ga0055526_1013767 Ga0055526_10137672 375
686 3300003775 Ga0055524_1001085 Ga0055524_10010855 375
687 3300003775 Ga0055524_1003087 Ga0055524_10030878 375
688 3300003775 Ga0055524_1007173 Ga0055524_10071734 375
689 3300003775 Ga0055524_1019611 Ga0055524_10196112 375
690 3300003775 Ga0055524_1028804 Ga0055524_10288041 375
691 3300003781 Ga0055536_1006588 Ga0055536_10065882 375
692 3300003790 Ga0055528_1000962 Ga0055528_10009629 375
693 3300003790 Ga0055528_1001865 Ga0055528_100186514 375
694 3300003790 Ga0055528_1002431 Ga0055528_100243112 375
695 3300003790 Ga0055528_1012566 Ga0055528_10125663 375
696 3300003792 Ga0055540_1000283 Ga0055540_100028330 375
697 3300003792 Ga0055540_1001971 Ga0055540_10019714 375
698 3300003792 Ga0055540_1028922 Ga0055540_10289221 375
699 3300003856 Ga0058692_1001129 Ga0058692_10011299 375
700 3300003856 Ga0058692_1003154 Ga0058692_10031546 375
701 3300004625 Ga0055543_1000003 Ga0055543_100000331 375
702 3300004625 Ga0055543_1000128 Ga0055543_100012825 375
703 3300004625 Ga0055543_1000130 Ga0055543_100013019 375
704 3300004625 Ga0055543_1000438 Ga0055543_100043822 375
705 3300005262 Ga0065165_1000013 Ga0065165_1000013280 375
706 3300005262 Ga0065165_1000068 Ga0065165_1000068137 375
707 3300005262 Ga0065165_1007614 Ga0065165_10076144 375
708 3300005262 Ga0065165_1011139 Ga0065165_10111392 375
709 3300005262 Ga0065165_1015958 Ga0065165_10159582 375
710 3300005331 Ga0070670_100004125 Ga0070670_10000412510 375
711 3300005347 Ga0070668_100016609 Ga0070668_1000166092 375
712 3300005353 Ga0070669_100079852 Ga0070669_1000798521 375
713 3300005455 Ga0070663_100020865 Ga0070663_1000208654 375
714 3300005459 Ga0068867_100134879 Ga0068867_1001348792 375
715 3300005539 Ga0068853_100013344 Ga0068853_1000133446 375
716 3300005548 Ga0070665_100143222 Ga0070665_1001432223 375
717 3300005548 Ga0070665_100209938 Ga0070665_1002099382 375
718 3300005614 Ga0068856_100025945 Ga0068856_1000259455 375
719 3300005614 Ga0068856_100097085 Ga0068856_1000970851 375
720 3300005983 Ga0081540_1032190 Ga0081540_10321902 375
721 3300005985 Ga0081539_10009861 Ga0081539_100098616 375
722 3300006038 Ga0075365_10005895 Ga0075365_100058954 375
723 3300006038 Ga0075365_10022146 Ga0075365_100221463 375
724 3300006038 Ga0075365_10024459 Ga0075365_100244594 375
725 3300006038 Ga0075365_10035692 Ga0075365_100356924 375
726 3300006038 Ga0075365_10091646 Ga0075365_100916462 375
727 3300006048 Ga0075363_100040032 Ga0075363_1000400323 375
728 3300006051 Ga0075364_10020218 Ga0075364_100202185 375
729 3300006051 Ga0075364_10061726 Ga0075364_100617262 375
730 3300006178 Ga0075367_10015244 Ga0075367_100152441 375
731 3300006178 Ga0075367_10023023 Ga0075367_100230233 375
732 3300006178 Ga0075367_10043918 Ga0075367_100439184 375
733 3300006186 Ga0075369_10000132 Ga0075369_1000013213 375
734 3300006186 Ga0075369_10001343 Ga0075369_100013437 375
735 3300006186 Ga0075369_10004049 Ga0075369_100040492 375
736 3300006186 Ga0075369_10014342 Ga0075369_100143422 375
737 3300006195 Ga0075366_10008456 Ga0075366_100084564 375
738 3300006195 Ga0075366_10039554 Ga0075366_100395543 375
739 3300006353 Ga0075370_10011704 Ga0075370_100117044 375
740 3300006353 Ga0075370_10130222 Ga0075370_101302222 375
741 3300006946 Ga0079104_1005344 Ga0079104_10053445 375
742 3300006948 Ga0099826_10001077 Ga0099826_100010778 375
743 3300006948 Ga0099826_10001302 Ga0099826_100013026 375
744 3300009036 Ga0105244_10094727 Ga0105244_100947272 375
745 3300009092 Ga0105250_10063915 Ga0105250_100639151 375
746 3300009093 Ga0105240_10000076 Ga0105240_1000007678 375
747 3300009148 Ga0105243_10010781 Ga0105243_100107814 375
748 3300009148 Ga0105243_10136372 Ga0105243_101363722 375
749 3300009174 Ga0105241_10047868 Ga0105241_100478684 375
750 3300009177 Ga0105248_10258531 Ga0105248_102585312 375
751 3300009545 Ga0105237_10011962 Ga0105237_1001196210 375
752 3300009545 Ga0105237_10099343 Ga0105237_100993434 375
753 3300009551 Ga0105238_10005101 Ga0105238_100051017 375
754 3300009765 Ga0123341_1000032 Ga0123341_100003240 375
755 3300009766 Ga0123342_1005565 Ga0123342_100556517 375
756 3300009766 Ga0123342_1027673 Ga0123342_10276733 375
757 3300010375 Ga0105239_10016340 Ga0105239_100163406 375
758 3300010375 Ga0105239_10170562 Ga0105239_101705623 375
759 3300010375 Ga0105239_10178087 Ga0105239_101780873 375
760 3300013100 Ga0157373_10050627 Ga0157373_100506272 375
761 3300013102 Ga0157371_10000908 Ga0157371_1000090811 375
762 3300013102 Ga0157371_10053052 Ga0157371_100530522 375
763 3300013104 Ga0157370_10000282 Ga0157370_1000028243 375
764 3300013104 Ga0157370_10000351 Ga0157370_1000035142 375
765 3300013105 Ga0157369_10068419 Ga0157369_100684195 375
766 3300013249 Ga0171463_1003 Ga0171463_1003258 375
767 3300013307 Ga0157372_10410434 Ga0157372_104104342 375
768 3300015262 Ga0182007_10005359 Ga0182007_100053595 375
769 3300015265 Ga0182005_1005134 Ga0182005_10051342 375
770 3300015690 Ga0183363_1104 Ga0183363_110415 375
771 3300021320 Ga0214544_1000161 Ga0214544_100016157 375
772 3300021321 Ga0214542_1000012 Ga0214542_1000012167 375
773 3300021321 Ga0214542_1022883 Ga0214542_10228833 375
774 3300021327 Ga0214543_1000024 Ga0214543_1000024168 375
775 3300021327 Ga0214543_1000038 Ga0214543_1000038154 375
776 3300022739 Ga0228711_1000008 Ga0228711_1000008132 375
777 3300022740 Ga0228710_1000009 Ga0228710_1000009131 375
778 3300025206 Ga0209435_100012 Ga0209435_100012260 375
779 3300025208 Ga0209436_100029 Ga0209436_10002978 375
780 3300025208 Ga0209436_100478 Ga0209436_10047818 375
781 3300025208 Ga0209436_103096 Ga0209436_1030965 375
782 3300025228 Ga0209672_106122 Ga0209672_1061222 375
783 3300025233 Ga0209437_100047 Ga0209437_10004734 375
784 3300025233 Ga0209437_100242 Ga0209437_10024262 375
785 3300025245 Ga0207425_1000024 Ga0207425_1000024280 375
786 3300025245 Ga0207425_1012717 Ga0207425_10127172 375
787 3300025246 Ga0209646_1000026 Ga0209646_1000026260 375
788 3300025250 Ga0209026_1000014 Ga0209026_1000014260 375
789 3300025250 Ga0209026_1000025 Ga0209026_1000025271 375
790 3300025253 Ga0209677_102528 Ga0209677_1025287 375
791 3300025254 Ga0209148_1000128 Ga0209148_1000128139 375
792 3300025256 Ga0209759_1000012 Ga0209759_1000012260 375
793 3300025256 Ga0209759_1000057 Ga0209759_100005740 375
794 3300025258 Ga0209129_1000146 Ga0209129_100014676 375
795 3300025258 Ga0209129_1000161 Ga0209129_100016185 375
796 3300025258 Ga0209129_1000384 Ga0209129_100038412 375
797 3300025258 Ga0209129_1005814 Ga0209129_10058142 375
798 3300025261 Ga0209233_1000010 Ga0209233_1000010144 375
799 3300025261 Ga0209233_1000048 Ga0209233_1000048367 375
800 3300025261 Ga0209233_1000069 Ga0209233_100006970 375
801 3300025261 Ga0209233_1000260 Ga0209233_100026022 375
802 3300025261 Ga0209233_1011159 Ga0209233_10111594 375
803 3300025272 Ga0209455_1000492 Ga0209455_100049222 375
804 3300025273 Ga0209673_1000010 Ga0209673_1000010105 375
805 3300025273 Ga0209673_1000384 Ga0209673_100038467 375
806 3300025273 Ga0209673_1000977 Ga0209673_100097714 375
807 3300025273 Ga0209673_1001611 Ga0209673_100161120 375
808 3300025273 Ga0209673_1004894 Ga0209673_10048944 375
809 3300025273 Ga0209673_1008652 Ga0209673_10086524 375
810 3300025273 Ga0209673_1020948 Ga0209673_10209482 375
811 3300025284 Ga0209130_1000003 Ga0209130_100000341 375
812 3300025284 Ga0209130_1000020 Ga0209130_1000020346 375
813 3300025284 Ga0209130_1000034 Ga0209130_1000034270 375
814 3300025292 Ga0209676_1014384 Ga0209676_10143843 375
815 3300025294 Ga0209025_1000050 Ga0209025_100005047 375
816 3300025294 Ga0209025_1000058 Ga0209025_1000058246 375
817 3300025294 Ga0209025_1000140 Ga0209025_1000140153 375
818 3300025294 Ga0209025_1000216 Ga0209025_10002169 375
819 3300025294 Ga0209025_1000405 Ga0209025_100040575 375
820 3300025294 Ga0209025_1006154 Ga0209025_10061542 375
821 3300025295 Ga0209564_1000013 Ga0209564_1000013268 375
822 3300025295 Ga0209564_1000388 Ga0209564_100038867 375
823 3300025295 Ga0209564_1000512 Ga0209564_100051252 375
824 3300025295 Ga0209564_1001530 Ga0209564_100153022 375
825 3300025295 Ga0209564_1006762 Ga0209564_10067623 375
826 3300025295 Ga0209564_1011654 Ga0209564_10116542 375
827 3300025297 Ga0209758_1000083 Ga0209758_1000083210 375
828 3300025297 Ga0209758_1002719 Ga0209758_100271922 375
829 3300025297 Ga0209758_1003069 Ga0209758_10030692 375
830 3300025297 Ga0209758_1003364 Ga0209758_100336416 375
831 3300025297 Ga0209758_1018176 Ga0209758_10181762 375
832 3300025298 Ga0209050_1004042 Ga0209050_10040424 375
833 3300025298 Ga0209050_1010948 Ga0209050_10109482 375
834 3300025299 Ga0209256_1000442 Ga0209256_100044249 375
835 3300025299 Ga0209256_1000738 Ga0209256_100073842 375
836 3300025299 Ga0209256_1001584 Ga0209256_100158418 375
837 3300025299 Ga0209256_1004887 Ga0209256_10048874 375
838 3300025299 Ga0209256_1006190 Ga0209256_10061907 375
839 3300025299 Ga0209256_1020856 Ga0209256_10208561 375
840 3300025302 Ga0207426_1000006 Ga0207426_1000006643 375
841 3300025302 Ga0207426_1000008 Ga0207426_1000008413 375
842 3300025302 Ga0207426_1000011 Ga0207426_1000011737 375
843 3300025302 Ga0207426_1000221 Ga0207426_100022131 375
844 3300025302 Ga0207426_1002076 Ga0207426_100207613 375
845 3300025303 Ga0209051_1000308 Ga0209051_100030849 375
846 3300025303 Ga0209051_1008939 Ga0209051_10089396 375
847 3300025303 Ga0209051_1011377 Ga0209051_10113774 375
848 3300025303 Ga0209051_1024303 Ga0209051_10243033 375
849 3300025303 Ga0209051_1029576 Ga0209051_10295762 375
850 3300025304 Ga0209257_1000853 Ga0209257_100085334 375
851 3300025304 Ga0209257_1027599 Ga0209257_10275992 375
852 3300025911 Ga0207654_10019351 Ga0207654_100193514 375
853 3300025913 Ga0207695_10000011 Ga0207695_10000011120 375
854 3300025913 Ga0207695_10179849 Ga0207695_101798492 375
855 3300025914 Ga0207671_10000093 Ga0207671_100000938 375
856 3300025925 Ga0207650_10012844 Ga0207650_100128442 375
857 3300025972 Ga0207668_10007707 Ga0207668_100077074 375
858 3300026041 Ga0207639_10028714 Ga0207639_100287145 375
859 3300026067 Ga0207678_10254862 Ga0207678_102548622 375
860 3300026078 Ga0207702_10018061 Ga0207702_100180615 375
861 3300026089 Ga0207648_10107359 Ga0207648_101073593 375
862 3300027111 Ga0209281_1000106 Ga0209281_100010698 375
863 3300027111 Ga0209281_1000426 Ga0209281_100042649 375
864 3300027312 Ga0209371_1000022 Ga0209371_100002215 375
865 3300027312 Ga0209371_1003118 Ga0209371_10031188 375
866 3300027666 Ga0209282_1000024 Ga0209282_100002429 375
867 3300027666 Ga0209282_1000646 Ga0209282_100064612 375
868 3300028379 Ga0268266_10023807 Ga0268266_100238073 375
869 3300028379 Ga0268266_10131348 Ga0268266_101313483 375
870 3300028379 Ga0268266_10168964 Ga0268266_101689642 375
871 3300028794 Ga0307515_10000307 Ga0307515_1000030730 375
872 3300028794 Ga0307515_10000788 Ga0307515_1000078825 375
873 3300028794 Ga0307515_10109955 Ga0307515_101099553 375
874 3300030500 Ga0268256_1000019 Ga0268256_1000019505 375
875 3300030500 Ga0268256_1005962 Ga0268256_10059624 375
876 3300031456 Ga0307513_10086474 Ga0307513_100864744 375
877 3300031691 Ga0316579_10044926 Ga0316579_100449263 375
878 3300031731 Ga0307405_10001398 Ga0307405_1000139812 375
879 3300031901 Ga0307406_10011163 Ga0307406_100111638 375
880 3300031911 Ga0307412_10008584 Ga0307412_100085846 375
881 3300031967 Ga0315914_1000012 Ga0315914_1000012133 375
882 3300031995 Ga0307409_100215038 Ga0307409_1002150381 375
883 3300031995 Ga0307409_100284723 Ga0307409_1002847232 375
884 3300033430 Ga0315913_1000006 Ga0315913_1000006131 375
885 3300033464 Ga0315915_1000010 Ga0315915_1000010131 375
886 3300035695 Ga0373927_0000810 Ga0373927_0000810_10196_11323 375
887 3300036647 Ga0316582_0099393 Ga0316582_0099393_608_1735 375
888 3300037068 Ga0373925_0006321 Ga0373925_0006321_1775_2902 375
889 3300037312 Ga0395899_0000117 Ga0395899_0000117_109414_110541 375
890 3300037418 Ga0395900_0000020 Ga0395900_0000020_109414_110541 375
891 3300037418 Ga0395900_0154508 Ga0395900_0154508_970_2097 375
892 3300037466 Ga0395898_0000259 Ga0395898_0000259_109414_110541 375
893 3300037466 Ga0395898_0094818 Ga0395898_0094818_1654_2781 375
894 3300037471 Ga0395905_0000019 Ga0395905_0000019_242960_244087 375
895 3300037471 Ga0395905_0000736 Ga0395905_0000736_32145_33275 375
896 3300037471 Ga0395905_0052490 Ga0395905_0052490_821_1960 375
897 3300038443 Ga0395901_0000016 Ga0395901_0000016_109922_111049 375
898 3300038443 Ga0395901_0011547 Ga0395901_0011547_1070_2245 375
899 3300038741 Ga0400488_06315 Ga0400488_06315_321_1448 375
900 3300041413 Ga0439465_0033772 Ga0439465_0033772_259_1386 375
901 3300041451 Ga0451791_1138375 Ga0451791_1138375_758_1885 375
902 3300041492 Ga0451835_0039587 Ga0451835_0039587_703_1830 375
903 3300041501 Ga0451845_0826072 Ga0451845_0826072_2211_3338 375
904 3300041505 Ga0451849_1373232 Ga0451849_1373232_346_1473 375
905 3300041509 Ga0451843_0297013 Ga0451843_0297013_2051_3178 375
906 3300044658 Ga0466972_0020643 Ga0466972_0020643_355_1530 375
907 3300046460 Ga0495638_0000195 Ga0495638_0000195_32880_34007 375
908 3300046460 Ga0495638_0013713 Ga0495638_0013713_3545_4768 375
909 3300046460 Ga0495638_0032072 Ga0495638_0032072_565_1692 375
910 3300046492 Ga0495585_0006794 Ga0495585_0006794_5526_6653 375
911 3300046492 Ga0495585_0017651 Ga0495585_0017651_1204_2331 375
912 3300046500 Ga0495596_0049578 Ga0495596_0049578_477_1604 375
913 3300046506 Ga0495583_0001630 Ga0495583_0001630_16088_17215 375
914 3300046506 Ga0495583_0064007 Ga0495583_0064007_373_1500 375
915 3300046507 Ga0495606_0002164 Ga0495606_0002164_7507_8748 375
916 3300046507 Ga0495606_0007242 Ga0495606_0007242_530_1657 375
917 3300046507 Ga0495606_0062004 Ga0495606_0062004_1222_2349 375
918 3300046512 Ga0495610_0001253 Ga0495610_0001253_11624_12751 375
919 3300046512 Ga0495610_0016243 Ga0495610_0016243_2115_3242 375
920 3300046515 Ga0495620_0028851 Ga0495620_0028851_649_1776 375
921 3300046518 Ga0495631_0001628 Ga0495631_0001628_6076_7203 375
922 3300046518 Ga0495631_0012959 Ga0495631_0012959_646_1773 375
923 3300046519 Ga0495632_0001015 Ga0495632_0001015_13168_14295 375
924 3300046522 Ga0495643_0013532 Ga0495643_0013532_865_1992 375
925 3300046522 Ga0495643_0014825 Ga0495643_0014825_1954_3111 375
926 3300046530 Ga0495654_0016736 Ga0495654_0016736_2056_3183 375
927 3300046530 Ga0495654_0063661 Ga0495654_0063661_159_1286 375
928 3300046538 Ga0495609_0067269 Ga0495609_0067269_46_1173 375
929 3300046558 Ga0495633_0007773 Ga0495633_0007773_3854_4981 375
930 3300046615 Ga0495656_0009496 Ga0495656_0009496_573_1760 375
931 3300046616 Ga0495668_0020849 Ga0495668_0020849_1546_2673 375
932 3300046660 Ga0495625_0000621 Ga0495625_0000621_38050_39177 375
933 3300046691 Ga0495670_0024091 Ga0495670_0024091_1537_2664 375
934 3300046691 Ga0495670_0031057 Ga0495670_0031057_703_1830 375
935 3300047317 Ga0495604_0012101 Ga0495604_0012101_4790_5917 375
936 3300047320 Ga0495672_0005251 Ga0495672_0005251_4410_5537 375
937 3300047447 Ga0495685_024882 Ga0495685_024882_821_1948 375
938 3300047470 Ga0495681_0006193 Ga0495681_0006193_28_1155 375
939 3300047472 Ga0495686_0000316 Ga0495686_0000316_11859_12986 375
940 3300047472 Ga0495686_0003045 Ga0495686_0003045_3197_4324 375
941 3300047472 Ga0495686_0067244 Ga0495686_0067244_130_1257 375
942 3300048090 Ga0495615_0007978 Ga0495615_0007978_538_1725 375
943 3300048909 Ga0496106_0000578 Ga0496106_0000578_11020_12216 375
944 3300048912 Ga0496109_0283369 Ga0496109_0283369_155_1282 375
945 3300048915 Ga0496112_0003167 Ga0496112_0003167_5664_6791 375
946 3300048916 Ga0496113_0045574 Ga0496113_0045574_1215_2342 375
947 3300048918 Ga0496115_0197362 Ga0496115_0197362_93_1220 375
948 3300048919 Ga0496116_0004831 Ga0496116_0004831_2660_3787 375
949 3300048919 Ga0496116_0048900 Ga0496116_0048900_676_1803 375
950 3300048919 Ga0496116_0054750 Ga0496116_0054750_719_1846 375
951 3300048919 Ga0496116_0079230 Ga0496116_0079230_456_1583 375
952 3300048919 Ga0496116_0083005 Ga0496116_0083005_399_1526 375
953 3300048919 Ga0496116_0110382 Ga0496116_0110382_301_1428 375
954 3300048920 Ga0496117_0000002 Ga0496117_0000002_553316_554443 375
955 3300048920 Ga0496117_0005629 Ga0496117_0005629_8707_9834 375
956 3300048920 Ga0496117_0010714 Ga0496117_0010714_2380_3507 375
957 3300048920 Ga0496117_0033555 Ga0496117_0033555_2211_3338 375
958 3300048921 Ga0496118_0000087 Ga0496118_0000087_164875_166002 375
959 3300048921 Ga0496118_0015216 Ga0496118_0015216_2335_3462 375
960 3300048922 Ga0496119_0040491 Ga0496119_0040491_605_1732 375
961 3300048923 Ga0496120_0000180 Ga0496120_0000180_35410_36537 375
962 3300048923 Ga0496120_0000621 Ga0496120_0000621_8312_9439 375
963 3300048923 Ga0496120_0053060 Ga0496120_0053060_836_1999 375
964 3300048923 Ga0496120_0099445 Ga0496120_0099445_120_1247 375
965 3300048924 Ga0496121_0000003 Ga0496121_0000003_302822_304012 375
966 3300048924 Ga0496121_0004088 Ga0496121_0004088_12399_13526 375
967 3300048924 Ga0496121_0005561 Ga0496121_0005561_1289_2530 375
968 3300048924 Ga0496121_0009569 Ga0496121_0009569_1131_2258 375
969 3300048924 Ga0496121_0086868 Ga0496121_0086868_880_2007 375
970 3300048924 Ga0496121_0249946 Ga0496121_0249946_63_1190 375
971 3300048925 Ga0496122_0000004 Ga0496122_0000004_35415_36542 375
972 3300048925 Ga0496122_0000190 Ga0496122_0000190_36659_37786 375
973 3300048925 Ga0496122_0005937 Ga0496122_0005937_6274_7401 375
974 3300048925 Ga0496122_0025840 Ga0496122_0025840_3029_4156 375
975 3300048925 Ga0496122_0097344 Ga0496122_0097344_824_1951 375
976 3300048926 Ga0496123_0000007 Ga0496123_0000007_35415_36542 375
977 3300048926 Ga0496123_0001159 Ga0496123_0001159_10993_12120 375
978 3300048926 Ga0496123_0007309 Ga0496123_0007309_299_1426 375
979 3300048926 Ga0496123_0028380 Ga0496123_0028380_956_2083 375
980 3300048926 Ga0496123_0076217 Ga0496123_0076217_923_2050 375
981 3300048927 Ga0496124_0000308 Ga0496124_0000308_29008_30135 375
982 3300048927 Ga0496124_0001702 Ga0496124_0001702_19303_20430 375
983 3300048927 Ga0496124_0005097 Ga0496124_0005097_1935_3062 375
984 3300048927 Ga0496124_0005246 Ga0496124_0005246_10461_11588 375
985 3300048927 Ga0496124_0006525 Ga0496124_0006525_2977_4104 375
986 3300048927 Ga0496124_0025248 Ga0496124_0025248_677_1804 375
987 3300048927 Ga0496124_0025497 Ga0496124_0025497_163_1290 375
988 3300048927 Ga0496124_0064161 Ga0496124_0064161_224_1351 375
989 3300048927 Ga0496124_0162235 Ga0496124_0162235_502_1629 375
990 3300048928 Ga0496125_0000039 Ga0496125_0000039_81466_82593 375
991 3300048928 Ga0496125_0000273 Ga0496125_0000273_78170_79297 375
992 3300048928 Ga0496125_0019255 Ga0496125_0019255_3400_4527 375
993 3300048928 Ga0496125_0028736 Ga0496125_0028736_2485_3612 375
994 3300048928 Ga0496125_0100336 Ga0496125_0100336_53_1180 375
995 3300048928 Ga0496125_0178773 Ga0496125_0178773_232_1359 375
996 3300048929 Ga0496126_0000589 Ga0496126_0000589_32860_33987 375
997 3300048929 Ga0496126_0001008 Ga0496126_0001008_4439_5566 375
998 3300048929 Ga0496126_0148441 Ga0496126_0148441_631_1758 375
999 3300049459 Ga0495678_008838 Ga0495678_008838_3337_4464 375
1000 3300049459 Ga0495678_070245 Ga0495678_070245_121_1248 375
1001 3300049460 Ga0495682_0058718 Ga0495682_0058718_195_1322 375
1002 3300049568 Ga0501031_0021184 Ga0501031_0021184_3042_4169 375
1003 3300049568 Ga0501031_0030492 Ga0501031_0030492_499_1626 375
1004 3300049568 Ga0501031_0102466 Ga0501031_0102466_471_1598 375
1005 3300049569 Ga0501032_0000031 Ga0501032_0000031_62973_64100 375
1006 3300049569 Ga0501032_0000201 Ga0501032_0000201_47071_48198 375
1007 3300049569 Ga0501032_0053525 Ga0501032_0053525_663_1790 375
1008 3300049570 Ga0501033_0000050 Ga0501033_0000050_58267_59394 375
1009 3300049570 Ga0501033_0000132 Ga0501033_0000132_69464_70591 375
1010 3300049570 Ga0501033_0000779 Ga0501033_0000779_26859_27986 375
1011 3300049570 Ga0501033_0001161 Ga0501033_0001161_6107_7234 375
1012 3300049570 Ga0501033_0253578 Ga0501033_0253578_51_1178 375
1013 3300049571 Ga0501034_0000005 Ga0501034_0000005_319118_320245 375
1014 3300049571 Ga0501034_0000064 Ga0501034_0000064_125362_126489 375
1015 3300049571 Ga0501034_0006650 Ga0501034_0006650_5516_6643 375
1016 3300049571 Ga0501034_0075936 Ga0501034_0075936_668_1798 375
1017 3300049571 Ga0501034_0193804 Ga0501034_0193804_566_1693 375
1018 3300049572 Ga0501036_0000005 Ga0501036_0000005_197986_199113 375
1019 3300049572 Ga0501036_0000563 Ga0501036_0000563_22867_23994 375
1020 3300049572 Ga0501036_0273621 Ga0501036_0273621_208_1335 375
1021 3300049573 Ga0501037_0000045 Ga0501037_0000045_68865_69992 375
1022 3300049573 Ga0501037_0000077 Ga0501037_0000077_23603_24730 375
1023 3300049573 Ga0501037_0000132 Ga0501037_0000132_61232_62359 375
1024 3300049574 Ga0501038_0000001 Ga0501038_0000001_319118_320245 375
1025 3300049574 Ga0501038_0000055 Ga0501038_0000055_8847_9974 375
1026 3300049574 Ga0501038_0061894 Ga0501038_0061894_1553_2680 375
1027 3300049575 Ga0501039_0000007 Ga0501039_0000007_176930_178057 375
1028 3300049575 Ga0501039_0000045 Ga0501039_0000045_35844_36971 375
1029 3300049575 Ga0501039_0141729 Ga0501039_0141729_467_1594 375
1030 3300049579 Ga0501043_0000015 Ga0501043_0000015_82694_83821 375
1031 3300049579 Ga0501043_0000104 Ga0501043_0000104_17208_18335 375
1032 3300049579 Ga0501043_0000333 Ga0501043_0000333_14_1141 375
1033 3300049579 Ga0501043_0003831 Ga0501043_0003831_177_1304 375
1034 3300049579 Ga0501043_0091800 Ga0501043_0091800_103_1230 375
1035 3300049580 Ga0501046_0037003 Ga0501046_0037003_1241_2368 375
1036 3300049580 Ga0501046_0150282 Ga0501046_0150282_490_1617 375
1037 3300049581 Ga0501047_0019278 Ga0501047_0019278_3923_5050 375
1038 3300049582 Ga0501048_0103466 Ga0501048_0103466_11_1138 375
1039 3300049584 Ga0501068_0004105 Ga0501068_0004105_4180_5307 375
1040 3300049585 Ga0501069_0000016 Ga0501069_0000016_93140_94267 375
1041 3300049585 Ga0501069_0036416 Ga0501069_0036416_61_1188 375
1042 3300049585 Ga0501069_0072483 Ga0501069_0072483_567_1694 375
1043 3300049586 Ga0501070_0000048 Ga0501070_0000048_73352_74479 375
1044 3300049586 Ga0501070_0000812 Ga0501070_0000812_16143_17270 375
1045 3300049586 Ga0501070_0021850 Ga0501070_0021850_1112_2239 375
1046 3300049586 Ga0501070_0028549 Ga0501070_0028549_340_1467 375
1047 3300049586 Ga0501070_0080511 Ga0501070_0080511_1319_2446 375
1048 3300049587 Ga0501071_0010145 Ga0501071_0010145_2855_3982 375
1049 3300049587 Ga0501071_0056683 Ga0501071_0056683_120_1247 375
1050 3300049588 Ga0501072_0077657 Ga0501072_0077657_1116_2243 375
1051 3300049590 Ga0501074_0001884 Ga0501074_0001884_3141_4268 375
1052 3300049590 Ga0501074_0064010 Ga0501074_0064010_588_1715 375
1053 3300049741 Ga0501079_0239388 Ga0501079_0239388_207_1334 375
1054 3300049742 Ga0501080_0000270 Ga0501080_0000270_5616_6743 375
1055 3300049742 Ga0501080_0001902 Ga0501080_0001902_1817_2944 375
1056 3300049742 Ga0501080_0176279 Ga0501080_0176279_367_1494 375
1057 3300049744 Ga0501083_0000069 Ga0501083_0000069_14139_15266 375
1058 3300049822 Ga0501035_0000008 Ga0501035_0000008_264997_266124 375
1059 3300049822 Ga0501035_0000048 Ga0501035_0000048_85109_86236 375
1060 3300049822 Ga0501035_0000306 Ga0501035_0000306_35871_36998 375
1061 3300049822 Ga0501035_0003062 Ga0501035_0003062_1057_2184 375
1062 3300049822 Ga0501035_0004314 Ga0501035_0004314_6507_7634 375
1063 3300049822 Ga0501035_0023011 Ga0501035_0023011_1554_2681 375
1064 3300049822 Ga0501035_0024962 Ga0501035_0024962_1222_2349 375
1065 3300049822 Ga0501035_0029453 Ga0501035_0029453_2065_3192 375
1066 3300049823 Ga0501044_0000001 Ga0501044_0000001_97843_98970 375
1067 3300049823 Ga0501044_0000003 Ga0501044_0000003_167742_168869 375
1068 3300049823 Ga0501044_0010525 Ga0501044_0010525_1568_2695 375
1069 3300049823 Ga0501044_0051990 Ga0501044_0051990_1607_2734 375
1070 3300049823 Ga0501044_0068556 Ga0501044_0068556_1534_2661 375
1071 3300049823 Ga0501044_0162287 Ga0501044_0162287_12_1139 375
1072 3300049824 Ga0501045_0051240 Ga0501045_0051240_1762_2889 375
1073 3300050489 nmdc:mga03683_23701_c1 nmdc:mga03683_23701_c1_509_1636 375
1074 3300050491 nmdc:mga00v17_12_c1 nmdc:mga00v17_12_c1_100076_101203 375
1075 3300050492 nmdc:mga0yw44_140341_c1 nmdc:mga0yw44_140341_c1_366_1493 375
1076 3300050492 nmdc:mga0yw44_31979_c1 nmdc:mga0yw44_31979_c1_1417_2544 375
1077 3300050492 nmdc:mga0yw44_47732_c1 nmdc:mga0yw44_47732_c1_39_1166 375
1078 3300050495 nmdc:mga04h51_13930_c1 nmdc:mga04h51_13930_c1_1138_2265 375
1079 3300050516 nmdc:mga0sz30_240_c1 nmdc:mga0sz30_240_c1_3825_4952 375
1080 3300050516 nmdc:mga0sz30_3440_c1 nmdc:mga0sz30_3440_c1_635_1762 375
1081 3300053079 Ga0500610_0002329 Ga0500610_0002329_416_1543 375
1082 3300053086 Ga0500578_0088087 Ga0500578_0088087_122_1249 375
1083 3300053087 Ga0500643_015830 Ga0500643_015830_1179_2306 375
1084 3300053105 Ga0500557_000324 Ga0500557_000324_2301_3428 375
1085 3300053134 Ga0500658_0000529 Ga0500658_0000529_2266_3393 375
1086 3300053136 Ga0500559_0017106 Ga0500559_0017106_292_1479 375
1087 3300053137 Ga0500561_0000126 Ga0500561_0000126_8402_9529 375
1088 3300053140 Ga0500573_0000585 Ga0500573_0000585_4642_5769 375
1089 3300053153 Ga0500616_0002961 Ga0500616_0002961_3417_4544 375
1090 3300053153 Ga0500616_0011965 Ga0500616_0011965_542_1669 375
1091 3300053153 Ga0500616_0030818 Ga0500616_0030818_1658_2785 375
1092 3300053155 Ga0500620_000067 Ga0500620_000067_18872_19999 375
1093 3300053156 Ga0500622_0000697 Ga0500622_0000697_12609_13736 375
1094 3300053156 Ga0500622_0000899 Ga0500622_0000899_13501_14628 375
1095 3300053157 Ga0500624_001069 Ga0500624_001069_1846_2973 375
1096 3300053161 Ga0500634_0004429 Ga0500634_0004429_1259_2386 375
1097 3300053161 Ga0500634_0008929 Ga0500634_0008929_1625_2752 375
1098 3300053177 Ga0500636_0000021 Ga0500636_0000021_46368_47495 375
1099 3300053177 Ga0500636_0004647 Ga0500636_0004647_4513_5640 375
1100 3300060353 Ga0501082_0017101 Ga0501082_0017101_2185_3312 375
1101 iso_pu_bacteria 2508501122 2509111337 375
1102 iso_pu_bacteria 2509276019 2509376385 375
1103 iso_pu_bacteria 2510065057 2510304382 375
1104 iso_pu_bacteria 2511231052 2511502155 375
1105 iso_pu_bacteria 2512875024 2512959182 375
1106 iso_pu_bacteria 2513237086 2513582451 375
1107 iso_pu_bacteria 2513237088 2513596396 375
1108 iso_pu_bacteria 2513237091 2513617992 375
1109 iso_pu_bacteria 2513237140 2513885497 375
1110 iso_pu_bacteria 2513237143 2513903273 375
1111 iso_pu_bacteria 2513237164 2514033780 375
1112 iso_pu_bacteria 2516143018 2516204071 375
1113 iso_pu_bacteria 2516653046 2516893535 375
1114 iso_pu_bacteria 2551306084 2551674474 375
1115 iso_pu_bacteria 2551306085 2551685857 375
1116 iso_pu_bacteria 2551306087 2551697259 375
1117 iso_pu_bacteria 2551306089 2551715313 375
1118 iso_pu_bacteria 2551306090 2551719986 375
1119 iso_pu_bacteria 2551306093 2551743312 375
1120 iso_pu_bacteria 2558860100 2558867791 375
1121 iso_pu_bacteria 2582581307 2585271048 375
1122 iso_pu_bacteria 2585427531 2585558772 375
1123 iso_pu_bacteria 2585427609 2585904258 375
1124 iso_pu_bacteria 2585428125 2587980625 375
1125 iso_pu_bacteria 2599185156 2599331690 375
1126 iso_pu_bacteria 2643221618 2644107383 375
1127 iso_pu_bacteria 2643221626 2644150950 375
1128 iso_pu_bacteria 2643221643 2644238885 375
1129 iso_pu_bacteria 2643221655 2644308778 375
1130 iso_pu_bacteria 2643221659 2644335595 375
1131 iso_pu_bacteria 2643221698 2644540001 375
1132 iso_pu_bacteria 2643221712 2644614719 375
1133 iso_pu_bacteria 2657244999 2657681448 375
1134 iso_pu_bacteria 2751185821 2753459025 375
1135 iso_pu_bacteria 2757320392 2757569665 375
1136 iso_pu_bacteria 2842922631 2842924094 375
1137 iso_pu_bacteria 2844163670 2844166666 375
1138 iso_pu_bacteria 2850079185 2850081354 375
1139 iso_pu_bacteria 2855825444 2855826255 375
1140 iso_pu_bacteria 2855839649 2855841600 375
1141 iso_pu_bacteria 2856349417 2856354882 375
1142 iso_pu_bacteria 2856364286 2856369586 375
1143 iso_pu_bacteria 2858800743 2858801716 375
1144 iso_pu_bacteria 2869285874 2869286060 375
1145 iso_pu_bacteria 2871429161 2871434493 375
1146 iso_pu_bacteria 2871495908 2871501274 375
1147 iso_pu_bacteria 2874123672 2874130727 375
1148 iso_pu_bacteria 2874155637 2874157957 375
1149 iso_pu_bacteria 2876413966 2876416161 375
1150 iso_pu_bacteria 2878745973 2878751626 375
1151 iso_pu_bacteria 2878760144 2878765254 375
1152 iso_pu_bacteria 2878767105 2878772961 375
1153 iso_pu_bacteria 2881853255 2881854863 375
1154 iso_pu_bacteria 2885312484 2885317872 375
1155 iso_pu_bacteria 2885342637 2885344583 375
1156 iso_pu_bacteria 2885350715 2885352294 375
1157 iso_pu_bacteria 2888343758 2888346940 375
1158 iso_pu_bacteria 2903492973 2903504571 375
1159 iso_pu_bacteria 2903540706 2903546085 375
1160 iso_pu_bacteria 2906308376 2906314024 375
1161 iso_pu_bacteria 2906321335 2906327190 375
1162 iso_pu_bacteria 2913295892 2913299402 375
1163 iso_pu_bacteria 2915986958 2915990428 375
1164 iso_pu_bacteria 2915993759 2915998070 375
1165 iso_pu_bacteria 2916000859 2916006845 375
1166 iso_pu_bacteria 2916007675 2916014058 375
1167 iso_pu_bacteria 2916014648 2916017595 375
1168 iso_pu_bacteria 2916021584 2916025034 375
1169 iso_pu_bacteria 2916028427 2916033197 375
1170 iso_pu_bacteria 2916035215 2916040199 375
1171 iso_pu_bacteria 2916041962 2916044057 375
1172 iso_pu_bacteria 2916048683 2916054238 375
1173 iso_pu_bacteria 2916055098 2916059666 375
1174 iso_pu_bacteria 2916068649 2916068924 375
1175 iso_pu_bacteria 2916076590 2916080629 375
1176 iso_pu_bacteria 2921201388 2921207564 375
1177 iso_pu_bacteria 2921208531 2921214501 375
1178 iso_pu_bacteria 2921237296 2921239406 375
1179 iso_pu_bacteria 2921244191 2921248556 375
1180 iso_pu_bacteria 2921257292 2921261213 375
1181 iso_pu_bacteria 2921263974 2921268629 375
1182 iso_pu_bacteria 2921282425 2921285850 375
1183 iso_pu_bacteria 2921289301 2921289463 375
1184 iso_pu_bacteria 2921296804 2921299919 375
1185 iso_pu_bacteria 2924144063 2924148448 375
1186 iso_pu_bacteria 2924150972 2924158076 375
1187 iso_pu_bacteria 2924158325 2924159190 375
1188 iso_pu_bacteria 2924165586 2924171440 375
1189 iso_pu_bacteria 2924172951 2924177911 375
1190 iso_pu_bacteria 2924179722 2924183703 375
1191 iso_pu_bacteria 2924186466 2924191955 375
1192 iso_pu_bacteria 2924193448 2924198001 375
1193 iso_pu_bacteria 2924200457 2924204763 375
1194 iso_pu_bacteria 2924207177 2924211509 375
1195 iso_pu_bacteria 2924214083 2924218816 375
1196 iso_pu_bacteria 2924221636 2924225731 375
1197 iso_pu_bacteria 2924228884 2924233072 375
1198 iso_pu_bacteria 2924762789 2924764929 375
1199 iso_pu_bacteria 2937002841 2937007341 375
1200 iso_pu_bacteria 2937009748 2937012929 375
1201 iso_pu_bacteria 2937016420 2937021645 375
1202 iso_pu_bacteria 2937023124 2937026876 375
1203 iso_pu_bacteria 2937042894 2937047727 375
1204 iso_pu_bacteria 2937049772 2937053688 375
1205 iso_pu_bacteria 2937056579 2937063412 375
1206 iso_pu_bacteria 2937063883 2937070738 375
1207 iso_pu_bacteria 2937071275 2937077139 375
1208 iso_pu_bacteria 2937091812 2937098208 375
1209 iso_pu_bacteria 2937098957 2937102515 375
1210 iso_pu_bacteria 2937106411 2937111225 375
1211 iso_pu_bacteria 2937113482 2937117915 375
1212 iso_pu_bacteria 2937119839 2937124034 375
1213 iso_pu_bacteria 2937126314 2937130577 375
1214 iso_pu_bacteria 2937813078 2937815866 375
1215 iso_pu_bacteria 2937994558 2937999943 375
1216 iso_pu_bacteria 2938014810 2938017331 375
1217 iso_pu_bacteria 2941499720 2941502232 375
1218 iso_pu_bacteria 2957382221 2957386618 375
1219 iso_pu_bacteria 2957388812 2957392900 375
1220 iso_pu_bacteria 2957395598 2957395982 375
1221 iso_pu_bacteria 2957402308 2957406717 375
1222 iso_pu_bacteria 2957408893 2957410778 375
1223 iso_pu_bacteria 2957415311 2957417606 375
1224 iso_pu_bacteria 2957422303 2957423727 375
1225 iso_pu_bacteria 2957430029 2957434293 375
1226 iso_pu_bacteria 2957443900 2957446350 375
1227 iso_pu_bacteria 2957450854 2957454716 375
1228 iso_pu_bacteria 2957457609 2957461990 375
1229 iso_pu_bacteria 2957464669 2957468634 375
1230 iso_pu_bacteria 2957471148 2957476476 375
1231 iso_pu_bacteria 2957478035 2957482816 375
1232 iso_pu_bacteria 2957484790 2957488710 375
1233 iso_pu_bacteria 2957491536 2957496979 375
1234 iso_pu_bacteria 2957498199 2957503222 375
1235 iso_pu_bacteria 2957505466 2957507298 375
1236 iso_pu_bacteria 2958071322 2958078078 375
1237 iso_pu_bacteria 2958130278 2958130459 375
1238 iso_pu_bacteria 2958165035 2958170407 375
1239 iso_pu_bacteria 2958179912 2958184664 375
1240 iso_pu_bacteria 2960584000 2960590463 375
1241 iso_pu_bacteria 2960597568 2960602502 375
1242 iso_pu_bacteria 2960603979 2960606459 375
1243 iso_pu_bacteria 2960610863 2960612404 375
1244 iso_pu_bacteria 2960617483 2960621496 375
1245 iso_pu_bacteria 2960624210 2960630840 375
1246 iso_pu_bacteria 2960637947 2960644504 375
1247 iso_pu_bacteria 2960645483 2960650019 375
1248 iso_pu_bacteria 2960652885 2960654760 375
1249 iso_pu_bacteria 2960660292 2960665237 375
1250 iso_pu_bacteria 2960667422 2960671722 375
1251 iso_pu_bacteria 2960674078 2960678357 375
1252 iso_pu_bacteria 2960687367 2960692536 375
1253 iso_pu_bacteria 2961077736 2961082831 375
1254 iso_pu_bacteria 2961163497 2961168862 375
1255 iso_pu_bacteria 2964607997 2964614515 375
1256 iso_pu_bacteria 2964615318 2964621055 375
1257 iso_pu_bacteria 2964621998 2964625736 375
1258 iso_pu_bacteria 2964628898 2964632997 375
1259 iso_pu_bacteria 2964636051 2964640137 375
1260 iso_pu_bacteria 2964643177 2964646827 375
1261 iso_pu_bacteria 2964649959 2964655331 375
1262 iso_pu_bacteria 2964656573 2964663230 375
1263 iso_pu_bacteria 2964663802 2964668307 375
1264 iso_pu_bacteria 2964670856 2964671761 375
1265 iso_pu_bacteria 2964678106 2964681603 375
1266 iso_pu_bacteria 2964685014 2964687762 375
1267 iso_pu_bacteria 2964698721 2964704567 375
1268 iso_pu_bacteria 2964705432 2964709819 375
1269 iso_pu_bacteria 2964712639 2964716535 375
1270 iso_pu_bacteria 2964719344 2964724625 375
1271 iso_pu_bacteria 2965018300 2965024149 375
1272 iso_pu_bacteria 2965062239 2965065865 375
1273 iso_pu_bacteria 2967664464 2967668306 375
1274 iso_pu_bacteria 2967671571 2967675919 375
1275 iso_pu_bacteria 2967678726 2967684513 375
1276 iso_pu_bacteria 2967693043 2967697365 375
1277 iso_pu_bacteria 2967699805 2967706613 375
1278 iso_pu_bacteria 2967706974 2967711555 375
1279 iso_pu_bacteria 2967714385 2967714785 375
1280 iso_pu_bacteria 2967721400 2967725820 375
1281 iso_pu_bacteria 2967735183 2967738868 375
1282 iso_pu_bacteria 2967742019 2967746811 375
1283 iso_pu_bacteria 2967748971 2967753576 375
1284 iso_pu_bacteria 2967755722 2967758948 375
1285 iso_pu_bacteria 2967762386 2967768471 375
1286 iso_pu_bacteria 2967769361 2967773839 375
1287 iso_pu_bacteria 2967775926 2967781937 375
1288 iso_pu_bacteria 2968117919 2968120754 375
1289 iso_pu_bacteria 2968128360 2968129301 375
1290 iso_pu_bacteria 2968171901 2968177256 375
1291 iso_pu_bacteria 2970019648 2970023502 375
1292 iso_pu_bacteria 2970033650 2970040202 375
1293 iso_pu_bacteria 2970040964 2970045869 375
1294 iso_pu_bacteria 2970047711 2970053957 375
1295 iso_pu_bacteria 2970054988 2970059276 375
1296 iso_pu_bacteria 2970061556 2970065667 375
1297 iso_pu_bacteria 2970068827 2970075500 375
1298 iso_pu_bacteria 2970076120 2970080184 375
1299 iso_pu_bacteria 2970082768 2970087790 375
1300 iso_pu_bacteria 2970088815 2970093211 375
1301 iso_pu_bacteria 2970095765 2970100062 375
1302 iso_pu_bacteria 2970102677 2970108085 375
1303 iso_pu_bacteria 2970109326 2970113877 375
1304 iso_pu_bacteria 2970116247 2970120500 375
1305 iso_pu_bacteria 2970129317 2970133193 375
1306 iso_pu_bacteria 2970136068 2970140450 375
1307 iso_pu_bacteria 2970149975 2970155958 375
1308 iso_pu_bacteria 2970156795 2970161101 375
1309 iso_pu_bacteria 2970164137 2970168486 375
1310 iso_pu_bacteria 2970170962 2970171572 375
1311 iso_pu_bacteria 2970177841 2970182903 375
1312 iso_pu_bacteria 2970184632 2970188688 375
1313 iso_pu_bacteria 2970191845 2970196374 375
1314 iso_pu_bacteria 2970524798 2970528739 375
1315 iso_pu_bacteria 2970540015 2970545536 375
1316 iso_pu_bacteria 2970554993 2970560102 375
1317 iso_pu_bacteria 2977516862 2977522521 375
1318 iso_pu_bacteria 2977523885 2977526241 375
1319 iso_pu_bacteria 2977537788 2977542029 375
1320 iso_pu_bacteria 2977551784 2977558344 375
1321 iso_pu_bacteria 2977558990 2977562671 375
1322 iso_pu_bacteria 2977565890 2977570280 375
1323 iso_pu_bacteria 2977572785 2977577081 375
1324 iso_pu_bacteria 2977579622 2977583568 375
1325 iso_pu_bacteria 2977843712 2977846101 375
1326 iso_pu_bacteria 2977922695 2977924365 375
1327 iso_pu_bacteria 2977942078 2977945472 375
1328 iso_pu_bacteria 2987636660 2987638210 375
1329 iso_pu_bacteria 2987659509 2987664893 375
1330 iso_pu_bacteria 2987666974 2987669107 375
1331 iso_pu_bacteria 2989771324 2989774204 375
1332 iso_pu_bacteria 2996310559 2996313953 375
1333 iso_pu_bacteria 3004203850 3004205546 375
1334 iso_pu_bacteria 3004211236 3004216099 375
1335 iso_pu_bacteria 3004218560 3004223849 375
1336 iso_pu_bacteria 648276728 648740485 375
1337 iso_pu_bacteria 8002285264 8002288938 375
1338 iso_pu_bacteria 8003992118 8003994075 375
1339 iso_pu_bacteria 8004387939 8004393514 375
1340 iso_pu_bacteria 8004395343 8004400982 375
1341 iso_pu_bacteria 8004714634 8004720282 375
1342 iso_pu_bacteria 8049293176 8049295239 375
1343 iso_pu_bacteria 8054558443 8054560753 375
1344 iso_pu_bacteria 8055617313 8055620908 375

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13538

UvrD_C_2

UvrD-like helicase C-terminal domain

405

453

0.91

PF13604

AAA_30

AAA domain

81

285

0.85

PF13245

AAA_19

AAA domain

90

232

0.79

PF05970

PIF1

PIF1-like helicase

81

265

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e1s-assembly1.cif.gz_A structure of an n-terminal truncation of deinococcus radiodurans recd2 0.7701 3 374
3gp8-assembly1.cif.gz_A crystal structure of the binary complex of recd2 with dna 0.7503 3 374
8jx6-assembly1.cif.gz_A deep-sea helicase 9 (dsh9) 0.7437 4 374
3er0-assembly2.cif.gz_B crystal structure of the full length eif5a from saccharomyces cerevisiae 0.7373 242 303
8jx6-assembly2.cif.gz_B deep-sea helicase 9 (dsh9) 0.7349 3 374
ID Description Score Start End Superfamily
af_F1LX81_770_884_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8985 329 375 3.40.50.300
3k70G03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7839 327 374 3.40.50.300
af_P04993_474_593_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7611 241 375 3.40.50.300
af_Q0DRG6_235_426_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7519 328 375 3.40.50.300
3e1sA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7494 3 170 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A529Q9I4-F1-model_v4 ATP-binding protein 0.9906 190 372 GO:0005524
AF-A0A3S0F363-F1-model_v4 ATP-binding protein 0.9878 1 375 GO:0005524
AF-A0A4R3NPT5-F1-model_v4 Exodeoxyribonuclease-5 0.9877 1 375 GO:0005524
AF-A0A5B8L0P3-F1-model_v4 AAA family ATPase 0.9873 1 375 GO:0005524
AF-A0A1W6KNT5-F1-model_v4 P-loop NTPase domain-containing protein 0.9869 1 375 GO:0005524

Feature Viewer

pLDDT pTM Quality
89.77 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map