F493181
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1344 | 1052 | 545 | 380 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2513237088|2513596396 |
| Length | 454 |
| Sequence | SSLRTIRCADTQHRTACTITFDLSRPAAPLADCAIAELAIDPTRGLETREASAQFPCDPQFGRIFRVAYVRRILPSRSTMQFAPQQDEALKAVSKWLKEGRSPLFRLFGYAGTGKTTLARHFAEHVDGEVLFAAFTGKAAQVLRSRGASNAKTIHSLIYRPRGEEAVEDEETGKTSIAPMFTINRQSPVAKAALIIVDECSMVDEALGKDLMSFGTPILVLGDPGQLPPVSGGGYFTNQEPDYLLTDIHRQARDNPIIKLAMQVREGNEIMYGDYGAAQVISKNEVNQSLVLDADQVLVGTNRTRRRYNQRLRELKGFTAEYPQTGDKLVCLRNDPAKGLLNGSLWQVMTSSRETTKPGINLLIRPEDDDMDRGAAKIKLLKQAFEDVEGEIPWNTRKRYDEFDYGYALTVHKAQGSQWNNVVLFDESWAFRDTRERWLYTAITRAAETLTIVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 4 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 5 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 6 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 7 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 8 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 9 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 10 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 11 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 12 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 13 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 14 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 15 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 16 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 17 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 18 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 19 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 20 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 21 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 22 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 23 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 24 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 25 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 26 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 27 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 28 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 29 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 30 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 31 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 32 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 33 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 34 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 35 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 36 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 37 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 38 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 39 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 40 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 41 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 42 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 43 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 44 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 45 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 46 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 47 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 48 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 49 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 50 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 51 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 52 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 53 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 54 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 55 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 56 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 57 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 58 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 59 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 60 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 61 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 62 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 63 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 64 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 65 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 66 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 67 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 68 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 69 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 70 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 71 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 72 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 73 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 74 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 75 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 76 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 77 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 78 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 79 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 80 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 81 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 82 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 83 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 84 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 85 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 86 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 87 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 88 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 89 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 90 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 91 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 92 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 93 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 94 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 95 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 96 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 97 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 98 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 99 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 100 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 101 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 102 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 103 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 104 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 105 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 106 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 107 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 108 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 109 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 110 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 111 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 112 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 113 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 114 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 115 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 116 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 117 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 118 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 119 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 120 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 121 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 122 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 123 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 124 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 125 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 126 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 127 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 128 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 129 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 130 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 131 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 132 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 133 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 134 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 135 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 136 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 137 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 138 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 139 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 140 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 141 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 142 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 143 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 144 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 145 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 146 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 147 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 148 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 149 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 150 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 151 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 152 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 153 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 154 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 155 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 156 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 157 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 158 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 159 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 160 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 161 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 162 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 163 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 164 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 165 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 166 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 167 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 168 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 169 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 170 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 171 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 172 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 173 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 174 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 175 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 176 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 177 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 178 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 179 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 180 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 181 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 182 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 183 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 184 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 185 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 186 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 187 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 188 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 189 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 190 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 191 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 192 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 193 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 194 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 195 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 196 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 197 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 198 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 199 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 200 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 201 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 202 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 203 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 204 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 205 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 206 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 207 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 208 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 209 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 210 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 211 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 212 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 213 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 214 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 215 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 216 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 217 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 218 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 219 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 220 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 221 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 222 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 223 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 224 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 225 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 226 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 227 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 228 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 229 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 230 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 231 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 232 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 233 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 234 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 235 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 236 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 237 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 238 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 239 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 240 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 241 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 242 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 243 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 244 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 245 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 246 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 247 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 248 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 249 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 250 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 251 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 252 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 253 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 254 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 255 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 256 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 257 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 258 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 259 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 260 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 261 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 262 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 263 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 264 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 265 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 266 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 267 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 268 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 269 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 270 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 271 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 272 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 273 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 274 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 275 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 276 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 277 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 278 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 279 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 280 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 281 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 282 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 283 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 284 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 285 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 286 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 287 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 288 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 289 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 290 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 291 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 292 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 293 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 294 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 295 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 296 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 297 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 298 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 299 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 300 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 301 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 302 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 303 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 304 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 305 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 306 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 307 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 308 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 309 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 310 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 311 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 312 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 313 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 314 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 315 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 316 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 317 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 318 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 319 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 320 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 321 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 322 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 323 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 324 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 325 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 326 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 327 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 328 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 329 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 330 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 331 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 332 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 333 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 334 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 335 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 336 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 337 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 338 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 339 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 340 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 341 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 342 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 343 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 344 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 345 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 346 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 347 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 348 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 349 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 350 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 351 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 352 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 353 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 354 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 355 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 356 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 357 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 358 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 359 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 360 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 361 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 362 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 363 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 364 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 365 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 366 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 367 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 368 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 369 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 370 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 371 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 372 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 373 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 374 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 375 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 376 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 377 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 378 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 379 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 380 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 381 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 382 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 383 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 384 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 385 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 386 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 387 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 388 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 389 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 390 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 391 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 392 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 393 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 394 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 395 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 396 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 397 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 398 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 399 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 400 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 401 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 402 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 403 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 404 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 405 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 406 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 407 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 408 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 409 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 410 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 411 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 412 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 413 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 414 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 415 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 416 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 417 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 418 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 419 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 420 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 421 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 422 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 423 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 424 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 425 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 426 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 427 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 428 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 429 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 430 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 431 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 432 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 433 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 434 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 435 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 436 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 437 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 438 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 439 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 440 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 441 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 442 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 443 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 444 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 445 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 446 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 447 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 448 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 449 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 450 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 451 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 452 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 453 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 454 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 455 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 456 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 457 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 458 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 459 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 460 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 461 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 462 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 463 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 464 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 465 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 466 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 467 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 468 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 469 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 470 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 471 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 472 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 473 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 474 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 475 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 476 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 477 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 478 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 479 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 480 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 481 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 482 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 483 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 484 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 485 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 486 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 487 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 488 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 489 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 490 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 491 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 492 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 493 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 494 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 495 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 496 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 497 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 498 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 499 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 500 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 501 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 502 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 503 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 504 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 505 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 506 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 507 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 508 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 509 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 510 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 511 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 512 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 513 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 514 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 515 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 516 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 517 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 518 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 519 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 520 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 521 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 522 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 523 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 524 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 525 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 526 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 527 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 528 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 529 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 530 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 531 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 532 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 533 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 534 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 535 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 536 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 537 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 538 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 539 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 540 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 541 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 542 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 543 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 544 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 545 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 546 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 547 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 548 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 549 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 550 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 551 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 552 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 553 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 554 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 555 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 556 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 557 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 558 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 559 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 560 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 561 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 562 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 563 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 564 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 565 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 566 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 567 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 568 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 569 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 570 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 571 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 572 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 573 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 574 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 575 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 576 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 577 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 578 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 579 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 580 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 581 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 582 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 583 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 584 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 585 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 586 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 587 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 588 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 589 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 590 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 591 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 592 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 593 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 594 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 595 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 596 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 597 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 598 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 599 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 600 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 601 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 602 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 603 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 604 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 605 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 606 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 607 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 608 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 609 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 610 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 611 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 612 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 613 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 614 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 615 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 616 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 617 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 618 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 619 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 620 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 621 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 622 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 623 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 624 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 625 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 626 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 627 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 628 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 629 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 630 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 631 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 632 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 633 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 634 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 635 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 636 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 637 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 638 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 639 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 640 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 641 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 642 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 643 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 644 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 645 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 646 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 647 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 648 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 649 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 650 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 651 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 652 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 653 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 654 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 655 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 656 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 657 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 658 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 659 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 660 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 661 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 662 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 663 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 664 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 665 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 666 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 667 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 668 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 669 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 670 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 671 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 672 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 673 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 674 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 675 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 676 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 677 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 678 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 679 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 680 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 681 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 682 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 683 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 684 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 685 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 686 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 687 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 688 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 689 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 690 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 691 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 692 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 693 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 694 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 695 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 696 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 697 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 698 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 699 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 700 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 701 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 702 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 703 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 704 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 705 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 706 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 707 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 708 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 709 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 710 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 711 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 712 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 713 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 714 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 715 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 716 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 717 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 718 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 719 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 720 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 721 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 722 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 723 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 724 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 725 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 726 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 727 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 728 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 729 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 730 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 731 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 732 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 733 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 734 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 735 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 736 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 737 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 738 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 739 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 740 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 741 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 742 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 743 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 744 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 745 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 746 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 747 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 748 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 749 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 750 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 751 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 752 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 753 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 754 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 755 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 756 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 757 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 758 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 759 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 760 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 761 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 762 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 763 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 764 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 765 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 766 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 767 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 768 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 769 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 770 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 771 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 772 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 773 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 774 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 775 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 776 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 777 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 778 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 779 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 780 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 781 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 782 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 783 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 784 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 785 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 786 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 787 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 788 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 789 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 790 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 791 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 792 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 793 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 794 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 795 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 796 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 797 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 798 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 799 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 800 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 801 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 802 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 803 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 804 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 805 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 806 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 807 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 808 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 809 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 810 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 811 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 812 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 813 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 814 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 815 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 816 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 817 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 818 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 819 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 820 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 821 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 822 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 823 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 824 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 825 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 826 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 827 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 828 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 829 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 830 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 831 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 832 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 833 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 834 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 835 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 836 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 837 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 838 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 839 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 840 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 841 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 842 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 843 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 844 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 845 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 846 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 847 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 848 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 849 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 850 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 851 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 852 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 853 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 854 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 855 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 856 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 857 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 858 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 859 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 860 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 861 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 862 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 863 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 864 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 865 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 866 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 867 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 868 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 869 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 870 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 871 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 872 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 873 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 874 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 875 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 876 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 877 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 878 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 879 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 880 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 881 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 882 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 883 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 884 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 885 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 886 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 887 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 888 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 889 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 890 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 891 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 892 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 893 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 894 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 895 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 896 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 897 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 898 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 899 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 900 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 901 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 902 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 903 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 904 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 905 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 906 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 907 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 908 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 909 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 910 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 911 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 912 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 913 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 914 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 915 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 916 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 917 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 918 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 919 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 920 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 921 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 922 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 923 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 924 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 925 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 926 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 927 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 928 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 929 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 930 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 931 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 932 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 933 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 934 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 935 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 936 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 937 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 938 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 939 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 940 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 941 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 942 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 943 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 944 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 945 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 946 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 947 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 948 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 949 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 950 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 951 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 952 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 953 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 954 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 955 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 956 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 957 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 958 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 959 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 960 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 961 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 962 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 963 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 964 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 965 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 966 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 967 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 968 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 969 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 970 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 971 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 972 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 973 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 974 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 975 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 976 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 977 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 978 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 979 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 980 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 981 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 982 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 983 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 984 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 985 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 986 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 987 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 988 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 989 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 990 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 991 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 992 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 993 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 994 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 995 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 996 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 997 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 998 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 999 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 1000 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 1001 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 1002 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 1003 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 1004 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 1005 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 1006 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 1007 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 1008 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1009 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1010 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1011 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1012 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1013 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1014 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1015 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1016 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1017 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1018 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1019 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1020 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1021 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 1022 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1023 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 1024 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1025 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1026 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1027 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1028 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1029 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 1030 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1031 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 1032 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1033 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1034 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1035 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 1036 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1037 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1038 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1039 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1040 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 1041 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1042 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 1043 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 1044 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1045 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 1046 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 1047 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 1048 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1049 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1050 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 1051 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 1052 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 40.48 |
| Metatranscriptomes | 0.07 |
| Isolates | 59.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.37 |
| Bulb | 0 |
| Endosphere | 13.84 |
| Nodule | 45.91 |
| Rhizoplane | 1.71 |
| Rhizosphere | 22.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10031325 | 3300001979 | Bacteria | 1717 |
| 2 | JGI25155J39150_1000001 | 3300002704 | Bacteria | 354543 |
| 3 | JGI25156J39149_1000001 | 3300002705 | Bacteria | 354557 |
| 4 | JGI25162J39368_1000380 | 3300002737 | Bacteria | 37780 |
| 5 | JGI25162J39368_1000534 | 3300002737 | Bacteria | 28340 |
| 6 | JGI25154J39366_1000011 | 3300002738 | Bacteria | 296007 |
| 7 | JGI25158J39367_1000129 | 3300002739 | Bacteria | 17721 |
| 8 | JGI25157J39369_1000079 | 3300002741 | Bacteria | 86111 |
| 9 | JGI25157J39369_1000237 | 3300002741 | Bacteria | 42496 |
| 10 | JGI25152J39213_1000826 | 3300002773 | Bacteria | 15432 |
| 11 | JGI25152J39213_1003179 | 3300002773 | Bacteria | 5718 |
| 12 | JGI25152J39213_1007411 | 3300002773 | Bacteria | 2844 |
| 13 | JGI25150J39212_1000165 | 3300002774 | Bacteria | 37364 |
| 14 | JGI25150J39212_1000307 | 3300002774 | Bacteria | 24463 |
| 15 | JGI25150J39212_1007748 | 3300002774 | Bacteria | 2141 |
| 16 | JGI25159J45721_1000040 | 3300002987 | Bacteria | 68143 |
| 17 | JGI25159J45721_1000613 | 3300002987 | Bacteria | 15891 |
| 18 | JGI25159J45721_1001660 | 3300002987 | Bacteria | 9022 |
| 19 | JGI25151J46595_10000329 | 3300003187 | Bacteria | 51364 |
| 20 | JGI25151J46595_10011722 | 3300003187 | Bacteria | 4017 |
| 21 | JGI25151J46595_10027067 | 3300003187 | Bacteria | 2305 |
| 22 | JGI25165J46597_1000015 | 3300003214 | Bacteria | 380891 |
| 23 | JGI25165J46597_1000422 | 3300003214 | Bacteria | 43957 |
| 24 | JGI25165J46597_1001018 | 3300003214 | Bacteria | 18487 |
| 25 | JGI25165J46597_1002237 | 3300003214 | Bacteria | 6736 |
| 26 | JGI25165J46597_1004651 | 3300003214 | Bacteria | 2873 |
| 27 | JGI25153J46596_10001789 | 3300003215 | Bacteria | 12751 |
| 28 | JGI25153J46596_10003058 | 3300003215 | Bacteria | 9445 |
| 29 | JGI25153J46596_10003631 | 3300003215 | Bacteria | 8560 |
| 30 | rootL2_10016257 | 3300003322 | Bacteria | 18880 |
| 31 | rootL2_10035682 | 3300003322 | Bacteria | 24737 |
| 32 | JGI25160J50197_1000001 | 3300003354 | Bacteria | 782301 |
| 33 | JGI25160J50197_1000128 | 3300003354 | Bacteria | 68143 |
| 34 | JGI25160J50197_1000397 | 3300003354 | Bacteria | 28201 |
| 35 | JGI25161J50226_1000001 | 3300003374 | Bacteria | 655036 |
| 36 | JGI25161J50226_1000099 | 3300003374 | Bacteria | 70186 |
| 37 | JGI25161J50226_1000140 | 3300003374 | Bacteria | 50175 |
| 38 | JGI25161J50226_1000921 | 3300003374 | Bacteria | 10544 |
| 39 | Ga0006562J51391_1019610 | 3300003578 | Bacteria | 2300 |
| 40 | Ga0055542_1000519 | 3300003762 | Bacteria | 34751 |
| 41 | Ga0055529_1002792 | 3300003763 | Bacteria | 3165 |
| 42 | Ga0055526_1000484 | 3300003771 | Bacteria | 31547 |
| 43 | Ga0055526_1009798 | 3300003771 | Bacteria | 4553 |
| 44 | Ga0055526_1010515 | 3300003771 | Bacteria | 4291 |
| 45 | Ga0055526_1013767 | 3300003771 | Bacteria | 3390 |
| 46 | Ga0055524_1001085 | 3300003775 | Bacteria | 16634 |
| 47 | Ga0055524_1003087 | 3300003775 | Bacteria | 8223 |
| 48 | Ga0055524_1007173 | 3300003775 | Bacteria | 4769 |
| 49 | Ga0055524_1019611 | 3300003775 | Bacteria | 2305 |
| 50 | Ga0055524_1028804 | 3300003775 | Bacteria | 1657 |
| 51 | Ga0055536_1006588 | 3300003781 | Bacteria | 5373 |
| 52 | Ga0055528_1000962 | 3300003790 | Bacteria | 19094 |
| 53 | Ga0055528_1001865 | 3300003790 | Bacteria | 12000 |
| 54 | Ga0055528_1002431 | 3300003790 | Bacteria | 9980 |
| 55 | Ga0055528_1012566 | 3300003790 | Bacteria | 3277 |
| 56 | Ga0055540_1000283 | 3300003792 | Bacteria | 45546 |
| 57 | Ga0055540_1001971 | 3300003792 | Bacteria | 11472 |
| 58 | Ga0055540_1002778 | 3300003792 | Bacteria | 8963 |
| 59 | Ga0055540_1028922 | 3300003792 | Bacteria | 1304 |
| 60 | Ga0058692_1001129 | 3300003856 | Bacteria | 10338 |
| 61 | Ga0058692_1003154 | 3300003856 | Bacteria | 5224 |
| 62 | Ga0055543_1000003 | 3300004625 | Bacteria | 358656 |
| 63 | Ga0055543_1000128 | 3300004625 | Bacteria | 63029 |
| 64 | Ga0055543_1000130 | 3300004625 | Bacteria | 62045 |
| 65 | Ga0055543_1000438 | 3300004625 | Bacteria | 25752 |
| 66 | Ga0065165_1000013 | 3300005262 | Bacteria | 301887 |
| 67 | Ga0065165_1000068 | 3300005262 | Bacteria | 170609 |
| 68 | Ga0065165_1003952 | 3300005262 | Bacteria | 9730 |
| 69 | Ga0065165_1007614 | 3300005262 | Bacteria | 5273 |
| 70 | Ga0065165_1011139 | 3300005262 | Bacteria | 3793 |
| 71 | Ga0065165_1015958 | 3300005262 | Bacteria | 2837 |
| 72 | Ga0070670_100004125 | 3300005331 | Bacteria | 12142 |
| 73 | Ga0070660_100016320 | 3300005339 | Bacteria | 5388 |
| 74 | Ga0070668_100016609 | 3300005347 | Bacteria | 5502 |
| 75 | Ga0070669_100079852 | 3300005353 | Bacteria | 2434 |
| 76 | Ga0070663_100020865 | 3300005455 | Bacteria | 4345 |
| 77 | Ga0070681_10164431 | 3300005458 | Bacteria | 2142 |
| 78 | Ga0068867_100134879 | 3300005459 | Bacteria | 1923 |
| 79 | Ga0068853_100013344 | 3300005539 | Bacteria | 6708 |
| 80 | Ga0070665_100062656 | 3300005548 | Bacteria | 3728 |
| 81 | Ga0070665_100143222 | 3300005548 | Bacteria | 2393 |
| 82 | Ga0070665_100209938 | 3300005548 | Bacteria | 1948 |
| 83 | Ga0068855_100080060 | 3300005563 | Bacteria | 3788 |
| 84 | Ga0068856_100000396 | 3300005614 | Bacteria | 47717 |
| 85 | Ga0068856_100025945 | 3300005614 | Bacteria | 5715 |
| 86 | Ga0068856_100097085 | 3300005614 | Bacteria | 2935 |
| 87 | Ga0068858_100231704 | 3300005842 | Bacteria | 1751 |
| 88 | Ga0081540_1032190 | 3300005983 | Bacteria | 2868 |
| 89 | Ga0081539_10009861 | 3300005985 | Bacteria | 7879 |
| 90 | Ga0075365_10003238 | 3300006038 | Bacteria | 8336 |
| 91 | Ga0075365_10005895 | 3300006038 | Bacteria | 6670 |
| 92 | Ga0075365_10022146 | 3300006038 | Bacteria | 3977 |
| 93 | Ga0075365_10024459 | 3300006038 | Bacteria | 3811 |
| 94 | Ga0075365_10035692 | 3300006038 | Bacteria | 3218 |
| 95 | Ga0075365_10091646 | 3300006038 | Bacteria | 2071 |
| 96 | Ga0075363_100040032 | 3300006048 | Bacteria | 2469 |
| 97 | Ga0075364_10000201 | 3300006051 | Bacteria | 27803 |
| 98 | Ga0075364_10020218 | 3300006051 | Bacteria | 4187 |
| 99 | Ga0075364_10061726 | 3300006051 | Bacteria | 2459 |
| 100 | Ga0075364_10152495 | 3300006051 | Bacteria | 1558 |
| 101 | Ga0075367_10015244 | 3300006178 | Bacteria | 4172 |
| 102 | Ga0075367_10023023 | 3300006178 | Bacteria | 3501 |
| 103 | Ga0075367_10043918 | 3300006178 | Bacteria | 2618 |
| 104 | Ga0075369_10000132 | 3300006186 | Bacteria | 20799 |
| 105 | Ga0075369_10001343 | 3300006186 | Bacteria | 8357 |
| 106 | Ga0075369_10004049 | 3300006186 | Bacteria | 5386 |
| 107 | Ga0075369_10014342 | 3300006186 | Bacteria | 3164 |
| 108 | Ga0075366_10008456 | 3300006195 | Bacteria | 5724 |
| 109 | Ga0075366_10039554 | 3300006195 | Bacteria | 2788 |
| 110 | Ga0075370_10011704 | 3300006353 | Bacteria | 4618 |
| 111 | Ga0075370_10130222 | 3300006353 | Bacteria | 1468 |
| 112 | Ga0068865_100241105 | 3300006881 | Bacteria | 1423 |
| 113 | Ga0079104_1000193 | 3300006946 | Bacteria | 85489 |
| 114 | Ga0079104_1005344 | 3300006946 | Bacteria | 5157 |
| 115 | Ga0099826_10001077 | 3300006948 | Bacteria | 15493 |
| 116 | Ga0099826_10001302 | 3300006948 | Bacteria | 14710 |
| 117 | Ga0105244_10094727 | 3300009036 | Bacteria | 1465 |
| 118 | Ga0105250_10063915 | 3300009092 | Bacteria | 1482 |
| 119 | Ga0105240_10000076 | 3300009093 | Bacteria | 198848 |
| 120 | Ga0105243_10010781 | 3300009148 | Bacteria | 6918 |
| 121 | Ga0105243_10136372 | 3300009148 | Bacteria | 2088 |
| 122 | Ga0105241_10047868 | 3300009174 | Bacteria | 3252 |
| 123 | Ga0105248_10258531 | 3300009177 | Bacteria | 1960 |
| 124 | Ga0105237_10011962 | 3300009545 | Bacteria | 9171 |
| 125 | Ga0105237_10099343 | 3300009545 | Bacteria | 2902 |
| 126 | Ga0105238_10005101 | 3300009551 | Bacteria | 12985 |
| 127 | Ga0123341_1000032 | 3300009765 | Bacteria | 62527 |
| 128 | Ga0123342_1005565 | 3300009766 | Bacteria | 18132 |
| 129 | Ga0123342_1027673 | 3300009766 | Bacteria | 3145 |
| 130 | Ga0105239_10016340 | 3300010375 | Bacteria | 8208 |
| 131 | Ga0105239_10170562 | 3300010375 | Bacteria | 2433 |
| 132 | Ga0105239_10178087 | 3300010375 | Bacteria | 2378 |
| 133 | Ga0157318_1000561 | 3300012482 | Unclassified | 1629 |
| 134 | Ga0157373_10050627 | 3300013100 | Bacteria | 2958 |
| 135 | Ga0157371_10000908 | 3300013102 | Bacteria | 33346 |
| 136 | Ga0157371_10053052 | 3300013102 | Bacteria | 2879 |
| 137 | Ga0157370_10000282 | 3300013104 | Bacteria | 64601 |
| 138 | Ga0157370_10000351 | 3300013104 | Bacteria | 58496 |
| 139 | Ga0157369_10068419 | 3300013105 | Bacteria | 3815 |
| 140 | Ga0171463_1003 | 3300013249 | Bacteria | 695693 |
| 141 | Ga0157378_10112084 | 3300013297 | Bacteria | 2502 |
| 142 | Ga0157372_10410434 | 3300013307 | Bacteria | 1578 |
| 143 | Ga0182007_10005359 | 3300015262 | Bacteria | 5651 |
| 144 | Ga0182005_1005134 | 3300015265 | Bacteria | 4124 |
| 145 | Ga0183363_1104 | 3300015690 | Bacteria | 24110 |
| 146 | Ga0214544_1000161 | 3300021320 | Bacteria | 101808 |
| 147 | Ga0214542_1000012 | 3300021321 | Bacteria | 235800 |
| 148 | Ga0214542_1022883 | 3300021321 | Bacteria | 3887 |
| 149 | Ga0214543_1000024 | 3300021327 | Bacteria | 235745 |
| 150 | Ga0214543_1000038 | 3300021327 | Bacteria | 182106 |
| 151 | Ga0228711_1000008 | 3300022739 | Bacteria | 169893 |
| 152 | Ga0228710_1000009 | 3300022740 | Bacteria | 169770 |
| 153 | Ga0209435_100012 | 3300025206 | Bacteria | 401621 |
| 154 | Ga0209436_100029 | 3300025208 | Bacteria | 85964 |
| 155 | Ga0209436_100478 | 3300025208 | Bacteria | 17685 |
| 156 | Ga0209436_103096 | 3300025208 | Bacteria | 4583 |
| 157 | Ga0209672_106122 | 3300025228 | Bacteria | 1989 |
| 158 | Ga0209437_100047 | 3300025233 | Bacteria | 405163 |
| 159 | Ga0209437_100242 | 3300025233 | Bacteria | 89060 |
| 160 | Ga0207425_1000024 | 3300025245 | Bacteria | 328978 |
| 161 | Ga0207425_1012717 | 3300025245 | Bacteria | 1963 |
| 162 | Ga0209646_1000026 | 3300025246 | Bacteria | 401621 |
| 163 | Ga0209026_1000014 | 3300025250 | Bacteria | 401621 |
| 164 | Ga0209026_1000025 | 3300025250 | Bacteria | 352548 |
| 165 | Ga0209677_102528 | 3300025253 | Bacteria | 6783 |
| 166 | Ga0209148_1000128 | 3300025254 | Bacteria | 179154 |
| 167 | Ga0209759_1000012 | 3300025256 | Bacteria | 401621 |
| 168 | Ga0209759_1000057 | 3300025256 | Bacteria | 205181 |
| 169 | Ga0209129_1000146 | 3300025258 | Bacteria | 115180 |
| 170 | Ga0209129_1000161 | 3300025258 | Bacteria | 102017 |
| 171 | Ga0209129_1000384 | 3300025258 | Bacteria | 35556 |
| 172 | Ga0209129_1005814 | 3300025258 | Bacteria | 4207 |
| 173 | Ga0209233_1000010 | 3300025261 | Bacteria | 1194329 |
| 174 | Ga0209233_1000048 | 3300025261 | Bacteria | 453669 |
| 175 | Ga0209233_1000069 | 3300025261 | Bacteria | 367639 |
| 176 | Ga0209233_1000260 | 3300025261 | Bacteria | 79607 |
| 177 | Ga0209233_1011159 | 3300025261 | Bacteria | 2656 |
| 178 | Ga0209455_1000492 | 3300025272 | Bacteria | 28972 |
| 179 | Ga0209673_1000010 | 3300025273 | Bacteria | 596656 |
| 180 | Ga0209673_1000384 | 3300025273 | Bacteria | 79540 |
| 181 | Ga0209673_1000977 | 3300025273 | Bacteria | 35281 |
| 182 | Ga0209673_1001611 | 3300025273 | Bacteria | 19722 |
| 183 | Ga0209673_1004894 | 3300025273 | Bacteria | 6978 |
| 184 | Ga0209673_1008652 | 3300025273 | Bacteria | 4507 |
| 185 | Ga0209673_1020948 | 3300025273 | Bacteria | 2299 |
| 186 | Ga0209130_1000003 | 3300025284 | Bacteria | 677988 |
| 187 | Ga0209130_1000020 | 3300025284 | Bacteria | 379297 |
| 188 | Ga0209130_1000034 | 3300025284 | Bacteria | 302439 |
| 189 | Ga0209676_1014384 | 3300025292 | Bacteria | 2978 |
| 190 | Ga0209025_1000050 | 3300025294 | Bacteria | 331531 |
| 191 | Ga0209025_1000058 | 3300025294 | Bacteria | 311398 |
| 192 | Ga0209025_1000140 | 3300025294 | Bacteria | 184765 |
| 193 | Ga0209025_1000216 | 3300025294 | Bacteria | 138307 |
| 194 | Ga0209025_1000405 | 3300025294 | Bacteria | 87670 |
| 195 | Ga0209025_1006154 | 3300025294 | Bacteria | 9440 |
| 196 | Ga0209564_1000013 | 3300025295 | Bacteria | 775755 |
| 197 | Ga0209564_1000388 | 3300025295 | Bacteria | 79331 |
| 198 | Ga0209564_1000512 | 3300025295 | Bacteria | 63708 |
| 199 | Ga0209564_1001530 | 3300025295 | Bacteria | 22948 |
| 200 | Ga0209564_1006762 | 3300025295 | Bacteria | 6081 |
| 201 | Ga0209564_1011654 | 3300025295 | Bacteria | 3915 |
| 202 | Ga0209758_1000083 | 3300025297 | Bacteria | 257283 |
| 203 | Ga0209758_1000642 | 3300025297 | Bacteria | 53219 |
| 204 | Ga0209758_1002719 | 3300025297 | Bacteria | 17418 |
| 205 | Ga0209758_1003069 | 3300025297 | Bacteria | 15878 |
| 206 | Ga0209758_1003364 | 3300025297 | Bacteria | 14653 |
| 207 | Ga0209758_1018176 | 3300025297 | Bacteria | 3461 |
| 208 | Ga0209050_1002400 | 3300025298 | Bacteria | 16206 |
| 209 | Ga0209050_1004042 | 3300025298 | Bacteria | 10298 |
| 210 | Ga0209050_1010948 | 3300025298 | Bacteria | 4383 |
| 211 | Ga0209256_1000442 | 3300025299 | Bacteria | 63395 |
| 212 | Ga0209256_1000738 | 3300025299 | Bacteria | 42913 |
| 213 | Ga0209256_1001584 | 3300025299 | Bacteria | 22294 |
| 214 | Ga0209256_1004887 | 3300025299 | Bacteria | 8069 |
| 215 | Ga0209256_1006190 | 3300025299 | Bacteria | 6454 |
| 216 | Ga0209256_1020856 | 3300025299 | Bacteria | 2031 |
| 217 | Ga0207426_1000006 | 3300025302 | Bacteria | 1025969 |
| 218 | Ga0207426_1000008 | 3300025302 | Bacteria | 848730 |
| 219 | Ga0207426_1000011 | 3300025302 | Bacteria | 791203 |
| 220 | Ga0207426_1000221 | 3300025302 | Bacteria | 134756 |
| 221 | Ga0207426_1002076 | 3300025302 | Bacteria | 13895 |
| 222 | Ga0209051_1000308 | 3300025303 | Bacteria | 76477 |
| 223 | Ga0209051_1008939 | 3300025303 | Bacteria | 5231 |
| 224 | Ga0209051_1011377 | 3300025303 | Bacteria | 4398 |
| 225 | Ga0209051_1024303 | 3300025303 | Bacteria | 2494 |
| 226 | Ga0209051_1029576 | 3300025303 | Bacteria | 2141 |
| 227 | Ga0209051_1030731 | 3300025303 | Bacteria | 2079 |
| 228 | Ga0209257_1000853 | 3300025304 | Bacteria | 43617 |
| 229 | Ga0209257_1019949 | 3300025304 | Bacteria | 2500 |
| 230 | Ga0209257_1027599 | 3300025304 | Bacteria | 1888 |
| 231 | Ga0207654_10019351 | 3300025911 | Bacteria | 3593 |
| 232 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 233 | Ga0207695_10179849 | 3300025913 | Bacteria | 2036 |
| 234 | Ga0207671_10000093 | 3300025914 | Bacteria | 138939 |
| 235 | Ga0207657_10000483 | 3300025919 | Bacteria | 42060 |
| 236 | Ga0207681_10030629 | 3300025923 | Bacteria | 3509 |
| 237 | Ga0207694_10023427 | 3300025924 | Viruses | 4686 |
| 238 | Ga0207650_10012844 | 3300025925 | Bacteria | 5787 |
| 239 | Ga0207704_10223982 | 3300025938 | Bacteria | 1394 |
| 240 | Ga0207667_10006604 | 3300025949 | Bacteria | 14025 |
| 241 | Ga0207668_10007707 | 3300025972 | Bacteria | 6405 |
| 242 | Ga0207639_10028714 | 3300026041 | Bacteria | 4064 |
| 243 | Ga0207678_10254862 | 3300026067 | Bacteria | 1503 |
| 244 | Ga0207702_10000423 | 3300026078 | Bacteria | 48508 |
| 245 | Ga0207702_10018061 | 3300026078 | Bacteria | 5835 |
| 246 | Ga0207648_10107359 | 3300026089 | Bacteria | 2450 |
| 247 | Ga0209281_1000034 | 3300027111 | Bacteria | 382562 |
| 248 | Ga0209281_1000106 | 3300027111 | Bacteria | 219666 |
| 249 | Ga0209281_1000426 | 3300027111 | Bacteria | 62651 |
| 250 | Ga0209371_1000022 | 3300027312 | Bacteria | 536342 |
| 251 | Ga0209371_1003118 | 3300027312 | Bacteria | 8450 |
| 252 | Ga0209282_1000024 | 3300027666 | Bacteria | 170348 |
| 253 | Ga0209282_1000646 | 3300027666 | Bacteria | 17203 |
| 254 | Ga0268266_10023807 | 3300028379 | Bacteria | 5212 |
| 255 | Ga0268266_10128965 | 3300028379 | Bacteria | 2260 |
| 256 | Ga0268266_10131348 | 3300028379 | Bacteria | 2240 |
| 257 | Ga0268266_10168964 | 3300028379 | Bacteria | 1984 |
| 258 | Ga0265336_10005821 | 3300028666 | Bacteria | 4508 |
| 259 | Ga0307515_10000307 | 3300028794 | Bacteria | 121172 |
| 260 | Ga0307515_10000788 | 3300028794 | Bacteria | 72975 |
| 261 | Ga0307515_10109955 | 3300028794 | Bacteria | 3231 |
| 262 | Ga0268256_1000019 | 3300030500 | Bacteria | 587949 |
| 263 | Ga0268256_1005962 | 3300030500 | Bacteria | 4650 |
| 264 | Ga0265328_10001732 | 3300031239 | Bacteria | 9995 |
| 265 | Ga0307513_10086474 | 3300031456 | Bacteria | 3213 |
| 266 | Ga0316579_10044926 | 3300031691 | Bacteria | 2059 |
| 267 | Ga0307405_10001398 | 3300031731 | Bacteria | 10146 |
| 268 | Ga0307406_10011163 | 3300031901 | Bacteria | 5091 |
| 269 | Ga0307412_10008584 | 3300031911 | Bacteria | 5839 |
| 270 | Ga0315914_1000012 | 3300031967 | Bacteria | 169896 |
| 271 | Ga0307409_100215038 | 3300031995 | Bacteria | 1731 |
| 272 | Ga0307409_100284723 | 3300031995 | Bacteria | 1530 |
| 273 | Ga0315913_1000006 | 3300033430 | Bacteria | 169893 |
| 274 | Ga0315915_1000010 | 3300033464 | Bacteria | 240214 |
| 275 | Ga0373941_0027699 | 3300035115 | Bacteria | 1657 |
| 276 | Ga0373953_0024208 | 3300035117 | Bacteria | 2306 |
| 277 | Ga0373961_0032165 | 3300035241 | Bacteria | 1469 |
| 278 | Ga0373927_0000810 | 3300035695 | Bacteria | 23917 |
| 279 | Ga0373937_0015885 | 3300036401 | Bacteria | 6676 |
| 280 | Ga0316582_0099393 | 3300036647 | Bacteria | 1925 |
| 281 | Ga0373925_0006321 | 3300037068 | Bacteria | 8727 |
| 282 | Ga0373925_0016891 | 3300037068 | Bacteria | 5284 |
| 283 | Ga0395899_0000117 | 3300037312 | Bacteria | 130159 |
| 284 | Ga0395900_0000020 | 3300037418 | Bacteria | 353500 |
| 285 | Ga0395900_0154508 | 3300037418 | Bacteria | 2344 |
| 286 | Ga0395898_0000259 | 3300037466 | Bacteria | 130131 |
| 287 | Ga0395898_0094818 | 3300037466 | Bacteria | 2868 |
| 288 | Ga0395905_0000019 | 3300037471 | Bacteria | 353500 |
| 289 | Ga0395905_0000736 | 3300037471 | Bacteria | 43138 |
| 290 | Ga0395905_0052490 | 3300037471 | Bacteria | 3816 |
| 291 | Ga0395901_0000016 | 3300038443 | Bacteria | 354008 |
| 292 | Ga0395901_0011547 | 3300038443 | Bacteria | 8951 |
| 293 | Ga0400488_06315 | 3300038741 | Bacteria | 1581 |
| 294 | Ga0439465_0033772 | 3300041413 | Bacteria | 1636 |
| 295 | Ga0451791_1138375 | 3300041451 | Bacteria | 1970 |
| 296 | Ga0451800_1271145 | 3300041459 | Unclassified | 1842 |
| 297 | Ga0451833_1236258 | 3300041491 | Bacteria | 1223 |
| 298 | Ga0451835_0039587 | 3300041492 | Bacteria | 1891 |
| 299 | Ga0451845_0826072 | 3300041501 | Bacteria | 4063 |
| 300 | Ga0451849_1373232 | 3300041505 | Bacteria | 2064 |
| 301 | Ga0451843_0297013 | 3300041509 | Bacteria | 3239 |
| 302 | Ga0439432_026057 | 3300042006 | Bacteria | 1915 |
| 303 | Ga0439435_0001675 | 3300042436 | Bacteria | 4171 |
| 304 | Ga0439435_0040162 | 3300042436 | Bacteria | 1306 |
| 305 | Ga0466972_0020643 | 3300044658 | Bacteria | 3291 |
| 306 | Ga0453684_0035183 | 3300044712 | Bacteria | 6928 |
| 307 | Ga0495638_0000195 | 3300046460 | Bacteria | 88030 |
| 308 | Ga0495638_0013713 | 3300046460 | Bacteria | 5506 |
| 309 | Ga0495638_0032072 | 3300046460 | Bacteria | 3370 |
| 310 | Ga0495585_0006794 | 3300046492 | Bacteria | 7061 |
| 311 | Ga0495585_0017651 | 3300046492 | Bacteria | 4120 |
| 312 | Ga0495596_0049578 | 3300046500 | Bacteria | 1646 |
| 313 | Ga0495583_0001630 | 3300046506 | Bacteria | 21886 |
| 314 | Ga0495583_0064007 | 3300046506 | Bacteria | 1633 |
| 315 | Ga0495606_0002164 | 3300046507 | Bacteria | 23646 |
| 316 | Ga0495606_0007242 | 3300046507 | Bacteria | 9996 |
| 317 | Ga0495606_0010798 | 3300046507 | Bacteria | 7526 |
| 318 | Ga0495606_0062004 | 3300046507 | Bacteria | 2389 |
| 319 | Ga0495610_0001253 | 3300046512 | Bacteria | 22804 |
| 320 | Ga0495610_0016243 | 3300046512 | Bacteria | 4295 |
| 321 | Ga0495620_0028851 | 3300046515 | Bacteria | 2575 |
| 322 | Ga0495630_0080599 | 3300046517 | Bacteria | 2456 |
| 323 | Ga0495630_0116728 | 3300046517 | Bacteria | 2023 |
| 324 | Ga0495631_0001628 | 3300046518 | Bacteria | 13398 |
| 325 | Ga0495631_0012959 | 3300046518 | Bacteria | 4060 |
| 326 | Ga0495632_0001015 | 3300046519 | Bacteria | 24284 |
| 327 | Ga0495643_0013532 | 3300046522 | Bacteria | 4877 |
| 328 | Ga0495643_0014825 | 3300046522 | Bacteria | 4628 |
| 329 | Ga0495654_0000254 | 3300046530 | Bacteria | 48831 |
| 330 | Ga0495654_0016736 | 3300046530 | Bacteria | 3867 |
| 331 | Ga0495654_0063661 | 3300046530 | Bacteria | 1765 |
| 332 | Ga0495609_0067269 | 3300046538 | Bacteria | 1578 |
| 333 | Ga0495633_0007773 | 3300046558 | Bacteria | 6127 |
| 334 | Ga0495656_0009496 | 3300046615 | Bacteria | 3499 |
| 335 | Ga0495668_0020849 | 3300046616 | Bacteria | 3764 |
| 336 | Ga0495611_0013209 | 3300046648 | Bacteria | 3514 |
| 337 | Ga0495625_0000621 | 3300046660 | Bacteria | 51568 |
| 338 | Ga0495613_0052683 | 3300046689 | Bacteria | 2996 |
| 339 | Ga0495613_0169814 | 3300046689 | Bacteria | 1548 |
| 340 | Ga0495670_0024091 | 3300046691 | Bacteria | 3006 |
| 341 | Ga0495670_0031057 | 3300046691 | Bacteria | 2654 |
| 342 | Ga0495671_0141849 | 3300046692 | Bacteria | 1171 |
| 343 | Ga0495604_0012101 | 3300047317 | Bacteria | 6860 |
| 344 | Ga0495672_0005251 | 3300047320 | Bacteria | 10318 |
| 345 | Ga0495685_024882 | 3300047447 | Bacteria | 2061 |
| 346 | Ga0495681_0006193 | 3300047470 | Bacteria | 7891 |
| 347 | Ga0495686_0000316 | 3300047472 | Bacteria | 80803 |
| 348 | Ga0495686_0003045 | 3300047472 | Bacteria | 14859 |
| 349 | Ga0495686_0067244 | 3300047472 | Bacteria | 2212 |
| 350 | Ga0495615_0007978 | 3300048090 | Bacteria | 2030 |
| 351 | Ga0495626_0018872 | 3300048091 | Bacteria | 3454 |
| 352 | Ga0496106_0000578 | 3300048909 | Bacteria | 26182 |
| 353 | Ga0496109_0283369 | 3300048912 | Bacteria | 1562 |
| 354 | Ga0496110_0084685 | 3300048913 | Bacteria | 2830 |
| 355 | Ga0496110_0289290 | 3300048913 | Bacteria | 1492 |
| 356 | Ga0496111_0000592 | 3300048914 | Bacteria | 19050 |
| 357 | Ga0496112_0003167 | 3300048915 | Bacteria | 13516 |
| 358 | Ga0496113_0045574 | 3300048916 | Bacteria | 3253 |
| 359 | Ga0496114_0131600 | 3300048917 | Bacteria | 2161 |
| 360 | Ga0496115_0197362 | 3300048918 | Bacteria | 1663 |
| 361 | Ga0496116_0004831 | 3300048919 | Bacteria | 12714 |
| 362 | Ga0496116_0048900 | 3300048919 | Bacteria | 2833 |
| 363 | Ga0496116_0054750 | 3300048919 | Bacteria | 2625 |
| 364 | Ga0496116_0079230 | 3300048919 | Bacteria | 2045 |
| 365 | Ga0496116_0083005 | 3300048919 | Bacteria | 1980 |
| 366 | Ga0496116_0110382 | 3300048919 | Bacteria | 1618 |
| 367 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 368 | Ga0496117_0005629 | 3300048920 | Bacteria | 13083 |
| 369 | Ga0496117_0010714 | 3300048920 | Bacteria | 8293 |
| 370 | Ga0496117_0033555 | 3300048920 | Bacteria | 3879 |
| 371 | Ga0496118_0000087 | 3300048921 | Bacteria | 176693 |
| 372 | Ga0496118_0015216 | 3300048921 | Bacteria | 7141 |
| 373 | Ga0496119_0040491 | 3300048922 | Bacteria | 2979 |
| 374 | Ga0496120_0000180 | 3300048923 | Bacteria | 107518 |
| 375 | Ga0496120_0000621 | 3300048923 | Bacteria | 53511 |
| 376 | Ga0496120_0053060 | 3300048923 | Bacteria | 2305 |
| 377 | Ga0496120_0099445 | 3300048923 | Bacteria | 1540 |
| 378 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 379 | Ga0496121_0000059 | 3300048924 | Bacteria | 278177 |
| 380 | Ga0496121_0000363 | 3300048924 | Bacteria | 93101 |
| 381 | Ga0496121_0004088 | 3300048924 | Bacteria | 20038 |
| 382 | Ga0496121_0005561 | 3300048924 | Bacteria | 16097 |
| 383 | Ga0496121_0009569 | 3300048924 | Bacteria | 11104 |
| 384 | Ga0496121_0086868 | 3300048924 | Bacteria | 2456 |
| 385 | Ga0496121_0249946 | 3300048924 | Bacteria | 1230 |
| 386 | Ga0496122_0000004 | 3300048925 | Bacteria | 645283 |
| 387 | Ga0496122_0000190 | 3300048925 | Bacteria | 140376 |
| 388 | Ga0496122_0000369 | 3300048925 | Bacteria | 96672 |
| 389 | Ga0496122_0005937 | 3300048925 | Bacteria | 14292 |
| 390 | Ga0496122_0025840 | 3300048925 | Bacteria | 5084 |
| 391 | Ga0496122_0047231 | 3300048925 | Bacteria | 3325 |
| 392 | Ga0496122_0097344 | 3300048925 | Bacteria | 1980 |
| 393 | Ga0496123_0000007 | 3300048926 | Bacteria | 645283 |
| 394 | Ga0496123_0000054 | 3300048926 | Bacteria | 234046 |
| 395 | Ga0496123_0001159 | 3300048926 | Bacteria | 39083 |
| 396 | Ga0496123_0007309 | 3300048926 | Bacteria | 10471 |
| 397 | Ga0496123_0011197 | 3300048926 | Bacteria | 7806 |
| 398 | Ga0496123_0028380 | 3300048926 | Bacteria | 4144 |
| 399 | Ga0496123_0076217 | 3300048926 | Bacteria | 2065 |
| 400 | Ga0496124_0000308 | 3300048927 | Bacteria | 90566 |
| 401 | Ga0496124_0001702 | 3300048927 | Bacteria | 31109 |
| 402 | Ga0496124_0005097 | 3300048927 | Bacteria | 14961 |
| 403 | Ga0496124_0005246 | 3300048927 | Bacteria | 14679 |
| 404 | Ga0496124_0006525 | 3300048927 | Bacteria | 12691 |
| 405 | Ga0496124_0025248 | 3300048927 | Bacteria | 5384 |
| 406 | Ga0496124_0025497 | 3300048927 | Bacteria | 5354 |
| 407 | Ga0496124_0064161 | 3300048927 | Bacteria | 3067 |
| 408 | Ga0496124_0162235 | 3300048927 | Bacteria | 1741 |
| 409 | Ga0496125_0000039 | 3300048928 | Bacteria | 318665 |
| 410 | Ga0496125_0000273 | 3300048928 | Bacteria | 104663 |
| 411 | Ga0496125_0019255 | 3300048928 | Bacteria | 6446 |
| 412 | Ga0496125_0028736 | 3300048928 | Bacteria | 5013 |
| 413 | Ga0496125_0100336 | 3300048928 | Bacteria | 2134 |
| 414 | Ga0496125_0178773 | 3300048928 | Bacteria | 1416 |
| 415 | Ga0496126_0000589 | 3300048929 | Bacteria | 68753 |
| 416 | Ga0496126_0001008 | 3300048929 | Bacteria | 47974 |
| 417 | Ga0496126_0148441 | 3300048929 | Bacteria | 2011 |
| 418 | Ga0495678_008838 | 3300049459 | Bacteria | 5037 |
| 419 | Ga0495678_070245 | 3300049459 | Bacteria | 1286 |
| 420 | Ga0495682_0058718 | 3300049460 | Bacteria | 1391 |
| 421 | Ga0501031_0019611 | 3300049568 | Bacteria | 4404 |
| 422 | Ga0501031_0021184 | 3300049568 | Bacteria | 4240 |
| 423 | Ga0501031_0030492 | 3300049568 | Bacteria | 3518 |
| 424 | Ga0501031_0102466 | 3300049568 | Bacteria | 1868 |
| 425 | Ga0501032_0000031 | 3300049569 | Bacteria | 130204 |
| 426 | Ga0501032_0000201 | 3300049569 | Bacteria | 49742 |
| 427 | Ga0501032_0005441 | 3300049569 | Bacteria | 9451 |
| 428 | Ga0501032_0053525 | 3300049569 | Bacteria | 2718 |
| 429 | Ga0501033_0000050 | 3300049570 | Bacteria | 111819 |
| 430 | Ga0501033_0000132 | 3300049570 | Bacteria | 72558 |
| 431 | Ga0501033_0000779 | 3300049570 | Bacteria | 29299 |
| 432 | Ga0501033_0001161 | 3300049570 | Bacteria | 23830 |
| 433 | Ga0501033_0051885 | 3300049570 | Bacteria | 3040 |
| 434 | Ga0501033_0253578 | 3300049570 | Bacteria | 1246 |
| 435 | Ga0501034_0000005 | 3300049571 | Bacteria | 367512 |
| 436 | Ga0501034_0000064 | 3300049571 | Bacteria | 189461 |
| 437 | Ga0501034_0006650 | 3300049571 | Bacteria | 12404 |
| 438 | Ga0501034_0075936 | 3300049571 | Bacteria | 3367 |
| 439 | Ga0501034_0084426 | 3300049571 | Bacteria | 3177 |
| 440 | Ga0501034_0113265 | 3300049571 | Bacteria | 2702 |
| 441 | Ga0501034_0193804 | 3300049571 | Bacteria | 1993 |
| 442 | Ga0501036_0000005 | 3300049572 | Bacteria | 246420 |
| 443 | Ga0501036_0000563 | 3300049572 | Bacteria | 26668 |
| 444 | Ga0501036_0005458 | 3300049572 | Bacteria | 10305 |
| 445 | Ga0501036_0273621 | 3300049572 | Bacteria | 1413 |
| 446 | Ga0501037_0000045 | 3300049573 | Bacteria | 117148 |
| 447 | Ga0501037_0000077 | 3300049573 | Bacteria | 91081 |
| 448 | Ga0501037_0000132 | 3300049573 | Bacteria | 69775 |
| 449 | Ga0501037_0005351 | 3300049573 | Bacteria | 9336 |
| 450 | Ga0501038_0000001 | 3300049574 | Bacteria | 375481 |
| 451 | Ga0501038_0000055 | 3300049574 | Bacteria | 93761 |
| 452 | Ga0501038_0001140 | 3300049574 | Bacteria | 24106 |
| 453 | Ga0501038_0061894 | 3300049574 | Bacteria | 3200 |
| 454 | Ga0501039_0000007 | 3300049575 | Bacteria | 277831 |
| 455 | Ga0501039_0000045 | 3300049575 | Bacteria | 104513 |
| 456 | Ga0501039_0035466 | 3300049575 | Bacteria | 3849 |
| 457 | Ga0501039_0141729 | 3300049575 | Bacteria | 1888 |
| 458 | Ga0501043_0000015 | 3300049579 | Bacteria | 175932 |
| 459 | Ga0501043_0000104 | 3300049579 | Bacteria | 78808 |
| 460 | Ga0501043_0000333 | 3300049579 | Bacteria | 42740 |
| 461 | Ga0501043_0003831 | 3300049579 | Bacteria | 12371 |
| 462 | Ga0501043_0091800 | 3300049579 | Bacteria | 2387 |
| 463 | Ga0501046_0037003 | 3300049580 | Bacteria | 3923 |
| 464 | Ga0501046_0150282 | 3300049580 | Bacteria | 1757 |
| 465 | Ga0501047_0012373 | 3300049581 | Bacteria | 8078 |
| 466 | Ga0501047_0019278 | 3300049581 | Bacteria | 6545 |
| 467 | Ga0501048_0008140 | 3300049582 | Bacteria | 7932 |
| 468 | Ga0501048_0103466 | 3300049582 | Bacteria | 2009 |
| 469 | Ga0501067_0017298 | 3300049583 | Bacteria | 3984 |
| 470 | Ga0501068_0004105 | 3300049584 | Bacteria | 7895 |
| 471 | Ga0501069_0000016 | 3300049585 | Bacteria | 142565 |
| 472 | Ga0501069_0036416 | 3300049585 | Bacteria | 2713 |
| 473 | Ga0501069_0072483 | 3300049585 | Bacteria | 1931 |
| 474 | Ga0501070_0000048 | 3300049586 | Bacteria | 105951 |
| 475 | Ga0501070_0000812 | 3300049586 | Bacteria | 28368 |
| 476 | Ga0501070_0021850 | 3300049586 | Bacteria | 5361 |
| 477 | Ga0501070_0028549 | 3300049586 | Bacteria | 4680 |
| 478 | Ga0501070_0080511 | 3300049586 | Bacteria | 2695 |
| 479 | Ga0501071_0010145 | 3300049587 | Bacteria | 6302 |
| 480 | Ga0501071_0056683 | 3300049587 | Bacteria | 2831 |
| 481 | Ga0501072_0077657 | 3300049588 | Bacteria | 2629 |
| 482 | Ga0501073_0014561 | 3300049589 | Bacteria | 5715 |
| 483 | Ga0501073_0170114 | 3300049589 | Bacteria | 1508 |
| 484 | Ga0501074_0001884 | 3300049590 | Bacteria | 14398 |
| 485 | Ga0501074_0064010 | 3300049590 | Bacteria | 2648 |
| 486 | Ga0501079_0239388 | 3300049741 | Bacteria | 1418 |
| 487 | Ga0501080_0000270 | 3300049742 | Bacteria | 39305 |
| 488 | Ga0501080_0001902 | 3300049742 | Bacteria | 17987 |
| 489 | Ga0501080_0002829 | 3300049742 | Bacteria | 15254 |
| 490 | Ga0501080_0026963 | 3300049742 | Bacteria | 5342 |
| 491 | Ga0501080_0176279 | 3300049742 | Bacteria | 1969 |
| 492 | Ga0501083_0000069 | 3300049744 | Bacteria | 68635 |
| 493 | Ga0501035_0000008 | 3300049822 | Bacteria | 313425 |
| 494 | Ga0501035_0000048 | 3300049822 | Bacteria | 146466 |
| 495 | Ga0501035_0000306 | 3300049822 | Bacteria | 57505 |
| 496 | Ga0501035_0003062 | 3300049822 | Bacteria | 16037 |
| 497 | Ga0501035_0004314 | 3300049822 | Bacteria | 13514 |
| 498 | Ga0501035_0023011 | 3300049822 | Bacteria | 5719 |
| 499 | Ga0501035_0024962 | 3300049822 | Bacteria | 5480 |
| 500 | Ga0501035_0029453 | 3300049822 | Bacteria | 5006 |
| 501 | Ga0501044_0000001 | 3300049823 | Bacteria | 418087 |
| 502 | Ga0501044_0000003 | 3300049823 | Bacteria | 345647 |
| 503 | Ga0501044_0010525 | 3300049823 | Bacteria | 10038 |
| 504 | Ga0501044_0021795 | 3300049823 | Bacteria | 6832 |
| 505 | Ga0501044_0051990 | 3300049823 | Bacteria | 4224 |
| 506 | Ga0501044_0068556 | 3300049823 | Bacteria | 3613 |
| 507 | Ga0501044_0162287 | 3300049823 | Bacteria | 2210 |
| 508 | Ga0501045_0051240 | 3300049824 | Bacteria | 3012 |
| 509 | nmdc:mga03683_23701_c1 | 3300050489 | Bacteria | 2394 |
| 510 | nmdc:mga00v17_109_c1 | 3300050491 | Bacteria | 49123 |
| 511 | nmdc:mga00v17_12_c1 | 3300050491 | Bacteria | 129050 |
| 512 | nmdc:mga0yw44_140341_c1 | 3300050492 | Bacteria | 1570 |
| 513 | nmdc:mga0yw44_1670_c2 | 3300050492 | Bacteria | 8399 |
| 514 | nmdc:mga0yw44_31979_c1 | 3300050492 | Bacteria | 3064 |
| 515 | nmdc:mga0yw44_47732_c1 | 3300050492 | Bacteria | 2579 |
| 516 | nmdc:mga04h51_13930_c1 | 3300050495 | Bacteria | 2288 |
| 517 | nmdc:mga0sz30_240_c1 | 3300050516 | Bacteria | 21031 |
| 518 | nmdc:mga0sz30_3440_c1 | 3300050516 | Bacteria | 3912 |
| 519 | Ga0500610_0002329 | 3300053079 | Bacteria | 6948 |
| 520 | Ga0500578_0088087 | 3300053086 | Bacteria | 1971 |
| 521 | Ga0500643_015830 | 3300053087 | Bacteria | 2575 |
| 522 | Ga0500557_000324 | 3300053105 | Bacteria | 6271 |
| 523 | Ga0500618_000361 | 3300053125 | Bacteria | 31600 |
| 524 | Ga0500618_001657 | 3300053125 | Bacteria | 9570 |
| 525 | Ga0500618_016697 | 3300053125 | Bacteria | 1833 |
| 526 | Ga0500658_0000529 | 3300053134 | Bacteria | 16130 |
| 527 | Ga0500559_0017106 | 3300053136 | Bacteria | 3062 |
| 528 | Ga0500561_0000126 | 3300053137 | Bacteria | 14808 |
| 529 | Ga0500573_0000585 | 3300053140 | Bacteria | 16001 |
| 530 | Ga0500616_0002961 | 3300053153 | Bacteria | 13495 |
| 531 | Ga0500616_0011965 | 3300053153 | Bacteria | 5097 |
| 532 | Ga0500616_0030818 | 3300053153 | Bacteria | 2942 |
| 533 | Ga0500620_000067 | 3300053155 | Bacteria | 20011 |
| 534 | Ga0500622_0000697 | 3300053156 | Bacteria | 29561 |
| 535 | Ga0500622_0000899 | 3300053156 | Bacteria | 25323 |
| 536 | Ga0500624_001069 | 3300053157 | Bacteria | 5287 |
| 537 | Ga0500634_0004429 | 3300053161 | Bacteria | 6490 |
| 538 | Ga0500634_0008929 | 3300053161 | Bacteria | 5037 |
| 539 | Ga0500636_0000021 | 3300053177 | Bacteria | 96861 |
| 540 | Ga0500636_0004647 | 3300053177 | Bacteria | 7790 |
| 541 | Ga0501084_0108695 | 3300054114 | Bacteria | 2330 |
| 542 | Ga0501084_0309798 | 3300054114 | Bacteria | 1333 |
| 543 | Ga0501082_0000036 | 3300060353 | Bacteria | 95930 |
| 544 | Ga0501082_0017101 | 3300060353 | Bacteria | 6248 |
| 545 | Ga0501082_0065523 | 3300060353 | Bacteria | 3129 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003214 | JGI25165J46597_1002237 | JGI25165J46597_10022375 | 295 |
| 2 | 3300048913 | Ga0496110_0084685 | Ga0496110_0084685_1152_2093 | 307 |
| 3 | 3300025923 | Ga0207681_10030629 | Ga0207681_100306294 | 333 |
| 4 | 3300012482 | Ga0157318_1000561 | Ga0157318_10005612 | 345 |
| 5 | 3300035117 | Ga0373953_0024208 | Ga0373953_0024208_25_1224 | 345 |
| 6 | 3300054114 | Ga0501084_0309798 | Ga0501084_0309798_108_1256 | 355 |
| 7 | 3300005842 | Ga0068858_100231704 | Ga0068858_1002317042 | 356 |
| 8 | 3300060353 | Ga0501082_0000036 | Ga0501082_0000036_64916_66121 | 356 |
| 9 | 3300005339 | Ga0070660_100016320 | Ga0070660_1000163205 | 357 |
| 10 | 3300005563 | Ga0068855_100080060 | Ga0068855_1000800603 | 357 |
| 11 | 3300006051 | Ga0075364_10152495 | Ga0075364_101524952 | 357 |
| 12 | 3300006881 | Ga0068865_100241105 | Ga0068865_1002411052 | 357 |
| 13 | 3300025919 | Ga0207657_10000483 | Ga0207657_100004833 | 357 |
| 14 | 3300025938 | Ga0207704_10223982 | Ga0207704_102239822 | 357 |
| 15 | 3300025949 | Ga0207667_10006604 | Ga0207667_100066044 | 357 |
| 16 | 3300035115 | Ga0373941_0027699 | Ga0373941_0027699_397_1506 | 357 |
| 17 | 3300035241 | Ga0373961_0032165 | Ga0373961_0032165_27_1136 | 357 |
| 18 | 3300042436 | Ga0439435_0040162 | Ga0439435_0040162_59_1204 | 357 |
| 19 | 3300028666 | Ga0265336_10005821 | Ga0265336_100058212 | 358 |
| 20 | 3300042006 | Ga0439432_026057 | Ga0439432_026057_692_1795 | 358 |
| 21 | 3300048924 | Ga0496121_0000059 | Ga0496121_0000059_208087_209247 | 358 |
| 22 | iso_pu_bacteria | 2582581315 | 2585323541 | 358 |
| 23 | 3300044712 | Ga0453684_0035183 | Ga0453684_0035183_3126_4247 | 359 |
| 24 | 3300005614 | Ga0068856_100000396 | Ga0068856_1000003965 | 360 |
| 25 | 3300026078 | Ga0207702_10000423 | Ga0207702_1000042341 | 360 |
| 26 | 3300046648 | Ga0495611_0013209 | Ga0495611_0013209_1211_2326 | 360 |
| 27 | 3300041459 | Ga0451800_1271145 | Ga0451800_1271145_534_1721 | 361 |
| 28 | 3300046689 | Ga0495613_0169814 | Ga0495613_0169814_53_1159 | 361 |
| 29 | 3300046507 | Ga0495606_0010798 | Ga0495606_0010798_681_1793 | 364 |
| 30 | 3300046692 | Ga0495671_0141849 | Ga0495671_0141849_55_1149 | 364 |
| 31 | 3300025924 | Ga0207694_10023427 | Ga0207694_100234272 | 365 |
| 32 | 3300031239 | Ga0265328_10001732 | Ga0265328_100017328 | 365 |
| 33 | iso_pu_bacteria | 2671180139 | 2671693313 | 366 |
| 34 | 3300003322 | rootL2_10035682 | rootL2_1003568227 | 367 |
| 35 | 3300005458 | Ga0070681_10164431 | Ga0070681_101644313 | 368 |
| 36 | 3300041491 | Ga0451833_1236258 | Ga0451833_1236258_92_1198 | 368 |
| 37 | 3300048091 | Ga0495626_0018872 | Ga0495626_0018872_39_1145 | 368 |
| 38 | 3300013297 | Ga0157378_10112084 | Ga0157378_101120843 | 369 |
| 39 | 3300036401 | Ga0373937_0015885 | Ga0373937_0015885_4276_5559 | 369 |
| 40 | 3300037068 | Ga0373925_0016891 | Ga0373925_0016891_1082_2365 | 369 |
| 41 | 3300046517 | Ga0495630_0116728 | Ga0495630_0116728_418_1701 | 369 |
| 42 | 3300046689 | Ga0495613_0052683 | Ga0495613_0052683_335_1618 | 369 |
| 43 | 3300048917 | Ga0496114_0131600 | Ga0496114_0131600_453_1739 | 369 |
| 44 | 3300049568 | Ga0501031_0019611 | Ga0501031_0019611_2601_3881 | 369 |
| 45 | 3300049569 | Ga0501032_0005441 | Ga0501032_0005441_2702_3982 | 369 |
| 46 | 3300049570 | Ga0501033_0051885 | Ga0501033_0051885_733_2013 | 369 |
| 47 | 3300049571 | Ga0501034_0113265 | Ga0501034_0113265_195_1475 | 369 |
| 48 | 3300049572 | Ga0501036_0005458 | Ga0501036_0005458_1092_2372 | 369 |
| 49 | 3300049573 | Ga0501037_0005351 | Ga0501037_0005351_5774_7054 | 369 |
| 50 | 3300049574 | Ga0501038_0001140 | Ga0501038_0001140_2601_3881 | 369 |
| 51 | 3300049575 | Ga0501039_0035466 | Ga0501039_0035466_1903_3183 | 369 |
| 52 | 3300049581 | Ga0501047_0012373 | Ga0501047_0012373_5197_6477 | 369 |
| 53 | 3300049582 | Ga0501048_0008140 | Ga0501048_0008140_1092_2372 | 369 |
| 54 | 3300049583 | Ga0501067_0017298 | Ga0501067_0017298_771_2051 | 369 |
| 55 | 3300049589 | Ga0501073_0014561 | Ga0501073_0014561_1804_3084 | 369 |
| 56 | 3300049742 | Ga0501080_0002829 | Ga0501080_0002829_13650_14930 | 369 |
| 57 | 3300049823 | Ga0501044_0021795 | Ga0501044_0021795_2601_3881 | 369 |
| 58 | 3300054114 | Ga0501084_0108695 | Ga0501084_0108695_455_1735 | 369 |
| 59 | 3300060353 | Ga0501082_0065523 | Ga0501082_0065523_1803_3083 | 369 |
| 60 | iso_pu_bacteria | 2534681786 | 2535485090 | 369 |
| 61 | iso_pu_bacteria | 2854911287 | 2854912360 | 369 |
| 62 | iso_pu_bacteria | 2899259804 | 2899260714 | 369 |
| 63 | iso_pu_bacteria | 2915650412 | 2915653100 | 369 |
| 64 | 3300042436 | Ga0439435_0001675 | Ga0439435_0001675_372_1499 | 370 |
| 65 | 3300046517 | Ga0495630_0080599 | Ga0495630_0080599_900_2138 | 370 |
| 66 | 3300049571 | Ga0501034_0084426 | Ga0501034_0084426_1171_2292 | 370 |
| 67 | 3300049589 | Ga0501073_0170114 | Ga0501073_0170114_244_1365 | 370 |
| 68 | 3300049742 | Ga0501080_0026963 | Ga0501080_0026963_1261_2382 | 370 |
| 69 | iso_pu_bacteria | 2510917026 | 2511172477 | 370 |
| 70 | iso_pu_bacteria | 2585427633 | 2585996117 | 370 |
| 71 | iso_pu_bacteria | 2585427634 | 2586000732 | 370 |
| 72 | iso_pu_bacteria | 2599185236 | 2599721980 | 370 |
| 73 | iso_pu_bacteria | 2600254933 | 2600374424 | 370 |
| 74 | iso_pu_bacteria | 2643221558 | 2643811591 | 370 |
| 75 | iso_pu_bacteria | 2818991461 | 2819684828 | 370 |
| 76 | iso_pu_bacteria | 2821123053 | 2821127554 | 370 |
| 77 | iso_pu_bacteria | 2838736955 | 2838738077 | 370 |
| 78 | iso_pu_bacteria | 2841840854 | 2841841554 | 370 |
| 79 | iso_pu_bacteria | 2842140634 | 2842141332 | 370 |
| 80 | iso_pu_bacteria | 2854896431 | 2854899213 | 370 |
| 81 | iso_pu_bacteria | 2854916844 | 2854918758 | 370 |
| 82 | iso_pu_bacteria | 2857531043 | 2857536434 | 370 |
| 83 | iso_pu_bacteria | 2919171160 | 2919174785 | 370 |
| 84 | iso_pu_bacteria | 8018150411 | 8018153157 | 370 |
| 85 | iso_pu_bacteria | 2503198000 | 2503201676 | 371 |
| 86 | iso_pu_bacteria | 2508501123 | 2509118844 | 371 |
| 87 | iso_pu_bacteria | 2508501127 | 2509144839 | 371 |
| 88 | iso_pu_bacteria | 2509276021 | 2509392148 | 371 |
| 89 | iso_pu_bacteria | 2509276022 | 2509396441 | 371 |
| 90 | iso_pu_bacteria | 2509276033 | 2509445793 | 371 |
| 91 | iso_pu_bacteria | 2509276033 | 2509446905 | 371 |
| 92 | iso_pu_bacteria | 2510065019 | 2510133860 | 371 |
| 93 | iso_pu_bacteria | 2510065059 | 2510315363 | 371 |
| 94 | iso_pu_bacteria | 2510461069 | 2510840072 | 371 |
| 95 | iso_pu_bacteria | 2510461076 | 2510895280 | 371 |
| 96 | iso_pu_bacteria | 2510917022 | 2511135311 | 371 |
| 97 | iso_pu_bacteria | 2510917028 | 2511186975 | 371 |
| 98 | iso_pu_bacteria | 2510917030 | 2511196066 | 371 |
| 99 | iso_pu_bacteria | 2511231027 | 2511389776 | 371 |
| 100 | iso_pu_bacteria | 2512047086 | 2512533536 | 371 |
| 101 | iso_pu_bacteria | 2512875016 | 2512931354 | 371 |
| 102 | iso_pu_bacteria | 2512875026 | 2512970789 | 371 |
| 103 | iso_pu_bacteria | 2513237084 | 2513573665 | 371 |
| 104 | iso_pu_bacteria | 2513237085 | 2513576850 | 371 |
| 105 | iso_pu_bacteria | 2513237089 | 2513604168 | 371 |
| 106 | iso_pu_bacteria | 2513237090 | 2513613258 | 371 |
| 107 | iso_pu_bacteria | 2513237093 | 2513629493 | 371 |
| 108 | iso_pu_bacteria | 2513237103 | 2513708143 | 371 |
| 109 | iso_pu_bacteria | 2513237138 | 2513865517 | 371 |
| 110 | iso_pu_bacteria | 2513237144 | 2513909197 | 371 |
| 111 | iso_pu_bacteria | 2513237146 | 2513925465 | 371 |
| 112 | iso_pu_bacteria | 2513237156 | 2513985309 | 371 |
| 113 | iso_pu_bacteria | 2513237160 | 2514006483 | 371 |
| 114 | iso_pu_bacteria | 2513237162 | 2514020101 | 371 |
| 115 | iso_pu_bacteria | 2513237305 | 2514421622 | 371 |
| 116 | iso_pu_bacteria | 2513237351 | 2514589146 | 371 |
| 117 | iso_pu_bacteria | 2515075009 | 2515112905 | 371 |
| 118 | iso_pu_bacteria | 2515154107 | 2515608937 | 371 |
| 119 | iso_pu_bacteria | 2515154113 | 2515636416 | 371 |
| 120 | iso_pu_bacteria | 2515154114 | 2515640868 | 371 |
| 121 | iso_pu_bacteria | 2515154116 | 2515655449 | 371 |
| 122 | iso_pu_bacteria | 2515154134 | 2515739389 | 371 |
| 123 | iso_pu_bacteria | 2516653077 | 2517036607 | 371 |
| 124 | iso_pu_bacteria | 2516653085 | 2517076969 | 371 |
| 125 | iso_pu_bacteria | 2517093000 | 2517095739 | 371 |
| 126 | iso_pu_bacteria | 2517287029 | 2517407306 | 371 |
| 127 | iso_pu_bacteria | 2517487022 | 2517570240 | 371 |
| 128 | iso_pu_bacteria | 2524023209 | 2524459508 | 371 |
| 129 | iso_pu_bacteria | 2529292951 | 2530646048 | 371 |
| 130 | iso_pu_bacteria | 2534681796 | 2535516789 | 371 |
| 131 | iso_pu_bacteria | 2537561587 | 2537875631 | 371 |
| 132 | iso_pu_bacteria | 2554235003 | 2554248153 | 371 |
| 133 | iso_pu_bacteria | 2558860242 | 2559295269 | 371 |
| 134 | iso_pu_bacteria | 2558860983 | 2561468987 | 371 |
| 135 | iso_pu_bacteria | 2582581294 | 2585200526 | 371 |
| 136 | iso_pu_bacteria | 2582581298 | 2585222736 | 371 |
| 137 | iso_pu_bacteria | 2582581299 | 2585232757 | 371 |
| 138 | iso_pu_bacteria | 2582581304 | 2585255003 | 371 |
| 139 | iso_pu_bacteria | 2582581308 | 2585277400 | 371 |
| 140 | iso_pu_bacteria | 2582581315 | 2585323426 | 371 |
| 141 | iso_pu_bacteria | 2582581316 | 2585331558 | 371 |
| 142 | iso_pu_bacteria | 2582581867 | 2585402480 | 371 |
| 143 | iso_pu_bacteria | 2585427526 | 2585527349 | 371 |
| 144 | iso_pu_bacteria | 2585427527 | 2585535027 | 371 |
| 145 | iso_pu_bacteria | 2585427528 | 2585538091 | 371 |
| 146 | iso_pu_bacteria | 2585427529 | 2585545319 | 371 |
| 147 | iso_pu_bacteria | 2585427530 | 2585555875 | 371 |
| 148 | iso_pu_bacteria | 2585427590 | 2585822832 | 371 |
| 149 | iso_pu_bacteria | 2585427593 | 2585836039 | 371 |
| 150 | iso_pu_bacteria | 2585427594 | 2585843088 | 371 |
| 151 | iso_pu_bacteria | 2588253730 | 2588517184 | 371 |
| 152 | iso_pu_bacteria | 2597489875 | 2597813613 | 371 |
| 153 | iso_pu_bacteria | 2599185170 | 2599417381 | 371 |
| 154 | iso_pu_bacteria | 2599185210 | 2599601585 | 371 |
| 155 | iso_pu_bacteria | 2599185301 | 2599936627 | 371 |
| 156 | iso_pu_bacteria | 2599185352 | 2600194287 | 371 |
| 157 | iso_pu_bacteria | 2600255279 | 2601610154 | 371 |
| 158 | iso_pu_bacteria | 2600255308 | 2601746928 | 371 |
| 159 | iso_pu_bacteria | 2615840624 | 2616293450 | 371 |
| 160 | iso_pu_bacteria | 2615840626 | 2616308875 | 371 |
| 161 | iso_pu_bacteria | 2615840698 | 2616556914 | 371 |
| 162 | iso_pu_bacteria | 2617270742 | 2617385963 | 371 |
| 163 | iso_pu_bacteria | 2643221550 | 2643773015 | 371 |
| 164 | iso_pu_bacteria | 2643221551 | 2643775989 | 371 |
| 165 | iso_pu_bacteria | 2643221555 | 2643794436 | 371 |
| 166 | iso_pu_bacteria | 2643221557 | 2643803206 | 371 |
| 167 | iso_pu_bacteria | 2643221564 | 2643840106 | 371 |
| 168 | iso_pu_bacteria | 2643221568 | 2643856845 | 371 |
| 169 | iso_pu_bacteria | 2643221582 | 2643920421 | 371 |
| 170 | iso_pu_bacteria | 2643221595 | 2643984534 | 371 |
| 171 | iso_pu_bacteria | 2643221599 | 2644003236 | 371 |
| 172 | iso_pu_bacteria | 2643221610 | 2644063571 | 371 |
| 173 | iso_pu_bacteria | 2643221623 | 2644129277 | 371 |
| 174 | iso_pu_bacteria | 2643221627 | 2644153390 | 371 |
| 175 | iso_pu_bacteria | 2643221634 | 2644193422 | 371 |
| 176 | iso_pu_bacteria | 2643221637 | 2644210101 | 371 |
| 177 | iso_pu_bacteria | 2643221653 | 2644298594 | 371 |
| 178 | iso_pu_bacteria | 2643221668 | 2644374851 | 371 |
| 179 | iso_pu_bacteria | 2643221675 | 2644414334 | 371 |
| 180 | iso_pu_bacteria | 2643221680 | 2644447862 | 371 |
| 181 | iso_pu_bacteria | 2643221693 | 2644522037 | 371 |
| 182 | iso_pu_bacteria | 2643221718 | 2644653653 | 371 |
| 183 | iso_pu_bacteria | 2643221719 | 2644656823 | 371 |
| 184 | iso_pu_bacteria | 2643221723 | 2644676189 | 371 |
| 185 | iso_pu_bacteria | 2643221726 | 2644690335 | 371 |
| 186 | iso_pu_bacteria | 2667528174 | 2671111525 | 371 |
| 187 | iso_pu_bacteria | 2687453392 | 2688598587 | 371 |
| 188 | iso_pu_bacteria | 2690316117 | 2692315622 | 371 |
| 189 | iso_pu_bacteria | 2693429783 | 2694633044 | 371 |
| 190 | iso_pu_bacteria | 2693429784 | 2694635921 | 371 |
| 191 | iso_pu_bacteria | 2718217882 | 2719181721 | 371 |
| 192 | iso_pu_bacteria | 2718217927 | 2719386245 | 371 |
| 193 | iso_pu_bacteria | 2718217997 | 2719666065 | 371 |
| 194 | iso_pu_bacteria | 2718218009 | 2719732385 | 371 |
| 195 | iso_pu_bacteria | 2718218199 | 2720492485 | 371 |
| 196 | iso_pu_bacteria | 2718218232 | 2720613923 | 371 |
| 197 | iso_pu_bacteria | 2718218233 | 2720620727 | 371 |
| 198 | iso_pu_bacteria | 2718218235 | 2720632050 | 371 |
| 199 | iso_pu_bacteria | 2718218269 | 2720775778 | 371 |
| 200 | iso_pu_bacteria | 2718218363 | 2721147812 | 371 |
| 201 | iso_pu_bacteria | 2718218365 | 2721159261 | 371 |
| 202 | iso_pu_bacteria | 2718218366 | 2721164648 | 371 |
| 203 | iso_pu_bacteria | 2718218423 | 2721400027 | 371 |
| 204 | iso_pu_bacteria | 2721755514 | 2722840818 | 371 |
| 205 | iso_pu_bacteria | 2721755556 | 2723027385 | 371 |
| 206 | iso_pu_bacteria | 2721755684 | 2723561004 | 371 |
| 207 | iso_pu_bacteria | 2721755685 | 2723567597 | 371 |
| 208 | iso_pu_bacteria | 2721755686 | 2723575523 | 371 |
| 209 | iso_pu_bacteria | 2721755809 | 2724038840 | 371 |
| 210 | iso_pu_bacteria | 2721755810 | 2724045141 | 371 |
| 211 | iso_pu_bacteria | 2721755819 | 2724090385 | 371 |
| 212 | iso_pu_bacteria | 2721755822 | 2724104862 | 371 |
| 213 | iso_pu_bacteria | 2721755823 | 2724110666 | 371 |
| 214 | iso_pu_bacteria | 2724679232 | 2725952654 | 371 |
| 215 | iso_pu_bacteria | 2728369352 | 2730108321 | 371 |
| 216 | iso_pu_bacteria | 2728369365 | 2730164956 | 371 |
| 217 | iso_pu_bacteria | 2728369397 | 2730298893 | 371 |
| 218 | iso_pu_bacteria | 2738541293 | 2738799999 | 371 |
| 219 | iso_pu_bacteria | 2738541317 | 2738948869 | 371 |
| 220 | iso_pu_bacteria | 2738541333 | 2739032748 | 371 |
| 221 | iso_pu_bacteria | 2738543024 | 2739307276 | 371 |
| 222 | iso_pu_bacteria | 2756170246 | 2756675330 | 371 |
| 223 | iso_pu_bacteria | 2765235802 | 2765464704 | 371 |
| 224 | iso_pu_bacteria | 2765235942 | 2766065773 | 371 |
| 225 | iso_pu_bacteria | 2767802442 | 2770195365 | 371 |
| 226 | iso_pu_bacteria | 2775506902 | 2776270693 | 371 |
| 227 | iso_pu_bacteria | 2775506904 | 2776280484 | 371 |
| 228 | iso_pu_bacteria | 2775507049 | 2776913848 | 371 |
| 229 | iso_pu_bacteria | 2775507266 | 2778175336 | 371 |
| 230 | iso_pu_bacteria | 2791355091 | 2792620855 | 371 |
| 231 | iso_pu_bacteria | 2791355092 | 2792626215 | 371 |
| 232 | iso_pu_bacteria | 2791355094 | 2792639153 | 371 |
| 233 | iso_pu_bacteria | 2791355123 | 2792749378 | 371 |
| 234 | iso_pu_bacteria | 2791355256 | 2793294527 | 371 |
| 235 | iso_pu_bacteria | 2791355259 | 2793314629 | 371 |
| 236 | iso_pu_bacteria | 2791355260 | 2793320455 | 371 |
| 237 | iso_pu_bacteria | 2791355261 | 2793330530 | 371 |
| 238 | iso_pu_bacteria | 2791355262 | 2793336820 | 371 |
| 239 | iso_pu_bacteria | 2791355263 | 2793339112 | 371 |
| 240 | iso_pu_bacteria | 2791355264 | 2793348795 | 371 |
| 241 | iso_pu_bacteria | 2791355265 | 2793351922 | 371 |
| 242 | iso_pu_bacteria | 2791355266 | 2793363607 | 371 |
| 243 | iso_pu_bacteria | 2791355267 | 2793370267 | 371 |
| 244 | iso_pu_bacteria | 2802428858 | 2802719935 | 371 |
| 245 | iso_pu_bacteria | 2802428859 | 2802727133 | 371 |
| 246 | iso_pu_bacteria | 2802428860 | 2802731867 | 371 |
| 247 | iso_pu_bacteria | 2802428861 | 2802739197 | 371 |
| 248 | iso_pu_bacteria | 2802428862 | 2802745823 | 371 |
| 249 | iso_pu_bacteria | 2802428863 | 2802752425 | 371 |
| 250 | iso_pu_bacteria | 2802429268 | 2804752641 | 371 |
| 251 | iso_pu_bacteria | 2802429605 | 2805931391 | 371 |
| 252 | iso_pu_bacteria | 2802429606 | 2805937411 | 371 |
| 253 | iso_pu_bacteria | 2802429633 | 2806043728 | 371 |
| 254 | iso_pu_bacteria | 2802429634 | 2806050340 | 371 |
| 255 | iso_pu_bacteria | 2802429635 | 2806057157 | 371 |
| 256 | iso_pu_bacteria | 2802429636 | 2806064539 | 371 |
| 257 | iso_pu_bacteria | 2802429637 | 2806071806 | 371 |
| 258 | iso_pu_bacteria | 2808606387 | 2808987997 | 371 |
| 259 | iso_pu_bacteria | 2818991439 | 2819558990 | 371 |
| 260 | iso_pu_bacteria | 2818991448 | 2819609060 | 371 |
| 261 | iso_pu_bacteria | 2818991453 | 2819637709 | 371 |
| 262 | iso_pu_bacteria | 2837651117 | 2837653155 | 371 |
| 263 | iso_pu_bacteria | 2837678835 | 2837681387 | 371 |
| 264 | iso_pu_bacteria | 2838016132 | 2838017744 | 371 |
| 265 | iso_pu_bacteria | 2838022645 | 2838028382 | 371 |
| 266 | iso_pu_bacteria | 2838029111 | 2838029895 | 371 |
| 267 | iso_pu_bacteria | 2838035591 | 2838038416 | 371 |
| 268 | iso_pu_bacteria | 2838042994 | 2838043875 | 371 |
| 269 | iso_pu_bacteria | 2838048938 | 2838051963 | 371 |
| 270 | iso_pu_bacteria | 2838061910 | 2838067420 | 371 |
| 271 | iso_pu_bacteria | 2838068647 | 2838070237 | 371 |
| 272 | iso_pu_bacteria | 2838661181 | 2838661674 | 371 |
| 273 | iso_pu_bacteria | 2838668709 | 2838670271 | 371 |
| 274 | iso_pu_bacteria | 2838675328 | 2838675851 | 371 |
| 275 | iso_pu_bacteria | 2838680041 | 2838681703 | 371 |
| 276 | iso_pu_bacteria | 2838686498 | 2838687149 | 371 |
| 277 | iso_pu_bacteria | 2838694306 | 2838696275 | 371 |
| 278 | iso_pu_bacteria | 2838701080 | 2838702642 | 371 |
| 279 | iso_pu_bacteria | 2838707686 | 2838710486 | 371 |
| 280 | iso_pu_bacteria | 2838714209 | 2838714733 | 371 |
| 281 | iso_pu_bacteria | 2838719591 | 2838721466 | 371 |
| 282 | iso_pu_bacteria | 2838724970 | 2838725493 | 371 |
| 283 | iso_pu_bacteria | 2838729681 | 2838729878 | 371 |
| 284 | iso_pu_bacteria | 2838742623 | 2838743107 | 371 |
| 285 | iso_pu_bacteria | 2839993093 | 2839996956 | 371 |
| 286 | iso_pu_bacteria | 2840764183 | 2840767490 | 371 |
| 287 | iso_pu_bacteria | 2841846520 | 2841848418 | 371 |
| 288 | iso_pu_bacteria | 2841851746 | 2841852593 | 371 |
| 289 | iso_pu_bacteria | 2841859092 | 2841862048 | 371 |
| 290 | iso_pu_bacteria | 2841864319 | 2841869890 | 371 |
| 291 | iso_pu_bacteria | 2842077413 | 2842078660 | 371 |
| 292 | iso_pu_bacteria | 2842110456 | 2842114886 | 371 |
| 293 | iso_pu_bacteria | 2842118031 | 2842118831 | 371 |
| 294 | iso_pu_bacteria | 2842124991 | 2842125551 | 371 |
| 295 | iso_pu_bacteria | 2842130223 | 2842130746 | 371 |
| 296 | iso_pu_bacteria | 2842146304 | 2842148100 | 371 |
| 297 | iso_pu_bacteria | 2842152218 | 2842154084 | 371 |
| 298 | iso_pu_bacteria | 2842156927 | 2842157947 | 371 |
| 299 | iso_pu_bacteria | 2842163707 | 2842167503 | 371 |
| 300 | iso_pu_bacteria | 2842170452 | 2842170977 | 371 |
| 301 | iso_pu_bacteria | 2842175837 | 2842177704 | 371 |
| 302 | iso_pu_bacteria | 2842180545 | 2842181566 | 371 |
| 303 | iso_pu_bacteria | 2842187318 | 2842187842 | 371 |
| 304 | iso_pu_bacteria | 2842198810 | 2842204487 | 371 |
| 305 | iso_pu_bacteria | 2842211629 | 2842212153 | 371 |
| 306 | iso_pu_bacteria | 2842217011 | 2842217838 | 371 |
| 307 | iso_pu_bacteria | 2842224351 | 2842226228 | 371 |
| 308 | iso_pu_bacteria | 2842229732 | 2842230383 | 371 |
| 309 | iso_pu_bacteria | 2842237096 | 2842239898 | 371 |
| 310 | iso_pu_bacteria | 2842243621 | 2842244285 | 371 |
| 311 | iso_pu_bacteria | 2842250916 | 2842253166 | 371 |
| 312 | iso_pu_bacteria | 2842257432 | 2842257629 | 371 |
| 313 | iso_pu_bacteria | 2842264693 | 2842266172 | 371 |
| 314 | iso_pu_bacteria | 2842271015 | 2842271313 | 371 |
| 315 | iso_pu_bacteria | 2842285085 | 2842285690 | 371 |
| 316 | iso_pu_bacteria | 2842291075 | 2842292322 | 371 |
| 317 | iso_pu_bacteria | 2842298080 | 2842301288 | 371 |
| 318 | iso_pu_bacteria | 2842304105 | 2842304943 | 371 |
| 319 | iso_pu_bacteria | 2842311132 | 2842315005 | 371 |
| 320 | iso_pu_bacteria | 2842317721 | 2842320618 | 371 |
| 321 | iso_pu_bacteria | 2842341865 | 2842346364 | 371 |
| 322 | iso_pu_bacteria | 2842357229 | 2842357825 | 371 |
| 323 | iso_pu_bacteria | 2842363717 | 2842369056 | 371 |
| 324 | iso_pu_bacteria | 2842370503 | 2842372270 | 371 |
| 325 | iso_pu_bacteria | 2842377471 | 2842378719 | 371 |
| 326 | iso_pu_bacteria | 2842384541 | 2842385341 | 371 |
| 327 | iso_pu_bacteria | 2842395702 | 2842399974 | 371 |
| 328 | iso_pu_bacteria | 2842402390 | 2842403050 | 371 |
| 329 | iso_pu_bacteria | 2842409023 | 2842409578 | 371 |
| 330 | iso_pu_bacteria | 2842415677 | 2842416229 | 371 |
| 331 | iso_pu_bacteria | 2842422224 | 2842423851 | 371 |
| 332 | iso_pu_bacteria | 2842428310 | 2842430635 | 371 |
| 333 | iso_pu_bacteria | 2842434925 | 2842437378 | 371 |
| 334 | iso_pu_bacteria | 2842441272 | 2842443748 | 371 |
| 335 | iso_pu_bacteria | 2842447887 | 2842453126 | 371 |
| 336 | iso_pu_bacteria | 2842462802 | 2842464778 | 371 |
| 337 | iso_pu_bacteria | 2842469257 | 2842471996 | 371 |
| 338 | iso_pu_bacteria | 2842475841 | 2842476820 | 371 |
| 339 | iso_pu_bacteria | 2842482326 | 2842484645 | 371 |
| 340 | iso_pu_bacteria | 2842489311 | 2842491888 | 371 |
| 341 | iso_pu_bacteria | 2842495871 | 2842496918 | 371 |
| 342 | iso_pu_bacteria | 2842502639 | 2842503423 | 371 |
| 343 | iso_pu_bacteria | 2842509118 | 2842511216 | 371 |
| 344 | iso_pu_bacteria | 2842515876 | 2842518832 | 371 |
| 345 | iso_pu_bacteria | 2842871566 | 2842871873 | 371 |
| 346 | iso_pu_bacteria | 2844002411 | 2844007287 | 371 |
| 347 | iso_pu_bacteria | 2844009547 | 2844013840 | 371 |
| 348 | iso_pu_bacteria | 2844454524 | 2844458516 | 371 |
| 349 | iso_pu_bacteria | 2847417321 | 2847419318 | 371 |
| 350 | iso_pu_bacteria | 2847686936 | 2847692371 | 371 |
| 351 | iso_pu_bacteria | 2848992105 | 2848994338 | 371 |
| 352 | iso_pu_bacteria | 2852387548 | 2852390126 | 371 |
| 353 | iso_pu_bacteria | 2855872281 | 2855876143 | 371 |
| 354 | iso_pu_bacteria | 2856320880 | 2856325385 | 371 |
| 355 | iso_pu_bacteria | 2856328259 | 2856331237 | 371 |
| 356 | iso_pu_bacteria | 2856334872 | 2856338269 | 371 |
| 357 | iso_pu_bacteria | 2856342000 | 2856347388 | 371 |
| 358 | iso_pu_bacteria | 2857349434 | 2857351025 | 371 |
| 359 | iso_pu_bacteria | 2857367948 | 2857371480 | 371 |
| 360 | iso_pu_bacteria | 2857516855 | 2857517532 | 371 |
| 361 | iso_pu_bacteria | 2869162929 | 2869167124 | 371 |
| 362 | iso_pu_bacteria | 2869169390 | 2869174344 | 371 |
| 363 | iso_pu_bacteria | 2869234852 | 2869236149 | 371 |
| 364 | iso_pu_bacteria | 2869256925 | 2869262685 | 371 |
| 365 | iso_pu_bacteria | 2869264136 | 2869270192 | 371 |
| 366 | iso_pu_bacteria | 2869271264 | 2869277799 | 371 |
| 367 | iso_pu_bacteria | 2869278585 | 2869285072 | 371 |
| 368 | iso_pu_bacteria | 2871444079 | 2871449782 | 371 |
| 369 | iso_pu_bacteria | 2871451962 | 2871455890 | 371 |
| 370 | iso_pu_bacteria | 2871459585 | 2871465413 | 371 |
| 371 | iso_pu_bacteria | 2871474448 | 2871479539 | 371 |
| 372 | iso_pu_bacteria | 2871481445 | 2871481939 | 371 |
| 373 | iso_pu_bacteria | 2874102143 | 2874105756 | 371 |
| 374 | iso_pu_bacteria | 2874109183 | 2874109858 | 371 |
| 375 | iso_pu_bacteria | 2874116593 | 2874119108 | 371 |
| 376 | iso_pu_bacteria | 2874139085 | 2874146012 | 371 |
| 377 | iso_pu_bacteria | 2874146452 | 2874149697 | 371 |
| 378 | iso_pu_bacteria | 2874162495 | 2874165613 | 371 |
| 379 | iso_pu_bacteria | 2874168670 | 2874174670 | 371 |
| 380 | iso_pu_bacteria | 2876363079 | 2876369415 | 371 |
| 381 | iso_pu_bacteria | 2876386047 | 2876389543 | 371 |
| 382 | iso_pu_bacteria | 2876399893 | 2876401453 | 371 |
| 383 | iso_pu_bacteria | 2876406927 | 2876413254 | 371 |
| 384 | iso_pu_bacteria | 2878730984 | 2878735065 | 371 |
| 385 | iso_pu_bacteria | 2878774303 | 2878778092 | 371 |
| 386 | iso_pu_bacteria | 2878781027 | 2878788470 | 371 |
| 387 | iso_pu_bacteria | 2881147464 | 2881151642 | 371 |
| 388 | iso_pu_bacteria | 2881161766 | 2881167662 | 371 |
| 389 | iso_pu_bacteria | 2882632389 | 2882636408 | 371 |
| 390 | iso_pu_bacteria | 2885305155 | 2885309554 | 371 |
| 391 | iso_pu_bacteria | 2888337043 | 2888339561 | 371 |
| 392 | iso_pu_bacteria | 2888350351 | 2888355893 | 371 |
| 393 | iso_pu_bacteria | 2889010040 | 2889010830 | 371 |
| 394 | iso_pu_bacteria | 2889016732 | 2889017474 | 371 |
| 395 | iso_pu_bacteria | 2889790730 | 2889793909 | 371 |
| 396 | iso_pu_bacteria | 2889914905 | 2889916870 | 371 |
| 397 | iso_pu_bacteria | 2891048133 | 2891052151 | 371 |
| 398 | iso_pu_bacteria | 2891373044 | 2891373262 | 371 |
| 399 | iso_pu_bacteria | 2894652903 | 2894656066 | 371 |
| 400 | iso_pu_bacteria | 2894817345 | 2894820308 | 371 |
| 401 | iso_pu_bacteria | 2899792073 | 2899796130 | 371 |
| 402 | iso_pu_bacteria | 2899803654 | 2899807357 | 371 |
| 403 | iso_pu_bacteria | 2899845264 | 2899850714 | 371 |
| 404 | iso_pu_bacteria | 2903448605 | 2903451467 | 371 |
| 405 | iso_pu_bacteria | 2903521522 | 2903522978 | 371 |
| 406 | iso_pu_bacteria | 2903528002 | 2903534562 | 371 |
| 407 | iso_pu_bacteria | 2904578770 | 2904580695 | 371 |
| 408 | iso_pu_bacteria | 2906328253 | 2906329893 | 371 |
| 409 | iso_pu_bacteria | 2906354277 | 2906357988 | 371 |
| 410 | iso_pu_bacteria | 2906370794 | 2906371519 | 371 |
| 411 | iso_pu_bacteria | 2906401398 | 2906402168 | 371 |
| 412 | iso_pu_bacteria | 2906408224 | 2906413924 | 371 |
| 413 | iso_pu_bacteria | 2913308742 | 2913313718 | 371 |
| 414 | iso_pu_bacteria | 2915980308 | 2915981345 | 371 |
| 415 | iso_pu_bacteria | 2916061851 | 2916064261 | 371 |
| 416 | iso_pu_bacteria | 2919100787 | 2919106621 | 371 |
| 417 | iso_pu_bacteria | 2919114240 | 2919114772 | 371 |
| 418 | iso_pu_bacteria | 2919119836 | 2919121591 | 371 |
| 419 | iso_pu_bacteria | 2919166419 | 2919169168 | 371 |
| 420 | iso_pu_bacteria | 2919408235 | 2919409895 | 371 |
| 421 | iso_pu_bacteria | 2920822456 | 2920825117 | 371 |
| 422 | iso_pu_bacteria | 2921250672 | 2921251992 | 371 |
| 423 | iso_pu_bacteria | 2922130491 | 2922138293 | 371 |
| 424 | iso_pu_bacteria | 2922151315 | 2922157230 | 371 |
| 425 | iso_pu_bacteria | 2922158528 | 2922158790 | 371 |
| 426 | iso_pu_bacteria | 2922172374 | 2922172601 | 371 |
| 427 | iso_pu_bacteria | 2922178524 | 2922181717 | 371 |
| 428 | iso_pu_bacteria | 2922185730 | 2922193311 | 371 |
| 429 | iso_pu_bacteria | 2923556063 | 2923558488 | 371 |
| 430 | iso_pu_bacteria | 2924710171 | 2924714009 | 371 |
| 431 | iso_pu_bacteria | 2924718760 | 2924723771 | 371 |
| 432 | iso_pu_bacteria | 2924726620 | 2924727822 | 371 |
| 433 | iso_pu_bacteria | 2924733363 | 2924733537 | 371 |
| 434 | iso_pu_bacteria | 2924741084 | 2924741530 | 371 |
| 435 | iso_pu_bacteria | 2924748358 | 2924749810 | 371 |
| 436 | iso_pu_bacteria | 2926754445 | 2926755788 | 371 |
| 437 | iso_pu_bacteria | 2926760298 | 2926762909 | 371 |
| 438 | iso_pu_bacteria | 2928521798 | 2928523804 | 371 |
| 439 | iso_pu_bacteria | 2929138655 | 2929140787 | 371 |
| 440 | iso_pu_bacteria | 2933006813 | 2933008729 | 371 |
| 441 | iso_pu_bacteria | 2933011516 | 2933014994 | 371 |
| 442 | iso_pu_bacteria | 2933016740 | 2933017495 | 371 |
| 443 | iso_pu_bacteria | 2933570622 | 2933570751 | 371 |
| 444 | iso_pu_bacteria | 2933586486 | 2933591258 | 371 |
| 445 | iso_pu_bacteria | 2933594066 | 2933596673 | 371 |
| 446 | iso_pu_bacteria | 2933599457 | 2933601043 | 371 |
| 447 | iso_pu_bacteria | 2935894831 | 2935900719 | 371 |
| 448 | iso_pu_bacteria | 2935901341 | 2935902053 | 371 |
| 449 | iso_pu_bacteria | 2936367885 | 2936372139 | 371 |
| 450 | iso_pu_bacteria | 2936375103 | 2936381057 | 371 |
| 451 | iso_pu_bacteria | 2936381700 | 2936382985 | 371 |
| 452 | iso_pu_bacteria | 2936996657 | 2936999696 | 371 |
| 453 | iso_pu_bacteria | 2937029754 | 2937030191 | 371 |
| 454 | iso_pu_bacteria | 2937036028 | 2937042571 | 371 |
| 455 | iso_pu_bacteria | 2937078374 | 2937080372 | 371 |
| 456 | iso_pu_bacteria | 2937084907 | 2937085550 | 371 |
| 457 | iso_pu_bacteria | 2937836603 | 2937838100 | 371 |
| 458 | iso_pu_bacteria | 2937848649 | 2937853045 | 371 |
| 459 | iso_pu_bacteria | 2937861824 | 2937863373 | 371 |
| 460 | iso_pu_bacteria | 2937868953 | 2937875148 | 371 |
| 461 | iso_pu_bacteria | 2937891427 | 2937893761 | 371 |
| 462 | iso_pu_bacteria | 2937972304 | 2937978448 | 371 |
| 463 | iso_pu_bacteria | 2937980651 | 2937980755 | 371 |
| 464 | iso_pu_bacteria | 2954011201 | 2954016089 | 371 |
| 465 | iso_pu_bacteria | 2957375807 | 2957376479 | 371 |
| 466 | iso_pu_bacteria | 2957437181 | 2957437643 | 371 |
| 467 | iso_pu_bacteria | 2958034702 | 2958040774 | 371 |
| 468 | iso_pu_bacteria | 2958041894 | 2958056856 | 371 |
| 469 | iso_pu_bacteria | 2958064165 | 2958064169 | 371 |
| 470 | iso_pu_bacteria | 2958100919 | 2958102493 | 371 |
| 471 | iso_pu_bacteria | 2958108152 | 2958114020 | 371 |
| 472 | iso_pu_bacteria | 2958115193 | 2958118573 | 371 |
| 473 | iso_pu_bacteria | 2958122699 | 2958126767 | 371 |
| 474 | iso_pu_bacteria | 2958158011 | 2958163878 | 371 |
| 475 | iso_pu_bacteria | 2958172287 | 2958178595 | 371 |
| 476 | iso_pu_bacteria | 2960591022 | 2960591990 | 371 |
| 477 | iso_pu_bacteria | 2960631154 | 2960631951 | 371 |
| 478 | iso_pu_bacteria | 2960680706 | 2960681526 | 371 |
| 479 | iso_pu_bacteria | 2960693952 | 2960698109 | 371 |
| 480 | iso_pu_bacteria | 2961114664 | 2961120124 | 371 |
| 481 | iso_pu_bacteria | 2961170736 | 2961175916 | 371 |
| 482 | iso_pu_bacteria | 2961183825 | 2961188893 | 371 |
| 483 | iso_pu_bacteria | 2963644680 | 2963647861 | 371 |
| 484 | iso_pu_bacteria | 2965025482 | 2965031414 | 371 |
| 485 | iso_pu_bacteria | 2965032056 | 2965036681 | 371 |
| 486 | iso_pu_bacteria | 2965040258 | 2965041092 | 371 |
| 487 | iso_pu_bacteria | 2965102966 | 2965105362 | 371 |
| 488 | iso_pu_bacteria | 2965110997 | 2965113589 | 371 |
| 489 | iso_pu_bacteria | 2967686174 | 2967688874 | 371 |
| 490 | iso_pu_bacteria | 2967728569 | 2967729092 | 371 |
| 491 | iso_pu_bacteria | 2967996073 | 2968001804 | 371 |
| 492 | iso_pu_bacteria | 2968003550 | 2968009172 | 371 |
| 493 | iso_pu_bacteria | 2968083720 | 2968085984 | 371 |
| 494 | iso_pu_bacteria | 2968091066 | 2968093260 | 371 |
| 495 | iso_pu_bacteria | 2968097103 | 2968102834 | 371 |
| 496 | iso_pu_bacteria | 2968110612 | 2968116481 | 371 |
| 497 | iso_pu_bacteria | 2968138860 | 2968141817 | 371 |
| 498 | iso_pu_bacteria | 2970026789 | 2970030346 | 371 |
| 499 | iso_pu_bacteria | 2970122695 | 2970127019 | 371 |
| 500 | iso_pu_bacteria | 2970143518 | 2970146198 | 371 |
| 501 | iso_pu_bacteria | 2970489779 | 2970492277 | 371 |
| 502 | iso_pu_bacteria | 2970503327 | 2970508581 | 371 |
| 503 | iso_pu_bacteria | 2970510686 | 2970513728 | 371 |
| 504 | iso_pu_bacteria | 2970547951 | 2970554682 | 371 |
| 505 | iso_pu_bacteria | 2970593180 | 2970599686 | 371 |
| 506 | iso_pu_bacteria | 2970619444 | 2970623441 | 371 |
| 507 | iso_pu_bacteria | 2970627176 | 2970627920 | 371 |
| 508 | iso_pu_bacteria | 2977530762 | 2977534338 | 371 |
| 509 | iso_pu_bacteria | 2977544691 | 2977547705 | 371 |
| 510 | iso_pu_bacteria | 2977821940 | 2977827545 | 371 |
| 511 | iso_pu_bacteria | 2977828996 | 2977835260 | 371 |
| 512 | iso_pu_bacteria | 2977851361 | 2977851425 | 371 |
| 513 | iso_pu_bacteria | 2977858184 | 2977861871 | 371 |
| 514 | iso_pu_bacteria | 2977864932 | 2977866964 | 371 |
| 515 | iso_pu_bacteria | 2977872689 | 2977876828 | 371 |
| 516 | iso_pu_bacteria | 2977907340 | 2977911942 | 371 |
| 517 | iso_pu_bacteria | 2977915119 | 2977921553 | 371 |
| 518 | iso_pu_bacteria | 2977935797 | 2977939586 | 371 |
| 519 | iso_pu_bacteria | 2977950692 | 2977956176 | 371 |
| 520 | iso_pu_bacteria | 2977986579 | 2977991539 | 371 |
| 521 | iso_pu_bacteria | 2978969890 | 2978974544 | 371 |
| 522 | iso_pu_bacteria | 2979089926 | 2979094599 | 371 |
| 523 | iso_pu_bacteria | 2979095461 | 2979100836 | 371 |
| 524 | iso_pu_bacteria | 2979100975 | 2979103840 | 371 |
| 525 | iso_pu_bacteria | 2979710463 | 2979711367 | 371 |
| 526 | iso_pu_bacteria | 2979742915 | 2979747633 | 371 |
| 527 | iso_pu_bacteria | 2979764755 | 2979769779 | 371 |
| 528 | iso_pu_bacteria | 2979779861 | 2979782735 | 371 |
| 529 | iso_pu_bacteria | 2979793036 | 2979797358 | 371 |
| 530 | iso_pu_bacteria | 2979808191 | 2979811770 | 371 |
| 531 | iso_pu_bacteria | 2984509177 | 2984511593 | 371 |
| 532 | iso_pu_bacteria | 2984518228 | 2984522046 | 371 |
| 533 | iso_pu_bacteria | 2984537506 | 2984541344 | 371 |
| 534 | iso_pu_bacteria | 2984587000 | 2984589862 | 371 |
| 535 | iso_pu_bacteria | 2984601300 | 2984603621 | 371 |
| 536 | iso_pu_bacteria | 2987652177 | 2987655066 | 371 |
| 537 | iso_pu_bacteria | 2987673487 | 2987679276 | 371 |
| 538 | iso_pu_bacteria | 2989349275 | 2989349564 | 371 |
| 539 | iso_pu_bacteria | 2995392953 | 2995393356 | 371 |
| 540 | iso_pu_bacteria | 2996336353 | 2996340486 | 371 |
| 541 | iso_pu_bacteria | 2996386984 | 2996388168 | 371 |
| 542 | iso_pu_bacteria | 2996887358 | 2996889120 | 371 |
| 543 | iso_pu_bacteria | 2996893221 | 2996896448 | 371 |
| 544 | iso_pu_bacteria | 3000135777 | 3000140523 | 371 |
| 545 | iso_pu_bacteria | 3002141150 | 3002144686 | 371 |
| 546 | iso_pu_bacteria | 3003930520 | 3003933932 | 371 |
| 547 | iso_pu_bacteria | 3004167301 | 3004169047 | 371 |
| 548 | iso_pu_bacteria | 3004188549 | 3004193950 | 371 |
| 549 | iso_pu_bacteria | 3004232784 | 3004235998 | 371 |
| 550 | iso_pu_bacteria | 3004239961 | 3004246043 | 371 |
| 551 | iso_pu_bacteria | 3004248173 | 3004250278 | 371 |
| 552 | iso_pu_bacteria | 3004268573 | 3004273646 | 371 |
| 553 | iso_pu_bacteria | 3004334049 | 3004334196 | 371 |
| 554 | iso_pu_bacteria | 3005409236 | 3005414711 | 371 |
| 555 | iso_pu_bacteria | 3005416602 | 3005419904 | 371 |
| 556 | iso_pu_bacteria | 3005445848 | 3005448347 | 371 |
| 557 | iso_pu_bacteria | 3005452660 | 3005454553 | 371 |
| 558 | iso_pu_bacteria | 637000159 | 637074458 | 371 |
| 559 | iso_pu_bacteria | 639633055 | 639649098 | 371 |
| 560 | iso_pu_bacteria | 643692032 | 643826204 | 371 |
| 561 | iso_pu_bacteria | 649633066 | 649873105 | 371 |
| 562 | iso_pu_bacteria | 650716007 | 650740478 | 371 |
| 563 | iso_pu_bacteria | 8003570095 | 8003571545 | 371 |
| 564 | iso_pu_bacteria | 8003999396 | 8004001701 | 371 |
| 565 | iso_pu_bacteria | 8004300914 | 8004303291 | 371 |
| 566 | iso_pu_bacteria | 8004312739 | 8004313248 | 371 |
| 567 | iso_pu_bacteria | 8004361976 | 8004362077 | 371 |
| 568 | iso_pu_bacteria | 8004374579 | 8004380526 | 371 |
| 569 | iso_pu_bacteria | 8004445564 | 8004451397 | 371 |
| 570 | iso_pu_bacteria | 8004633249 | 8004638295 | 371 |
| 571 | iso_pu_bacteria | 8004640170 | 8004640683 | 371 |
| 572 | iso_pu_bacteria | 8004695233 | 8004702267 | 371 |
| 573 | iso_pu_bacteria | 8004703790 | 8004709475 | 371 |
| 574 | iso_pu_bacteria | 8004727605 | 8004730314 | 371 |
| 575 | iso_pu_bacteria | 8005246636 | 8005248691 | 371 |
| 576 | iso_pu_bacteria | 8005258706 | 8005262273 | 371 |
| 577 | iso_pu_bacteria | 8005275841 | 8005281036 | 371 |
| 578 | iso_pu_bacteria | 8005282627 | 8005283353 | 371 |
| 579 | iso_pu_bacteria | 8005289223 | 8005293545 | 371 |
| 580 | iso_pu_bacteria | 8005301065 | 8005303029 | 371 |
| 581 | iso_pu_bacteria | 8005307578 | 8005312736 | 371 |
| 582 | iso_pu_bacteria | 8005314921 | 8005316855 | 371 |
| 583 | iso_pu_bacteria | 8005321885 | 8005323647 | 371 |
| 584 | iso_pu_bacteria | 8005376324 | 8005380831 | 371 |
| 585 | iso_pu_bacteria | 8005382845 | 8005385298 | 371 |
| 586 | iso_pu_bacteria | 8005395548 | 8005396216 | 371 |
| 587 | iso_pu_bacteria | 8005430974 | 8005435061 | 371 |
| 588 | iso_pu_bacteria | 8005460587 | 8005463582 | 371 |
| 589 | iso_pu_bacteria | 8005484373 | 8005485342 | 371 |
| 590 | iso_pu_bacteria | 8005497431 | 8005500800 | 371 |
| 591 | iso_pu_bacteria | 8005542996 | 8005545515 | 371 |
| 592 | iso_pu_bacteria | 8005556819 | 8005557111 | 371 |
| 593 | iso_pu_bacteria | 8005563573 | 8005567894 | 371 |
| 594 | iso_pu_bacteria | 8005570704 | 8005573560 | 371 |
| 595 | iso_pu_bacteria | 8005619151 | 8005622176 | 371 |
| 596 | iso_pu_bacteria | 8005626139 | 8005632347 | 371 |
| 597 | iso_pu_bacteria | 8005645114 | 8005649668 | 371 |
| 598 | iso_pu_bacteria | 8005668836 | 8005672218 | 371 |
| 599 | iso_pu_bacteria | 8005682033 | 8005682978 | 371 |
| 600 | iso_pu_bacteria | 8005688590 | 8005692201 | 371 |
| 601 | iso_pu_bacteria | 8005695170 | 8005697306 | 371 |
| 602 | iso_pu_bacteria | 8018127388 | 8018134001 | 371 |
| 603 | iso_pu_bacteria | 8018163183 | 8018163851 | 371 |
| 604 | iso_pu_bacteria | 8018176218 | 8018181416 | 371 |
| 605 | iso_pu_bacteria | 8023680758 | 8023683265 | 371 |
| 606 | iso_pu_bacteria | 8024479707 | 8024482963 | 371 |
| 607 | iso_pu_bacteria | 8024486573 | 8024487940 | 371 |
| 608 | iso_pu_bacteria | 8024501048 | 8024504267 | 371 |
| 609 | iso_pu_bacteria | 8045864390 | 8045864657 | 371 |
| 610 | iso_pu_bacteria | 8046767195 | 8046772260 | 371 |
| 611 | iso_pu_bacteria | 8054460903 | 8054462901 | 371 |
| 612 | iso_pu_bacteria | 8056375014 | 8056378435 | 371 |
| 613 | iso_pu_bacteria | 8056382006 | 8056386632 | 371 |
| 614 | iso_pu_bacteria | 8056875544 | 8056877369 | 371 |
| 615 | iso_pu_bacteria | 8057575449 | 8057575826 | 371 |
| 616 | iso_pu_bacteria | 8057874678 | 8057877336 | 371 |
| 617 | 3300003578 | Ga0006562J51391_1019610 | Ga0006562J51391_10196102 | 373 |
| 618 | 3300006038 | Ga0075365_10003238 | Ga0075365_100032384 | 373 |
| 619 | 3300050492 | nmdc:mga0yw44_1670_c2 | nmdc:mga0yw44_1670_c2_4556_5773 | 373 |
| 620 | iso_pu_bacteria | 2751185800 | 2753359712 | 373 |
| 621 | 3300003792 | Ga0055540_1002778 | Ga0055540_100277811 | 374 |
| 622 | 3300005262 | Ga0065165_1003952 | Ga0065165_10039526 | 374 |
| 623 | 3300005548 | Ga0070665_100062656 | Ga0070665_1000626562 | 374 |
| 624 | 3300006051 | Ga0075364_10000201 | Ga0075364_1000020112 | 374 |
| 625 | 3300006946 | Ga0079104_1000193 | Ga0079104_10001936 | 374 |
| 626 | 3300025297 | Ga0209758_1000642 | Ga0209758_100064244 | 374 |
| 627 | 3300025298 | Ga0209050_1002400 | Ga0209050_10024002 | 374 |
| 628 | 3300025303 | Ga0209051_1030731 | Ga0209051_10307312 | 374 |
| 629 | 3300025304 | Ga0209257_1019949 | Ga0209257_10199492 | 374 |
| 630 | 3300027111 | Ga0209281_1000034 | Ga0209281_10000346 | 374 |
| 631 | 3300028379 | Ga0268266_10128965 | Ga0268266_101289651 | 374 |
| 632 | 3300046530 | Ga0495654_0000254 | Ga0495654_0000254_45473_46597 | 374 |
| 633 | 3300048913 | Ga0496110_0289290 | Ga0496110_0289290_29_1153 | 374 |
| 634 | 3300048914 | Ga0496111_0000592 | Ga0496111_0000592_2781_3905 | 374 |
| 635 | 3300048924 | Ga0496121_0000363 | Ga0496121_0000363_19156_20340 | 374 |
| 636 | 3300048925 | Ga0496122_0000369 | Ga0496122_0000369_2677_3801 | 374 |
| 637 | 3300048925 | Ga0496122_0047231 | Ga0496122_0047231_640_1764 | 374 |
| 638 | 3300048926 | Ga0496123_0000054 | Ga0496123_0000054_60993_62117 | 374 |
| 639 | 3300048926 | Ga0496123_0011197 | Ga0496123_0011197_4636_5760 | 374 |
| 640 | 3300050491 | nmdc:mga00v17_109_c1 | nmdc:mga00v17_109_c1_17046_18170 | 374 |
| 641 | 3300053125 | Ga0500618_000361 | Ga0500618_000361_17135_18259 | 374 |
| 642 | 3300053125 | Ga0500618_001657 | Ga0500618_001657_2611_3735 | 374 |
| 643 | 3300053125 | Ga0500618_016697 | Ga0500618_016697_637_1761 | 374 |
| 644 | 3300001979 | JGI24740J21852_10031325 | JGI24740J21852_100313251 | 375 |
| 645 | 3300002704 | JGI25155J39150_1000001 | JGI25155J39150_1000001209 | 375 |
| 646 | 3300002705 | JGI25156J39149_1000001 | JGI25156J39149_1000001124 | 375 |
| 647 | 3300002737 | JGI25162J39368_1000380 | JGI25162J39368_100038022 | 375 |
| 648 | 3300002737 | JGI25162J39368_1000534 | JGI25162J39368_10005343 | 375 |
| 649 | 3300002738 | JGI25154J39366_1000011 | JGI25154J39366_1000011260 | 375 |
| 650 | 3300002739 | JGI25158J39367_1000129 | JGI25158J39367_100012910 | 375 |
| 651 | 3300002741 | JGI25157J39369_1000079 | JGI25157J39369_100007979 | 375 |
| 652 | 3300002741 | JGI25157J39369_1000237 | JGI25157J39369_100023733 | 375 |
| 653 | 3300002773 | JGI25152J39213_1000826 | JGI25152J39213_10008263 | 375 |
| 654 | 3300002773 | JGI25152J39213_1003179 | JGI25152J39213_10031794 | 375 |
| 655 | 3300002773 | JGI25152J39213_1007411 | JGI25152J39213_10074112 | 375 |
| 656 | 3300002774 | JGI25150J39212_1000165 | JGI25150J39212_100016511 | 375 |
| 657 | 3300002774 | JGI25150J39212_1000307 | JGI25150J39212_100030725 | 375 |
| 658 | 3300002774 | JGI25150J39212_1007748 | JGI25150J39212_10077482 | 375 |
| 659 | 3300002987 | JGI25159J45721_1000040 | JGI25159J45721_100004022 | 375 |
| 660 | 3300002987 | JGI25159J45721_1000613 | JGI25159J45721_100061316 | 375 |
| 661 | 3300002987 | JGI25159J45721_1001660 | JGI25159J45721_10016606 | 375 |
| 662 | 3300003187 | JGI25151J46595_10000329 | JGI25151J46595_1000032925 | 375 |
| 663 | 3300003187 | JGI25151J46595_10011722 | JGI25151J46595_100117222 | 375 |
| 664 | 3300003187 | JGI25151J46595_10027067 | JGI25151J46595_100270672 | 375 |
| 665 | 3300003214 | JGI25165J46597_1000015 | JGI25165J46597_100001546 | 375 |
| 666 | 3300003214 | JGI25165J46597_1000422 | JGI25165J46597_100042220 | 375 |
| 667 | 3300003214 | JGI25165J46597_1001018 | JGI25165J46597_100101814 | 375 |
| 668 | 3300003214 | JGI25165J46597_1004651 | JGI25165J46597_10046511 | 375 |
| 669 | 3300003215 | JGI25153J46596_10001789 | JGI25153J46596_100017898 | 375 |
| 670 | 3300003215 | JGI25153J46596_10003058 | JGI25153J46596_1000305811 | 375 |
| 671 | 3300003215 | JGI25153J46596_10003631 | JGI25153J46596_1000363111 | 375 |
| 672 | 3300003322 | rootL2_10016257 | rootL2_100162578 | 375 |
| 673 | 3300003354 | JGI25160J50197_1000001 | JGI25160J50197_1000001735 | 375 |
| 674 | 3300003354 | JGI25160J50197_1000128 | JGI25160J50197_100012859 | 375 |
| 675 | 3300003354 | JGI25160J50197_1000397 | JGI25160J50197_100039724 | 375 |
| 676 | 3300003374 | JGI25161J50226_1000001 | JGI25161J50226_100000115 | 375 |
| 677 | 3300003374 | JGI25161J50226_1000099 | JGI25161J50226_100009915 | 375 |
| 678 | 3300003374 | JGI25161J50226_1000140 | JGI25161J50226_100014038 | 375 |
| 679 | 3300003374 | JGI25161J50226_1000921 | JGI25161J50226_10009215 | 375 |
| 680 | 3300003762 | Ga0055542_1000519 | Ga0055542_100051930 | 375 |
| 681 | 3300003763 | Ga0055529_1002792 | Ga0055529_10027923 | 375 |
| 682 | 3300003771 | Ga0055526_1000484 | Ga0055526_100048420 | 375 |
| 683 | 3300003771 | Ga0055526_1009798 | Ga0055526_10097982 | 375 |
| 684 | 3300003771 | Ga0055526_1010515 | Ga0055526_10105155 | 375 |
| 685 | 3300003771 | Ga0055526_1013767 | Ga0055526_10137672 | 375 |
| 686 | 3300003775 | Ga0055524_1001085 | Ga0055524_10010855 | 375 |
| 687 | 3300003775 | Ga0055524_1003087 | Ga0055524_10030878 | 375 |
| 688 | 3300003775 | Ga0055524_1007173 | Ga0055524_10071734 | 375 |
| 689 | 3300003775 | Ga0055524_1019611 | Ga0055524_10196112 | 375 |
| 690 | 3300003775 | Ga0055524_1028804 | Ga0055524_10288041 | 375 |
| 691 | 3300003781 | Ga0055536_1006588 | Ga0055536_10065882 | 375 |
| 692 | 3300003790 | Ga0055528_1000962 | Ga0055528_10009629 | 375 |
| 693 | 3300003790 | Ga0055528_1001865 | Ga0055528_100186514 | 375 |
| 694 | 3300003790 | Ga0055528_1002431 | Ga0055528_100243112 | 375 |
| 695 | 3300003790 | Ga0055528_1012566 | Ga0055528_10125663 | 375 |
| 696 | 3300003792 | Ga0055540_1000283 | Ga0055540_100028330 | 375 |
| 697 | 3300003792 | Ga0055540_1001971 | Ga0055540_10019714 | 375 |
| 698 | 3300003792 | Ga0055540_1028922 | Ga0055540_10289221 | 375 |
| 699 | 3300003856 | Ga0058692_1001129 | Ga0058692_10011299 | 375 |
| 700 | 3300003856 | Ga0058692_1003154 | Ga0058692_10031546 | 375 |
| 701 | 3300004625 | Ga0055543_1000003 | Ga0055543_100000331 | 375 |
| 702 | 3300004625 | Ga0055543_1000128 | Ga0055543_100012825 | 375 |
| 703 | 3300004625 | Ga0055543_1000130 | Ga0055543_100013019 | 375 |
| 704 | 3300004625 | Ga0055543_1000438 | Ga0055543_100043822 | 375 |
| 705 | 3300005262 | Ga0065165_1000013 | Ga0065165_1000013280 | 375 |
| 706 | 3300005262 | Ga0065165_1000068 | Ga0065165_1000068137 | 375 |
| 707 | 3300005262 | Ga0065165_1007614 | Ga0065165_10076144 | 375 |
| 708 | 3300005262 | Ga0065165_1011139 | Ga0065165_10111392 | 375 |
| 709 | 3300005262 | Ga0065165_1015958 | Ga0065165_10159582 | 375 |
| 710 | 3300005331 | Ga0070670_100004125 | Ga0070670_10000412510 | 375 |
| 711 | 3300005347 | Ga0070668_100016609 | Ga0070668_1000166092 | 375 |
| 712 | 3300005353 | Ga0070669_100079852 | Ga0070669_1000798521 | 375 |
| 713 | 3300005455 | Ga0070663_100020865 | Ga0070663_1000208654 | 375 |
| 714 | 3300005459 | Ga0068867_100134879 | Ga0068867_1001348792 | 375 |
| 715 | 3300005539 | Ga0068853_100013344 | Ga0068853_1000133446 | 375 |
| 716 | 3300005548 | Ga0070665_100143222 | Ga0070665_1001432223 | 375 |
| 717 | 3300005548 | Ga0070665_100209938 | Ga0070665_1002099382 | 375 |
| 718 | 3300005614 | Ga0068856_100025945 | Ga0068856_1000259455 | 375 |
| 719 | 3300005614 | Ga0068856_100097085 | Ga0068856_1000970851 | 375 |
| 720 | 3300005983 | Ga0081540_1032190 | Ga0081540_10321902 | 375 |
| 721 | 3300005985 | Ga0081539_10009861 | Ga0081539_100098616 | 375 |
| 722 | 3300006038 | Ga0075365_10005895 | Ga0075365_100058954 | 375 |
| 723 | 3300006038 | Ga0075365_10022146 | Ga0075365_100221463 | 375 |
| 724 | 3300006038 | Ga0075365_10024459 | Ga0075365_100244594 | 375 |
| 725 | 3300006038 | Ga0075365_10035692 | Ga0075365_100356924 | 375 |
| 726 | 3300006038 | Ga0075365_10091646 | Ga0075365_100916462 | 375 |
| 727 | 3300006048 | Ga0075363_100040032 | Ga0075363_1000400323 | 375 |
| 728 | 3300006051 | Ga0075364_10020218 | Ga0075364_100202185 | 375 |
| 729 | 3300006051 | Ga0075364_10061726 | Ga0075364_100617262 | 375 |
| 730 | 3300006178 | Ga0075367_10015244 | Ga0075367_100152441 | 375 |
| 731 | 3300006178 | Ga0075367_10023023 | Ga0075367_100230233 | 375 |
| 732 | 3300006178 | Ga0075367_10043918 | Ga0075367_100439184 | 375 |
| 733 | 3300006186 | Ga0075369_10000132 | Ga0075369_1000013213 | 375 |
| 734 | 3300006186 | Ga0075369_10001343 | Ga0075369_100013437 | 375 |
| 735 | 3300006186 | Ga0075369_10004049 | Ga0075369_100040492 | 375 |
| 736 | 3300006186 | Ga0075369_10014342 | Ga0075369_100143422 | 375 |
| 737 | 3300006195 | Ga0075366_10008456 | Ga0075366_100084564 | 375 |
| 738 | 3300006195 | Ga0075366_10039554 | Ga0075366_100395543 | 375 |
| 739 | 3300006353 | Ga0075370_10011704 | Ga0075370_100117044 | 375 |
| 740 | 3300006353 | Ga0075370_10130222 | Ga0075370_101302222 | 375 |
| 741 | 3300006946 | Ga0079104_1005344 | Ga0079104_10053445 | 375 |
| 742 | 3300006948 | Ga0099826_10001077 | Ga0099826_100010778 | 375 |
| 743 | 3300006948 | Ga0099826_10001302 | Ga0099826_100013026 | 375 |
| 744 | 3300009036 | Ga0105244_10094727 | Ga0105244_100947272 | 375 |
| 745 | 3300009092 | Ga0105250_10063915 | Ga0105250_100639151 | 375 |
| 746 | 3300009093 | Ga0105240_10000076 | Ga0105240_1000007678 | 375 |
| 747 | 3300009148 | Ga0105243_10010781 | Ga0105243_100107814 | 375 |
| 748 | 3300009148 | Ga0105243_10136372 | Ga0105243_101363722 | 375 |
| 749 | 3300009174 | Ga0105241_10047868 | Ga0105241_100478684 | 375 |
| 750 | 3300009177 | Ga0105248_10258531 | Ga0105248_102585312 | 375 |
| 751 | 3300009545 | Ga0105237_10011962 | Ga0105237_1001196210 | 375 |
| 752 | 3300009545 | Ga0105237_10099343 | Ga0105237_100993434 | 375 |
| 753 | 3300009551 | Ga0105238_10005101 | Ga0105238_100051017 | 375 |
| 754 | 3300009765 | Ga0123341_1000032 | Ga0123341_100003240 | 375 |
| 755 | 3300009766 | Ga0123342_1005565 | Ga0123342_100556517 | 375 |
| 756 | 3300009766 | Ga0123342_1027673 | Ga0123342_10276733 | 375 |
| 757 | 3300010375 | Ga0105239_10016340 | Ga0105239_100163406 | 375 |
| 758 | 3300010375 | Ga0105239_10170562 | Ga0105239_101705623 | 375 |
| 759 | 3300010375 | Ga0105239_10178087 | Ga0105239_101780873 | 375 |
| 760 | 3300013100 | Ga0157373_10050627 | Ga0157373_100506272 | 375 |
| 761 | 3300013102 | Ga0157371_10000908 | Ga0157371_1000090811 | 375 |
| 762 | 3300013102 | Ga0157371_10053052 | Ga0157371_100530522 | 375 |
| 763 | 3300013104 | Ga0157370_10000282 | Ga0157370_1000028243 | 375 |
| 764 | 3300013104 | Ga0157370_10000351 | Ga0157370_1000035142 | 375 |
| 765 | 3300013105 | Ga0157369_10068419 | Ga0157369_100684195 | 375 |
| 766 | 3300013249 | Ga0171463_1003 | Ga0171463_1003258 | 375 |
| 767 | 3300013307 | Ga0157372_10410434 | Ga0157372_104104342 | 375 |
| 768 | 3300015262 | Ga0182007_10005359 | Ga0182007_100053595 | 375 |
| 769 | 3300015265 | Ga0182005_1005134 | Ga0182005_10051342 | 375 |
| 770 | 3300015690 | Ga0183363_1104 | Ga0183363_110415 | 375 |
| 771 | 3300021320 | Ga0214544_1000161 | Ga0214544_100016157 | 375 |
| 772 | 3300021321 | Ga0214542_1000012 | Ga0214542_1000012167 | 375 |
| 773 | 3300021321 | Ga0214542_1022883 | Ga0214542_10228833 | 375 |
| 774 | 3300021327 | Ga0214543_1000024 | Ga0214543_1000024168 | 375 |
| 775 | 3300021327 | Ga0214543_1000038 | Ga0214543_1000038154 | 375 |
| 776 | 3300022739 | Ga0228711_1000008 | Ga0228711_1000008132 | 375 |
| 777 | 3300022740 | Ga0228710_1000009 | Ga0228710_1000009131 | 375 |
| 778 | 3300025206 | Ga0209435_100012 | Ga0209435_100012260 | 375 |
| 779 | 3300025208 | Ga0209436_100029 | Ga0209436_10002978 | 375 |
| 780 | 3300025208 | Ga0209436_100478 | Ga0209436_10047818 | 375 |
| 781 | 3300025208 | Ga0209436_103096 | Ga0209436_1030965 | 375 |
| 782 | 3300025228 | Ga0209672_106122 | Ga0209672_1061222 | 375 |
| 783 | 3300025233 | Ga0209437_100047 | Ga0209437_10004734 | 375 |
| 784 | 3300025233 | Ga0209437_100242 | Ga0209437_10024262 | 375 |
| 785 | 3300025245 | Ga0207425_1000024 | Ga0207425_1000024280 | 375 |
| 786 | 3300025245 | Ga0207425_1012717 | Ga0207425_10127172 | 375 |
| 787 | 3300025246 | Ga0209646_1000026 | Ga0209646_1000026260 | 375 |
| 788 | 3300025250 | Ga0209026_1000014 | Ga0209026_1000014260 | 375 |
| 789 | 3300025250 | Ga0209026_1000025 | Ga0209026_1000025271 | 375 |
| 790 | 3300025253 | Ga0209677_102528 | Ga0209677_1025287 | 375 |
| 791 | 3300025254 | Ga0209148_1000128 | Ga0209148_1000128139 | 375 |
| 792 | 3300025256 | Ga0209759_1000012 | Ga0209759_1000012260 | 375 |
| 793 | 3300025256 | Ga0209759_1000057 | Ga0209759_100005740 | 375 |
| 794 | 3300025258 | Ga0209129_1000146 | Ga0209129_100014676 | 375 |
| 795 | 3300025258 | Ga0209129_1000161 | Ga0209129_100016185 | 375 |
| 796 | 3300025258 | Ga0209129_1000384 | Ga0209129_100038412 | 375 |
| 797 | 3300025258 | Ga0209129_1005814 | Ga0209129_10058142 | 375 |
| 798 | 3300025261 | Ga0209233_1000010 | Ga0209233_1000010144 | 375 |
| 799 | 3300025261 | Ga0209233_1000048 | Ga0209233_1000048367 | 375 |
| 800 | 3300025261 | Ga0209233_1000069 | Ga0209233_100006970 | 375 |
| 801 | 3300025261 | Ga0209233_1000260 | Ga0209233_100026022 | 375 |
| 802 | 3300025261 | Ga0209233_1011159 | Ga0209233_10111594 | 375 |
| 803 | 3300025272 | Ga0209455_1000492 | Ga0209455_100049222 | 375 |
| 804 | 3300025273 | Ga0209673_1000010 | Ga0209673_1000010105 | 375 |
| 805 | 3300025273 | Ga0209673_1000384 | Ga0209673_100038467 | 375 |
| 806 | 3300025273 | Ga0209673_1000977 | Ga0209673_100097714 | 375 |
| 807 | 3300025273 | Ga0209673_1001611 | Ga0209673_100161120 | 375 |
| 808 | 3300025273 | Ga0209673_1004894 | Ga0209673_10048944 | 375 |
| 809 | 3300025273 | Ga0209673_1008652 | Ga0209673_10086524 | 375 |
| 810 | 3300025273 | Ga0209673_1020948 | Ga0209673_10209482 | 375 |
| 811 | 3300025284 | Ga0209130_1000003 | Ga0209130_100000341 | 375 |
| 812 | 3300025284 | Ga0209130_1000020 | Ga0209130_1000020346 | 375 |
| 813 | 3300025284 | Ga0209130_1000034 | Ga0209130_1000034270 | 375 |
| 814 | 3300025292 | Ga0209676_1014384 | Ga0209676_10143843 | 375 |
| 815 | 3300025294 | Ga0209025_1000050 | Ga0209025_100005047 | 375 |
| 816 | 3300025294 | Ga0209025_1000058 | Ga0209025_1000058246 | 375 |
| 817 | 3300025294 | Ga0209025_1000140 | Ga0209025_1000140153 | 375 |
| 818 | 3300025294 | Ga0209025_1000216 | Ga0209025_10002169 | 375 |
| 819 | 3300025294 | Ga0209025_1000405 | Ga0209025_100040575 | 375 |
| 820 | 3300025294 | Ga0209025_1006154 | Ga0209025_10061542 | 375 |
| 821 | 3300025295 | Ga0209564_1000013 | Ga0209564_1000013268 | 375 |
| 822 | 3300025295 | Ga0209564_1000388 | Ga0209564_100038867 | 375 |
| 823 | 3300025295 | Ga0209564_1000512 | Ga0209564_100051252 | 375 |
| 824 | 3300025295 | Ga0209564_1001530 | Ga0209564_100153022 | 375 |
| 825 | 3300025295 | Ga0209564_1006762 | Ga0209564_10067623 | 375 |
| 826 | 3300025295 | Ga0209564_1011654 | Ga0209564_10116542 | 375 |
| 827 | 3300025297 | Ga0209758_1000083 | Ga0209758_1000083210 | 375 |
| 828 | 3300025297 | Ga0209758_1002719 | Ga0209758_100271922 | 375 |
| 829 | 3300025297 | Ga0209758_1003069 | Ga0209758_10030692 | 375 |
| 830 | 3300025297 | Ga0209758_1003364 | Ga0209758_100336416 | 375 |
| 831 | 3300025297 | Ga0209758_1018176 | Ga0209758_10181762 | 375 |
| 832 | 3300025298 | Ga0209050_1004042 | Ga0209050_10040424 | 375 |
| 833 | 3300025298 | Ga0209050_1010948 | Ga0209050_10109482 | 375 |
| 834 | 3300025299 | Ga0209256_1000442 | Ga0209256_100044249 | 375 |
| 835 | 3300025299 | Ga0209256_1000738 | Ga0209256_100073842 | 375 |
| 836 | 3300025299 | Ga0209256_1001584 | Ga0209256_100158418 | 375 |
| 837 | 3300025299 | Ga0209256_1004887 | Ga0209256_10048874 | 375 |
| 838 | 3300025299 | Ga0209256_1006190 | Ga0209256_10061907 | 375 |
| 839 | 3300025299 | Ga0209256_1020856 | Ga0209256_10208561 | 375 |
| 840 | 3300025302 | Ga0207426_1000006 | Ga0207426_1000006643 | 375 |
| 841 | 3300025302 | Ga0207426_1000008 | Ga0207426_1000008413 | 375 |
| 842 | 3300025302 | Ga0207426_1000011 | Ga0207426_1000011737 | 375 |
| 843 | 3300025302 | Ga0207426_1000221 | Ga0207426_100022131 | 375 |
| 844 | 3300025302 | Ga0207426_1002076 | Ga0207426_100207613 | 375 |
| 845 | 3300025303 | Ga0209051_1000308 | Ga0209051_100030849 | 375 |
| 846 | 3300025303 | Ga0209051_1008939 | Ga0209051_10089396 | 375 |
| 847 | 3300025303 | Ga0209051_1011377 | Ga0209051_10113774 | 375 |
| 848 | 3300025303 | Ga0209051_1024303 | Ga0209051_10243033 | 375 |
| 849 | 3300025303 | Ga0209051_1029576 | Ga0209051_10295762 | 375 |
| 850 | 3300025304 | Ga0209257_1000853 | Ga0209257_100085334 | 375 |
| 851 | 3300025304 | Ga0209257_1027599 | Ga0209257_10275992 | 375 |
| 852 | 3300025911 | Ga0207654_10019351 | Ga0207654_100193514 | 375 |
| 853 | 3300025913 | Ga0207695_10000011 | Ga0207695_10000011120 | 375 |
| 854 | 3300025913 | Ga0207695_10179849 | Ga0207695_101798492 | 375 |
| 855 | 3300025914 | Ga0207671_10000093 | Ga0207671_100000938 | 375 |
| 856 | 3300025925 | Ga0207650_10012844 | Ga0207650_100128442 | 375 |
| 857 | 3300025972 | Ga0207668_10007707 | Ga0207668_100077074 | 375 |
| 858 | 3300026041 | Ga0207639_10028714 | Ga0207639_100287145 | 375 |
| 859 | 3300026067 | Ga0207678_10254862 | Ga0207678_102548622 | 375 |
| 860 | 3300026078 | Ga0207702_10018061 | Ga0207702_100180615 | 375 |
| 861 | 3300026089 | Ga0207648_10107359 | Ga0207648_101073593 | 375 |
| 862 | 3300027111 | Ga0209281_1000106 | Ga0209281_100010698 | 375 |
| 863 | 3300027111 | Ga0209281_1000426 | Ga0209281_100042649 | 375 |
| 864 | 3300027312 | Ga0209371_1000022 | Ga0209371_100002215 | 375 |
| 865 | 3300027312 | Ga0209371_1003118 | Ga0209371_10031188 | 375 |
| 866 | 3300027666 | Ga0209282_1000024 | Ga0209282_100002429 | 375 |
| 867 | 3300027666 | Ga0209282_1000646 | Ga0209282_100064612 | 375 |
| 868 | 3300028379 | Ga0268266_10023807 | Ga0268266_100238073 | 375 |
| 869 | 3300028379 | Ga0268266_10131348 | Ga0268266_101313483 | 375 |
| 870 | 3300028379 | Ga0268266_10168964 | Ga0268266_101689642 | 375 |
| 871 | 3300028794 | Ga0307515_10000307 | Ga0307515_1000030730 | 375 |
| 872 | 3300028794 | Ga0307515_10000788 | Ga0307515_1000078825 | 375 |
| 873 | 3300028794 | Ga0307515_10109955 | Ga0307515_101099553 | 375 |
| 874 | 3300030500 | Ga0268256_1000019 | Ga0268256_1000019505 | 375 |
| 875 | 3300030500 | Ga0268256_1005962 | Ga0268256_10059624 | 375 |
| 876 | 3300031456 | Ga0307513_10086474 | Ga0307513_100864744 | 375 |
| 877 | 3300031691 | Ga0316579_10044926 | Ga0316579_100449263 | 375 |
| 878 | 3300031731 | Ga0307405_10001398 | Ga0307405_1000139812 | 375 |
| 879 | 3300031901 | Ga0307406_10011163 | Ga0307406_100111638 | 375 |
| 880 | 3300031911 | Ga0307412_10008584 | Ga0307412_100085846 | 375 |
| 881 | 3300031967 | Ga0315914_1000012 | Ga0315914_1000012133 | 375 |
| 882 | 3300031995 | Ga0307409_100215038 | Ga0307409_1002150381 | 375 |
| 883 | 3300031995 | Ga0307409_100284723 | Ga0307409_1002847232 | 375 |
| 884 | 3300033430 | Ga0315913_1000006 | Ga0315913_1000006131 | 375 |
| 885 | 3300033464 | Ga0315915_1000010 | Ga0315915_1000010131 | 375 |
| 886 | 3300035695 | Ga0373927_0000810 | Ga0373927_0000810_10196_11323 | 375 |
| 887 | 3300036647 | Ga0316582_0099393 | Ga0316582_0099393_608_1735 | 375 |
| 888 | 3300037068 | Ga0373925_0006321 | Ga0373925_0006321_1775_2902 | 375 |
| 889 | 3300037312 | Ga0395899_0000117 | Ga0395899_0000117_109414_110541 | 375 |
| 890 | 3300037418 | Ga0395900_0000020 | Ga0395900_0000020_109414_110541 | 375 |
| 891 | 3300037418 | Ga0395900_0154508 | Ga0395900_0154508_970_2097 | 375 |
| 892 | 3300037466 | Ga0395898_0000259 | Ga0395898_0000259_109414_110541 | 375 |
| 893 | 3300037466 | Ga0395898_0094818 | Ga0395898_0094818_1654_2781 | 375 |
| 894 | 3300037471 | Ga0395905_0000019 | Ga0395905_0000019_242960_244087 | 375 |
| 895 | 3300037471 | Ga0395905_0000736 | Ga0395905_0000736_32145_33275 | 375 |
| 896 | 3300037471 | Ga0395905_0052490 | Ga0395905_0052490_821_1960 | 375 |
| 897 | 3300038443 | Ga0395901_0000016 | Ga0395901_0000016_109922_111049 | 375 |
| 898 | 3300038443 | Ga0395901_0011547 | Ga0395901_0011547_1070_2245 | 375 |
| 899 | 3300038741 | Ga0400488_06315 | Ga0400488_06315_321_1448 | 375 |
| 900 | 3300041413 | Ga0439465_0033772 | Ga0439465_0033772_259_1386 | 375 |
| 901 | 3300041451 | Ga0451791_1138375 | Ga0451791_1138375_758_1885 | 375 |
| 902 | 3300041492 | Ga0451835_0039587 | Ga0451835_0039587_703_1830 | 375 |
| 903 | 3300041501 | Ga0451845_0826072 | Ga0451845_0826072_2211_3338 | 375 |
| 904 | 3300041505 | Ga0451849_1373232 | Ga0451849_1373232_346_1473 | 375 |
| 905 | 3300041509 | Ga0451843_0297013 | Ga0451843_0297013_2051_3178 | 375 |
| 906 | 3300044658 | Ga0466972_0020643 | Ga0466972_0020643_355_1530 | 375 |
| 907 | 3300046460 | Ga0495638_0000195 | Ga0495638_0000195_32880_34007 | 375 |
| 908 | 3300046460 | Ga0495638_0013713 | Ga0495638_0013713_3545_4768 | 375 |
| 909 | 3300046460 | Ga0495638_0032072 | Ga0495638_0032072_565_1692 | 375 |
| 910 | 3300046492 | Ga0495585_0006794 | Ga0495585_0006794_5526_6653 | 375 |
| 911 | 3300046492 | Ga0495585_0017651 | Ga0495585_0017651_1204_2331 | 375 |
| 912 | 3300046500 | Ga0495596_0049578 | Ga0495596_0049578_477_1604 | 375 |
| 913 | 3300046506 | Ga0495583_0001630 | Ga0495583_0001630_16088_17215 | 375 |
| 914 | 3300046506 | Ga0495583_0064007 | Ga0495583_0064007_373_1500 | 375 |
| 915 | 3300046507 | Ga0495606_0002164 | Ga0495606_0002164_7507_8748 | 375 |
| 916 | 3300046507 | Ga0495606_0007242 | Ga0495606_0007242_530_1657 | 375 |
| 917 | 3300046507 | Ga0495606_0062004 | Ga0495606_0062004_1222_2349 | 375 |
| 918 | 3300046512 | Ga0495610_0001253 | Ga0495610_0001253_11624_12751 | 375 |
| 919 | 3300046512 | Ga0495610_0016243 | Ga0495610_0016243_2115_3242 | 375 |
| 920 | 3300046515 | Ga0495620_0028851 | Ga0495620_0028851_649_1776 | 375 |
| 921 | 3300046518 | Ga0495631_0001628 | Ga0495631_0001628_6076_7203 | 375 |
| 922 | 3300046518 | Ga0495631_0012959 | Ga0495631_0012959_646_1773 | 375 |
| 923 | 3300046519 | Ga0495632_0001015 | Ga0495632_0001015_13168_14295 | 375 |
| 924 | 3300046522 | Ga0495643_0013532 | Ga0495643_0013532_865_1992 | 375 |
| 925 | 3300046522 | Ga0495643_0014825 | Ga0495643_0014825_1954_3111 | 375 |
| 926 | 3300046530 | Ga0495654_0016736 | Ga0495654_0016736_2056_3183 | 375 |
| 927 | 3300046530 | Ga0495654_0063661 | Ga0495654_0063661_159_1286 | 375 |
| 928 | 3300046538 | Ga0495609_0067269 | Ga0495609_0067269_46_1173 | 375 |
| 929 | 3300046558 | Ga0495633_0007773 | Ga0495633_0007773_3854_4981 | 375 |
| 930 | 3300046615 | Ga0495656_0009496 | Ga0495656_0009496_573_1760 | 375 |
| 931 | 3300046616 | Ga0495668_0020849 | Ga0495668_0020849_1546_2673 | 375 |
| 932 | 3300046660 | Ga0495625_0000621 | Ga0495625_0000621_38050_39177 | 375 |
| 933 | 3300046691 | Ga0495670_0024091 | Ga0495670_0024091_1537_2664 | 375 |
| 934 | 3300046691 | Ga0495670_0031057 | Ga0495670_0031057_703_1830 | 375 |
| 935 | 3300047317 | Ga0495604_0012101 | Ga0495604_0012101_4790_5917 | 375 |
| 936 | 3300047320 | Ga0495672_0005251 | Ga0495672_0005251_4410_5537 | 375 |
| 937 | 3300047447 | Ga0495685_024882 | Ga0495685_024882_821_1948 | 375 |
| 938 | 3300047470 | Ga0495681_0006193 | Ga0495681_0006193_28_1155 | 375 |
| 939 | 3300047472 | Ga0495686_0000316 | Ga0495686_0000316_11859_12986 | 375 |
| 940 | 3300047472 | Ga0495686_0003045 | Ga0495686_0003045_3197_4324 | 375 |
| 941 | 3300047472 | Ga0495686_0067244 | Ga0495686_0067244_130_1257 | 375 |
| 942 | 3300048090 | Ga0495615_0007978 | Ga0495615_0007978_538_1725 | 375 |
| 943 | 3300048909 | Ga0496106_0000578 | Ga0496106_0000578_11020_12216 | 375 |
| 944 | 3300048912 | Ga0496109_0283369 | Ga0496109_0283369_155_1282 | 375 |
| 945 | 3300048915 | Ga0496112_0003167 | Ga0496112_0003167_5664_6791 | 375 |
| 946 | 3300048916 | Ga0496113_0045574 | Ga0496113_0045574_1215_2342 | 375 |
| 947 | 3300048918 | Ga0496115_0197362 | Ga0496115_0197362_93_1220 | 375 |
| 948 | 3300048919 | Ga0496116_0004831 | Ga0496116_0004831_2660_3787 | 375 |
| 949 | 3300048919 | Ga0496116_0048900 | Ga0496116_0048900_676_1803 | 375 |
| 950 | 3300048919 | Ga0496116_0054750 | Ga0496116_0054750_719_1846 | 375 |
| 951 | 3300048919 | Ga0496116_0079230 | Ga0496116_0079230_456_1583 | 375 |
| 952 | 3300048919 | Ga0496116_0083005 | Ga0496116_0083005_399_1526 | 375 |
| 953 | 3300048919 | Ga0496116_0110382 | Ga0496116_0110382_301_1428 | 375 |
| 954 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_553316_554443 | 375 |
| 955 | 3300048920 | Ga0496117_0005629 | Ga0496117_0005629_8707_9834 | 375 |
| 956 | 3300048920 | Ga0496117_0010714 | Ga0496117_0010714_2380_3507 | 375 |
| 957 | 3300048920 | Ga0496117_0033555 | Ga0496117_0033555_2211_3338 | 375 |
| 958 | 3300048921 | Ga0496118_0000087 | Ga0496118_0000087_164875_166002 | 375 |
| 959 | 3300048921 | Ga0496118_0015216 | Ga0496118_0015216_2335_3462 | 375 |
| 960 | 3300048922 | Ga0496119_0040491 | Ga0496119_0040491_605_1732 | 375 |
| 961 | 3300048923 | Ga0496120_0000180 | Ga0496120_0000180_35410_36537 | 375 |
| 962 | 3300048923 | Ga0496120_0000621 | Ga0496120_0000621_8312_9439 | 375 |
| 963 | 3300048923 | Ga0496120_0053060 | Ga0496120_0053060_836_1999 | 375 |
| 964 | 3300048923 | Ga0496120_0099445 | Ga0496120_0099445_120_1247 | 375 |
| 965 | 3300048924 | Ga0496121_0000003 | Ga0496121_0000003_302822_304012 | 375 |
| 966 | 3300048924 | Ga0496121_0004088 | Ga0496121_0004088_12399_13526 | 375 |
| 967 | 3300048924 | Ga0496121_0005561 | Ga0496121_0005561_1289_2530 | 375 |
| 968 | 3300048924 | Ga0496121_0009569 | Ga0496121_0009569_1131_2258 | 375 |
| 969 | 3300048924 | Ga0496121_0086868 | Ga0496121_0086868_880_2007 | 375 |
| 970 | 3300048924 | Ga0496121_0249946 | Ga0496121_0249946_63_1190 | 375 |
| 971 | 3300048925 | Ga0496122_0000004 | Ga0496122_0000004_35415_36542 | 375 |
| 972 | 3300048925 | Ga0496122_0000190 | Ga0496122_0000190_36659_37786 | 375 |
| 973 | 3300048925 | Ga0496122_0005937 | Ga0496122_0005937_6274_7401 | 375 |
| 974 | 3300048925 | Ga0496122_0025840 | Ga0496122_0025840_3029_4156 | 375 |
| 975 | 3300048925 | Ga0496122_0097344 | Ga0496122_0097344_824_1951 | 375 |
| 976 | 3300048926 | Ga0496123_0000007 | Ga0496123_0000007_35415_36542 | 375 |
| 977 | 3300048926 | Ga0496123_0001159 | Ga0496123_0001159_10993_12120 | 375 |
| 978 | 3300048926 | Ga0496123_0007309 | Ga0496123_0007309_299_1426 | 375 |
| 979 | 3300048926 | Ga0496123_0028380 | Ga0496123_0028380_956_2083 | 375 |
| 980 | 3300048926 | Ga0496123_0076217 | Ga0496123_0076217_923_2050 | 375 |
| 981 | 3300048927 | Ga0496124_0000308 | Ga0496124_0000308_29008_30135 | 375 |
| 982 | 3300048927 | Ga0496124_0001702 | Ga0496124_0001702_19303_20430 | 375 |
| 983 | 3300048927 | Ga0496124_0005097 | Ga0496124_0005097_1935_3062 | 375 |
| 984 | 3300048927 | Ga0496124_0005246 | Ga0496124_0005246_10461_11588 | 375 |
| 985 | 3300048927 | Ga0496124_0006525 | Ga0496124_0006525_2977_4104 | 375 |
| 986 | 3300048927 | Ga0496124_0025248 | Ga0496124_0025248_677_1804 | 375 |
| 987 | 3300048927 | Ga0496124_0025497 | Ga0496124_0025497_163_1290 | 375 |
| 988 | 3300048927 | Ga0496124_0064161 | Ga0496124_0064161_224_1351 | 375 |
| 989 | 3300048927 | Ga0496124_0162235 | Ga0496124_0162235_502_1629 | 375 |
| 990 | 3300048928 | Ga0496125_0000039 | Ga0496125_0000039_81466_82593 | 375 |
| 991 | 3300048928 | Ga0496125_0000273 | Ga0496125_0000273_78170_79297 | 375 |
| 992 | 3300048928 | Ga0496125_0019255 | Ga0496125_0019255_3400_4527 | 375 |
| 993 | 3300048928 | Ga0496125_0028736 | Ga0496125_0028736_2485_3612 | 375 |
| 994 | 3300048928 | Ga0496125_0100336 | Ga0496125_0100336_53_1180 | 375 |
| 995 | 3300048928 | Ga0496125_0178773 | Ga0496125_0178773_232_1359 | 375 |
| 996 | 3300048929 | Ga0496126_0000589 | Ga0496126_0000589_32860_33987 | 375 |
| 997 | 3300048929 | Ga0496126_0001008 | Ga0496126_0001008_4439_5566 | 375 |
| 998 | 3300048929 | Ga0496126_0148441 | Ga0496126_0148441_631_1758 | 375 |
| 999 | 3300049459 | Ga0495678_008838 | Ga0495678_008838_3337_4464 | 375 |
| 1000 | 3300049459 | Ga0495678_070245 | Ga0495678_070245_121_1248 | 375 |
| 1001 | 3300049460 | Ga0495682_0058718 | Ga0495682_0058718_195_1322 | 375 |
| 1002 | 3300049568 | Ga0501031_0021184 | Ga0501031_0021184_3042_4169 | 375 |
| 1003 | 3300049568 | Ga0501031_0030492 | Ga0501031_0030492_499_1626 | 375 |
| 1004 | 3300049568 | Ga0501031_0102466 | Ga0501031_0102466_471_1598 | 375 |
| 1005 | 3300049569 | Ga0501032_0000031 | Ga0501032_0000031_62973_64100 | 375 |
| 1006 | 3300049569 | Ga0501032_0000201 | Ga0501032_0000201_47071_48198 | 375 |
| 1007 | 3300049569 | Ga0501032_0053525 | Ga0501032_0053525_663_1790 | 375 |
| 1008 | 3300049570 | Ga0501033_0000050 | Ga0501033_0000050_58267_59394 | 375 |
| 1009 | 3300049570 | Ga0501033_0000132 | Ga0501033_0000132_69464_70591 | 375 |
| 1010 | 3300049570 | Ga0501033_0000779 | Ga0501033_0000779_26859_27986 | 375 |
| 1011 | 3300049570 | Ga0501033_0001161 | Ga0501033_0001161_6107_7234 | 375 |
| 1012 | 3300049570 | Ga0501033_0253578 | Ga0501033_0253578_51_1178 | 375 |
| 1013 | 3300049571 | Ga0501034_0000005 | Ga0501034_0000005_319118_320245 | 375 |
| 1014 | 3300049571 | Ga0501034_0000064 | Ga0501034_0000064_125362_126489 | 375 |
| 1015 | 3300049571 | Ga0501034_0006650 | Ga0501034_0006650_5516_6643 | 375 |
| 1016 | 3300049571 | Ga0501034_0075936 | Ga0501034_0075936_668_1798 | 375 |
| 1017 | 3300049571 | Ga0501034_0193804 | Ga0501034_0193804_566_1693 | 375 |
| 1018 | 3300049572 | Ga0501036_0000005 | Ga0501036_0000005_197986_199113 | 375 |
| 1019 | 3300049572 | Ga0501036_0000563 | Ga0501036_0000563_22867_23994 | 375 |
| 1020 | 3300049572 | Ga0501036_0273621 | Ga0501036_0273621_208_1335 | 375 |
| 1021 | 3300049573 | Ga0501037_0000045 | Ga0501037_0000045_68865_69992 | 375 |
| 1022 | 3300049573 | Ga0501037_0000077 | Ga0501037_0000077_23603_24730 | 375 |
| 1023 | 3300049573 | Ga0501037_0000132 | Ga0501037_0000132_61232_62359 | 375 |
| 1024 | 3300049574 | Ga0501038_0000001 | Ga0501038_0000001_319118_320245 | 375 |
| 1025 | 3300049574 | Ga0501038_0000055 | Ga0501038_0000055_8847_9974 | 375 |
| 1026 | 3300049574 | Ga0501038_0061894 | Ga0501038_0061894_1553_2680 | 375 |
| 1027 | 3300049575 | Ga0501039_0000007 | Ga0501039_0000007_176930_178057 | 375 |
| 1028 | 3300049575 | Ga0501039_0000045 | Ga0501039_0000045_35844_36971 | 375 |
| 1029 | 3300049575 | Ga0501039_0141729 | Ga0501039_0141729_467_1594 | 375 |
| 1030 | 3300049579 | Ga0501043_0000015 | Ga0501043_0000015_82694_83821 | 375 |
| 1031 | 3300049579 | Ga0501043_0000104 | Ga0501043_0000104_17208_18335 | 375 |
| 1032 | 3300049579 | Ga0501043_0000333 | Ga0501043_0000333_14_1141 | 375 |
| 1033 | 3300049579 | Ga0501043_0003831 | Ga0501043_0003831_177_1304 | 375 |
| 1034 | 3300049579 | Ga0501043_0091800 | Ga0501043_0091800_103_1230 | 375 |
| 1035 | 3300049580 | Ga0501046_0037003 | Ga0501046_0037003_1241_2368 | 375 |
| 1036 | 3300049580 | Ga0501046_0150282 | Ga0501046_0150282_490_1617 | 375 |
| 1037 | 3300049581 | Ga0501047_0019278 | Ga0501047_0019278_3923_5050 | 375 |
| 1038 | 3300049582 | Ga0501048_0103466 | Ga0501048_0103466_11_1138 | 375 |
| 1039 | 3300049584 | Ga0501068_0004105 | Ga0501068_0004105_4180_5307 | 375 |
| 1040 | 3300049585 | Ga0501069_0000016 | Ga0501069_0000016_93140_94267 | 375 |
| 1041 | 3300049585 | Ga0501069_0036416 | Ga0501069_0036416_61_1188 | 375 |
| 1042 | 3300049585 | Ga0501069_0072483 | Ga0501069_0072483_567_1694 | 375 |
| 1043 | 3300049586 | Ga0501070_0000048 | Ga0501070_0000048_73352_74479 | 375 |
| 1044 | 3300049586 | Ga0501070_0000812 | Ga0501070_0000812_16143_17270 | 375 |
| 1045 | 3300049586 | Ga0501070_0021850 | Ga0501070_0021850_1112_2239 | 375 |
| 1046 | 3300049586 | Ga0501070_0028549 | Ga0501070_0028549_340_1467 | 375 |
| 1047 | 3300049586 | Ga0501070_0080511 | Ga0501070_0080511_1319_2446 | 375 |
| 1048 | 3300049587 | Ga0501071_0010145 | Ga0501071_0010145_2855_3982 | 375 |
| 1049 | 3300049587 | Ga0501071_0056683 | Ga0501071_0056683_120_1247 | 375 |
| 1050 | 3300049588 | Ga0501072_0077657 | Ga0501072_0077657_1116_2243 | 375 |
| 1051 | 3300049590 | Ga0501074_0001884 | Ga0501074_0001884_3141_4268 | 375 |
| 1052 | 3300049590 | Ga0501074_0064010 | Ga0501074_0064010_588_1715 | 375 |
| 1053 | 3300049741 | Ga0501079_0239388 | Ga0501079_0239388_207_1334 | 375 |
| 1054 | 3300049742 | Ga0501080_0000270 | Ga0501080_0000270_5616_6743 | 375 |
| 1055 | 3300049742 | Ga0501080_0001902 | Ga0501080_0001902_1817_2944 | 375 |
| 1056 | 3300049742 | Ga0501080_0176279 | Ga0501080_0176279_367_1494 | 375 |
| 1057 | 3300049744 | Ga0501083_0000069 | Ga0501083_0000069_14139_15266 | 375 |
| 1058 | 3300049822 | Ga0501035_0000008 | Ga0501035_0000008_264997_266124 | 375 |
| 1059 | 3300049822 | Ga0501035_0000048 | Ga0501035_0000048_85109_86236 | 375 |
| 1060 | 3300049822 | Ga0501035_0000306 | Ga0501035_0000306_35871_36998 | 375 |
| 1061 | 3300049822 | Ga0501035_0003062 | Ga0501035_0003062_1057_2184 | 375 |
| 1062 | 3300049822 | Ga0501035_0004314 | Ga0501035_0004314_6507_7634 | 375 |
| 1063 | 3300049822 | Ga0501035_0023011 | Ga0501035_0023011_1554_2681 | 375 |
| 1064 | 3300049822 | Ga0501035_0024962 | Ga0501035_0024962_1222_2349 | 375 |
| 1065 | 3300049822 | Ga0501035_0029453 | Ga0501035_0029453_2065_3192 | 375 |
| 1066 | 3300049823 | Ga0501044_0000001 | Ga0501044_0000001_97843_98970 | 375 |
| 1067 | 3300049823 | Ga0501044_0000003 | Ga0501044_0000003_167742_168869 | 375 |
| 1068 | 3300049823 | Ga0501044_0010525 | Ga0501044_0010525_1568_2695 | 375 |
| 1069 | 3300049823 | Ga0501044_0051990 | Ga0501044_0051990_1607_2734 | 375 |
| 1070 | 3300049823 | Ga0501044_0068556 | Ga0501044_0068556_1534_2661 | 375 |
| 1071 | 3300049823 | Ga0501044_0162287 | Ga0501044_0162287_12_1139 | 375 |
| 1072 | 3300049824 | Ga0501045_0051240 | Ga0501045_0051240_1762_2889 | 375 |
| 1073 | 3300050489 | nmdc:mga03683_23701_c1 | nmdc:mga03683_23701_c1_509_1636 | 375 |
| 1074 | 3300050491 | nmdc:mga00v17_12_c1 | nmdc:mga00v17_12_c1_100076_101203 | 375 |
| 1075 | 3300050492 | nmdc:mga0yw44_140341_c1 | nmdc:mga0yw44_140341_c1_366_1493 | 375 |
| 1076 | 3300050492 | nmdc:mga0yw44_31979_c1 | nmdc:mga0yw44_31979_c1_1417_2544 | 375 |
| 1077 | 3300050492 | nmdc:mga0yw44_47732_c1 | nmdc:mga0yw44_47732_c1_39_1166 | 375 |
| 1078 | 3300050495 | nmdc:mga04h51_13930_c1 | nmdc:mga04h51_13930_c1_1138_2265 | 375 |
| 1079 | 3300050516 | nmdc:mga0sz30_240_c1 | nmdc:mga0sz30_240_c1_3825_4952 | 375 |
| 1080 | 3300050516 | nmdc:mga0sz30_3440_c1 | nmdc:mga0sz30_3440_c1_635_1762 | 375 |
| 1081 | 3300053079 | Ga0500610_0002329 | Ga0500610_0002329_416_1543 | 375 |
| 1082 | 3300053086 | Ga0500578_0088087 | Ga0500578_0088087_122_1249 | 375 |
| 1083 | 3300053087 | Ga0500643_015830 | Ga0500643_015830_1179_2306 | 375 |
| 1084 | 3300053105 | Ga0500557_000324 | Ga0500557_000324_2301_3428 | 375 |
| 1085 | 3300053134 | Ga0500658_0000529 | Ga0500658_0000529_2266_3393 | 375 |
| 1086 | 3300053136 | Ga0500559_0017106 | Ga0500559_0017106_292_1479 | 375 |
| 1087 | 3300053137 | Ga0500561_0000126 | Ga0500561_0000126_8402_9529 | 375 |
| 1088 | 3300053140 | Ga0500573_0000585 | Ga0500573_0000585_4642_5769 | 375 |
| 1089 | 3300053153 | Ga0500616_0002961 | Ga0500616_0002961_3417_4544 | 375 |
| 1090 | 3300053153 | Ga0500616_0011965 | Ga0500616_0011965_542_1669 | 375 |
| 1091 | 3300053153 | Ga0500616_0030818 | Ga0500616_0030818_1658_2785 | 375 |
| 1092 | 3300053155 | Ga0500620_000067 | Ga0500620_000067_18872_19999 | 375 |
| 1093 | 3300053156 | Ga0500622_0000697 | Ga0500622_0000697_12609_13736 | 375 |
| 1094 | 3300053156 | Ga0500622_0000899 | Ga0500622_0000899_13501_14628 | 375 |
| 1095 | 3300053157 | Ga0500624_001069 | Ga0500624_001069_1846_2973 | 375 |
| 1096 | 3300053161 | Ga0500634_0004429 | Ga0500634_0004429_1259_2386 | 375 |
| 1097 | 3300053161 | Ga0500634_0008929 | Ga0500634_0008929_1625_2752 | 375 |
| 1098 | 3300053177 | Ga0500636_0000021 | Ga0500636_0000021_46368_47495 | 375 |
| 1099 | 3300053177 | Ga0500636_0004647 | Ga0500636_0004647_4513_5640 | 375 |
| 1100 | 3300060353 | Ga0501082_0017101 | Ga0501082_0017101_2185_3312 | 375 |
| 1101 | iso_pu_bacteria | 2508501122 | 2509111337 | 375 |
| 1102 | iso_pu_bacteria | 2509276019 | 2509376385 | 375 |
| 1103 | iso_pu_bacteria | 2510065057 | 2510304382 | 375 |
| 1104 | iso_pu_bacteria | 2511231052 | 2511502155 | 375 |
| 1105 | iso_pu_bacteria | 2512875024 | 2512959182 | 375 |
| 1106 | iso_pu_bacteria | 2513237086 | 2513582451 | 375 |
| 1107 | iso_pu_bacteria | 2513237088 | 2513596396 | 375 |
| 1108 | iso_pu_bacteria | 2513237091 | 2513617992 | 375 |
| 1109 | iso_pu_bacteria | 2513237140 | 2513885497 | 375 |
| 1110 | iso_pu_bacteria | 2513237143 | 2513903273 | 375 |
| 1111 | iso_pu_bacteria | 2513237164 | 2514033780 | 375 |
| 1112 | iso_pu_bacteria | 2516143018 | 2516204071 | 375 |
| 1113 | iso_pu_bacteria | 2516653046 | 2516893535 | 375 |
| 1114 | iso_pu_bacteria | 2551306084 | 2551674474 | 375 |
| 1115 | iso_pu_bacteria | 2551306085 | 2551685857 | 375 |
| 1116 | iso_pu_bacteria | 2551306087 | 2551697259 | 375 |
| 1117 | iso_pu_bacteria | 2551306089 | 2551715313 | 375 |
| 1118 | iso_pu_bacteria | 2551306090 | 2551719986 | 375 |
| 1119 | iso_pu_bacteria | 2551306093 | 2551743312 | 375 |
| 1120 | iso_pu_bacteria | 2558860100 | 2558867791 | 375 |
| 1121 | iso_pu_bacteria | 2582581307 | 2585271048 | 375 |
| 1122 | iso_pu_bacteria | 2585427531 | 2585558772 | 375 |
| 1123 | iso_pu_bacteria | 2585427609 | 2585904258 | 375 |
| 1124 | iso_pu_bacteria | 2585428125 | 2587980625 | 375 |
| 1125 | iso_pu_bacteria | 2599185156 | 2599331690 | 375 |
| 1126 | iso_pu_bacteria | 2643221618 | 2644107383 | 375 |
| 1127 | iso_pu_bacteria | 2643221626 | 2644150950 | 375 |
| 1128 | iso_pu_bacteria | 2643221643 | 2644238885 | 375 |
| 1129 | iso_pu_bacteria | 2643221655 | 2644308778 | 375 |
| 1130 | iso_pu_bacteria | 2643221659 | 2644335595 | 375 |
| 1131 | iso_pu_bacteria | 2643221698 | 2644540001 | 375 |
| 1132 | iso_pu_bacteria | 2643221712 | 2644614719 | 375 |
| 1133 | iso_pu_bacteria | 2657244999 | 2657681448 | 375 |
| 1134 | iso_pu_bacteria | 2751185821 | 2753459025 | 375 |
| 1135 | iso_pu_bacteria | 2757320392 | 2757569665 | 375 |
| 1136 | iso_pu_bacteria | 2842922631 | 2842924094 | 375 |
| 1137 | iso_pu_bacteria | 2844163670 | 2844166666 | 375 |
| 1138 | iso_pu_bacteria | 2850079185 | 2850081354 | 375 |
| 1139 | iso_pu_bacteria | 2855825444 | 2855826255 | 375 |
| 1140 | iso_pu_bacteria | 2855839649 | 2855841600 | 375 |
| 1141 | iso_pu_bacteria | 2856349417 | 2856354882 | 375 |
| 1142 | iso_pu_bacteria | 2856364286 | 2856369586 | 375 |
| 1143 | iso_pu_bacteria | 2858800743 | 2858801716 | 375 |
| 1144 | iso_pu_bacteria | 2869285874 | 2869286060 | 375 |
| 1145 | iso_pu_bacteria | 2871429161 | 2871434493 | 375 |
| 1146 | iso_pu_bacteria | 2871495908 | 2871501274 | 375 |
| 1147 | iso_pu_bacteria | 2874123672 | 2874130727 | 375 |
| 1148 | iso_pu_bacteria | 2874155637 | 2874157957 | 375 |
| 1149 | iso_pu_bacteria | 2876413966 | 2876416161 | 375 |
| 1150 | iso_pu_bacteria | 2878745973 | 2878751626 | 375 |
| 1151 | iso_pu_bacteria | 2878760144 | 2878765254 | 375 |
| 1152 | iso_pu_bacteria | 2878767105 | 2878772961 | 375 |
| 1153 | iso_pu_bacteria | 2881853255 | 2881854863 | 375 |
| 1154 | iso_pu_bacteria | 2885312484 | 2885317872 | 375 |
| 1155 | iso_pu_bacteria | 2885342637 | 2885344583 | 375 |
| 1156 | iso_pu_bacteria | 2885350715 | 2885352294 | 375 |
| 1157 | iso_pu_bacteria | 2888343758 | 2888346940 | 375 |
| 1158 | iso_pu_bacteria | 2903492973 | 2903504571 | 375 |
| 1159 | iso_pu_bacteria | 2903540706 | 2903546085 | 375 |
| 1160 | iso_pu_bacteria | 2906308376 | 2906314024 | 375 |
| 1161 | iso_pu_bacteria | 2906321335 | 2906327190 | 375 |
| 1162 | iso_pu_bacteria | 2913295892 | 2913299402 | 375 |
| 1163 | iso_pu_bacteria | 2915986958 | 2915990428 | 375 |
| 1164 | iso_pu_bacteria | 2915993759 | 2915998070 | 375 |
| 1165 | iso_pu_bacteria | 2916000859 | 2916006845 | 375 |
| 1166 | iso_pu_bacteria | 2916007675 | 2916014058 | 375 |
| 1167 | iso_pu_bacteria | 2916014648 | 2916017595 | 375 |
| 1168 | iso_pu_bacteria | 2916021584 | 2916025034 | 375 |
| 1169 | iso_pu_bacteria | 2916028427 | 2916033197 | 375 |
| 1170 | iso_pu_bacteria | 2916035215 | 2916040199 | 375 |
| 1171 | iso_pu_bacteria | 2916041962 | 2916044057 | 375 |
| 1172 | iso_pu_bacteria | 2916048683 | 2916054238 | 375 |
| 1173 | iso_pu_bacteria | 2916055098 | 2916059666 | 375 |
| 1174 | iso_pu_bacteria | 2916068649 | 2916068924 | 375 |
| 1175 | iso_pu_bacteria | 2916076590 | 2916080629 | 375 |
| 1176 | iso_pu_bacteria | 2921201388 | 2921207564 | 375 |
| 1177 | iso_pu_bacteria | 2921208531 | 2921214501 | 375 |
| 1178 | iso_pu_bacteria | 2921237296 | 2921239406 | 375 |
| 1179 | iso_pu_bacteria | 2921244191 | 2921248556 | 375 |
| 1180 | iso_pu_bacteria | 2921257292 | 2921261213 | 375 |
| 1181 | iso_pu_bacteria | 2921263974 | 2921268629 | 375 |
| 1182 | iso_pu_bacteria | 2921282425 | 2921285850 | 375 |
| 1183 | iso_pu_bacteria | 2921289301 | 2921289463 | 375 |
| 1184 | iso_pu_bacteria | 2921296804 | 2921299919 | 375 |
| 1185 | iso_pu_bacteria | 2924144063 | 2924148448 | 375 |
| 1186 | iso_pu_bacteria | 2924150972 | 2924158076 | 375 |
| 1187 | iso_pu_bacteria | 2924158325 | 2924159190 | 375 |
| 1188 | iso_pu_bacteria | 2924165586 | 2924171440 | 375 |
| 1189 | iso_pu_bacteria | 2924172951 | 2924177911 | 375 |
| 1190 | iso_pu_bacteria | 2924179722 | 2924183703 | 375 |
| 1191 | iso_pu_bacteria | 2924186466 | 2924191955 | 375 |
| 1192 | iso_pu_bacteria | 2924193448 | 2924198001 | 375 |
| 1193 | iso_pu_bacteria | 2924200457 | 2924204763 | 375 |
| 1194 | iso_pu_bacteria | 2924207177 | 2924211509 | 375 |
| 1195 | iso_pu_bacteria | 2924214083 | 2924218816 | 375 |
| 1196 | iso_pu_bacteria | 2924221636 | 2924225731 | 375 |
| 1197 | iso_pu_bacteria | 2924228884 | 2924233072 | 375 |
| 1198 | iso_pu_bacteria | 2924762789 | 2924764929 | 375 |
| 1199 | iso_pu_bacteria | 2937002841 | 2937007341 | 375 |
| 1200 | iso_pu_bacteria | 2937009748 | 2937012929 | 375 |
| 1201 | iso_pu_bacteria | 2937016420 | 2937021645 | 375 |
| 1202 | iso_pu_bacteria | 2937023124 | 2937026876 | 375 |
| 1203 | iso_pu_bacteria | 2937042894 | 2937047727 | 375 |
| 1204 | iso_pu_bacteria | 2937049772 | 2937053688 | 375 |
| 1205 | iso_pu_bacteria | 2937056579 | 2937063412 | 375 |
| 1206 | iso_pu_bacteria | 2937063883 | 2937070738 | 375 |
| 1207 | iso_pu_bacteria | 2937071275 | 2937077139 | 375 |
| 1208 | iso_pu_bacteria | 2937091812 | 2937098208 | 375 |
| 1209 | iso_pu_bacteria | 2937098957 | 2937102515 | 375 |
| 1210 | iso_pu_bacteria | 2937106411 | 2937111225 | 375 |
| 1211 | iso_pu_bacteria | 2937113482 | 2937117915 | 375 |
| 1212 | iso_pu_bacteria | 2937119839 | 2937124034 | 375 |
| 1213 | iso_pu_bacteria | 2937126314 | 2937130577 | 375 |
| 1214 | iso_pu_bacteria | 2937813078 | 2937815866 | 375 |
| 1215 | iso_pu_bacteria | 2937994558 | 2937999943 | 375 |
| 1216 | iso_pu_bacteria | 2938014810 | 2938017331 | 375 |
| 1217 | iso_pu_bacteria | 2941499720 | 2941502232 | 375 |
| 1218 | iso_pu_bacteria | 2957382221 | 2957386618 | 375 |
| 1219 | iso_pu_bacteria | 2957388812 | 2957392900 | 375 |
| 1220 | iso_pu_bacteria | 2957395598 | 2957395982 | 375 |
| 1221 | iso_pu_bacteria | 2957402308 | 2957406717 | 375 |
| 1222 | iso_pu_bacteria | 2957408893 | 2957410778 | 375 |
| 1223 | iso_pu_bacteria | 2957415311 | 2957417606 | 375 |
| 1224 | iso_pu_bacteria | 2957422303 | 2957423727 | 375 |
| 1225 | iso_pu_bacteria | 2957430029 | 2957434293 | 375 |
| 1226 | iso_pu_bacteria | 2957443900 | 2957446350 | 375 |
| 1227 | iso_pu_bacteria | 2957450854 | 2957454716 | 375 |
| 1228 | iso_pu_bacteria | 2957457609 | 2957461990 | 375 |
| 1229 | iso_pu_bacteria | 2957464669 | 2957468634 | 375 |
| 1230 | iso_pu_bacteria | 2957471148 | 2957476476 | 375 |
| 1231 | iso_pu_bacteria | 2957478035 | 2957482816 | 375 |
| 1232 | iso_pu_bacteria | 2957484790 | 2957488710 | 375 |
| 1233 | iso_pu_bacteria | 2957491536 | 2957496979 | 375 |
| 1234 | iso_pu_bacteria | 2957498199 | 2957503222 | 375 |
| 1235 | iso_pu_bacteria | 2957505466 | 2957507298 | 375 |
| 1236 | iso_pu_bacteria | 2958071322 | 2958078078 | 375 |
| 1237 | iso_pu_bacteria | 2958130278 | 2958130459 | 375 |
| 1238 | iso_pu_bacteria | 2958165035 | 2958170407 | 375 |
| 1239 | iso_pu_bacteria | 2958179912 | 2958184664 | 375 |
| 1240 | iso_pu_bacteria | 2960584000 | 2960590463 | 375 |
| 1241 | iso_pu_bacteria | 2960597568 | 2960602502 | 375 |
| 1242 | iso_pu_bacteria | 2960603979 | 2960606459 | 375 |
| 1243 | iso_pu_bacteria | 2960610863 | 2960612404 | 375 |
| 1244 | iso_pu_bacteria | 2960617483 | 2960621496 | 375 |
| 1245 | iso_pu_bacteria | 2960624210 | 2960630840 | 375 |
| 1246 | iso_pu_bacteria | 2960637947 | 2960644504 | 375 |
| 1247 | iso_pu_bacteria | 2960645483 | 2960650019 | 375 |
| 1248 | iso_pu_bacteria | 2960652885 | 2960654760 | 375 |
| 1249 | iso_pu_bacteria | 2960660292 | 2960665237 | 375 |
| 1250 | iso_pu_bacteria | 2960667422 | 2960671722 | 375 |
| 1251 | iso_pu_bacteria | 2960674078 | 2960678357 | 375 |
| 1252 | iso_pu_bacteria | 2960687367 | 2960692536 | 375 |
| 1253 | iso_pu_bacteria | 2961077736 | 2961082831 | 375 |
| 1254 | iso_pu_bacteria | 2961163497 | 2961168862 | 375 |
| 1255 | iso_pu_bacteria | 2964607997 | 2964614515 | 375 |
| 1256 | iso_pu_bacteria | 2964615318 | 2964621055 | 375 |
| 1257 | iso_pu_bacteria | 2964621998 | 2964625736 | 375 |
| 1258 | iso_pu_bacteria | 2964628898 | 2964632997 | 375 |
| 1259 | iso_pu_bacteria | 2964636051 | 2964640137 | 375 |
| 1260 | iso_pu_bacteria | 2964643177 | 2964646827 | 375 |
| 1261 | iso_pu_bacteria | 2964649959 | 2964655331 | 375 |
| 1262 | iso_pu_bacteria | 2964656573 | 2964663230 | 375 |
| 1263 | iso_pu_bacteria | 2964663802 | 2964668307 | 375 |
| 1264 | iso_pu_bacteria | 2964670856 | 2964671761 | 375 |
| 1265 | iso_pu_bacteria | 2964678106 | 2964681603 | 375 |
| 1266 | iso_pu_bacteria | 2964685014 | 2964687762 | 375 |
| 1267 | iso_pu_bacteria | 2964698721 | 2964704567 | 375 |
| 1268 | iso_pu_bacteria | 2964705432 | 2964709819 | 375 |
| 1269 | iso_pu_bacteria | 2964712639 | 2964716535 | 375 |
| 1270 | iso_pu_bacteria | 2964719344 | 2964724625 | 375 |
| 1271 | iso_pu_bacteria | 2965018300 | 2965024149 | 375 |
| 1272 | iso_pu_bacteria | 2965062239 | 2965065865 | 375 |
| 1273 | iso_pu_bacteria | 2967664464 | 2967668306 | 375 |
| 1274 | iso_pu_bacteria | 2967671571 | 2967675919 | 375 |
| 1275 | iso_pu_bacteria | 2967678726 | 2967684513 | 375 |
| 1276 | iso_pu_bacteria | 2967693043 | 2967697365 | 375 |
| 1277 | iso_pu_bacteria | 2967699805 | 2967706613 | 375 |
| 1278 | iso_pu_bacteria | 2967706974 | 2967711555 | 375 |
| 1279 | iso_pu_bacteria | 2967714385 | 2967714785 | 375 |
| 1280 | iso_pu_bacteria | 2967721400 | 2967725820 | 375 |
| 1281 | iso_pu_bacteria | 2967735183 | 2967738868 | 375 |
| 1282 | iso_pu_bacteria | 2967742019 | 2967746811 | 375 |
| 1283 | iso_pu_bacteria | 2967748971 | 2967753576 | 375 |
| 1284 | iso_pu_bacteria | 2967755722 | 2967758948 | 375 |
| 1285 | iso_pu_bacteria | 2967762386 | 2967768471 | 375 |
| 1286 | iso_pu_bacteria | 2967769361 | 2967773839 | 375 |
| 1287 | iso_pu_bacteria | 2967775926 | 2967781937 | 375 |
| 1288 | iso_pu_bacteria | 2968117919 | 2968120754 | 375 |
| 1289 | iso_pu_bacteria | 2968128360 | 2968129301 | 375 |
| 1290 | iso_pu_bacteria | 2968171901 | 2968177256 | 375 |
| 1291 | iso_pu_bacteria | 2970019648 | 2970023502 | 375 |
| 1292 | iso_pu_bacteria | 2970033650 | 2970040202 | 375 |
| 1293 | iso_pu_bacteria | 2970040964 | 2970045869 | 375 |
| 1294 | iso_pu_bacteria | 2970047711 | 2970053957 | 375 |
| 1295 | iso_pu_bacteria | 2970054988 | 2970059276 | 375 |
| 1296 | iso_pu_bacteria | 2970061556 | 2970065667 | 375 |
| 1297 | iso_pu_bacteria | 2970068827 | 2970075500 | 375 |
| 1298 | iso_pu_bacteria | 2970076120 | 2970080184 | 375 |
| 1299 | iso_pu_bacteria | 2970082768 | 2970087790 | 375 |
| 1300 | iso_pu_bacteria | 2970088815 | 2970093211 | 375 |
| 1301 | iso_pu_bacteria | 2970095765 | 2970100062 | 375 |
| 1302 | iso_pu_bacteria | 2970102677 | 2970108085 | 375 |
| 1303 | iso_pu_bacteria | 2970109326 | 2970113877 | 375 |
| 1304 | iso_pu_bacteria | 2970116247 | 2970120500 | 375 |
| 1305 | iso_pu_bacteria | 2970129317 | 2970133193 | 375 |
| 1306 | iso_pu_bacteria | 2970136068 | 2970140450 | 375 |
| 1307 | iso_pu_bacteria | 2970149975 | 2970155958 | 375 |
| 1308 | iso_pu_bacteria | 2970156795 | 2970161101 | 375 |
| 1309 | iso_pu_bacteria | 2970164137 | 2970168486 | 375 |
| 1310 | iso_pu_bacteria | 2970170962 | 2970171572 | 375 |
| 1311 | iso_pu_bacteria | 2970177841 | 2970182903 | 375 |
| 1312 | iso_pu_bacteria | 2970184632 | 2970188688 | 375 |
| 1313 | iso_pu_bacteria | 2970191845 | 2970196374 | 375 |
| 1314 | iso_pu_bacteria | 2970524798 | 2970528739 | 375 |
| 1315 | iso_pu_bacteria | 2970540015 | 2970545536 | 375 |
| 1316 | iso_pu_bacteria | 2970554993 | 2970560102 | 375 |
| 1317 | iso_pu_bacteria | 2977516862 | 2977522521 | 375 |
| 1318 | iso_pu_bacteria | 2977523885 | 2977526241 | 375 |
| 1319 | iso_pu_bacteria | 2977537788 | 2977542029 | 375 |
| 1320 | iso_pu_bacteria | 2977551784 | 2977558344 | 375 |
| 1321 | iso_pu_bacteria | 2977558990 | 2977562671 | 375 |
| 1322 | iso_pu_bacteria | 2977565890 | 2977570280 | 375 |
| 1323 | iso_pu_bacteria | 2977572785 | 2977577081 | 375 |
| 1324 | iso_pu_bacteria | 2977579622 | 2977583568 | 375 |
| 1325 | iso_pu_bacteria | 2977843712 | 2977846101 | 375 |
| 1326 | iso_pu_bacteria | 2977922695 | 2977924365 | 375 |
| 1327 | iso_pu_bacteria | 2977942078 | 2977945472 | 375 |
| 1328 | iso_pu_bacteria | 2987636660 | 2987638210 | 375 |
| 1329 | iso_pu_bacteria | 2987659509 | 2987664893 | 375 |
| 1330 | iso_pu_bacteria | 2987666974 | 2987669107 | 375 |
| 1331 | iso_pu_bacteria | 2989771324 | 2989774204 | 375 |
| 1332 | iso_pu_bacteria | 2996310559 | 2996313953 | 375 |
| 1333 | iso_pu_bacteria | 3004203850 | 3004205546 | 375 |
| 1334 | iso_pu_bacteria | 3004211236 | 3004216099 | 375 |
| 1335 | iso_pu_bacteria | 3004218560 | 3004223849 | 375 |
| 1336 | iso_pu_bacteria | 648276728 | 648740485 | 375 |
| 1337 | iso_pu_bacteria | 8002285264 | 8002288938 | 375 |
| 1338 | iso_pu_bacteria | 8003992118 | 8003994075 | 375 |
| 1339 | iso_pu_bacteria | 8004387939 | 8004393514 | 375 |
| 1340 | iso_pu_bacteria | 8004395343 | 8004400982 | 375 |
| 1341 | iso_pu_bacteria | 8004714634 | 8004720282 | 375 |
| 1342 | iso_pu_bacteria | 8049293176 | 8049295239 | 375 |
| 1343 | iso_pu_bacteria | 8054558443 | 8054560753 | 375 |
| 1344 | iso_pu_bacteria | 8055617313 | 8055620908 | 375 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3e1s-assembly1.cif.gz_A | structure of an n-terminal truncation of deinococcus radiodurans recd2 | 0.7701 | 3 | 374 |
| 3gp8-assembly1.cif.gz_A | crystal structure of the binary complex of recd2 with dna | 0.7503 | 3 | 374 |
| 8jx6-assembly1.cif.gz_A | deep-sea helicase 9 (dsh9) | 0.7437 | 4 | 374 |
| 3er0-assembly2.cif.gz_B | crystal structure of the full length eif5a from saccharomyces cerevisiae | 0.7373 | 242 | 303 |
| 8jx6-assembly2.cif.gz_B | deep-sea helicase 9 (dsh9) | 0.7349 | 3 | 374 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F1LX81_770_884_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8985 | 329 | 375 | 3.40.50.300 |
| 3k70G03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7839 | 327 | 374 | 3.40.50.300 |
| af_P04993_474_593_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7611 | 241 | 375 | 3.40.50.300 |
| af_Q0DRG6_235_426_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7519 | 328 | 375 | 3.40.50.300 |
| 3e1sA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7494 | 3 | 170 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529Q9I4-F1-model_v4 | ATP-binding protein | 0.9906 | 190 | 372 |
GO:0005524
|
| AF-A0A3S0F363-F1-model_v4 | ATP-binding protein | 0.9878 | 1 | 375 |
GO:0005524
|
| AF-A0A4R3NPT5-F1-model_v4 | Exodeoxyribonuclease-5 | 0.9877 | 1 | 375 |
GO:0005524
|
| AF-A0A5B8L0P3-F1-model_v4 | AAA family ATPase | 0.9873 | 1 | 375 |
GO:0005524
|
| AF-A0A1W6KNT5-F1-model_v4 | P-loop NTPase domain-containing protein | 0.9869 | 1 | 375 |
GO:0005524
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar