F493060

General Info

Members Datasets Scaffolds Average Seq Length
1329 401 1327 124

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_101206247|Ga0075434_1012062472
Length 152
Sequence MPSRGQANPRRGIGVGSRRGWGPAASKYMKIKTKDDRRRRIHLRQRKRIMGSEERPRLSVFRSVSHVYAQIIDDMTGRTLVSASSVDGTLKGRFAKNVRGGNIKGAEEVGKAIAERSIEKGIKRVVFDRSGFLYHGRIRAVADAARKAGLEF

Samples

Sample ID Description Type Environment
1 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
2 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
116 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
200 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
201 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
202 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
203 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
204 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
205 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
206 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
207 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
208 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
209 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
210 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
211 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
212 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
213 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
214 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
215 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
216 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
217 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
218 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
219 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
220 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
221 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
222 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
223 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
224 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
229 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
230 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
231 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
232 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
233 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
234 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
235 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
236 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
237 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
238 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
239 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
240 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
241 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
242 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
243 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
245 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
246 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
247 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
248 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
249 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
250 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
251 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
252 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
253 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
254 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
255 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
256 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
257 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
258 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
259 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
260 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
261 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
262 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
263 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
264 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
265 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
266 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
267 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
268 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
269 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
270 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
271 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
272 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
273 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
274 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
275 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
276 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
277 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
278 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
279 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
280 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
281 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
282 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
283 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
284 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
285 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
286 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
287 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
288 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
289 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
290 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
291 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
292 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
293 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
294 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
295 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
296 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
297 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
298 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
299 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
300 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
301 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
302 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
303 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
304 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
305 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
306 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
307 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
308 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
309 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
310 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
311 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
312 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
313 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
314 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
315 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
316 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
317 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
318 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
319 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
320 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
321 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
322 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
323 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
324 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
325 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
326 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
327 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
328 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
329 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
330 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
331 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
332 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
333 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
334 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
335 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
336 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
337 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
338 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
339 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
340 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
341 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
342 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
343 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
344 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
345 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
346 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
347 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
348 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
349 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
350 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
351 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
352 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
367 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
368 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
369 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
370 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
371 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
372 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
373 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
374 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
375 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
376 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
377 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
378 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
379 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
380 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
383 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
384 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
385 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
386 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
387 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
388 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
389 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
390 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
391 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
392 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
393 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
394 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
395 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
396 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
397 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
398 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
400 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
401 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.68
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 4.14
Rhizosphere 95.26
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1069413 3300002076 Bacteria 543
2 Ga0058859_11726179 3300004798 Bacteria 795
3 Ga0058863_11600431 3300004799 Bacteria 964
4 Ga0058861_11821092 3300004800 Bacteria 1004
5 Ga0058861_12003411 3300004800 Bacteria 1805
6 Ga0058862_12498887 3300004803 Bacteria 1102
7 Ga0065712_10798698 3300005290 Unclassified 513
8 Ga0065715_10238277 3300005293 Bacteria 1206
9 Ga0065715_11048349 3300005293 Bacteria 529
10 Ga0070676_10007044 3300005328 Bacteria 6019
11 Ga0070676_10159227 3300005328 Bacteria 1452
12 Ga0070676_10403582 3300005328 Bacteria 952
13 Ga0070676_10826011 3300005328 Bacteria 685
14 Ga0070676_11123316 3300005328 Bacteria 595
15 Ga0070683_101683056 3300005329 Bacteria 610
16 Ga0070690_100446006 3300005330 Bacteria 959
17 Ga0070690_101236527 3300005330 Bacteria 597
18 Ga0070690_101753298 3300005330 Bacteria 505
19 Ga0070670_100050949 3300005331 Bacteria 3557
20 Ga0070670_100241783 3300005331 Bacteria 1572
21 Ga0070670_100280626 3300005331 Bacteria 1454
22 Ga0070670_100885322 3300005331 Bacteria 809
23 Ga0070677_10110670 3300005333 Bacteria 1225
24 Ga0070677_10157443 3300005333 Bacteria 1062
25 Ga0070677_10713595 3300005333 Bacteria 566
26 Ga0068869_102011201 3300005334 Bacteria 519
27 Ga0068869_102079101 3300005334 Bacteria 510
28 Ga0070666_10043493 3300005335 Bacteria 3008
29 Ga0070666_10051882 3300005335 Bacteria 2763
30 Ga0070666_10123865 3300005335 Bacteria 1793
31 Ga0070666_10451251 3300005335 Bacteria 928
32 Ga0070666_10820148 3300005335 Bacteria 686
33 Ga0070666_11214269 3300005335 Unclassified 562
34 Ga0070666_11429913 3300005335 Unclassified 517
35 Ga0070680_100400005 3300005336 Bacteria 1171
36 Ga0070680_100820182 3300005336 Bacteria 802
37 Ga0070682_100444190 3300005337 Bacteria 992
38 Ga0068868_100055137 3300005338 Bacteria 3135
39 Ga0068868_100170521 3300005338 Bacteria 1801
40 Ga0068868_100675396 3300005338 Bacteria 922
41 Ga0068868_101592413 3300005338 Bacteria 613
42 Ga0070660_100002987 3300005339 Bacteria 11642
43 Ga0070660_100633893 3300005339 Bacteria 895
44 Ga0070660_100722787 3300005339 Bacteria 836
45 Ga0070660_101198476 3300005339 Bacteria 644
46 Ga0070689_100084047 3300005340 Bacteria 2501
47 Ga0070689_100630930 3300005340 Bacteria 931
48 Ga0070689_100640555 3300005340 Bacteria 924
49 Ga0070691_10004188 3300005341 Bacteria 6554
50 Ga0070687_100080522 3300005343 Bacteria 1776
51 Ga0070687_100823372 3300005343 Bacteria 659
52 Ga0070687_101151696 3300005343 Bacteria 570
53 Ga0070661_100600365 3300005344 Bacteria 890
54 Ga0070661_101709519 3300005344 Bacteria 533
55 Ga0070692_10276697 3300005345 Bacteria 1016
56 Ga0070692_10299123 3300005345 Bacteria 982
57 Ga0070692_10524091 3300005345 Bacteria 772
58 Ga0070692_10731351 3300005345 Bacteria 669
59 Ga0070668_100026838 3300005347 Bacteria 4372
60 Ga0070668_101038652 3300005347 Bacteria 738
61 Ga0070669_100110504 3300005353 Bacteria 2085
62 Ga0070669_100320432 3300005353 Bacteria 1251
63 Ga0070669_100371678 3300005353 Bacteria 1165
64 Ga0070669_100842875 3300005353 Bacteria 781
65 Ga0070669_101966948 3300005353 Bacteria 511
66 Ga0070675_100029203 3300005354 Bacteria 4445
67 Ga0070675_100546245 3300005354 Bacteria 1047
68 Ga0070675_100597463 3300005354 Bacteria 1001
69 Ga0070675_101051383 3300005354 Bacteria 748
70 Ga0070671_100039487 3300005355 Bacteria 3918
71 Ga0070671_100820219 3300005355 Bacteria 810
72 Ga0070671_101556620 3300005355 Bacteria 585
73 Ga0070671_101565528 3300005355 Bacteria 584
74 Ga0070674_100015034 3300005356 Bacteria 4823
75 Ga0070674_100046049 3300005356 Bacteria 2982
76 Ga0070674_100078891 3300005356 Bacteria 2347
77 Ga0070674_100278160 3300005356 Bacteria 1325
78 Ga0070674_100318163 3300005356 Bacteria 1247
79 Ga0070674_101610961 3300005356 Bacteria 586
80 Ga0070673_100003427 3300005364 Bacteria 9877
81 Ga0070673_100043981 3300005364 Bacteria 3455
82 Ga0070673_100087145 3300005364 Bacteria 2544
83 Ga0070673_100249495 3300005364 Bacteria 1546
84 Ga0070673_100455448 3300005364 Bacteria 1151
85 Ga0070673_100640069 3300005364 Bacteria 972
86 Ga0070673_100869254 3300005364 Bacteria 835
87 Ga0070673_100989687 3300005364 Bacteria 783
88 Ga0070673_101510596 3300005364 Bacteria 633
89 Ga0070673_101510610 3300005364 Bacteria 633
90 Ga0070688_100101898 3300005365 Bacteria 1894
91 Ga0070688_100135330 3300005365 Bacteria 1667
92 Ga0070688_100192909 3300005365 Bacteria 1420
93 Ga0070688_100231336 3300005365 Bacteria 1308
94 Ga0070688_100830642 3300005365 Unclassified 724
95 Ga0070688_101335438 3300005365 Bacteria 580
96 Ga0070659_100440655 3300005366 Bacteria 1104
97 Ga0070659_101578708 3300005366 Unclassified 586
98 Ga0070667_100021149 3300005367 Bacteria 5405
99 Ga0070667_100168474 3300005367 Bacteria 1932
100 Ga0070667_100937400 3300005367 Bacteria 807
101 Ga0070667_101063147 3300005367 Bacteria 756
102 Ga0070667_101325267 3300005367 Bacteria 675
103 Ga0070703_10153609 3300005406 Bacteria 867
104 Ga0070703_10362369 3300005406 Bacteria 622
105 Ga0070714_100050502 3300005435 Bacteria 3543
106 Ga0070713_100043372 3300005436 Bacteria 3677
107 Ga0070701_10010126 3300005438 Bacteria 4157
108 Ga0070701_10716296 3300005438 Bacteria 675
109 Ga0070711_101100308 3300005439 Bacteria 685
110 Ga0070711_101399677 3300005439 Bacteria 609
111 Ga0070711_101560940 3300005439 Bacteria 577
112 Ga0070705_100016300 3300005440 Bacteria 3860
113 Ga0070705_100285699 3300005440 Bacteria 1175
114 Ga0070705_101148994 3300005440 Bacteria 637
115 Ga0070700_100080371 3300005441 Bacteria 2103
116 Ga0070700_100432017 3300005441 Bacteria 997
117 Ga0070694_100234674 3300005444 Bacteria 1381
118 Ga0070694_101713959 3300005444 Bacteria 534
119 Ga0070694_101733895 3300005444 Bacteria 532
120 Ga0070708_100055234 3300005445 Bacteria 3531
121 Ga0070708_100215472 3300005445 Bacteria 1800
122 Ga0070708_100526944 3300005445 Bacteria 1115
123 Ga0070708_100687049 3300005445 Bacteria 964
124 Ga0070708_101013417 3300005445 Bacteria 778
125 Ga0070708_101538191 3300005445 Bacteria 620
126 Ga0070663_102144914 3300005455 Unclassified 504
127 Ga0070678_100092251 3300005456 Bacteria 2326
128 Ga0070678_100476417 3300005456 Bacteria 1098
129 Ga0070678_100754103 3300005456 Bacteria 881
130 Ga0070678_100859872 3300005456 Bacteria 827
131 Ga0070678_101782795 3300005456 Unclassified 580
132 Ga0070662_100710711 3300005457 Bacteria 851
133 Ga0070662_101454571 3300005457 Unclassified 591
134 Ga0070681_10348644 3300005458 Bacteria 1391
135 Ga0070681_10770782 3300005458 Bacteria 879
136 Ga0068867_100035655 3300005459 Bacteria 3609
137 Ga0068867_100041777 3300005459 Bacteria 3351
138 Ga0068867_100073877 3300005459 Bacteria 2554
139 Ga0068867_100284679 3300005459 Bacteria 1357
140 Ga0068867_100764044 3300005459 Bacteria 859
141 Ga0068867_101530940 3300005459 Bacteria 622
142 Ga0068867_101605853 3300005459 Bacteria 608
143 Ga0068867_102119332 3300005459 Bacteria 533
144 Ga0070685_10229742 3300005466 Bacteria 1220
145 Ga0070685_10291890 3300005466 Bacteria 1096
146 Ga0070685_10721267 3300005466 Bacteria 729
147 Ga0070685_10933129 3300005466 Unclassified 648
148 Ga0070706_101086183 3300005467 Bacteria 737
149 Ga0070706_101878413 3300005467 Unclassified 544
150 Ga0070707_100125461 3300005468 Bacteria 2494
151 Ga0070707_100175008 3300005468 Bacteria 2092
152 Ga0070707_100175475 3300005468 Bacteria 2089
153 Ga0070698_100034124 3300005471 Bacteria 5270
154 Ga0070698_100183947 3300005471 Bacteria 2028
155 Ga0070698_100419294 3300005471 Bacteria 1273
156 Ga0070698_100624215 3300005471 Bacteria 1019
157 Ga0070698_101219582 3300005471 Bacteria 702
158 Ga0070698_101567014 3300005471 Bacteria 611
159 Ga0070698_101885703 3300005471 Bacteria 551
160 Ga0070699_100006991 3300005518 Bacteria 9807
161 Ga0070699_100119032 3300005518 Bacteria 2322
162 Ga0070699_100183830 3300005518 Bacteria 1855
163 Ga0070699_100336608 3300005518 Bacteria 1358
164 Ga0070699_100629525 3300005518 Unclassified 979
165 Ga0070679_100039507 3300005530 Bacteria 4690
166 Ga0070679_101801104 3300005530 Bacteria 561
167 Ga0070684_100358117 3300005535 Bacteria 1343
168 Ga0070684_101671756 3300005535 Bacteria 601
169 Ga0070697_100052802 3300005536 Bacteria 3303
170 Ga0070697_100193729 3300005536 Bacteria 1726
171 Ga0070697_100923913 3300005536 Bacteria 774
172 Ga0070697_101480664 3300005536 Bacteria 607
173 Ga0070697_101681747 3300005536 Bacteria 568
174 Ga0070697_101720592 3300005536 Bacteria 561
175 Ga0068853_101627908 3300005539 Bacteria 626
176 Ga0070672_100087900 3300005543 Bacteria 2501
177 Ga0070672_100191135 3300005543 Bacteria 1709
178 Ga0070672_100669285 3300005543 Bacteria 907
179 Ga0070672_100745188 3300005543 Bacteria 859
180 Ga0070672_101360894 3300005543 Bacteria 634
181 Ga0070686_100002243 3300005544 Bacteria 10661
182 Ga0070686_100024325 3300005544 Bacteria 3629
183 Ga0070686_100324083 3300005544 Bacteria 1149
184 Ga0070686_100499656 3300005544 Bacteria 943
185 Ga0070686_100566683 3300005544 Bacteria 890
186 Ga0070686_100715680 3300005544 Bacteria 800
187 Ga0070686_100846121 3300005544 Bacteria 740
188 Ga0070686_101561103 3300005544 Bacteria 558
189 Ga0070695_100036049 3300005545 Bacteria 3111
190 Ga0070695_100063603 3300005545 Bacteria 2398
191 Ga0070695_101014162 3300005545 Bacteria 676
192 Ga0070695_101247862 3300005545 Bacteria 613
193 Ga0070696_100012605 3300005546 Bacteria 5675
194 Ga0070696_100145121 3300005546 Bacteria 1738
195 Ga0070696_100707806 3300005546 Bacteria 821
196 Ga0070696_100938895 3300005546 Bacteria 719
197 Ga0070693_100775204 3300005547 Bacteria 709
198 Ga0070665_100004733 3300005548 Bacteria 14164
199 Ga0070665_100005447 3300005548 Bacteria 13122
200 Ga0070665_100010437 3300005548 Bacteria 9398
201 Ga0070665_100157655 3300005548 Bacteria 2271
202 Ga0070704_100074149 3300005549 Bacteria 2481
203 Ga0070704_100096664 3300005549 Bacteria 2215
204 Ga0070704_100355660 3300005549 Bacteria 1238
205 Ga0070704_100427538 3300005549 Bacteria 1135
206 Ga0070704_100521050 3300005549 Bacteria 1035
207 Ga0070704_101762984 3300005549 Bacteria 572
208 Ga0070704_101999660 3300005549 Unclassified 538
209 Ga0068855_100286434 3300005563 Bacteria 1827
210 Ga0068855_101552138 3300005563 Bacteria 679
211 Ga0070664_100786017 3300005564 Bacteria 889
212 Ga0070664_100943983 3300005564 Bacteria 810
213 Ga0068857_100422841 3300005577 Bacteria 1242
214 Ga0068857_100651834 3300005577 Bacteria 998
215 Ga0068857_101577410 3300005577 Bacteria 641
216 Ga0068854_100177554 3300005578 Bacteria 1661
217 Ga0068854_100226776 3300005578 Bacteria 1481
218 Ga0068854_100367708 3300005578 Bacteria 1181
219 Ga0068854_100710055 3300005578 Bacteria 869
220 Ga0068854_100794160 3300005578 Bacteria 824
221 Ga0068854_101174523 3300005578 Bacteria 687
222 Ga0068854_101451584 3300005578 Bacteria 622
223 Ga0068856_100018557 3300005614 Bacteria 6740
224 Ga0068856_101363773 3300005614 Unclassified 724
225 Ga0070702_100002883 3300005615 Bacteria 7557
226 Ga0070702_100096432 3300005615 Bacteria 1805
227 Ga0070702_100711926 3300005615 Bacteria 766
228 Ga0070702_101158181 3300005615 Bacteria 621
229 Ga0070702_101340709 3300005615 Bacteria 583
230 Ga0068859_100020008 3300005617 Bacteria 6721
231 Ga0068859_100168307 3300005617 Bacteria 2272
232 Ga0068859_100204696 3300005617 Bacteria 2058
233 Ga0068859_100207182 3300005617 Bacteria 2046
234 Ga0068859_101061226 3300005617 Bacteria 891
235 Ga0068859_101181081 3300005617 Bacteria 843
236 Ga0068859_101227473 3300005617 Bacteria 826
237 Ga0068859_101638902 3300005617 Bacteria 710
238 Ga0068859_102312331 3300005617 Bacteria 593
239 Ga0068859_102342522 3300005617 Bacteria 589
240 Ga0068859_102459209 3300005617 Bacteria 574
241 Ga0068859_103010841 3300005617 Unclassified 515
242 Ga0068864_100022274 3300005618 Bacteria 5312
243 Ga0068864_100054633 3300005618 Bacteria 3447
244 Ga0068864_100075695 3300005618 Bacteria 2940
245 Ga0068864_100174352 3300005618 Bacteria 1962
246 Ga0068864_100445229 3300005618 Bacteria 1238
247 Ga0068864_100880036 3300005618 Bacteria 884
248 Ga0068866_10135275 3300005718 Bacteria 1407
249 Ga0068866_10488287 3300005718 Bacteria 813
250 Ga0068861_100024888 3300005719 Bacteria 4334
251 Ga0068861_100182622 3300005719 Bacteria 1747
252 Ga0068861_100426718 3300005719 Bacteria 1182
253 Ga0068861_100882762 3300005719 Bacteria 845
254 Ga0068861_101910583 3300005719 Bacteria 591
255 Ga0068861_102018129 3300005719 Bacteria 576
256 Ga0068851_10330413 3300005834 Bacteria 883
257 Ga0068870_10292977 3300005840 Bacteria 1024
258 Ga0068863_100116801 3300005841 Bacteria 2542
259 Ga0068863_100239167 3300005841 Bacteria 1752
260 Ga0068863_101184807 3300005841 Bacteria 770
261 Ga0068863_101205666 3300005841 Bacteria 763
262 Ga0068863_101377225 3300005841 Bacteria 713
263 Ga0068863_102375069 3300005841 Bacteria 540
264 Ga0068858_100001254 3300005842 Bacteria 26256
265 Ga0068858_100008638 3300005842 Bacteria 9781
266 Ga0068858_100189424 3300005842 Bacteria 1944
267 Ga0068858_100454458 3300005842 Bacteria 1235
268 Ga0068858_100524546 3300005842 Bacteria 1146
269 Ga0068858_100550706 3300005842 Bacteria 1117
270 Ga0068858_100607081 3300005842 Bacteria 1061
271 Ga0068858_100637732 3300005842 Bacteria 1035
272 Ga0068858_100907620 3300005842 Bacteria 861
273 Ga0068858_100911270 3300005842 Bacteria 860
274 Ga0068858_101855983 3300005842 Bacteria 595
275 Ga0068860_100129065 3300005843 Bacteria 2424
276 Ga0068860_100269111 3300005843 Bacteria 1663
277 Ga0068860_100344425 3300005843 Bacteria 1466
278 Ga0068860_100534033 3300005843 Bacteria 1174
279 Ga0068860_100563925 3300005843 Bacteria 1142
280 Ga0068860_100875480 3300005843 Bacteria 914
281 Ga0068860_100939707 3300005843 Bacteria 882
282 Ga0068860_101020331 3300005843 Bacteria 846
283 Ga0068860_101064746 3300005843 Bacteria 827
284 Ga0068860_101786406 3300005843 Bacteria 637
285 Ga0068860_101797395 3300005843 Bacteria 635
286 Ga0068860_102136986 3300005843 Bacteria 581
287 Ga0068860_102258412 3300005843 Bacteria 565
288 Ga0068862_100033577 3300005844 Bacteria 4339
289 Ga0068862_100109135 3300005844 Bacteria 2427
290 Ga0068862_100110658 3300005844 Bacteria 2410
291 Ga0068862_101185800 3300005844 Bacteria 761
292 Ga0068862_101747854 3300005844 Bacteria 631
293 Ga0068862_101788945 3300005844 Bacteria 623
294 Ga0068862_102603068 3300005844 Unclassified 518
295 Ga0068862_102700756 3300005844 Bacteria 508
296 Ga0081455_10015745 3300005937 Bacteria 7324
297 Ga0070715_10822029 3300006163 Unclassified 566
298 Ga0070716_101496230 3300006173 Bacteria 552
299 Ga0070712_101324108 3300006175 Bacteria 628
300 Ga0070712_102018472 3300006175 Bacteria 505
301 Ga0097621_100006061 3300006237 Bacteria 8549
302 Ga0097621_100147924 3300006237 Bacteria 2013
303 Ga0097621_100238936 3300006237 Bacteria 1588
304 Ga0097621_100613316 3300006237 Bacteria 995
305 Ga0097621_100701910 3300006237 Bacteria 932
306 Ga0097621_101850913 3300006237 Unclassified 576
307 Ga0068871_100006055 3300006358 Bacteria 8509
308 Ga0068871_100040321 3300006358 Bacteria 3740
309 Ga0068871_100075510 3300006358 Bacteria 2782
310 Ga0068871_100110412 3300006358 Bacteria 2313
311 Ga0068871_100252750 3300006358 Bacteria 1536
312 Ga0068871_100379477 3300006358 Bacteria 1255
313 Ga0068871_100483006 3300006358 Bacteria 1115
314 Ga0068871_100788038 3300006358 Bacteria 875
315 Ga0068871_101167014 3300006358 Bacteria 722
316 Ga0075428_100319068 3300006844 Bacteria 1670
317 Ga0075428_100557089 3300006844 Bacteria 1225
318 Ga0075428_101239362 3300006844 Bacteria 786
319 Ga0075428_101335471 3300006844 Bacteria 753
320 Ga0075428_102391723 3300006844 Bacteria 542
321 Ga0075428_102693128 3300006844 Bacteria 507
322 Ga0075431_100155827 3300006847 Bacteria 2350
323 Ga0075431_100693248 3300006847 Bacteria 997
324 Ga0075433_10027003 3300006852 Bacteria 4866
325 Ga0075433_10100150 3300006852 Bacteria 2565
326 Ga0075433_10266146 3300006852 Bacteria 1519
327 Ga0075433_10422349 3300006852 Bacteria 1176
328 Ga0075433_10530184 3300006852 Bacteria 1036
329 Ga0075433_10707097 3300006852 Bacteria 882
330 Ga0075433_10920255 3300006852 Bacteria 762
331 Ga0075433_11004137 3300006852 Bacteria 727
332 Ga0075433_11051171 3300006852 Bacteria 709
333 Ga0075433_11484792 3300006852 Bacteria 586
334 Ga0075434_100069571 3300006871 Bacteria 3509
335 Ga0075434_100080091 3300006871 Bacteria 3262
336 Ga0075434_100109389 3300006871 Bacteria 2774
337 Ga0075434_100110530 3300006871 Bacteria 2759
338 Ga0075434_100135753 3300006871 Bacteria 2479
339 Ga0075434_100149750 3300006871 Bacteria 2354
340 Ga0075434_100986207 3300006871 Bacteria 857
341 Ga0075434_101206247 3300006871 Bacteria 769
342 Ga0075434_101242135 3300006871 Bacteria 757
343 Ga0075434_101338423 3300006871 Bacteria 727
344 Ga0075434_101646263 3300006871 Bacteria 650
345 Ga0075434_101761663 3300006871 Bacteria 627
346 Ga0075434_101830128 3300006871 Unclassified 614
347 Ga0075429_100476401 3300006880 Bacteria 1094
348 Ga0075429_100583453 3300006880 Bacteria 979
349 Ga0075429_100959948 3300006880 Bacteria 748
350 Ga0075429_101272403 3300006880 Bacteria 642
351 Ga0075429_101630104 3300006880 Bacteria 561
352 Ga0068865_100006729 3300006881 Bacteria 7032
353 Ga0068865_100111154 3300006881 Bacteria 2022
354 Ga0068865_100386721 3300006881 Bacteria 1142
355 Ga0068865_100661817 3300006881 Bacteria 889
356 Ga0068865_101497341 3300006881 Bacteria 605
357 Ga0075436_100018272 3300006914 Bacteria 4802
358 Ga0075436_100038116 3300006914 Bacteria 3318
359 Ga0075436_100107040 3300006914 Bacteria 1950
360 Ga0075436_100110506 3300006914 Bacteria 1918
361 Ga0075436_100177377 3300006914 Bacteria 1505
362 Ga0075436_100380999 3300006914 Bacteria 1020
363 Ga0075436_100465602 3300006914 Bacteria 922
364 Ga0075436_100843550 3300006914 Bacteria 684
365 Ga0097620_100020008 3300006931 Bacteria 6721
366 Ga0097620_100168317 3300006931 Bacteria 2272
367 Ga0097620_100204697 3300006931 Bacteria 2058
368 Ga0097620_100207170 3300006931 Bacteria 2046
369 Ga0097620_101061169 3300006931 Bacteria 891
370 Ga0097620_101181026 3300006931 Bacteria 843
371 Ga0097620_101227295 3300006931 Bacteria 826
372 Ga0097620_101638912 3300006931 Bacteria 710
373 Ga0097620_101844792 3300006931 Bacteria 668
374 Ga0097620_102312365 3300006931 Bacteria 593
375 Ga0097620_102342528 3300006931 Bacteria 589
376 Ga0097620_102459251 3300006931 Bacteria 574
377 Ga0097620_103011687 3300006931 Unclassified 515
378 Ga0075435_100001542 3300007076 Bacteria 14846
379 Ga0075435_100001694 3300007076 Bacteria 14328
380 Ga0075435_100028991 3300007076 Bacteria 4343
381 Ga0075435_100038141 3300007076 Bacteria 3830
382 Ga0075435_100103730 3300007076 Bacteria 2359
383 Ga0075435_100173755 3300007076 Bacteria 1818
384 Ga0075435_100360575 3300007076 Bacteria 1247
385 Ga0075435_101413232 3300007076 Bacteria 610
386 Ga0099794_10254417 3300007265 Bacteria 906
387 Ga0099795_10238705 3300007788 Bacteria 780
388 Ga0105251_10204990 3300009011 Bacteria 888
389 Ga0105244_10201811 3300009036 Bacteria 937
390 Ga0105240_10177867 3300009093 Bacteria 2514
391 Ga0105240_11534098 3300009093 Bacteria 698
392 Ga0105240_11757013 3300009093 Bacteria 647
393 Ga0111539_10000566 3300009094 Bacteria 47366
394 Ga0111539_10016960 3300009094 Bacteria 9014
395 Ga0111539_10049169 3300009094 Bacteria 5031
396 Ga0111539_10060191 3300009094 Bacteria 4500
397 Ga0111539_10253014 3300009094 Bacteria 2051
398 Ga0111539_10371413 3300009094 Bacteria 1665
399 Ga0111539_11286458 3300009094 Bacteria 849
400 Ga0111539_11370056 3300009094 Bacteria 821
401 Ga0105245_10035527 3300009098 Bacteria 4423
402 Ga0105245_10062980 3300009098 Bacteria 3348
403 Ga0105245_10246998 3300009098 Bacteria 1732
404 Ga0105245_11607643 3300009098 Bacteria 702
405 Ga0105245_11796780 3300009098 Bacteria 666
406 Ga0105247_10004209 3300009101 Bacteria 9230
407 Ga0105247_10211185 3300009101 Bacteria 1309
408 Ga0105247_10262879 3300009101 Bacteria 1184
409 Ga0105247_10307365 3300009101 Bacteria 1102
410 Ga0105247_10959656 3300009101 Bacteria 665
411 Ga0105247_11766986 3300009101 Bacteria 513
412 Ga0114129_10017270 3300009147 Bacteria 10276
413 Ga0114129_10049690 3300009147 Bacteria 5892
414 Ga0114129_10101848 3300009147 Bacteria 3972
415 Ga0114129_10123569 3300009147 Bacteria 3560
416 Ga0114129_10148538 3300009147 Bacteria 3209
417 Ga0114129_10216991 3300009147 Bacteria 2583
418 Ga0114129_10279068 3300009147 Bacteria 2233
419 Ga0114129_10303039 3300009147 Bacteria 2129
420 Ga0114129_10594150 3300009147 Bacteria 1435
421 Ga0114129_10821965 3300009147 Bacteria 1184
422 Ga0105243_10054004 3300009148 Bacteria 3188
423 Ga0105243_10063021 3300009148 Bacteria 2970
424 Ga0105243_10118284 3300009148 Bacteria 2229
425 Ga0105243_11010881 3300009148 Bacteria 835
426 Ga0105243_11205257 3300009148 Unclassified 770
427 Ga0105243_11243063 3300009148 Bacteria 760
428 Ga0105243_11245619 3300009148 Bacteria 759
429 Ga0105243_11579002 3300009148 Bacteria 682
430 Ga0105241_10100846 3300009174 Bacteria 2295
431 Ga0105241_10789569 3300009174 Bacteria 874
432 Ga0105241_12110588 3300009174 Bacteria 557
433 Ga0105242_10013585 3300009176 Bacteria 6299
434 Ga0105242_10129022 3300009176 Bacteria 2180
435 Ga0105242_10177665 3300009176 Bacteria 1876
436 Ga0105242_10512431 3300009176 Bacteria 1143
437 Ga0105242_10925046 3300009176 Bacteria 874
438 Ga0105242_11087995 3300009176 Bacteria 813
439 Ga0105242_12961599 3300009176 Bacteria 525
440 Ga0105248_10013460 3300009177 Bacteria 9007
441 Ga0105248_10019507 3300009177 Bacteria 7503
442 Ga0105248_10053076 3300009177 Bacteria 4548
443 Ga0105248_10320163 3300009177 Bacteria 1747
444 Ga0105248_10354349 3300009177 Bacteria 1652
445 Ga0105248_10387276 3300009177 Bacteria 1574
446 Ga0105248_10440668 3300009177 Bacteria 1467
447 Ga0105248_10794659 3300009177 Bacteria 1068
448 Ga0105248_11122134 3300009177 Bacteria 889
449 Ga0105248_11209782 3300009177 Bacteria 854
450 Ga0105248_11267466 3300009177 Bacteria 834
451 Ga0105248_11359820 3300009177 Unclassified 803
452 Ga0105248_11666203 3300009177 Bacteria 723
453 Ga0105248_12154192 3300009177 Bacteria 634
454 Ga0105248_12163185 3300009177 Bacteria 633
455 Ga0105248_12341195 3300009177 Bacteria 608
456 Ga0105248_12626452 3300009177 Unclassified 574
457 Ga0105237_10904267 3300009545 Bacteria 890
458 Ga0105238_10121264 3300009551 Bacteria 2594
459 Ga0105238_10125557 3300009551 Bacteria 2545
460 Ga0105238_10403235 3300009551 Bacteria 1361
461 Ga0105238_10628223 3300009551 Bacteria 1083
462 Ga0105238_11419503 3300009551 Bacteria 722
463 Ga0105238_11928995 3300009551 Bacteria 624
464 Ga0105249_10421252 3300009553 Bacteria 1369
465 Ga0105249_10455911 3300009553 Bacteria 1318
466 Ga0105249_10553701 3300009553 Bacteria 1201
467 Ga0105249_10629169 3300009553 Bacteria 1130
468 Ga0105249_10677625 3300009553 Bacteria 1090
469 Ga0105249_10974549 3300009553 Bacteria 916
470 Ga0105249_11323713 3300009553 Bacteria 792
471 Ga0105249_11803113 3300009553 Bacteria 684
472 Ga0099796_10030103 3300010159 Bacteria 1758
473 Ga0099796_10256688 3300010159 Bacteria 728
474 Ga0105239_11018775 3300010375 Bacteria 952
475 Ga0105246_10092494 3300011119 Bacteria 2183
476 Ga0105246_10336797 3300011119 Bacteria 1231
477 Ga0105246_10595286 3300011119 Bacteria 955
478 Ga0157329_1022760 3300012491 Bacteria 600
479 Ga0157319_1029039 3300012497 Bacteria 587
480 Ga0157369_10421253 3300013105 Bacteria 1384
481 Ga0157374_10119547 3300013296 Bacteria 2541
482 Ga0157374_10433731 3300013296 Bacteria 1314
483 Ga0157374_10813153 3300013296 Bacteria 951
484 Ga0157378_10067386 3300013297 Bacteria 3207
485 Ga0157378_10231855 3300013297 Bacteria 1760
486 Ga0157378_10474815 3300013297 Bacteria 1245
487 Ga0157378_11951552 3300013297 Bacteria 636
488 Ga0157378_12287744 3300013297 Bacteria 592
489 Ga0157378_12754927 3300013297 Bacteria 544
490 Ga0157378_13237018 3300013297 Bacteria 506
491 Ga0163162_10039352 3300013306 Bacteria 4724
492 Ga0163162_10364795 3300013306 Bacteria 1577
493 Ga0163162_10454448 3300013306 Bacteria 1413
494 Ga0163162_10924852 3300013306 Bacteria 984
495 Ga0163162_11058630 3300013306 Bacteria 918
496 Ga0163162_11731942 3300013306 Bacteria 714
497 Ga0163162_11751606 3300013306 Bacteria 710
498 Ga0163162_12322375 3300013306 Bacteria 616
499 Ga0157375_10053326 3300013308 Bacteria 3978
500 Ga0157375_10234254 3300013308 Bacteria 1995
501 Ga0157375_10277484 3300013308 Bacteria 1839
502 Ga0157375_10659062 3300013308 Bacteria 1202
503 Ga0157375_12058362 3300013308 Bacteria 679
504 Ga0157375_12205789 3300013308 Bacteria 656
505 Ga0157375_13542195 3300013308 Bacteria 519
506 Ga0163163_10061505 3300014325 Bacteria 3721
507 Ga0163163_10087285 3300014325 Bacteria 3130
508 Ga0163163_11020555 3300014325 Bacteria 890
509 Ga0163163_11096071 3300014325 Bacteria 859
510 Ga0163163_11427330 3300014325 Unclassified 754
511 Ga0157380_10075300 3300014326 Bacteria 2743
512 Ga0157380_10194070 3300014326 Bacteria 1795
513 Ga0157380_10280688 3300014326 Bacteria 1524
514 Ga0157380_10542010 3300014326 Bacteria 1139
515 Ga0157380_11856683 3300014326 Bacteria 662
516 Ga0157377_10019122 3300014745 Bacteria 3575
517 Ga0157377_10415483 3300014745 Bacteria 920
518 Ga0157377_10670906 3300014745 Bacteria 749
519 Ga0157377_10987261 3300014745 Bacteria 636
520 Ga0157377_11004875 3300014745 Bacteria 632
521 Ga0157379_10018550 3300014968 Bacteria 6136
522 Ga0157379_10063370 3300014968 Bacteria 3306
523 Ga0157379_10072684 3300014968 Bacteria 3077
524 Ga0157379_10146389 3300014968 Bacteria 2130
525 Ga0157379_10637239 3300014968 Bacteria 997
526 Ga0157379_10852336 3300014968 Bacteria 862
527 Ga0157379_11881743 3300014968 Bacteria 589
528 Ga0157376_10057273 3300014969 Bacteria 3259
529 Ga0157376_10145796 3300014969 Bacteria 2129
530 Ga0157376_10462769 3300014969 Bacteria 1239
531 Ga0157376_10583929 3300014969 Bacteria 1110
532 Ga0157376_11759762 3300014969 Bacteria 655
533 Ga0182007_10166916 3300015262 Bacteria 755
534 Ga0163161_10634310 3300017792 Bacteria 884
535 Ga0163161_10801553 3300017792 Bacteria 791
536 Ga0213876_10068153 3300021384 Bacteria 1880
537 Ga0207697_10022506 3300025315 Bacteria 2582
538 Ga0207697_10102162 3300025315 Bacteria 1223
539 Ga0207653_10034046 3300025885 Bacteria 1654
540 Ga0207682_10124695 3300025893 Bacteria 1145
541 Ga0207682_10134539 3300025893 Bacteria 1105
542 Ga0207682_10488355 3300025893 Bacteria 583
543 Ga0207642_10054168 3300025899 Bacteria 1828
544 Ga0207642_10663060 3300025899 Bacteria 655
545 Ga0207710_10084463 3300025900 Bacteria 1477
546 Ga0207710_10280234 3300025900 Bacteria 839
547 Ga0207688_10150432 3300025901 Bacteria 1375
548 Ga0207680_10142130 3300025903 Bacteria 1592
549 Ga0207680_10142428 3300025903 Bacteria 1590
550 Ga0207680_10337447 3300025903 Bacteria 1057
551 Ga0207680_10756860 3300025903 Bacteria 696
552 Ga0207680_10784100 3300025903 Bacteria 683
553 Ga0207685_10191380 3300025905 Bacteria 955
554 Ga0207699_10476806 3300025906 Bacteria 898
555 Ga0207699_10553436 3300025906 Bacteria 835
556 Ga0207645_10025953 3300025907 Bacteria 3789
557 Ga0207645_10155591 3300025907 Bacteria 1493
558 Ga0207645_10299026 3300025907 Bacteria 1071
559 Ga0207645_10304678 3300025907 Bacteria 1061
560 Ga0207645_10766794 3300025907 Bacteria 656
561 Ga0207645_10804889 3300025907 Bacteria 639
562 Ga0207705_10423658 3300025909 Bacteria 1031
563 Ga0207684_10880897 3300025910 Bacteria 753
564 Ga0207684_11587821 3300025910 Bacteria 530
565 Ga0207654_10338850 3300025911 Bacteria 1032
566 Ga0207707_10276896 3300025912 Bacteria 1454
567 Ga0207707_10595812 3300025912 Bacteria 936
568 Ga0207695_10131709 3300025913 Bacteria 2458
569 Ga0207695_10667116 3300025913 Bacteria 921
570 Ga0207695_11176248 3300025913 Bacteria 647
571 Ga0207671_10744242 3300025914 Bacteria 779
572 Ga0207693_10405020 3300025915 Bacteria 1066
573 Ga0207663_10236530 3300025916 Bacteria 1337
574 Ga0207663_10461732 3300025916 Bacteria 981
575 Ga0207663_10608636 3300025916 Bacteria 859
576 Ga0207663_10908255 3300025916 Bacteria 704
577 Ga0207660_10323655 3300025917 Bacteria 1232
578 Ga0207660_10617415 3300025917 Bacteria 883
579 Ga0207660_11242679 3300025917 Bacteria 606
580 Ga0207660_11689343 3300025917 Bacteria 509
581 Ga0207662_10118237 3300025918 Bacteria 1659
582 Ga0207662_10364872 3300025918 Bacteria 973
583 Ga0207662_10388071 3300025918 Bacteria 944
584 Ga0207662_10996645 3300025918 Bacteria 595
585 Ga0207662_11030518 3300025918 Bacteria 585
586 Ga0207662_11269996 3300025918 Bacteria 523
587 Ga0207657_10013143 3300025919 Bacteria 8130
588 Ga0207657_10468361 3300025919 Bacteria 988
589 Ga0207649_10350896 3300025920 Bacteria 1092
590 Ga0207652_10041098 3300025921 Bacteria 3929
591 Ga0207646_10036909 3300025922 Bacteria 4409
592 Ga0207646_10097073 3300025922 Bacteria 2640
593 Ga0207646_10278375 3300025922 Bacteria 1512
594 Ga0207646_10987315 3300025922 Bacteria 744
595 Ga0207646_11364446 3300025922 Bacteria 617
596 Ga0207681_10119814 3300025923 Bacteria 1928
597 Ga0207681_10272317 3300025923 Bacteria 1329
598 Ga0207681_10303136 3300025923 Bacteria 1265
599 Ga0207681_10368046 3300025923 Bacteria 1154
600 Ga0207681_10678473 3300025923 Bacteria 855
601 Ga0207681_10808536 3300025923 Bacteria 783
602 Ga0207681_11226222 3300025923 Bacteria 630
603 Ga0207694_10261502 3300025924 Bacteria 1418
604 Ga0207650_10063849 3300025925 Bacteria 2755
605 Ga0207650_10366088 3300025925 Bacteria 1188
606 Ga0207650_10773931 3300025925 Bacteria 813
607 Ga0207650_11766239 3300025925 Bacteria 524
608 Ga0207659_10001199 3300025926 Bacteria 15459
609 Ga0207659_10126623 3300025926 Bacteria 1965
610 Ga0207659_11153919 3300025926 Bacteria 666
611 Ga0207659_11281384 3300025926 Bacteria 629
612 Ga0207687_10015584 3300025927 Bacteria 4986
613 Ga0207687_10063053 3300025927 Bacteria 2623
614 Ga0207687_10714987 3300025927 Bacteria 851
615 Ga0207687_10747528 3300025927 Bacteria 832
616 Ga0207687_10859573 3300025927 Bacteria 775
617 Ga0207687_11120420 3300025927 Bacteria 676
618 Ga0207700_10152692 3300025928 Bacteria 1910
619 Ga0207664_10050545 3300025929 Bacteria 3278
620 Ga0207644_10059656 3300025931 Bacteria 2759
621 Ga0207644_10075564 3300025931 Bacteria 2476
622 Ga0207644_10355905 3300025931 Bacteria 1190
623 Ga0207644_10853274 3300025931 Bacteria 763
624 Ga0207644_11044450 3300025931 Bacteria 686
625 Ga0207644_11379665 3300025931 Bacteria 592
626 Ga0207690_10232957 3300025932 Bacteria 1415
627 Ga0207690_10926198 3300025932 Bacteria 723
628 Ga0207706_10047200 3300025933 Bacteria 3811
629 Ga0207706_10848538 3300025933 Bacteria 774
630 Ga0207706_11081156 3300025933 Bacteria 671
631 Ga0207706_11415773 3300025933 Bacteria 570
632 Ga0207686_10011631 3300025934 Bacteria 4826
633 Ga0207686_10013361 3300025934 Bacteria 4541
634 Ga0207686_10016494 3300025934 Bacteria 4146
635 Ga0207686_10160445 3300025934 Bacteria 1575
636 Ga0207686_10482102 3300025934 Bacteria 959
637 Ga0207686_10739320 3300025934 Bacteria 785
638 Ga0207709_10007222 3300025935 Bacteria 6197
639 Ga0207709_10084540 3300025935 Bacteria 2055
640 Ga0207709_10227729 3300025935 Bacteria 1349
641 Ga0207709_10555188 3300025935 Bacteria 904
642 Ga0207709_11061475 3300025935 Bacteria 664
643 Ga0207709_11360583 3300025935 Unclassified 587
644 Ga0207670_10082596 3300025936 Bacteria 2252
645 Ga0207670_10280206 3300025936 Bacteria 1299
646 Ga0207670_10343977 3300025936 Bacteria 1179
647 Ga0207670_10510891 3300025936 Bacteria 977
648 Ga0207670_11579906 3300025936 Unclassified 558
649 Ga0207669_10082660 3300025937 Bacteria 2062
650 Ga0207669_10127353 3300025937 Bacteria 1742
651 Ga0207669_10211411 3300025937 Bacteria 1416
652 Ga0207669_10337513 3300025937 Bacteria 1159
653 Ga0207669_10544775 3300025937 Bacteria 935
654 Ga0207669_11672365 3300025937 Unclassified 544
655 Ga0207704_10005828 3300025938 Bacteria 5701
656 Ga0207704_10169986 3300025938 Bacteria 1562
657 Ga0207704_10211258 3300025938 Bacteria 1428
658 Ga0207704_10588504 3300025938 Unclassified 909
659 Ga0207704_10670622 3300025938 Bacteria 856
660 Ga0207704_10861195 3300025938 Bacteria 760
661 Ga0207704_11081165 3300025938 Bacteria 681
662 Ga0207665_10048683 3300025939 Bacteria 2846
663 Ga0207691_10183706 3300025940 Bacteria 1826
664 Ga0207691_10213997 3300025940 Bacteria 1673
665 Ga0207691_10339779 3300025940 Bacteria 1285
666 Ga0207691_10656486 3300025940 Bacteria 886
667 Ga0207691_10680510 3300025940 Bacteria 868
668 Ga0207691_10734933 3300025940 Bacteria 831
669 Ga0207711_10026433 3300025941 Bacteria 4870
670 Ga0207711_10042393 3300025941 Bacteria 3878
671 Ga0207711_10050802 3300025941 Bacteria 3550
672 Ga0207711_10136539 3300025941 Bacteria 2203
673 Ga0207711_10366022 3300025941 Bacteria 1336
674 Ga0207711_10393563 3300025941 Bacteria 1287
675 Ga0207711_10719139 3300025941 Bacteria 931
676 Ga0207711_10920606 3300025941 Bacteria 812
677 Ga0207711_11549451 3300025941 Bacteria 606
678 Ga0207689_10034411 3300025942 Bacteria 4209
679 Ga0207689_10073175 3300025942 Bacteria 2815
680 Ga0207689_10293746 3300025942 Bacteria 1346
681 Ga0207689_10842358 3300025942 Bacteria 774
682 Ga0207689_11137741 3300025942 Bacteria 658
683 Ga0207689_11716710 3300025942 Bacteria 520
684 Ga0207661_10778463 3300025944 Bacteria 881
685 Ga0207661_11300702 3300025944 Bacteria 668
686 Ga0207679_10203401 3300025945 Bacteria 1655
687 Ga0207679_10448444 3300025945 Bacteria 1144
688 Ga0207679_10525449 3300025945 Bacteria 1059
689 Ga0207679_10541467 3300025945 Bacteria 1043
690 Ga0207679_11495173 3300025945 Bacteria 619
691 Ga0207667_10017864 3300025949 Bacteria 7972
692 Ga0207667_10168529 3300025949 Bacteria 2251
693 Ga0207667_11060981 3300025949 Bacteria 795
694 Ga0207651_10041000 3300025960 Bacteria 3069
695 Ga0207651_10110459 3300025960 Bacteria 2062
696 Ga0207651_10149189 3300025960 Bacteria 1818
697 Ga0207651_10156204 3300025960 Bacteria 1782
698 Ga0207651_10612455 3300025960 Bacteria 953
699 Ga0207651_10809175 3300025960 Bacteria 831
700 Ga0207651_10940673 3300025960 Bacteria 771
701 Ga0207651_11019218 3300025960 Bacteria 740
702 Ga0207651_11995319 3300025960 Bacteria 521
703 Ga0207712_10259532 3300025961 Bacteria 1408
704 Ga0207712_10271248 3300025961 Bacteria 1380
705 Ga0207712_10358937 3300025961 Bacteria 1213
706 Ga0207712_10428530 3300025961 Bacteria 1117
707 Ga0207712_10536849 3300025961 Bacteria 1004
708 Ga0207712_10660543 3300025961 Unclassified 909
709 Ga0207712_10662725 3300025961 Bacteria 908
710 Ga0207712_11489875 3300025961 Bacteria 606
711 Ga0207668_10076681 3300025972 Bacteria 2408
712 Ga0207668_10098613 3300025972 Bacteria 2165
713 Ga0207668_10310878 3300025972 Bacteria 1304
714 Ga0207640_10114374 3300025981 Bacteria 1920
715 Ga0207640_10198422 3300025981 Bacteria 1519
716 Ga0207640_10209777 3300025981 Bacteria 1483
717 Ga0207640_10652383 3300025981 Bacteria 897
718 Ga0207640_11132033 3300025981 Bacteria 694
719 Ga0207640_11211209 3300025981 Bacteria 672
720 Ga0207658_10353365 3300025986 Bacteria 1280
721 Ga0207658_10483386 3300025986 Bacteria 1101
722 Ga0207658_10856472 3300025986 Bacteria 826
723 Ga0207658_11004853 3300025986 Bacteria 761
724 Ga0207658_11859221 3300025986 Bacteria 549
725 Ga0207677_10084348 3300026023 Bacteria 2290
726 Ga0207677_10149948 3300026023 Bacteria 1797
727 Ga0207677_10288695 3300026023 Bacteria 1350
728 Ga0207677_10390960 3300026023 Bacteria 1177
729 Ga0207677_10620671 3300026023 Bacteria 951
730 Ga0207703_10114539 3300026035 Bacteria 2306
731 Ga0207703_10160423 3300026035 Bacteria 1969
732 Ga0207703_10215416 3300026035 Bacteria 1714
733 Ga0207703_10280457 3300026035 Bacteria 1513
734 Ga0207703_10383633 3300026035 Bacteria 1300
735 Ga0207703_10456520 3300026035 Bacteria 1194
736 Ga0207703_10505061 3300026035 Bacteria 1135
737 Ga0207703_11379936 3300026035 Bacteria 678
738 Ga0207703_12246442 3300026035 Bacteria 521
739 Ga0207639_10805391 3300026041 Bacteria 875
740 Ga0207639_12009415 3300026041 Bacteria 539
741 Ga0207639_12288411 3300026041 Bacteria 502
742 Ga0207678_10817264 3300026067 Bacteria 823
743 Ga0207678_11080060 3300026067 Bacteria 711
744 Ga0207678_11214375 3300026067 Bacteria 668
745 Ga0207708_10025274 3300026075 Bacteria 4492
746 Ga0207708_10107694 3300026075 Bacteria 2161
747 Ga0207708_11329283 3300026075 Bacteria 630
748 Ga0207708_11763130 3300026075 Bacteria 543
749 Ga0207702_10262266 3300026078 Bacteria 1627
750 Ga0207702_11376268 3300026078 Unclassified 700
751 Ga0207641_10087096 3300026088 Bacteria 2724
752 Ga0207641_10099999 3300026088 Bacteria 2553
753 Ga0207641_10674713 3300026088 Bacteria 1016
754 Ga0207641_10742896 3300026088 Bacteria 968
755 Ga0207641_10807778 3300026088 Bacteria 928
756 Ga0207641_12421496 3300026088 Unclassified 524
757 Ga0207648_10016724 3300026089 Bacteria 6693
758 Ga0207648_10037722 3300026089 Bacteria 4256
759 Ga0207648_10082760 3300026089 Bacteria 2799
760 Ga0207648_10103565 3300026089 Bacteria 2496
761 Ga0207648_10319166 3300026089 Bacteria 1396
762 Ga0207648_10370885 3300026089 Bacteria 1293
763 Ga0207648_10889708 3300026089 Bacteria 831
764 Ga0207648_11104954 3300026089 Bacteria 744
765 Ga0207648_11199692 3300026089 Bacteria 713
766 Ga0207648_11705187 3300026089 Unclassified 592
767 Ga0207648_11946234 3300026089 Bacteria 549
768 Ga0207676_10028142 3300026095 Bacteria 4195
769 Ga0207676_10069079 3300026095 Bacteria 2828
770 Ga0207676_10138631 3300026095 Bacteria 2079
771 Ga0207676_10164224 3300026095 Bacteria 1927
772 Ga0207676_10502054 3300026095 Bacteria 1152
773 Ga0207676_10629385 3300026095 Bacteria 1033
774 Ga0207676_10947882 3300026095 Bacteria 846
775 Ga0207676_11496682 3300026095 Bacteria 672
776 Ga0207674_10062761 3300026116 Bacteria 3752
777 Ga0207674_10203527 3300026116 Bacteria 1929
778 Ga0207675_100014045 3300026118 Bacteria 7468
779 Ga0207675_100038967 3300026118 Bacteria 4435
780 Ga0207675_100099958 3300026118 Bacteria 2732
781 Ga0207675_100360319 3300026118 Bacteria 1426
782 Ga0207675_100899736 3300026118 Bacteria 901
783 Ga0207675_101086473 3300026118 Bacteria 820
784 Ga0207675_101134005 3300026118 Bacteria 802
785 Ga0207675_101372554 3300026118 Bacteria 727
786 Ga0207675_101928867 3300026118 Bacteria 609
787 Ga0207675_102171026 3300026118 Bacteria 571
788 Ga0207675_102555791 3300026118 Bacteria 521
789 Ga0207683_10109399 3300026121 Bacteria 2473
790 Ga0207683_10628485 3300026121 Bacteria 994
791 Ga0207683_10784482 3300026121 Bacteria 884
792 Ga0207683_11332756 3300026121 Bacteria 664
793 Ga0207698_10854885 3300026142 Bacteria 915
794 Ga0207698_10947320 3300026142 Bacteria 870
795 Ga0207698_11175435 3300026142 Bacteria 781
796 Ga0210000_1043596 3300027462 Bacteria 714
797 Ga0207428_10041247 3300027907 Bacteria 3738
798 Ga0207428_10073024 3300027907 Bacteria 2692
799 Ga0207428_10107542 3300027907 Bacteria 2149
800 Ga0207428_10120374 3300027907 Bacteria 2013
801 Ga0268266_10005896 3300028379 Bacteria 11335
802 Ga0268266_10029767 3300028379 Bacteria 4639
803 Ga0268266_10572703 3300028379 Bacteria 1083
804 Ga0268265_10025303 3300028380 Bacteria 4210
805 Ga0268265_10060408 3300028380 Bacteria 2904
806 Ga0268265_10259045 3300028380 Bacteria 1545
807 Ga0268265_10598147 3300028380 Bacteria 1054
808 Ga0268265_11089529 3300028380 Bacteria 793
809 Ga0268265_11744953 3300028380 Bacteria 629
810 Ga0268264_10042810 3300028381 Bacteria 3749
811 Ga0268264_10124953 3300028381 Bacteria 2272
812 Ga0268264_10629629 3300028381 Bacteria 1060
813 Ga0268264_10753432 3300028381 Bacteria 970
814 Ga0268264_10903167 3300028381 Bacteria 887
815 Ga0268264_11418517 3300028381 Bacteria 705
816 Ga0268264_11776537 3300028381 Bacteria 627
817 Ga0268264_12342059 3300028381 Bacteria 541
818 Ga0268264_12359197 3300028381 Bacteria 538
819 Ga0265337_1012191 3300028556 Bacteria 2931
820 Ga0265326_10007699 3300028558 Bacteria 3288
821 Ga0265326_10040044 3300028558 Bacteria 1331
822 Ga0265323_10004178 3300028653 Bacteria 6252
823 Ga0265323_10007828 3300028653 Bacteria 4418
824 Ga0265323_10010760 3300028653 Bacteria 3703
825 Ga0265323_10023118 3300028653 Bacteria 2371
826 Ga0265323_10123910 3300028653 Bacteria 840
827 Ga0265322_10072512 3300028654 Bacteria 977
828 Ga0265338_10016967 3300028800 Bacteria 7878
829 Ga0265338_10028203 3300028800 Bacteria 5605
830 Ga0265338_10051083 3300028800 Bacteria 3728
831 Ga0265324_10007529 3300029957 Bacteria 4403
832 Ga0265330_10000541 3300031235 Bacteria 24732
833 Ga0265330_10001334 3300031235 Bacteria 14415
834 Ga0265330_10003060 3300031235 Bacteria 8862
835 Ga0265330_10015691 3300031235 Bacteria 3503
836 Ga0265330_10025564 3300031235 Bacteria 2675
837 Ga0265330_10032965 3300031235 Bacteria 2319
838 Ga0265330_10060804 3300031235 Bacteria 1644
839 Ga0265332_10040408 3300031238 Bacteria 2019
840 Ga0265332_10048353 3300031238 Bacteria 1830
841 Ga0265328_10172137 3300031239 Bacteria 818
842 Ga0265320_10231325 3300031240 Bacteria 822
843 Ga0265325_10005870 3300031241 Bacteria 7524
844 Ga0265325_10006951 3300031241 Bacteria 6822
845 Ga0265329_10000983 3300031242 Bacteria 14230
846 Ga0265329_10028351 3300031242 Bacteria 1836
847 Ga0265340_10017280 3300031247 Bacteria 3729
848 Ga0265340_10116407 3300031247 Bacteria 1232
849 Ga0265339_10000001 3300031249 Bacteria 613713
850 Ga0265331_10097514 3300031250 Bacteria 1355
851 Ga0265316_10000251 3300031344 Bacteria 61672
852 Ga0265316_10000984 3300031344 Bacteria 30933
853 Ga0265316_10014237 3300031344 Bacteria 7014
854 Ga0265316_10018769 3300031344 Bacteria 5936
855 Ga0265316_10028493 3300031344 Bacteria 4607
856 Ga0265316_10058510 3300031344 Bacteria 3002
857 Ga0265316_10261546 3300031344 Bacteria 1269
858 Ga0307513_10533383 3300031456 Bacteria 888
859 Ga0307408_100197181 3300031548 Bacteria 1627
860 Ga0265313_10009410 3300031595 Bacteria 6347
861 Ga0265314_10000109 3300031711 Bacteria 125470
862 Ga0265314_10007579 3300031711 Bacteria 9400
863 Ga0265342_10003389 3300031712 Bacteria 13133
864 Ga0265342_10006355 3300031712 Bacteria 8810
865 Ga0265342_10008085 3300031712 Bacteria 7603
866 Ga0265342_10008621 3300031712 Bacteria 7288
867 Ga0265342_10074527 3300031712 Bacteria 1971
868 Ga0265342_10247125 3300031712 Bacteria 953
869 Ga0316576_10431523 3300031727 Bacteria 974
870 Ga0316576_10493375 3300031727 Bacteria 901
871 Ga0307405_11144335 3300031731 Bacteria 671
872 Ga0307413_10805525 3300031824 Unclassified 790
873 Ga0307410_10927776 3300031852 Bacteria 747
874 Ga0307409_102196906 3300031995 Bacteria 581
875 Ga0307416_100160347 3300032002 Bacteria 2078
876 Ga0316592_1009839 3300033524 Bacteria 1919
877 Ga0316588_1012206 3300033528 Unclassified 1848
878 Ga0373930_0002995 3300034816 Bacteria 2656
879 Ga0373948_0001483 3300034817 Bacteria 3266
880 Ga0373950_0008982 3300034818 Bacteria 1585
881 Ga0373958_0000045 3300034819 Bacteria 12165
882 Ga0373958_0071175 3300034819 Bacteria 772
883 Ga0373959_0001151 3300034820 Bacteria 4278
884 Ga0373938_0000418 3300034957 Bacteria 6847
885 Ga0373938_0141126 3300034957 Bacteria 635
886 Ga0373926_0161839 3300035083 Bacteria 855
887 Ga0373928_0001212 3300035084 Bacteria 5090
888 Ga0373928_0041293 3300035084 Unclassified 1060
889 Ga0373929_0000116 3300035085 Bacteria 13311
890 Ga0373934_0002176 3300035086 Bacteria 7210
891 Ga0373934_0060164 3300035086 Bacteria 1513
892 Ga0373940_0000084 3300035088 Bacteria 11367
893 Ga0373940_0046104 3300035088 Bacteria 1212
894 Ga0373940_0152531 3300035088 Bacteria 737
895 Ga0373944_0043759 3300035089 Bacteria 1392
896 Ga0373949_0000597 3300035090 Bacteria 11806
897 Ga0373951_0001673 3300035091 Bacteria 5805
898 Ga0373951_0161691 3300035091 Bacteria 634
899 Ga0373952_0001387 3300035092 Bacteria 4428
900 Ga0373923_0151463 3300035111 Bacteria 1054
901 Ga0373923_0275358 3300035111 Bacteria 792
902 Ga0373923_0508091 3300035111 Bacteria 588
903 Ga0373932_0006095 3300035112 Bacteria 2845
904 Ga0373936_0426448 3300035113 Bacteria 611
905 Ga0373936_0511598 3300035113 Unclassified 559
906 Ga0373939_0001888 3300035114 Bacteria 5012
907 Ga0373939_0031755 3300035114 Bacteria 1529
908 Ga0373939_0090014 3300035114 Bacteria 1035
909 Ga0373941_0000161 3300035115 Bacteria 12224
910 Ga0373941_0340878 3300035115 Bacteria 607
911 Ga0373945_0035271 3300035116 Bacteria 1787
912 Ga0373945_0155487 3300035116 Bacteria 929
913 Ga0373953_0044678 3300035117 Bacteria 1772
914 Ga0373953_0103449 3300035117 Bacteria 1200
915 Ga0373953_0128422 3300035117 Unclassified 1080
916 Ga0373953_0140818 3300035117 Bacteria 1032
917 Ga0373953_0286057 3300035117 Bacteria 719
918 Ga0373954_0164931 3300035118 Bacteria 1084
919 Ga0373956_0254250 3300035119 Bacteria 835
920 Ga0373956_0320926 3300035119 Bacteria 738
921 Ga0373957_0027079 3300035120 Bacteria 2080
922 Ga0373960_0001448 3300035121 Bacteria 5252
923 Ga0373960_0057158 3300035121 Bacteria 1174
924 Ga0373943_0036985 3300035170 Bacteria 2341
925 Ga0373943_0426669 3300035170 Bacteria 768
926 Ga0373943_0450791 3300035170 Bacteria 747
927 Ga0373946_0202971 3300035171 Bacteria 950
928 Ga0373955_0006463 3300035172 Bacteria 5338
929 Ga0373955_0059904 3300035172 Bacteria 2098
930 Ga0373955_0117147 3300035172 Bacteria 1545
931 Ga0373955_0483193 3300035172 Bacteria 756
932 Ga0373942_0001757 3300035207 Bacteria 5486
933 Ga0373942_0087579 3300035207 Unclassified 934
934 Ga0373942_0216846 3300035207 Bacteria 640
935 Ga0373961_0001591 3300035241 Bacteria 6457
936 Ga0373962_0000245 3300035242 Bacteria 11519
937 Ga0373962_0034298 3300035242 Bacteria 1405
938 Ga0373962_0123488 3300035242 Bacteria 828
939 Ga0373931_0009494 3300035691 Bacteria 4653
940 Ga0373931_0169020 3300035691 Bacteria 1287
941 Ga0373931_0832583 3300035691 Bacteria 617
942 Ga0373931_1232580 3300035691 Bacteria 513
943 Ga0373935_0058708 3300035692 Bacteria 2458
944 Ga0373935_0087624 3300035692 Bacteria 2033
945 Ga0373935_0910469 3300035692 Unclassified 652
946 Ga0373935_1428516 3300035692 Bacteria 517
947 Ga0373927_0199653 3300035695 Bacteria 1313
948 Ga0373927_0214157 3300035695 Bacteria 1265
949 Ga0373927_0754014 3300035695 Bacteria 643
950 Ga0373933_0050350 3300035724 Bacteria 2486
951 Ga0373933_0632580 3300035724 Unclassified 703
952 Ga0373933_0762197 3300035724 Bacteria 637
953 Ga0373933_0777458 3300035724 Bacteria 630
954 Ga0373947_0018266 3300035725 Bacteria 4036
955 Ga0373947_0034097 3300035725 Bacteria 3010
956 Ga0373947_0123336 3300035725 Bacteria 1648
957 Ga0373937_0000078 3300036401 Bacteria 88688
958 Ga0373937_0055553 3300036401 Bacteria 3635
959 Ga0373937_0153828 3300036401 Bacteria 2155
960 Ga0373937_0356987 3300036401 Bacteria 1385
961 Ga0373937_0661902 3300036401 Bacteria 990
962 Ga0373937_0859138 3300036401 Bacteria 856
963 Ga0373937_1156319 3300036401 Bacteria 722
964 Ga0373937_1196130 3300036401 Bacteria 709
965 Ga0373925_0035123 3300037068 Bacteria 3698
966 Ga0373925_0160073 3300037068 Bacteria 1773
967 Ga0373925_0613814 3300037068 Bacteria 896
968 Ga0436365_0954923 3300039437 Bacteria 1356
969 Ga0451802_0953949 3300041460 Bacteria 610
970 Ga0451847_0676373 3300041503 Bacteria 1027
971 Ga0439441_021981 3300042001 Bacteria 1182
972 Ga0450891_037081 3300042129 Bacteria 517
973 Ga0439435_0078738 3300042436 Bacteria 986
974 Ga0450916_000502 3300042530 Bacteria 3425
975 Ga0450916_020578 3300042530 Bacteria 903
976 Ga0451577_0923480 3300042876 Bacteria 785
977 Ga0453683_0564416 3300044673 Bacteria 741
978 Ga0466966_0209879 3300044684 Bacteria 1177
979 Ga0466963_0288839 3300044694 Unclassified 1153
980 Ga0466963_0658783 3300044694 Bacteria 739
981 Ga0453684_0045078 3300044712 Bacteria 5887
982 Ga0453684_0082850 3300044712 Bacteria 3994
983 Ga0453684_0330628 3300044712 Bacteria 1723
984 Ga0466959_0639464 3300045049 Bacteria 714
985 Ga0451576_0071334 3300045051 Bacteria 3615
986 Ga0451576_0277902 3300045051 Bacteria 1751
987 Ga0451576_0401790 3300045051 Bacteria 1437
988 Ga0451576_1521021 3300045051 Bacteria 695
989 Ga0451576_2039290 3300045051 Bacteria 591
990 Ga0466967_0341168 3300045976 Bacteria 1449
991 Ga0466967_0717332 3300045976 Bacteria 991
992 Ga0466967_1005365 3300045976 Bacteria 830
993 Ga0495592_0168479 3300046454 Bacteria 1501
994 Ga0495592_0179321 3300046454 Bacteria 1444
995 Ga0495592_0725844 3300046454 Bacteria 596
996 Ga0495603_0531912 3300046455 Bacteria 673
997 Ga0495590_0380071 3300046457 Bacteria 540
998 Ga0495629_0168804 3300046459 Bacteria 1519
999 Ga0495629_0324963 3300046459 Bacteria 1051
1000 Ga0495629_0404725 3300046459 Bacteria 927
1001 Ga0495641_0068787 3300046461 Bacteria 1592
1002 Ga0495651_0267383 3300046462 Bacteria 1161
1003 Ga0495651_0366423 3300046462 Bacteria 948
1004 Ga0495653_0159656 3300046463 Bacteria 1566
1005 Ga0495580_0431859 3300046472 Bacteria 885
1006 Ga0495582_0746771 3300046473 Bacteria 566
1007 Ga0495662_0194313 3300046476 Bacteria 1000
1008 Ga0495664_0507972 3300046477 Bacteria 720
1009 Ga0495584_0652222 3300046491 Bacteria 537
1010 Ga0495585_0491825 3300046492 Bacteria 584
1011 Ga0495594_0413321 3300046499 Bacteria 767
1012 Ga0495608_0282693 3300046511 Bacteria 1030
1013 Ga0495610_0116527 3300046512 Bacteria 1177
1014 Ga0495618_0674693 3300046514 Bacteria 610
1015 Ga0495628_0162934 3300046516 Bacteria 1694
1016 Ga0495628_0210889 3300046516 Bacteria 1461
1017 Ga0495628_0733163 3300046516 Bacteria 696
1018 Ga0495628_1067069 3300046516 Bacteria 553
1019 Ga0495630_0809829 3300046517 Bacteria 715
1020 Ga0495666_0082957 3300046526 Bacteria 1516
1021 Ga0495642_0153914 3300046528 Bacteria 995
1022 Ga0495652_0368966 3300046529 Bacteria 1024
1023 Ga0495640_0030475 3300046533 Bacteria 3862
1024 Ga0495640_0815666 3300046533 Unclassified 556
1025 Ga0495586_0442156 3300046535 Bacteria 749
1026 Ga0495598_0172195 3300046537 Bacteria 768
1027 Ga0495598_0249336 3300046537 Bacteria 657
1028 Ga0495621_0182921 3300046539 Bacteria 837
1029 Ga0495633_0382471 3300046558 Bacteria 637
1030 Ga0495667_0185326 3300046559 Bacteria 1335
1031 Ga0495667_0289026 3300046559 Bacteria 1040
1032 Ga0495667_0389162 3300046559 Bacteria 879
1033 Ga0495656_0078931 3300046615 Bacteria 1481
1034 Ga0495656_0370951 3300046615 Bacteria 745
1035 Ga0495668_0487778 3300046616 Bacteria 679
1036 Ga0495634_0204819 3300046642 Bacteria 1224
1037 Ga0495634_0413357 3300046642 Bacteria 800
1038 Ga0495635_0064606 3300046663 Bacteria 2512
1039 Ga0495635_0138650 3300046663 Bacteria 1657
1040 Ga0495659_0077485 3300046664 Bacteria 1256
1041 Ga0495588_0364877 3300046674 Bacteria 759
1042 Ga0495599_0055493 3300046678 Bacteria 2481
1043 Ga0495599_0164235 3300046678 Bacteria 1372
1044 Ga0495623_0316917 3300046679 Bacteria 857
1045 Ga0495646_0573152 3300046680 Bacteria 575
1046 Ga0495647_0024667 3300046681 Bacteria 2191
1047 Ga0495647_0132001 3300046681 Bacteria 1059
1048 Ga0495647_0171326 3300046681 Bacteria 940
1049 Ga0495658_0063040 3300046683 Bacteria 2132
1050 Ga0495658_0311714 3300046683 Bacteria 996
1051 Ga0495669_0043985 3300046684 Bacteria 1989
1052 Ga0495669_0086899 3300046684 Bacteria 1440
1053 Ga0495669_0158329 3300046684 Bacteria 1074
1054 Ga0495669_0178050 3300046684 Bacteria 1013
1055 Ga0495613_0167259 3300046689 Bacteria 1562
1056 Ga0495613_0202812 3300046689 Bacteria 1398
1057 Ga0495624_0143899 3300046690 Bacteria 1460
1058 Ga0495670_0140849 3300046691 Bacteria 1261
1059 Ga0495670_0194629 3300046691 Bacteria 1073
1060 Ga0495649_0418206 3300046694 Bacteria 672
1061 Ga0495581_0255569 3300047315 Bacteria 1025
1062 Ga0495581_0610812 3300047315 Bacteria 631
1063 Ga0495604_0356972 3300047317 Bacteria 970
1064 Ga0495674_0130151 3300047319 Bacteria 2120
1065 Ga0495674_0325556 3300047319 Bacteria 1251
1066 Ga0495674_0743611 3300047319 Bacteria 767
1067 Ga0495674_0900527 3300047319 Bacteria 683
1068 Ga0495676_0688416 3300047321 Bacteria 662
1069 Ga0495680_0180664 3300047322 Bacteria 1523
1070 Ga0495677_0191648 3300047445 Bacteria 794
1071 Ga0495684_0476502 3300047471 Bacteria 862
1072 Ga0495684_0848008 3300047471 Bacteria 593
1073 Ga0495593_0274645 3300047673 Bacteria 843
1074 Ga0495602_0881955 3300048088 Bacteria 596
1075 Ga0495614_0170741 3300048089 Bacteria 976
1076 Ga0496100_0149902 3300048903 Bacteria 1662
1077 Ga0496100_0688142 3300048903 Bacteria 798
1078 Ga0496100_1205978 3300048903 Bacteria 597
1079 Ga0496100_1312480 3300048903 Unclassified 571
1080 Ga0496101_0460378 3300048904 Bacteria 1004
1081 Ga0496101_0478994 3300048904 Bacteria 983
1082 Ga0496102_0213093 3300048905 Bacteria 1821
1083 Ga0496102_0404817 3300048905 Bacteria 1283
1084 Ga0496103_0421973 3300048906 Bacteria 856
1085 Ga0496104_0017385 3300048907 Bacteria 6549
1086 Ga0496104_0083357 3300048907 Bacteria 3049
1087 Ga0496104_0368628 3300048907 Bacteria 1349
1088 Ga0496104_0572475 3300048907 Bacteria 1040
1089 Ga0496105_0090691 3300048908 Bacteria 2524
1090 Ga0496105_0201379 3300048908 Bacteria 1625
1091 Ga0496106_0175823 3300048909 Bacteria 1698
1092 Ga0496106_0311109 3300048909 Bacteria 1264
1093 Ga0496106_0545282 3300048909 Bacteria 931
1094 Ga0496106_0655395 3300048909 Bacteria 839
1095 Ga0496106_0783824 3300048909 Bacteria 757
1096 Ga0496106_0833561 3300048909 Bacteria 730
1097 Ga0496107_0104604 3300048910 Bacteria 2078
1098 Ga0496107_1055415 3300048910 Bacteria 588
1099 Ga0496108_0310386 3300048911 Bacteria 1374
1100 Ga0496108_0363468 3300048911 Bacteria 1263
1101 Ga0496108_1021063 3300048911 Bacteria 706
1102 Ga0496108_1165496 3300048911 Unclassified 653
1103 Ga0496108_1321968 3300048911 Bacteria 606
1104 Ga0496109_0151382 3300048912 Bacteria 2172
1105 Ga0496109_0191312 3300048912 Bacteria 1923
1106 Ga0496109_0224919 3300048912 Bacteria 1765
1107 Ga0496109_0417886 3300048912 Bacteria 1267
1108 Ga0496109_0494182 3300048912 Bacteria 1155
1109 Ga0496109_0503520 3300048912 Bacteria 1143
1110 Ga0496109_0825256 3300048912 Bacteria 865
1111 Ga0496109_1102746 3300048912 Bacteria 731
1112 Ga0496109_1687546 3300048912 Unclassified 567
1113 Ga0496110_0849885 3300048913 Bacteria 818
1114 Ga0496110_1253658 3300048913 Bacteria 650
1115 Ga0496112_0055326 3300048915 Bacteria 3901
1116 Ga0496112_0199485 3300048915 Bacteria 1961
1117 Ga0496112_0385536 3300048915 Bacteria 1342
1118 Ga0496112_1670065 3300048915 Bacteria 550
1119 Ga0496112_1761090 3300048915 Bacteria 532
1120 Ga0496113_1571094 3300048916 Bacteria 507
1121 Ga0496114_0013645 3300048917 Bacteria 6514
1122 Ga0496114_0063145 3300048917 Bacteria 3101
1123 Ga0496114_0095031 3300048917 Bacteria 2536
1124 Ga0496114_0259315 3300048917 Bacteria 1530
1125 Ga0496114_0333337 3300048917 Bacteria 1341
1126 Ga0496114_1494063 3300048917 Bacteria 563
1127 Ga0496114_1626459 3300048917 Bacteria 534
1128 Ga0496115_0383448 3300048918 Bacteria 1143
1129 Ga0496115_1058630 3300048918 Unclassified 617
1130 Ga0495682_0148887 3300049460 Bacteria 835
1131 Ga0501324_044926 3300049540 Bacteria 512
1132 Ga0501032_0086404 3300049569 Bacteria 2084
1133 Ga0501032_0171731 3300049569 Bacteria 1421
1134 Ga0501032_1017953 3300049569 Bacteria 520
1135 Ga0501033_0010156 3300049570 Bacteria 7228
1136 Ga0501033_1164972 3300049570 Bacteria 511
1137 Ga0501034_0035468 3300049571 Bacteria 5056
1138 Ga0501034_0098192 3300049571 Bacteria 2924
1139 Ga0501034_0108508 3300049571 Bacteria 2767
1140 Ga0501034_0228495 3300049571 Bacteria 1811
1141 Ga0501034_0313873 3300049571 Bacteria 1501
1142 Ga0501036_0100207 3300049572 Bacteria 2450
1143 Ga0501036_0185304 3300049572 Bacteria 1751
1144 Ga0501037_0053449 3300049573 Bacteria 2954
1145 Ga0501037_0950393 3300049573 Bacteria 561
1146 Ga0501038_0060881 3300049574 Bacteria 3229
1147 Ga0501038_0071796 3300049574 Bacteria 2935
1148 Ga0501038_0142171 3300049574 Bacteria 1962
1149 Ga0501038_0264930 3300049574 Bacteria 1357
1150 Ga0501039_0039586 3300049575 Bacteria 3640
1151 Ga0501039_0075924 3300049575 Bacteria 2612
1152 Ga0501039_0203788 3300049575 Bacteria 1555
1153 Ga0501040_0705437 3300049576 Bacteria 730
1154 Ga0501040_0936100 3300049576 Bacteria 628
1155 Ga0501040_1354970 3300049576 Bacteria 516
1156 Ga0501042_0411153 3300049578 Bacteria 980
1157 Ga0501043_0039924 3300049579 Bacteria 3689
1158 Ga0501043_0067123 3300049579 Bacteria 2817
1159 Ga0501043_0123914 3300049579 Bacteria 2026
1160 Ga0501043_0313649 3300049579 Bacteria 1196
1161 Ga0501046_0030233 3300049580 Bacteria 4397
1162 Ga0501046_0059141 3300049580 Bacteria 3003
1163 Ga0501046_0142415 3300049580 Bacteria 1813
1164 Ga0501046_0780566 3300049580 Bacteria 670
1165 Ga0501046_1169881 3300049580 Bacteria 529
1166 Ga0501047_0032236 3300049581 Bacteria 5057
1167 Ga0501047_0053218 3300049581 Bacteria 3913
1168 Ga0501047_0061080 3300049581 Bacteria 3636
1169 Ga0501047_0092564 3300049581 Bacteria 2901
1170 Ga0501047_0399559 3300049581 Bacteria 1207
1171 Ga0501048_0073638 3300049582 Bacteria 2410
1172 Ga0501048_0193859 3300049582 Bacteria 1440
1173 Ga0501048_0695946 3300049582 Bacteria 730
1174 Ga0501067_0034008 3300049583 Bacteria 2828
1175 Ga0501068_0019337 3300049584 Bacteria 3953
1176 Ga0501068_0030055 3300049584 Bacteria 3220
1177 Ga0501069_0453234 3300049585 Bacteria 762
1178 Ga0501069_0495123 3300049585 Bacteria 729
1179 Ga0501069_0567043 3300049585 Bacteria 680
1180 Ga0501070_0197523 3300049586 Bacteria 1652
1181 Ga0501070_0711708 3300049586 Bacteria 793
1182 Ga0501071_0308340 3300049587 Bacteria 1201
1183 Ga0501071_0746197 3300049587 Bacteria 754
1184 Ga0501072_0013067 3300049588 Bacteria 6354
1185 Ga0501073_0091075 3300049589 Bacteria 2119
1186 Ga0501073_0126622 3300049589 Bacteria 1770
1187 Ga0501073_0244426 3300049589 Bacteria 1239
1188 Ga0501073_0332258 3300049589 Bacteria 1049
1189 Ga0501073_0431618 3300049589 Bacteria 910
1190 Ga0501074_0033770 3300049590 Bacteria 3708
1191 Ga0501074_0862227 3300049590 Bacteria 638
1192 Ga0501074_0975059 3300049590 Bacteria 596
1193 Ga0501075_0029181 3300049591 Bacteria 4078
1194 Ga0501075_0117141 3300049591 Bacteria 2025
1195 Ga0501075_0182600 3300049591 Bacteria 1600
1196 Ga0501075_0434504 3300049591 Bacteria 1001
1197 Ga0501076_0029709 3300049592 Bacteria 4252
1198 Ga0501076_0118714 3300049592 Bacteria 2141
1199 Ga0501076_0373665 3300049592 Bacteria 1171
1200 Ga0501076_0751359 3300049592 Bacteria 805
1201 Ga0501076_0897976 3300049592 Bacteria 730
1202 Ga0501077_0277325 3300049593 Bacteria 1067
1203 Ga0501077_0365378 3300049593 Bacteria 921
1204 Ga0501079_0038135 3300049741 Bacteria 3706
1205 Ga0501079_0068731 3300049741 Bacteria 2734
1206 Ga0501079_0931005 3300049741 Bacteria 684
1207 Ga0501080_0014568 3300049742 Bacteria 7243
1208 Ga0501080_0086218 3300049742 Bacteria 2917
1209 Ga0501080_0088731 3300049742 Bacteria 2872
1210 Ga0501080_0696908 3300049742 Bacteria 896
1211 Ga0501080_0883977 3300049742 Bacteria 780
1212 Ga0501080_1476830 3300049742 Bacteria 578
1213 Ga0501080_1608365 3300049742 Bacteria 550
1214 Ga0501083_0018519 3300049744 Bacteria 4852
1215 Ga0501083_0032228 3300049744 Bacteria 3595
1216 Ga0501083_0062545 3300049744 Bacteria 2483
1217 Ga0501083_0164822 3300049744 Bacteria 1449
1218 Ga0501035_0477565 3300049822 Bacteria 1028
1219 Ga0501044_0003452 3300049823 Bacteria 17800
1220 Ga0501044_0075438 3300049823 Bacteria 3423
1221 Ga0501044_0445426 3300049823 Bacteria 1202
1222 Ga0501044_0992848 3300049823 Bacteria 711
1223 Ga0501045_0235791 3300049824 Bacteria 1362
1224 Ga0501045_0307840 3300049824 Bacteria 1179
1225 Ga0501045_1034553 3300049824 Bacteria 602
1226 nmdc:mga05p37_119480_c1 3300050507 Bacteria 3238
1227 nmdc:mga05p37_199866_c1 3300050507 Bacteria 2422
1228 nmdc:mga05p37_20342_c1 3300050507 Bacteria 8030
1229 nmdc:mga05p37_260703_c1 3300050507 Bacteria 2075
1230 nmdc:mga05p37_361676_c1 3300050507 Bacteria 1706
1231 nmdc:mga05p37_411029_c1 3300050507 Bacteria 1577
1232 nmdc:mga05p37_423802_c1 3300050507 Bacteria 1548
1233 nmdc:mga05p37_57020_c1 3300050507 Bacteria 4811
1234 nmdc:mga05p37_595_c1 3300050507 Bacteria 25325
1235 nmdc:mga05p37_6561_c1 3300050507 Bacteria 13712
1236 nmdc:mga05p37_84346_c1 3300050507 Bacteria 3914
1237 nmdc:mga09592_1347983_c1 3300050508 Bacteria 585
1238 nmdc:mga09592_51941_c3 3300050508 Bacteria 1155
1239 nmdc:mga09592_519740_c1 3300050508 Bacteria 1024
1240 nmdc:mga06r32_27167_c1 3300050510 Bacteria 1111
1241 nmdc:mga06r32_85956_c1 3300050510 Bacteria 3067
1242 nmdc:mga08y16_1370276_c1 3300050511 Bacteria 672
1243 nmdc:mga08y16_158503_c1 3300050511 Bacteria 2352
1244 nmdc:mga08y16_16207_c1 3300050511 Bacteria 7835
1245 nmdc:mga08y16_20665_c1 3300050511 Bacteria 6949
1246 nmdc:mga08y16_256926_c1 3300050511 Bacteria 1805
1247 nmdc:mga08y16_61471_c1 3300050511 Bacteria 3922
1248 nmdc:mga08y16_815198_c1 3300050511 Bacteria 925
1249 nmdc:mga08y16_869470_c1 3300050511 Unclassified 890
1250 nmdc:mga08y16_899340_c1 3300050511 Bacteria 871
1251 nmdc:mga0n895_1043386_c1 3300050512 Bacteria 797
1252 nmdc:mga0n895_12982_c1 3300050512 Bacteria 4790
1253 nmdc:mga0n895_1298775_c1 3300050512 Bacteria 699
1254 nmdc:mga0n895_139147_c1 3300050512 Bacteria 2455
1255 nmdc:mga0n895_17757_c1 3300050512 Bacteria 6566
1256 nmdc:mga0n895_192714_c1 3300050512 Bacteria 2069
1257 nmdc:mga0n895_198609_c1 3300050512 Bacteria 2037
1258 nmdc:mga0n895_24421_c1 3300050512 Bacteria 5697
1259 nmdc:mga0n895_27160_c1 3300050512 Bacteria 5435
1260 nmdc:mga0n895_7101_c1 3300050512 Bacteria 9574
1261 nmdc:mga0n895_739842_c1 3300050512 Bacteria 977
1262 nmdc:mga0n895_744129_c1 3300050512 Bacteria 974
1263 nmdc:mga0rr50_1164720_c1 3300050513 Bacteria 655
1264 nmdc:mga0rr50_1217370_c1 3300050513 Bacteria 640
1265 nmdc:mga0rr50_140171_c1 3300050513 Bacteria 1945
1266 nmdc:mga0rr50_1773_c1 3300050513 Bacteria 11923
1267 nmdc:mga0rr50_2205_c1 3300050513 Bacteria 10927
1268 nmdc:mga0rr50_234983_c1 3300050513 Bacteria 1518
1269 nmdc:mga0rr50_314394_c1 3300050513 Bacteria 1312
1270 nmdc:mga0rr50_373_c1 3300050513 Bacteria 24506
1271 nmdc:mga0rr50_40661_c1 3300050513 Bacteria 3382
1272 nmdc:mga0rr50_762456_c1 3300050513 Bacteria 826
1273 nmdc:mga0rr50_909536_c1 3300050513 Unclassified 750
1274 nmdc:mga08x19_10007_c1 3300050514 Bacteria 5684
1275 nmdc:mga08x19_112685_c1 3300050514 Bacteria 1816
1276 nmdc:mga08x19_153239_c1 3300050514 Bacteria 1562
1277 nmdc:mga08x19_158938_c1 3300050514 Bacteria 1534
1278 nmdc:mga08x19_189510_c1 3300050514 Bacteria 1407
1279 nmdc:mga08x19_30264_c1 3300050514 Bacteria 3400
1280 nmdc:mga08x19_438501_c1 3300050514 Bacteria 919
1281 nmdc:mga08x19_665902_c1 3300050514 Bacteria 738
1282 nmdc:mga08x19_785094_c1 3300050514 Bacteria 676
1283 nmdc:mga08x19_79203_c1 3300050514 Bacteria 2155
1284 nmdc:mga0a205_10346_c1 3300050515 Bacteria 8575
1285 nmdc:mga0a205_1279869_c1 3300050515 Bacteria 581
1286 nmdc:mga0a205_1360548_c1 3300050515 Bacteria 558
1287 nmdc:mga0a205_14317_c1 3300050515 Bacteria 7396
1288 nmdc:mga0a205_1522759_c1 3300050515 Bacteria 517
1289 nmdc:mga0a205_162299_c1 3300050515 Bacteria 2131
1290 nmdc:mga0a205_171832_c1 3300050515 Bacteria 2063
1291 nmdc:mga0a205_193005_c1 3300050515 Bacteria 1928
1292 nmdc:mga0a205_255698_c1 3300050515 Bacteria 1630
1293 nmdc:mga0a205_376723_c1 3300050515 Bacteria 1285
1294 nmdc:mga0a205_45628_c1 3300050515 Bacteria 4226
1295 nmdc:mga0a205_657122_c1 3300050515 Bacteria 899
1296 nmdc:mga0a205_6655_c1 3300050515 Bacteria 10458
1297 Ga0495601_0198282 3300053077 Bacteria 1312
1298 Ga0495601_0405323 3300053077 Bacteria 884
1299 Ga0495601_0688660 3300053077 Bacteria 653
1300 Ga0495612_0160616 3300053078 Bacteria 981
1301 Ga0495595_0099791 3300053084 Bacteria 1400
1302 Ga0495595_0246362 3300053084 Bacteria 894
1303 Ga0495595_0321667 3300053084 Bacteria 779
1304 Ga0495619_0136666 3300053085 Bacteria 1686
1305 Ga0495619_0163154 3300053085 Bacteria 1539
1306 Ga0495619_0406257 3300053085 Bacteria 940
1307 Ga0495619_0418607 3300053085 Bacteria 924
1308 Ga0495619_0482795 3300053085 Bacteria 853
1309 Ga0495619_0582024 3300053085 Bacteria 766
1310 Ga0500658_0026256 3300053134 Bacteria 2243
1311 Ga0500588_0284118 3300053146 Bacteria 625
1312 Ga0501084_0033473 3300054114 Bacteria 4299
1313 Ga0501084_0100345 3300054114 Bacteria 2431
1314 Ga0501084_0106680 3300054114 Bacteria 2353
1315 Ga0501084_0584933 3300054114 Bacteria 943
1316 Ga0587073_0017061 3300059492 Bacteria 1335
1317 Ga0501082_0042145 3300060353 Bacteria 3935
1318 Ga0501082_0055188 3300060353 Bacteria 3423
1319 Ga0501082_0143873 3300060353 Bacteria 2069
1320 Ga0501082_0196569 3300060353 Bacteria 1754
1321 Ga0501082_0764892 3300060353 Bacteria 845
1322 Ga0501082_1549494 3300060353 Bacteria 579
1323 Ga0466962_0381869 3300061719 Bacteria 704
1324 Ga0530510_0334248 3300061734 Bacteria 1137
1325 Ga0530510_0628785 3300061734 Bacteria 817
1326 Ga0530510_0671455 3300061734 Bacteria 789
1327 Ga0530510_0822230 3300061734 Bacteria 709

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044673 Ga0453683_0564416 Ga0453683_0564416_386_709 107
2 3300031235 Ga0265330_10001334 Ga0265330_1000133417 118
3 3300048911 Ga0496108_1021063 Ga0496108_1021063_222_578 118
4 3300048912 Ga0496109_1102746 Ga0496109_1102746_27_404 118
5 3300048918 Ga0496115_1058630 Ga0496115_1058630_118_474 118
6 iso_pu_bacteria 2687453257 2688065824 118
7 iso_pu_bacteria 2889415604 2889421828 118
8 3300028556 Ga0265337_1012191 Ga0265337_10121914 123
9 3300028558 Ga0265326_10007699 Ga0265326_100076995 123
10 3300028558 Ga0265326_10040044 Ga0265326_100400442 123
11 3300028653 Ga0265323_10004178 Ga0265323_1000417812 123
12 3300028653 Ga0265323_10007828 Ga0265323_100078287 123
13 3300028653 Ga0265323_10010760 Ga0265323_100107605 123
14 3300028653 Ga0265323_10023118 Ga0265323_100231185 123
15 3300028653 Ga0265323_10123910 Ga0265323_101239102 123
16 3300028654 Ga0265322_10072512 Ga0265322_100725122 123
17 3300028800 Ga0265338_10016967 Ga0265338_1001696718 123
18 3300028800 Ga0265338_10028203 Ga0265338_100282031 123
19 3300028800 Ga0265338_10051083 Ga0265338_1005108310 123
20 3300029957 Ga0265324_10007529 Ga0265324_1000752911 123
21 3300031235 Ga0265330_10000541 Ga0265330_1000054117 123
22 3300031235 Ga0265330_10003060 Ga0265330_100030608 123
23 3300031235 Ga0265330_10015691 Ga0265330_100156914 123
24 3300031235 Ga0265330_10025564 Ga0265330_100255642 123
25 3300031235 Ga0265330_10032965 Ga0265330_100329655 123
26 3300031235 Ga0265330_10060804 Ga0265330_100608042 123
27 3300031238 Ga0265332_10040408 Ga0265332_100404082 123
28 3300031239 Ga0265328_10172137 Ga0265328_101721372 123
29 3300031240 Ga0265320_10231325 Ga0265320_102313252 123
30 3300031241 Ga0265325_10005870 Ga0265325_1000587010 123
31 3300031241 Ga0265325_10006951 Ga0265325_100069514 123
32 3300031242 Ga0265329_10000983 Ga0265329_100009833 123
33 3300031242 Ga0265329_10028351 Ga0265329_100283512 123
34 3300031247 Ga0265340_10017280 Ga0265340_100172805 123
35 3300031247 Ga0265340_10116407 Ga0265340_101164072 123
36 3300031249 Ga0265339_10000001 Ga0265339_10000001256 123
37 3300031250 Ga0265331_10097514 Ga0265331_100975142 123
38 3300031344 Ga0265316_10000251 Ga0265316_1000025118 123
39 3300031344 Ga0265316_10000984 Ga0265316_1000098424 123
40 3300031344 Ga0265316_10014237 Ga0265316_100142376 123
41 3300031344 Ga0265316_10018769 Ga0265316_100187695 123
42 3300031344 Ga0265316_10028493 Ga0265316_1002849311 123
43 3300031344 Ga0265316_10058510 Ga0265316_100585105 123
44 3300031595 Ga0265313_10009410 Ga0265313_100094104 123
45 3300031711 Ga0265314_10000109 Ga0265314_1000010918 123
46 3300031712 Ga0265342_10003389 Ga0265342_100033892 123
47 3300031712 Ga0265342_10006355 Ga0265342_1000635516 123
48 3300031712 Ga0265342_10008085 Ga0265342_1000808517 123
49 3300031712 Ga0265342_10008621 Ga0265342_1000862111 123
50 3300031712 Ga0265342_10074527 Ga0265342_100745274 123
51 3300031712 Ga0265342_10247125 Ga0265342_102471252 123
52 3300031727 Ga0316576_10431523 Ga0316576_104315232 123
53 3300031727 Ga0316576_10493375 Ga0316576_104933752 123
54 3300042876 Ga0451577_0923480 Ga0451577_0923480_202_573 123
55 3300044712 Ga0453684_0045078 Ga0453684_0045078_479_850 123
56 3300044712 Ga0453684_0082850 Ga0453684_0082850_965_1336 123
57 3300044712 Ga0453684_0330628 Ga0453684_0330628_596_967 123
58 3300002076 JGI24749J21850_1069413 JGI24749J21850_10694131 124
59 3300004798 Ga0058859_11726179 Ga0058859_117261792 124
60 3300004799 Ga0058863_11600431 Ga0058863_116004311 124
61 3300004800 Ga0058861_11821092 Ga0058861_118210922 124
62 3300004800 Ga0058861_12003411 Ga0058861_120034114 124
63 3300004803 Ga0058862_12498887 Ga0058862_124988871 124
64 3300005290 Ga0065712_10798698 Ga0065712_107986981 124
65 3300005293 Ga0065715_10238277 Ga0065715_102382771 124
66 3300005293 Ga0065715_11048349 Ga0065715_110483491 124
67 3300005328 Ga0070676_10007044 Ga0070676_100070446 124
68 3300005328 Ga0070676_10159227 Ga0070676_101592272 124
69 3300005328 Ga0070676_10403582 Ga0070676_104035822 124
70 3300005328 Ga0070676_10826011 Ga0070676_108260112 124
71 3300005328 Ga0070676_11123316 Ga0070676_111233161 124
72 3300005329 Ga0070683_101683056 Ga0070683_1016830561 124
73 3300005330 Ga0070690_100446006 Ga0070690_1004460062 124
74 3300005330 Ga0070690_101236527 Ga0070690_1012365272 124
75 3300005330 Ga0070690_101753298 Ga0070690_1017532981 124
76 3300005331 Ga0070670_100050949 Ga0070670_1000509493 124
77 3300005331 Ga0070670_100241783 Ga0070670_1002417833 124
78 3300005331 Ga0070670_100280626 Ga0070670_1002806262 124
79 3300005331 Ga0070670_100885322 Ga0070670_1008853222 124
80 3300005333 Ga0070677_10110670 Ga0070677_101106701 124
81 3300005333 Ga0070677_10157443 Ga0070677_101574432 124
82 3300005333 Ga0070677_10713595 Ga0070677_107135951 124
83 3300005334 Ga0068869_102011201 Ga0068869_1020112011 124
84 3300005334 Ga0068869_102079101 Ga0068869_1020791011 124
85 3300005335 Ga0070666_10043493 Ga0070666_100434932 124
86 3300005335 Ga0070666_10051882 Ga0070666_100518825 124
87 3300005335 Ga0070666_10123865 Ga0070666_101238653 124
88 3300005335 Ga0070666_10451251 Ga0070666_104512512 124
89 3300005335 Ga0070666_10820148 Ga0070666_108201481 124
90 3300005335 Ga0070666_11214269 Ga0070666_112142691 124
91 3300005335 Ga0070666_11429913 Ga0070666_114299131 124
92 3300005336 Ga0070680_100400005 Ga0070680_1004000052 124
93 3300005336 Ga0070680_100820182 Ga0070680_1008201822 124
94 3300005337 Ga0070682_100444190 Ga0070682_1004441902 124
95 3300005338 Ga0068868_100055137 Ga0068868_1000551375 124
96 3300005338 Ga0068868_100170521 Ga0068868_1001705214 124
97 3300005338 Ga0068868_100675396 Ga0068868_1006753962 124
98 3300005338 Ga0068868_101592413 Ga0068868_1015924131 124
99 3300005339 Ga0070660_100002987 Ga0070660_10000298711 124
100 3300005339 Ga0070660_100633893 Ga0070660_1006338932 124
101 3300005339 Ga0070660_100722787 Ga0070660_1007227872 124
102 3300005339 Ga0070660_101198476 Ga0070660_1011984761 124
103 3300005340 Ga0070689_100084047 Ga0070689_1000840472 124
104 3300005340 Ga0070689_100630930 Ga0070689_1006309302 124
105 3300005340 Ga0070689_100640555 Ga0070689_1006405552 124
106 3300005341 Ga0070691_10004188 Ga0070691_100041885 124
107 3300005343 Ga0070687_100080522 Ga0070687_1000805224 124
108 3300005343 Ga0070687_100823372 Ga0070687_1008233721 124
109 3300005343 Ga0070687_101151696 Ga0070687_1011516962 124
110 3300005344 Ga0070661_100600365 Ga0070661_1006003651 124
111 3300005344 Ga0070661_101709519 Ga0070661_1017095191 124
112 3300005345 Ga0070692_10276697 Ga0070692_102766972 124
113 3300005345 Ga0070692_10299123 Ga0070692_102991231 124
114 3300005345 Ga0070692_10524091 Ga0070692_105240912 124
115 3300005345 Ga0070692_10731351 Ga0070692_107313512 124
116 3300005347 Ga0070668_100026838 Ga0070668_1000268381 124
117 3300005347 Ga0070668_101038652 Ga0070668_1010386521 124
118 3300005353 Ga0070669_100110504 Ga0070669_1001105041 124
119 3300005353 Ga0070669_100320432 Ga0070669_1003204322 124
120 3300005353 Ga0070669_100371678 Ga0070669_1003716781 124
121 3300005353 Ga0070669_100842875 Ga0070669_1008428751 124
122 3300005353 Ga0070669_101966948 Ga0070669_1019669481 124
123 3300005354 Ga0070675_100029203 Ga0070675_1000292037 124
124 3300005354 Ga0070675_100546245 Ga0070675_1005462451 124
125 3300005354 Ga0070675_100597463 Ga0070675_1005974632 124
126 3300005354 Ga0070675_101051383 Ga0070675_1010513832 124
127 3300005355 Ga0070671_100039487 Ga0070671_1000394873 124
128 3300005355 Ga0070671_100820219 Ga0070671_1008202192 124
129 3300005355 Ga0070671_101556620 Ga0070671_1015566201 124
130 3300005355 Ga0070671_101565528 Ga0070671_1015655281 124
131 3300005356 Ga0070674_100015034 Ga0070674_10001503411 124
132 3300005356 Ga0070674_100046049 Ga0070674_1000460495 124
133 3300005356 Ga0070674_100078891 Ga0070674_1000788911 124
134 3300005356 Ga0070674_100278160 Ga0070674_1002781603 124
135 3300005356 Ga0070674_100318163 Ga0070674_1003181633 124
136 3300005356 Ga0070674_101610961 Ga0070674_1016109612 124
137 3300005364 Ga0070673_100003427 Ga0070673_1000034279 124
138 3300005364 Ga0070673_100043981 Ga0070673_1000439815 124
139 3300005364 Ga0070673_100087145 Ga0070673_1000871456 124
140 3300005364 Ga0070673_100249495 Ga0070673_1002494951 124
141 3300005364 Ga0070673_100455448 Ga0070673_1004554482 124
142 3300005364 Ga0070673_100640069 Ga0070673_1006400692 124
143 3300005364 Ga0070673_100869254 Ga0070673_1008692542 124
144 3300005364 Ga0070673_100989687 Ga0070673_1009896872 124
145 3300005364 Ga0070673_101510596 Ga0070673_1015105961 124
146 3300005364 Ga0070673_101510610 Ga0070673_1015106101 124
147 3300005365 Ga0070688_100101898 Ga0070688_1001018984 124
148 3300005365 Ga0070688_100135330 Ga0070688_1001353304 124
149 3300005365 Ga0070688_100192909 Ga0070688_1001929093 124
150 3300005365 Ga0070688_100231336 Ga0070688_1002313362 124
151 3300005365 Ga0070688_100830642 Ga0070688_1008306422 124
152 3300005365 Ga0070688_101335438 Ga0070688_1013354382 124
153 3300005366 Ga0070659_100440655 Ga0070659_1004406552 124
154 3300005366 Ga0070659_101578708 Ga0070659_1015787082 124
155 3300005367 Ga0070667_100021149 Ga0070667_1000211495 124
156 3300005367 Ga0070667_100168474 Ga0070667_1001684745 124
157 3300005367 Ga0070667_100937400 Ga0070667_1009374001 124
158 3300005367 Ga0070667_101063147 Ga0070667_1010631471 124
159 3300005367 Ga0070667_101325267 Ga0070667_1013252671 124
160 3300005406 Ga0070703_10153609 Ga0070703_101536092 124
161 3300005406 Ga0070703_10362369 Ga0070703_103623691 124
162 3300005435 Ga0070714_100050502 Ga0070714_1000505025 124
163 3300005436 Ga0070713_100043372 Ga0070713_1000433727 124
164 3300005438 Ga0070701_10010126 Ga0070701_100101266 124
165 3300005438 Ga0070701_10716296 Ga0070701_107162961 124
166 3300005439 Ga0070711_101100308 Ga0070711_1011003082 124
167 3300005439 Ga0070711_101399677 Ga0070711_1013996772 124
168 3300005439 Ga0070711_101560940 Ga0070711_1015609401 124
169 3300005440 Ga0070705_100016300 Ga0070705_10001630010 124
170 3300005440 Ga0070705_100285699 Ga0070705_1002856992 124
171 3300005440 Ga0070705_101148994 Ga0070705_1011489942 124
172 3300005441 Ga0070700_100080371 Ga0070700_1000803715 124
173 3300005441 Ga0070700_100432017 Ga0070700_1004320171 124
174 3300005444 Ga0070694_100234674 Ga0070694_1002346742 124
175 3300005444 Ga0070694_101713959 Ga0070694_1017139591 124
176 3300005444 Ga0070694_101733895 Ga0070694_1017338951 124
177 3300005445 Ga0070708_100055234 Ga0070708_1000552344 124
178 3300005445 Ga0070708_100215472 Ga0070708_1002154722 124
179 3300005445 Ga0070708_100526944 Ga0070708_1005269442 124
180 3300005445 Ga0070708_100687049 Ga0070708_1006870492 124
181 3300005445 Ga0070708_101013417 Ga0070708_1010134172 124
182 3300005445 Ga0070708_101538191 Ga0070708_1015381912 124
183 3300005455 Ga0070663_102144914 Ga0070663_1021449141 124
184 3300005456 Ga0070678_100092251 Ga0070678_1000922514 124
185 3300005456 Ga0070678_100476417 Ga0070678_1004764172 124
186 3300005456 Ga0070678_100754103 Ga0070678_1007541032 124
187 3300005456 Ga0070678_100859872 Ga0070678_1008598722 124
188 3300005456 Ga0070678_101782795 Ga0070678_1017827951 124
189 3300005457 Ga0070662_100710711 Ga0070662_1007107112 124
190 3300005457 Ga0070662_101454571 Ga0070662_1014545711 124
191 3300005458 Ga0070681_10348644 Ga0070681_103486441 124
192 3300005458 Ga0070681_10770782 Ga0070681_107707822 124
193 3300005459 Ga0068867_100035655 Ga0068867_1000356557 124
194 3300005459 Ga0068867_100041777 Ga0068867_1000417772 124
195 3300005459 Ga0068867_100073877 Ga0068867_1000738775 124
196 3300005459 Ga0068867_100284679 Ga0068867_1002846793 124
197 3300005459 Ga0068867_100764044 Ga0068867_1007640442 124
198 3300005459 Ga0068867_101530940 Ga0068867_1015309401 124
199 3300005459 Ga0068867_101605853 Ga0068867_1016058532 124
200 3300005459 Ga0068867_102119332 Ga0068867_1021193321 124
201 3300005466 Ga0070685_10229742 Ga0070685_102297422 124
202 3300005466 Ga0070685_10291890 Ga0070685_102918902 124
203 3300005466 Ga0070685_10721267 Ga0070685_107212672 124
204 3300005466 Ga0070685_10933129 Ga0070685_109331291 124
205 3300005467 Ga0070706_101086183 Ga0070706_1010861832 124
206 3300005467 Ga0070706_101878413 Ga0070706_1018784131 124
207 3300005468 Ga0070707_100125461 Ga0070707_1001254615 124
208 3300005468 Ga0070707_100175008 Ga0070707_1001750085 124
209 3300005468 Ga0070707_100175475 Ga0070707_1001754752 124
210 3300005471 Ga0070698_100034124 Ga0070698_1000341242 124
211 3300005471 Ga0070698_100183947 Ga0070698_1001839473 124
212 3300005471 Ga0070698_100419294 Ga0070698_1004192942 124
213 3300005471 Ga0070698_100624215 Ga0070698_1006242152 124
214 3300005471 Ga0070698_101219582 Ga0070698_1012195821 124
215 3300005471 Ga0070698_101567014 Ga0070698_1015670142 124
216 3300005471 Ga0070698_101885703 Ga0070698_1018857031 124
217 3300005518 Ga0070699_100006991 Ga0070699_10000699111 124
218 3300005518 Ga0070699_100119032 Ga0070699_1001190324 124
219 3300005518 Ga0070699_100183830 Ga0070699_1001838302 124
220 3300005518 Ga0070699_100336608 Ga0070699_1003366081 124
221 3300005518 Ga0070699_100629525 Ga0070699_1006295252 124
222 3300005530 Ga0070679_100039507 Ga0070679_1000395072 124
223 3300005530 Ga0070679_101801104 Ga0070679_1018011041 124
224 3300005535 Ga0070684_100358117 Ga0070684_1003581172 124
225 3300005535 Ga0070684_101671756 Ga0070684_1016717561 124
226 3300005536 Ga0070697_100052802 Ga0070697_1000528022 124
227 3300005536 Ga0070697_100193729 Ga0070697_1001937292 124
228 3300005536 Ga0070697_100923913 Ga0070697_1009239132 124
229 3300005536 Ga0070697_101480664 Ga0070697_1014806642 124
230 3300005536 Ga0070697_101681747 Ga0070697_1016817471 124
231 3300005536 Ga0070697_101720592 Ga0070697_1017205921 124
232 3300005539 Ga0068853_101627908 Ga0068853_1016279081 124
233 3300005543 Ga0070672_100087900 Ga0070672_1000879006 124
234 3300005543 Ga0070672_100191135 Ga0070672_1001911352 124
235 3300005543 Ga0070672_100669285 Ga0070672_1006692852 124
236 3300005543 Ga0070672_100745188 Ga0070672_1007451882 124
237 3300005543 Ga0070672_101360894 Ga0070672_1013608941 124
238 3300005544 Ga0070686_100002243 Ga0070686_1000022437 124
239 3300005544 Ga0070686_100024325 Ga0070686_1000243254 124
240 3300005544 Ga0070686_100324083 Ga0070686_1003240832 124
241 3300005544 Ga0070686_100499656 Ga0070686_1004996561 124
242 3300005544 Ga0070686_100566683 Ga0070686_1005666832 124
243 3300005544 Ga0070686_100715680 Ga0070686_1007156802 124
244 3300005544 Ga0070686_100846121 Ga0070686_1008461212 124
245 3300005544 Ga0070686_101561103 Ga0070686_1015611031 124
246 3300005545 Ga0070695_100036049 Ga0070695_1000360497 124
247 3300005545 Ga0070695_100063603 Ga0070695_1000636032 124
248 3300005545 Ga0070695_101014162 Ga0070695_1010141622 124
249 3300005545 Ga0070695_101247862 Ga0070695_1012478622 124
250 3300005546 Ga0070696_100012605 Ga0070696_1000126055 124
251 3300005546 Ga0070696_100145121 Ga0070696_1001451214 124
252 3300005546 Ga0070696_100707806 Ga0070696_1007078061 124
253 3300005546 Ga0070696_100938895 Ga0070696_1009388952 124
254 3300005547 Ga0070693_100775204 Ga0070693_1007752041 124
255 3300005548 Ga0070665_100004733 Ga0070665_10000473312 124
256 3300005548 Ga0070665_100005447 Ga0070665_1000054472 124
257 3300005548 Ga0070665_100010437 Ga0070665_1000104374 124
258 3300005548 Ga0070665_100157655 Ga0070665_1001576555 124
259 3300005549 Ga0070704_100074149 Ga0070704_1000741492 124
260 3300005549 Ga0070704_100096664 Ga0070704_1000966644 124
261 3300005549 Ga0070704_100355660 Ga0070704_1003556602 124
262 3300005549 Ga0070704_100427538 Ga0070704_1004275382 124
263 3300005549 Ga0070704_100521050 Ga0070704_1005210501 124
264 3300005549 Ga0070704_101762984 Ga0070704_1017629841 124
265 3300005549 Ga0070704_101999660 Ga0070704_1019996601 124
266 3300005563 Ga0068855_100286434 Ga0068855_1002864341 124
267 3300005563 Ga0068855_101552138 Ga0068855_1015521381 124
268 3300005564 Ga0070664_100786017 Ga0070664_1007860171 124
269 3300005564 Ga0070664_100943983 Ga0070664_1009439832 124
270 3300005577 Ga0068857_100422841 Ga0068857_1004228412 124
271 3300005577 Ga0068857_100651834 Ga0068857_1006518342 124
272 3300005577 Ga0068857_101577410 Ga0068857_1015774101 124
273 3300005578 Ga0068854_100177554 Ga0068854_1001775542 124
274 3300005578 Ga0068854_100226776 Ga0068854_1002267762 124
275 3300005578 Ga0068854_100367708 Ga0068854_1003677082 124
276 3300005578 Ga0068854_100710055 Ga0068854_1007100551 124
277 3300005578 Ga0068854_100794160 Ga0068854_1007941602 124
278 3300005578 Ga0068854_101174523 Ga0068854_1011745231 124
279 3300005578 Ga0068854_101451584 Ga0068854_1014515842 124
280 3300005614 Ga0068856_100018557 Ga0068856_1000185578 124
281 3300005614 Ga0068856_101363773 Ga0068856_1013637731 124
282 3300005615 Ga0070702_100002883 Ga0070702_1000028834 124
283 3300005615 Ga0070702_100096432 Ga0070702_1000964321 124
284 3300005615 Ga0070702_100711926 Ga0070702_1007119262 124
285 3300005615 Ga0070702_101158181 Ga0070702_1011581811 124
286 3300005615 Ga0070702_101340709 Ga0070702_1013407092 124
287 3300005617 Ga0068859_100020008 Ga0068859_10002000814 124
288 3300005617 Ga0068859_100168307 Ga0068859_1001683072 124
289 3300005617 Ga0068859_100204696 Ga0068859_1002046962 124
290 3300005617 Ga0068859_100207182 Ga0068859_1002071822 124
291 3300005617 Ga0068859_101061226 Ga0068859_1010612262 124
292 3300005617 Ga0068859_101181081 Ga0068859_1011810812 124
293 3300005617 Ga0068859_101227473 Ga0068859_1012274732 124
294 3300005617 Ga0068859_101638902 Ga0068859_1016389022 124
295 3300005617 Ga0068859_102312331 Ga0068859_1023123312 124
296 3300005617 Ga0068859_102342522 Ga0068859_1023425222 124
297 3300005617 Ga0068859_102459209 Ga0068859_1024592091 124
298 3300005617 Ga0068859_103010841 Ga0068859_1030108411 124
299 3300005618 Ga0068864_100022274 Ga0068864_10002227411 124
300 3300005618 Ga0068864_100054633 Ga0068864_1000546338 124
301 3300005618 Ga0068864_100075695 Ga0068864_1000756956 124
302 3300005618 Ga0068864_100174352 Ga0068864_1001743522 124
303 3300005618 Ga0068864_100445229 Ga0068864_1004452291 124
304 3300005618 Ga0068864_100880036 Ga0068864_1008800362 124
305 3300005718 Ga0068866_10135275 Ga0068866_101352753 124
306 3300005718 Ga0068866_10488287 Ga0068866_104882872 124
307 3300005719 Ga0068861_100024888 Ga0068861_1000248887 124
308 3300005719 Ga0068861_100182622 Ga0068861_1001826222 124
309 3300005719 Ga0068861_100426718 Ga0068861_1004267182 124
310 3300005719 Ga0068861_100882762 Ga0068861_1008827622 124
311 3300005719 Ga0068861_101910583 Ga0068861_1019105831 124
312 3300005719 Ga0068861_102018129 Ga0068861_1020181291 124
313 3300005834 Ga0068851_10330413 Ga0068851_103304132 124
314 3300005840 Ga0068870_10292977 Ga0068870_102929772 124
315 3300005841 Ga0068863_100116801 Ga0068863_1001168014 124
316 3300005841 Ga0068863_100239167 Ga0068863_1002391673 124
317 3300005841 Ga0068863_101184807 Ga0068863_1011848071 124
318 3300005841 Ga0068863_101205666 Ga0068863_1012056662 124
319 3300005841 Ga0068863_101377225 Ga0068863_1013772252 124
320 3300005841 Ga0068863_102375069 Ga0068863_1023750691 124
321 3300005842 Ga0068858_100001254 Ga0068858_10000125426 124
322 3300005842 Ga0068858_100008638 Ga0068858_10000863813 124
323 3300005842 Ga0068858_100189424 Ga0068858_1001894242 124
324 3300005842 Ga0068858_100454458 Ga0068858_1004544582 124
325 3300005842 Ga0068858_100524546 Ga0068858_1005245463 124
326 3300005842 Ga0068858_100550706 Ga0068858_1005507062 124
327 3300005842 Ga0068858_100607081 Ga0068858_1006070812 124
328 3300005842 Ga0068858_100637732 Ga0068858_1006377322 124
329 3300005842 Ga0068858_100907620 Ga0068858_1009076202 124
330 3300005842 Ga0068858_100911270 Ga0068858_1009112701 124
331 3300005842 Ga0068858_101855983 Ga0068858_1018559832 124
332 3300005843 Ga0068860_100129065 Ga0068860_1001290654 124
333 3300005843 Ga0068860_100269111 Ga0068860_1002691114 124
334 3300005843 Ga0068860_100344425 Ga0068860_1003444251 124
335 3300005843 Ga0068860_100534033 Ga0068860_1005340332 124
336 3300005843 Ga0068860_100563925 Ga0068860_1005639252 124
337 3300005843 Ga0068860_100875480 Ga0068860_1008754802 124
338 3300005843 Ga0068860_100939707 Ga0068860_1009397071 124
339 3300005843 Ga0068860_101020331 Ga0068860_1010203312 124
340 3300005843 Ga0068860_101064746 Ga0068860_1010647462 124
341 3300005843 Ga0068860_101786406 Ga0068860_1017864062 124
342 3300005843 Ga0068860_101797395 Ga0068860_1017973952 124
343 3300005843 Ga0068860_102136986 Ga0068860_1021369862 124
344 3300005843 Ga0068860_102258412 Ga0068860_1022584122 124
345 3300005844 Ga0068862_100033577 Ga0068862_1000335775 124
346 3300005844 Ga0068862_100109135 Ga0068862_1001091354 124
347 3300005844 Ga0068862_100110658 Ga0068862_1001106582 124
348 3300005844 Ga0068862_101185800 Ga0068862_1011858001 124
349 3300005844 Ga0068862_101747854 Ga0068862_1017478542 124
350 3300005844 Ga0068862_101788945 Ga0068862_1017889452 124
351 3300005844 Ga0068862_102603068 Ga0068862_1026030681 124
352 3300005844 Ga0068862_102700756 Ga0068862_1027007561 124
353 3300005937 Ga0081455_10015745 Ga0081455_100157456 124
354 3300006163 Ga0070715_10822029 Ga0070715_108220291 124
355 3300006173 Ga0070716_101496230 Ga0070716_1014962302 124
356 3300006175 Ga0070712_101324108 Ga0070712_1013241081 124
357 3300006175 Ga0070712_102018472 Ga0070712_1020184721 124
358 3300006237 Ga0097621_100006061 Ga0097621_10000606115 124
359 3300006237 Ga0097621_100147924 Ga0097621_1001479241 124
360 3300006237 Ga0097621_100238936 Ga0097621_1002389362 124
361 3300006237 Ga0097621_100613316 Ga0097621_1006133162 124
362 3300006237 Ga0097621_100701910 Ga0097621_1007019102 124
363 3300006237 Ga0097621_101850913 Ga0097621_1018509132 124
364 3300006358 Ga0068871_100006055 Ga0068871_10000605510 124
365 3300006358 Ga0068871_100040321 Ga0068871_1000403217 124
366 3300006358 Ga0068871_100075510 Ga0068871_1000755105 124
367 3300006358 Ga0068871_100110412 Ga0068871_1001104122 124
368 3300006358 Ga0068871_100252750 Ga0068871_1002527503 124
369 3300006358 Ga0068871_100379477 Ga0068871_1003794772 124
370 3300006358 Ga0068871_100483006 Ga0068871_1004830062 124
371 3300006358 Ga0068871_100788038 Ga0068871_1007880382 124
372 3300006358 Ga0068871_101167014 Ga0068871_1011670142 124
373 3300006844 Ga0075428_100319068 Ga0075428_1003190684 124
374 3300006844 Ga0075428_100557089 Ga0075428_1005570893 124
375 3300006844 Ga0075428_101239362 Ga0075428_1012393622 124
376 3300006844 Ga0075428_101335471 Ga0075428_1013354712 124
377 3300006844 Ga0075428_102391723 Ga0075428_1023917232 124
378 3300006844 Ga0075428_102693128 Ga0075428_1026931281 124
379 3300006847 Ga0075431_100155827 Ga0075431_1001558275 124
380 3300006847 Ga0075431_100693248 Ga0075431_1006932482 124
381 3300006852 Ga0075433_10027003 Ga0075433_100270032 124
382 3300006852 Ga0075433_10100150 Ga0075433_101001505 124
383 3300006852 Ga0075433_10266146 Ga0075433_102661463 124
384 3300006852 Ga0075433_10422349 Ga0075433_104223493 124
385 3300006852 Ga0075433_10530184 Ga0075433_105301841 124
386 3300006852 Ga0075433_10707097 Ga0075433_107070972 124
387 3300006852 Ga0075433_10920255 Ga0075433_109202552 124
388 3300006852 Ga0075433_11004137 Ga0075433_110041372 124
389 3300006852 Ga0075433_11051171 Ga0075433_110511712 124
390 3300006852 Ga0075433_11484792 Ga0075433_114847922 124
391 3300006871 Ga0075434_100069571 Ga0075434_1000695711 124
392 3300006871 Ga0075434_100080091 Ga0075434_1000800914 124
393 3300006871 Ga0075434_100109389 Ga0075434_1001093894 124
394 3300006871 Ga0075434_100110530 Ga0075434_1001105303 124
395 3300006871 Ga0075434_100135753 Ga0075434_1001357533 124
396 3300006871 Ga0075434_100149750 Ga0075434_1001497502 124
397 3300006871 Ga0075434_100986207 Ga0075434_1009862071 124
398 3300006871 Ga0075434_101206247 Ga0075434_1012062472 124
399 3300006871 Ga0075434_101242135 Ga0075434_1012421352 124
400 3300006871 Ga0075434_101338423 Ga0075434_1013384232 124
401 3300006871 Ga0075434_101646263 Ga0075434_1016462632 124
402 3300006871 Ga0075434_101761663 Ga0075434_1017616631 124
403 3300006871 Ga0075434_101830128 Ga0075434_1018301282 124
404 3300006880 Ga0075429_100476401 Ga0075429_1004764012 124
405 3300006880 Ga0075429_100583453 Ga0075429_1005834532 124
406 3300006880 Ga0075429_100959948 Ga0075429_1009599482 124
407 3300006880 Ga0075429_101272403 Ga0075429_1012724032 124
408 3300006880 Ga0075429_101630104 Ga0075429_1016301042 124
409 3300006881 Ga0068865_100006729 Ga0068865_10000672914 124
410 3300006881 Ga0068865_100111154 Ga0068865_1001111545 124
411 3300006881 Ga0068865_100386721 Ga0068865_1003867212 124
412 3300006881 Ga0068865_100661817 Ga0068865_1006618172 124
413 3300006881 Ga0068865_101497341 Ga0068865_1014973412 124
414 3300006914 Ga0075436_100018272 Ga0075436_1000182722 124
415 3300006914 Ga0075436_100038116 Ga0075436_1000381162 124
416 3300006914 Ga0075436_100107040 Ga0075436_1001070405 124
417 3300006914 Ga0075436_100110506 Ga0075436_1001105065 124
418 3300006914 Ga0075436_100177377 Ga0075436_1001773772 124
419 3300006914 Ga0075436_100380999 Ga0075436_1003809991 124
420 3300006914 Ga0075436_100465602 Ga0075436_1004656022 124
421 3300006914 Ga0075436_100843550 Ga0075436_1008435502 124
422 3300006931 Ga0097620_100020008 Ga0097620_10002000814 124
423 3300006931 Ga0097620_100168317 Ga0097620_1001683172 124
424 3300006931 Ga0097620_100204697 Ga0097620_1002046974 124
425 3300006931 Ga0097620_100207170 Ga0097620_1002071705 124
426 3300006931 Ga0097620_101061169 Ga0097620_1010611692 124
427 3300006931 Ga0097620_101181026 Ga0097620_1011810262 124
428 3300006931 Ga0097620_101227295 Ga0097620_1012272952 124
429 3300006931 Ga0097620_101638912 Ga0097620_1016389122 124
430 3300006931 Ga0097620_101844792 Ga0097620_1018447922 124
431 3300006931 Ga0097620_102312365 Ga0097620_1023123652 124
432 3300006931 Ga0097620_102342528 Ga0097620_1023425282 124
433 3300006931 Ga0097620_102459251 Ga0097620_1024592511 124
434 3300006931 Ga0097620_103011687 Ga0097620_1030116871 124
435 3300007076 Ga0075435_100001542 Ga0075435_10000154216 124
436 3300007076 Ga0075435_100001694 Ga0075435_10000169418 124
437 3300007076 Ga0075435_100028991 Ga0075435_1000289917 124
438 3300007076 Ga0075435_100038141 Ga0075435_1000381417 124
439 3300007076 Ga0075435_100103730 Ga0075435_1001037305 124
440 3300007076 Ga0075435_100173755 Ga0075435_1001737554 124
441 3300007076 Ga0075435_100360575 Ga0075435_1003605752 124
442 3300007076 Ga0075435_101413232 Ga0075435_1014132321 124
443 3300007265 Ga0099794_10254417 Ga0099794_102544172 124
444 3300007788 Ga0099795_10238705 Ga0099795_102387052 124
445 3300009011 Ga0105251_10204990 Ga0105251_102049902 124
446 3300009036 Ga0105244_10201811 Ga0105244_102018112 124
447 3300009093 Ga0105240_10177867 Ga0105240_101778675 124
448 3300009093 Ga0105240_11534098 Ga0105240_115340982 124
449 3300009093 Ga0105240_11757013 Ga0105240_117570131 124
450 3300009094 Ga0111539_10000566 Ga0111539_1000056611 124
451 3300009094 Ga0111539_10016960 Ga0111539_1001696018 124
452 3300009094 Ga0111539_10049169 Ga0111539_100491695 124
453 3300009094 Ga0111539_10060191 Ga0111539_1006019111 124
454 3300009094 Ga0111539_10253014 Ga0111539_102530143 124
455 3300009094 Ga0111539_10371413 Ga0111539_103714132 124
456 3300009094 Ga0111539_11286458 Ga0111539_112864582 124
457 3300009094 Ga0111539_11370056 Ga0111539_113700562 124
458 3300009098 Ga0105245_10035527 Ga0105245_1003552710 124
459 3300009098 Ga0105245_10062980 Ga0105245_100629802 124
460 3300009098 Ga0105245_10246998 Ga0105245_102469984 124
461 3300009098 Ga0105245_11607643 Ga0105245_116076432 124
462 3300009098 Ga0105245_11796780 Ga0105245_117967801 124
463 3300009101 Ga0105247_10004209 Ga0105247_100042097 124
464 3300009101 Ga0105247_10211185 Ga0105247_102111852 124
465 3300009101 Ga0105247_10262879 Ga0105247_102628792 124
466 3300009101 Ga0105247_10307365 Ga0105247_103073652 124
467 3300009101 Ga0105247_10959656 Ga0105247_109596562 124
468 3300009101 Ga0105247_11766986 Ga0105247_117669861 124
469 3300009147 Ga0114129_10017270 Ga0114129_100172706 124
470 3300009147 Ga0114129_10049690 Ga0114129_1004969010 124
471 3300009147 Ga0114129_10101848 Ga0114129_101018487 124
472 3300009147 Ga0114129_10123569 Ga0114129_101235693 124
473 3300009147 Ga0114129_10148538 Ga0114129_101485382 124
474 3300009147 Ga0114129_10216991 Ga0114129_102169912 124
475 3300009147 Ga0114129_10279068 Ga0114129_102790685 124
476 3300009147 Ga0114129_10303039 Ga0114129_103030392 124
477 3300009147 Ga0114129_10594150 Ga0114129_105941503 124
478 3300009147 Ga0114129_10821965 Ga0114129_108219652 124
479 3300009148 Ga0105243_10054004 Ga0105243_100540045 124
480 3300009148 Ga0105243_10063021 Ga0105243_100630212 124
481 3300009148 Ga0105243_10118284 Ga0105243_101182845 124
482 3300009148 Ga0105243_11010881 Ga0105243_110108812 124
483 3300009148 Ga0105243_11205257 Ga0105243_112052571 124
484 3300009148 Ga0105243_11243063 Ga0105243_112430632 124
485 3300009148 Ga0105243_11245619 Ga0105243_112456192 124
486 3300009148 Ga0105243_11579002 Ga0105243_115790021 124
487 3300009174 Ga0105241_10100846 Ga0105241_101008462 124
488 3300009174 Ga0105241_10789569 Ga0105241_107895692 124
489 3300009174 Ga0105241_12110588 Ga0105241_121105882 124
490 3300009176 Ga0105242_10013585 Ga0105242_1001358512 124
491 3300009176 Ga0105242_10129022 Ga0105242_101290222 124
492 3300009176 Ga0105242_10177665 Ga0105242_101776655 124
493 3300009176 Ga0105242_10512431 Ga0105242_105124312 124
494 3300009176 Ga0105242_10925046 Ga0105242_109250462 124
495 3300009176 Ga0105242_11087995 Ga0105242_110879952 124
496 3300009176 Ga0105242_12961599 Ga0105242_129615991 124
497 3300009177 Ga0105248_10013460 Ga0105248_1001346011 124
498 3300009177 Ga0105248_10019507 Ga0105248_1001950711 124
499 3300009177 Ga0105248_10053076 Ga0105248_100530765 124
500 3300009177 Ga0105248_10320163 Ga0105248_103201632 124
501 3300009177 Ga0105248_10354349 Ga0105248_103543492 124
502 3300009177 Ga0105248_10387276 Ga0105248_103872763 124
503 3300009177 Ga0105248_10440668 Ga0105248_104406682 124
504 3300009177 Ga0105248_10794659 Ga0105248_107946592 124
505 3300009177 Ga0105248_11122134 Ga0105248_111221342 124
506 3300009177 Ga0105248_11209782 Ga0105248_112097821 124
507 3300009177 Ga0105248_11267466 Ga0105248_112674661 124
508 3300009177 Ga0105248_11359820 Ga0105248_113598202 124
509 3300009177 Ga0105248_11666203 Ga0105248_116662031 124
510 3300009177 Ga0105248_12154192 Ga0105248_121541921 124
511 3300009177 Ga0105248_12163185 Ga0105248_121631852 124
512 3300009177 Ga0105248_12341195 Ga0105248_123411952 124
513 3300009177 Ga0105248_12626452 Ga0105248_126264522 124
514 3300009545 Ga0105237_10904267 Ga0105237_109042672 124
515 3300009551 Ga0105238_10121264 Ga0105238_101212645 124
516 3300009551 Ga0105238_10125557 Ga0105238_101255575 124
517 3300009551 Ga0105238_10403235 Ga0105238_104032352 124
518 3300009551 Ga0105238_10628223 Ga0105238_106282232 124
519 3300009551 Ga0105238_11419503 Ga0105238_114195032 124
520 3300009551 Ga0105238_11928995 Ga0105238_119289951 124
521 3300009553 Ga0105249_10421252 Ga0105249_104212523 124
522 3300009553 Ga0105249_10455911 Ga0105249_104559113 124
523 3300009553 Ga0105249_10553701 Ga0105249_105537012 124
524 3300009553 Ga0105249_10629169 Ga0105249_106291692 124
525 3300009553 Ga0105249_10677625 Ga0105249_106776252 124
526 3300009553 Ga0105249_10974549 Ga0105249_109745492 124
527 3300009553 Ga0105249_11323713 Ga0105249_113237132 124
528 3300009553 Ga0105249_11803113 Ga0105249_118031131 124
529 3300010159 Ga0099796_10030103 Ga0099796_100301032 124
530 3300010159 Ga0099796_10256688 Ga0099796_102566881 124
531 3300010375 Ga0105239_11018775 Ga0105239_110187752 124
532 3300011119 Ga0105246_10092494 Ga0105246_100924945 124
533 3300011119 Ga0105246_10336797 Ga0105246_103367972 124
534 3300011119 Ga0105246_10595286 Ga0105246_105952862 124
535 3300012491 Ga0157329_1022760 Ga0157329_10227601 124
536 3300012497 Ga0157319_1029039 Ga0157319_10290391 124
537 3300013105 Ga0157369_10421253 Ga0157369_104212532 124
538 3300013296 Ga0157374_10119547 Ga0157374_101195472 124
539 3300013296 Ga0157374_10433731 Ga0157374_104337312 124
540 3300013296 Ga0157374_10813153 Ga0157374_108131532 124
541 3300013297 Ga0157378_10067386 Ga0157378_100673865 124
542 3300013297 Ga0157378_10231855 Ga0157378_102318552 124
543 3300013297 Ga0157378_10474815 Ga0157378_104748152 124
544 3300013297 Ga0157378_11951552 Ga0157378_119515522 124
545 3300013297 Ga0157378_12287744 Ga0157378_122877442 124
546 3300013297 Ga0157378_12754927 Ga0157378_127549272 124
547 3300013297 Ga0157378_13237018 Ga0157378_132370181 124
548 3300013306 Ga0163162_10039352 Ga0163162_100393527 124
549 3300013306 Ga0163162_10364795 Ga0163162_103647954 124
550 3300013306 Ga0163162_10454448 Ga0163162_104544484 124
551 3300013306 Ga0163162_10924852 Ga0163162_109248522 124
552 3300013306 Ga0163162_11058630 Ga0163162_110586302 124
553 3300013306 Ga0163162_11731942 Ga0163162_117319422 124
554 3300013306 Ga0163162_11751606 Ga0163162_117516062 124
555 3300013306 Ga0163162_12322375 Ga0163162_123223752 124
556 3300013308 Ga0157375_10053326 Ga0157375_100533265 124
557 3300013308 Ga0157375_10234254 Ga0157375_102342542 124
558 3300013308 Ga0157375_10277484 Ga0157375_102774842 124
559 3300013308 Ga0157375_10659062 Ga0157375_106590622 124
560 3300013308 Ga0157375_12058362 Ga0157375_120583622 124
561 3300013308 Ga0157375_12205789 Ga0157375_122057892 124
562 3300013308 Ga0157375_13542195 Ga0157375_135421951 124
563 3300014325 Ga0163163_10061505 Ga0163163_100615059 124
564 3300014325 Ga0163163_10087285 Ga0163163_100872852 124
565 3300014325 Ga0163163_11020555 Ga0163163_110205552 124
566 3300014325 Ga0163163_11096071 Ga0163163_110960712 124
567 3300014325 Ga0163163_11427330 Ga0163163_114273302 124
568 3300014326 Ga0157380_10075300 Ga0157380_100753005 124
569 3300014326 Ga0157380_10194070 Ga0157380_101940704 124
570 3300014326 Ga0157380_10280688 Ga0157380_102806882 124
571 3300014326 Ga0157380_10542010 Ga0157380_105420102 124
572 3300014326 Ga0157380_11856683 Ga0157380_118566831 124
573 3300014745 Ga0157377_10019122 Ga0157377_100191225 124
574 3300014745 Ga0157377_10415483 Ga0157377_104154832 124
575 3300014745 Ga0157377_10670906 Ga0157377_106709061 124
576 3300014745 Ga0157377_10987261 Ga0157377_109872612 124
577 3300014745 Ga0157377_11004875 Ga0157377_110048752 124
578 3300014968 Ga0157379_10018550 Ga0157379_100185505 124
579 3300014968 Ga0157379_10063370 Ga0157379_100633704 124
580 3300014968 Ga0157379_10072684 Ga0157379_100726846 124
581 3300014968 Ga0157379_10146389 Ga0157379_101463894 124
582 3300014968 Ga0157379_10637239 Ga0157379_106372392 124
583 3300014968 Ga0157379_10852336 Ga0157379_108523361 124
584 3300014968 Ga0157379_11881743 Ga0157379_118817432 124
585 3300014969 Ga0157376_10057273 Ga0157376_100572734 124
586 3300014969 Ga0157376_10145796 Ga0157376_101457962 124
587 3300014969 Ga0157376_10462769 Ga0157376_104627692 124
588 3300014969 Ga0157376_10583929 Ga0157376_105839292 124
589 3300014969 Ga0157376_11759762 Ga0157376_117597622 124
590 3300015262 Ga0182007_10166916 Ga0182007_101669161 124
591 3300017792 Ga0163161_10634310 Ga0163161_106343102 124
592 3300017792 Ga0163161_10801553 Ga0163161_108015532 124
593 3300021384 Ga0213876_10068153 Ga0213876_100681533 124
594 3300025315 Ga0207697_10022506 Ga0207697_100225066 124
595 3300025315 Ga0207697_10102162 Ga0207697_101021622 124
596 3300025885 Ga0207653_10034046 Ga0207653_100340462 124
597 3300025893 Ga0207682_10124695 Ga0207682_101246952 124
598 3300025893 Ga0207682_10134539 Ga0207682_101345392 124
599 3300025893 Ga0207682_10488355 Ga0207682_104883552 124
600 3300025899 Ga0207642_10054168 Ga0207642_100541683 124
601 3300025899 Ga0207642_10663060 Ga0207642_106630602 124
602 3300025900 Ga0207710_10084463 Ga0207710_100844633 124
603 3300025900 Ga0207710_10280234 Ga0207710_102802342 124
604 3300025901 Ga0207688_10150432 Ga0207688_101504322 124
605 3300025903 Ga0207680_10142130 Ga0207680_101421303 124
606 3300025903 Ga0207680_10142428 Ga0207680_101424282 124
607 3300025903 Ga0207680_10337447 Ga0207680_103374472 124
608 3300025903 Ga0207680_10756860 Ga0207680_107568602 124
609 3300025903 Ga0207680_10784100 Ga0207680_107841002 124
610 3300025905 Ga0207685_10191380 Ga0207685_101913801 124
611 3300025906 Ga0207699_10476806 Ga0207699_104768062 124
612 3300025906 Ga0207699_10553436 Ga0207699_105534362 124
613 3300025907 Ga0207645_10025953 Ga0207645_1002595310 124
614 3300025907 Ga0207645_10155591 Ga0207645_101555912 124
615 3300025907 Ga0207645_10299026 Ga0207645_102990262 124
616 3300025907 Ga0207645_10304678 Ga0207645_103046782 124
617 3300025907 Ga0207645_10766794 Ga0207645_107667942 124
618 3300025907 Ga0207645_10804889 Ga0207645_108048892 124
619 3300025909 Ga0207705_10423658 Ga0207705_104236581 124
620 3300025910 Ga0207684_10880897 Ga0207684_108808972 124
621 3300025910 Ga0207684_11587821 Ga0207684_115878212 124
622 3300025911 Ga0207654_10338850 Ga0207654_103388502 124
623 3300025912 Ga0207707_10276896 Ga0207707_102768962 124
624 3300025912 Ga0207707_10595812 Ga0207707_105958122 124
625 3300025913 Ga0207695_10131709 Ga0207695_101317095 124
626 3300025913 Ga0207695_10667116 Ga0207695_106671162 124
627 3300025913 Ga0207695_11176248 Ga0207695_111762482 124
628 3300025914 Ga0207671_10744242 Ga0207671_107442422 124
629 3300025915 Ga0207693_10405020 Ga0207693_104050203 124
630 3300025916 Ga0207663_10236530 Ga0207663_102365302 124
631 3300025916 Ga0207663_10461732 Ga0207663_104617322 124
632 3300025916 Ga0207663_10608636 Ga0207663_106086362 124
633 3300025916 Ga0207663_10908255 Ga0207663_109082552 124
634 3300025917 Ga0207660_10323655 Ga0207660_103236552 124
635 3300025917 Ga0207660_10617415 Ga0207660_106174152 124
636 3300025917 Ga0207660_11242679 Ga0207660_112426792 124
637 3300025917 Ga0207660_11689343 Ga0207660_116893431 124
638 3300025918 Ga0207662_10118237 Ga0207662_101182373 124
639 3300025918 Ga0207662_10364872 Ga0207662_103648722 124
640 3300025918 Ga0207662_10388071 Ga0207662_103880712 124
641 3300025918 Ga0207662_10996645 Ga0207662_109966451 124
642 3300025918 Ga0207662_11030518 Ga0207662_110305182 124
643 3300025918 Ga0207662_11269996 Ga0207662_112699962 124
644 3300025919 Ga0207657_10013143 Ga0207657_1001314310 124
645 3300025919 Ga0207657_10468361 Ga0207657_104683612 124
646 3300025920 Ga0207649_10350896 Ga0207649_103508962 124
647 3300025921 Ga0207652_10041098 Ga0207652_100410982 124
648 3300025922 Ga0207646_10036909 Ga0207646_100369092 124
649 3300025922 Ga0207646_10097073 Ga0207646_100970732 124
650 3300025922 Ga0207646_10278375 Ga0207646_102783752 124
651 3300025922 Ga0207646_10987315 Ga0207646_109873152 124
652 3300025922 Ga0207646_11364446 Ga0207646_113644462 124
653 3300025923 Ga0207681_10119814 Ga0207681_101198142 124
654 3300025923 Ga0207681_10272317 Ga0207681_102723173 124
655 3300025923 Ga0207681_10303136 Ga0207681_103031362 124
656 3300025923 Ga0207681_10368046 Ga0207681_103680462 124
657 3300025923 Ga0207681_10678473 Ga0207681_106784732 124
658 3300025923 Ga0207681_10808536 Ga0207681_108085362 124
659 3300025923 Ga0207681_11226222 Ga0207681_112262221 124
660 3300025924 Ga0207694_10261502 Ga0207694_102615022 124
661 3300025925 Ga0207650_10063849 Ga0207650_100638493 124
662 3300025925 Ga0207650_10366088 Ga0207650_103660882 124
663 3300025925 Ga0207650_10773931 Ga0207650_107739312 124
664 3300025925 Ga0207650_11766239 Ga0207650_117662391 124
665 3300025926 Ga0207659_10001199 Ga0207659_1000119925 124
666 3300025926 Ga0207659_10126623 Ga0207659_101266232 124
667 3300025926 Ga0207659_11153919 Ga0207659_111539191 124
668 3300025926 Ga0207659_11281384 Ga0207659_112813842 124
669 3300025927 Ga0207687_10015584 Ga0207687_100155844 124
670 3300025927 Ga0207687_10063053 Ga0207687_100630533 124
671 3300025927 Ga0207687_10714987 Ga0207687_107149872 124
672 3300025927 Ga0207687_10747528 Ga0207687_107475282 124
673 3300025927 Ga0207687_10859573 Ga0207687_108595732 124
674 3300025927 Ga0207687_11120420 Ga0207687_111204202 124
675 3300025928 Ga0207700_10152692 Ga0207700_101526922 124
676 3300025929 Ga0207664_10050545 Ga0207664_100505455 124
677 3300025931 Ga0207644_10059656 Ga0207644_100596565 124
678 3300025931 Ga0207644_10075564 Ga0207644_100755642 124
679 3300025931 Ga0207644_10355905 Ga0207644_103559053 124
680 3300025931 Ga0207644_10853274 Ga0207644_108532742 124
681 3300025931 Ga0207644_11044450 Ga0207644_110444502 124
682 3300025931 Ga0207644_11379665 Ga0207644_113796651 124
683 3300025932 Ga0207690_10232957 Ga0207690_102329571 124
684 3300025932 Ga0207690_10926198 Ga0207690_109261982 124
685 3300025933 Ga0207706_10047200 Ga0207706_100472001 124
686 3300025933 Ga0207706_10848538 Ga0207706_108485382 124
687 3300025933 Ga0207706_11081156 Ga0207706_110811561 124
688 3300025933 Ga0207706_11415773 Ga0207706_114157731 124
689 3300025934 Ga0207686_10011631 Ga0207686_100116312 124
690 3300025934 Ga0207686_10013361 Ga0207686_100133613 124
691 3300025934 Ga0207686_10016494 Ga0207686_100164945 124
692 3300025934 Ga0207686_10160445 Ga0207686_101604454 124
693 3300025934 Ga0207686_10482102 Ga0207686_104821022 124
694 3300025934 Ga0207686_10739320 Ga0207686_107393202 124
695 3300025935 Ga0207709_10007222 Ga0207709_1000722211 124
696 3300025935 Ga0207709_10084540 Ga0207709_100845402 124
697 3300025935 Ga0207709_10227729 Ga0207709_102277292 124
698 3300025935 Ga0207709_10555188 Ga0207709_105551882 124
699 3300025935 Ga0207709_11061475 Ga0207709_110614752 124
700 3300025935 Ga0207709_11360583 Ga0207709_113605831 124
701 3300025936 Ga0207670_10082596 Ga0207670_100825965 124
702 3300025936 Ga0207670_10280206 Ga0207670_102802063 124
703 3300025936 Ga0207670_10343977 Ga0207670_103439772 124
704 3300025936 Ga0207670_10510891 Ga0207670_105108912 124
705 3300025936 Ga0207670_11579906 Ga0207670_115799061 124
706 3300025937 Ga0207669_10082660 Ga0207669_100826603 124
707 3300025937 Ga0207669_10127353 Ga0207669_101273532 124
708 3300025937 Ga0207669_10211411 Ga0207669_102114113 124
709 3300025937 Ga0207669_10337513 Ga0207669_103375131 124
710 3300025937 Ga0207669_10544775 Ga0207669_105447752 124
711 3300025937 Ga0207669_11672365 Ga0207669_116723652 124
712 3300025938 Ga0207704_10005828 Ga0207704_100058285 124
713 3300025938 Ga0207704_10169986 Ga0207704_101699864 124
714 3300025938 Ga0207704_10211258 Ga0207704_102112582 124
715 3300025938 Ga0207704_10588504 Ga0207704_105885042 124
716 3300025938 Ga0207704_10670622 Ga0207704_106706222 124
717 3300025938 Ga0207704_10861195 Ga0207704_108611952 124
718 3300025938 Ga0207704_11081165 Ga0207704_110811652 124
719 3300025939 Ga0207665_10048683 Ga0207665_100486833 124
720 3300025940 Ga0207691_10183706 Ga0207691_101837062 124
721 3300025940 Ga0207691_10213997 Ga0207691_102139974 124
722 3300025940 Ga0207691_10339779 Ga0207691_103397793 124
723 3300025940 Ga0207691_10656486 Ga0207691_106564861 124
724 3300025940 Ga0207691_10680510 Ga0207691_106805102 124
725 3300025940 Ga0207691_10734933 Ga0207691_107349332 124
726 3300025941 Ga0207711_10026433 Ga0207711_100264336 124
727 3300025941 Ga0207711_10042393 Ga0207711_100423934 124
728 3300025941 Ga0207711_10050802 Ga0207711_100508022 124
729 3300025941 Ga0207711_10136539 Ga0207711_101365392 124
730 3300025941 Ga0207711_10366022 Ga0207711_103660223 124
731 3300025941 Ga0207711_10393563 Ga0207711_103935631 124
732 3300025941 Ga0207711_10719139 Ga0207711_107191392 124
733 3300025941 Ga0207711_10920606 Ga0207711_109206062 124
734 3300025941 Ga0207711_11549451 Ga0207711_115494511 124
735 3300025942 Ga0207689_10034411 Ga0207689_100344114 124
736 3300025942 Ga0207689_10073175 Ga0207689_100731755 124
737 3300025942 Ga0207689_10293746 Ga0207689_102937464 124
738 3300025942 Ga0207689_10842358 Ga0207689_108423582 124
739 3300025942 Ga0207689_11137741 Ga0207689_111377412 124
740 3300025942 Ga0207689_11716710 Ga0207689_117167101 124
741 3300025944 Ga0207661_10778463 Ga0207661_107784632 124
742 3300025944 Ga0207661_11300702 Ga0207661_113007022 124
743 3300025945 Ga0207679_10203401 Ga0207679_102034012 124
744 3300025945 Ga0207679_10448444 Ga0207679_104484442 124
745 3300025945 Ga0207679_10525449 Ga0207679_105254492 124
746 3300025945 Ga0207679_10541467 Ga0207679_105414672 124
747 3300025945 Ga0207679_11495173 Ga0207679_114951732 124
748 3300025949 Ga0207667_10017864 Ga0207667_1001786416 124
749 3300025949 Ga0207667_10168529 Ga0207667_101685295 124
750 3300025949 Ga0207667_11060981 Ga0207667_110609811 124
751 3300025960 Ga0207651_10041000 Ga0207651_100410004 124
752 3300025960 Ga0207651_10110459 Ga0207651_101104592 124
753 3300025960 Ga0207651_10149189 Ga0207651_101491894 124
754 3300025960 Ga0207651_10156204 Ga0207651_101562043 124
755 3300025960 Ga0207651_10612455 Ga0207651_106124552 124
756 3300025960 Ga0207651_10809175 Ga0207651_108091752 124
757 3300025960 Ga0207651_10940673 Ga0207651_109406732 124
758 3300025960 Ga0207651_11019218 Ga0207651_110192182 124
759 3300025960 Ga0207651_11995319 Ga0207651_119953191 124
760 3300025961 Ga0207712_10259532 Ga0207712_102595324 124
761 3300025961 Ga0207712_10271248 Ga0207712_102712483 124
762 3300025961 Ga0207712_10358937 Ga0207712_103589372 124
763 3300025961 Ga0207712_10428530 Ga0207712_104285302 124
764 3300025961 Ga0207712_10536849 Ga0207712_105368492 124
765 3300025961 Ga0207712_10660543 Ga0207712_106605432 124
766 3300025961 Ga0207712_10662725 Ga0207712_106627252 124
767 3300025961 Ga0207712_11489875 Ga0207712_114898752 124
768 3300025972 Ga0207668_10076681 Ga0207668_100766815 124
769 3300025972 Ga0207668_10098613 Ga0207668_100986135 124
770 3300025972 Ga0207668_10310878 Ga0207668_103108783 124
771 3300025981 Ga0207640_10114374 Ga0207640_101143744 124
772 3300025981 Ga0207640_10198422 Ga0207640_101984222 124
773 3300025981 Ga0207640_10209777 Ga0207640_102097772 124
774 3300025981 Ga0207640_10652383 Ga0207640_106523832 124
775 3300025981 Ga0207640_11132033 Ga0207640_111320332 124
776 3300025981 Ga0207640_11211209 Ga0207640_112112091 124
777 3300025986 Ga0207658_10353365 Ga0207658_103533652 124
778 3300025986 Ga0207658_10483386 Ga0207658_104833862 124
779 3300025986 Ga0207658_10856472 Ga0207658_108564722 124
780 3300025986 Ga0207658_11004853 Ga0207658_110048531 124
781 3300025986 Ga0207658_11859221 Ga0207658_118592212 124
782 3300026023 Ga0207677_10084348 Ga0207677_100843485 124
783 3300026023 Ga0207677_10149948 Ga0207677_101499482 124
784 3300026023 Ga0207677_10288695 Ga0207677_102886952 124
785 3300026023 Ga0207677_10390960 Ga0207677_103909602 124
786 3300026023 Ga0207677_10620671 Ga0207677_106206712 124
787 3300026035 Ga0207703_10114539 Ga0207703_101145395 124
788 3300026035 Ga0207703_10160423 Ga0207703_101604235 124
789 3300026035 Ga0207703_10215416 Ga0207703_102154164 124
790 3300026035 Ga0207703_10280457 Ga0207703_102804571 124
791 3300026035 Ga0207703_10383633 Ga0207703_103836332 124
792 3300026035 Ga0207703_10456520 Ga0207703_104565202 124
793 3300026035 Ga0207703_10505061 Ga0207703_105050612 124
794 3300026035 Ga0207703_11379936 Ga0207703_113799361 124
795 3300026035 Ga0207703_12246442 Ga0207703_122464422 124
796 3300026041 Ga0207639_10805391 Ga0207639_108053912 124
797 3300026041 Ga0207639_12009415 Ga0207639_120094151 124
798 3300026041 Ga0207639_12288411 Ga0207639_122884111 124
799 3300026067 Ga0207678_10817264 Ga0207678_108172641 124
800 3300026067 Ga0207678_11080060 Ga0207678_110800602 124
801 3300026067 Ga0207678_11214375 Ga0207678_112143752 124
802 3300026075 Ga0207708_10025274 Ga0207708_100252742 124
803 3300026075 Ga0207708_10107694 Ga0207708_101076945 124
804 3300026075 Ga0207708_11329283 Ga0207708_113292832 124
805 3300026075 Ga0207708_11763130 Ga0207708_117631301 124
806 3300026078 Ga0207702_10262266 Ga0207702_102622661 124
807 3300026078 Ga0207702_11376268 Ga0207702_113762682 124
808 3300026088 Ga0207641_10087096 Ga0207641_100870966 124
809 3300026088 Ga0207641_10099999 Ga0207641_100999996 124
810 3300026088 Ga0207641_10674713 Ga0207641_106747132 124
811 3300026088 Ga0207641_10742896 Ga0207641_107428962 124
812 3300026088 Ga0207641_10807778 Ga0207641_108077781 124
813 3300026088 Ga0207641_12421496 Ga0207641_124214961 124
814 3300026089 Ga0207648_10016724 Ga0207648_100167247 124
815 3300026089 Ga0207648_10037722 Ga0207648_100377226 124
816 3300026089 Ga0207648_10082760 Ga0207648_100827604 124
817 3300026089 Ga0207648_10103565 Ga0207648_101035654 124
818 3300026089 Ga0207648_10319166 Ga0207648_103191662 124
819 3300026089 Ga0207648_10370885 Ga0207648_103708852 124
820 3300026089 Ga0207648_10889708 Ga0207648_108897082 124
821 3300026089 Ga0207648_11104954 Ga0207648_111049542 124
822 3300026089 Ga0207648_11199692 Ga0207648_111996922 124
823 3300026089 Ga0207648_11705187 Ga0207648_117051871 124
824 3300026089 Ga0207648_11946234 Ga0207648_119462341 124
825 3300026095 Ga0207676_10028142 Ga0207676_100281423 124
826 3300026095 Ga0207676_10069079 Ga0207676_100690794 124
827 3300026095 Ga0207676_10138631 Ga0207676_101386312 124
828 3300026095 Ga0207676_10164224 Ga0207676_101642243 124
829 3300026095 Ga0207676_10502054 Ga0207676_105020543 124
830 3300026095 Ga0207676_10629385 Ga0207676_106293852 124
831 3300026095 Ga0207676_10947882 Ga0207676_109478822 124
832 3300026095 Ga0207676_11496682 Ga0207676_114966822 124
833 3300026116 Ga0207674_10062761 Ga0207674_100627615 124
834 3300026116 Ga0207674_10203527 Ga0207674_102035272 124
835 3300026118 Ga0207675_100014045 Ga0207675_10001404513 124
836 3300026118 Ga0207675_100038967 Ga0207675_1000389675 124
837 3300026118 Ga0207675_100099958 Ga0207675_1000999587 124
838 3300026118 Ga0207675_100360319 Ga0207675_1003603194 124
839 3300026118 Ga0207675_100899736 Ga0207675_1008997362 124
840 3300026118 Ga0207675_101086473 Ga0207675_1010864732 124
841 3300026118 Ga0207675_101134005 Ga0207675_1011340052 124
842 3300026118 Ga0207675_101372554 Ga0207675_1013725542 124
843 3300026118 Ga0207675_101928867 Ga0207675_1019288672 124
844 3300026118 Ga0207675_102171026 Ga0207675_1021710261 124
845 3300026118 Ga0207675_102555791 Ga0207675_1025557911 124
846 3300026121 Ga0207683_10109399 Ga0207683_101093992 124
847 3300026121 Ga0207683_10628485 Ga0207683_106284852 124
848 3300026121 Ga0207683_10784482 Ga0207683_107844822 124
849 3300026121 Ga0207683_11332756 Ga0207683_113327562 124
850 3300026142 Ga0207698_10854885 Ga0207698_108548852 124
851 3300026142 Ga0207698_10947320 Ga0207698_109473202 124
852 3300026142 Ga0207698_11175435 Ga0207698_111754352 124
853 3300027462 Ga0210000_1043596 Ga0210000_10435961 124
854 3300027907 Ga0207428_10041247 Ga0207428_100412476 124
855 3300027907 Ga0207428_10073024 Ga0207428_100730244 124
856 3300027907 Ga0207428_10107542 Ga0207428_101075422 124
857 3300027907 Ga0207428_10120374 Ga0207428_101203743 124
858 3300028379 Ga0268266_10005896 Ga0268266_100058969 124
859 3300028379 Ga0268266_10029767 Ga0268266_100297672 124
860 3300028379 Ga0268266_10572703 Ga0268266_105727032 124
861 3300028380 Ga0268265_10025303 Ga0268265_100253036 124
862 3300028380 Ga0268265_10060408 Ga0268265_100604082 124
863 3300028380 Ga0268265_10259045 Ga0268265_102590452 124
864 3300028380 Ga0268265_10598147 Ga0268265_105981472 124
865 3300028380 Ga0268265_11089529 Ga0268265_110895292 124
866 3300028380 Ga0268265_11744953 Ga0268265_117449532 124
867 3300028381 Ga0268264_10042810 Ga0268264_100428103 124
868 3300028381 Ga0268264_10124953 Ga0268264_101249535 124
869 3300028381 Ga0268264_10629629 Ga0268264_106296292 124
870 3300028381 Ga0268264_10753432 Ga0268264_107534321 124
871 3300028381 Ga0268264_10903167 Ga0268264_109031672 124
872 3300028381 Ga0268264_11418517 Ga0268264_114185172 124
873 3300028381 Ga0268264_11776537 Ga0268264_117765372 124
874 3300028381 Ga0268264_12342059 Ga0268264_123420592 124
875 3300028381 Ga0268264_12359197 Ga0268264_123591972 124
876 3300031238 Ga0265332_10048353 Ga0265332_100483533 124
877 3300031344 Ga0265316_10261546 Ga0265316_102615462 124
878 3300031456 Ga0307513_10533383 Ga0307513_105333832 124
879 3300031548 Ga0307408_100197181 Ga0307408_1001971812 124
880 3300031711 Ga0265314_10007579 Ga0265314_100075796 124
881 3300031731 Ga0307405_11144335 Ga0307405_111443351 124
882 3300031824 Ga0307413_10805525 Ga0307413_108055251 124
883 3300031852 Ga0307410_10927776 Ga0307410_109277762 124
884 3300031995 Ga0307409_102196906 Ga0307409_1021969062 124
885 3300032002 Ga0307416_100160347 Ga0307416_1001603472 124
886 3300033524 Ga0316592_1009839 Ga0316592_10098392 124
887 3300033528 Ga0316588_1012206 Ga0316588_10122062 124
888 3300034816 Ga0373930_0002995 Ga0373930_0002995_1665_2039 124
889 3300034817 Ga0373948_0001483 Ga0373948_0001483_1776_2150 124
890 3300034818 Ga0373950_0008982 Ga0373950_0008982_1016_1390 124
891 3300034819 Ga0373958_0000045 Ga0373958_0000045_2151_2525 124
892 3300034819 Ga0373958_0071175 Ga0373958_0071175_319_693 124
893 3300034820 Ga0373959_0001151 Ga0373959_0001151_549_923 124
894 3300034957 Ga0373938_0000418 Ga0373938_0000418_1486_1860 124
895 3300034957 Ga0373938_0141126 Ga0373938_0141126_243_617 124
896 3300035083 Ga0373926_0161839 Ga0373926_0161839_162_536 124
897 3300035084 Ga0373928_0001212 Ga0373928_0001212_2330_2704 124
898 3300035084 Ga0373928_0041293 Ga0373928_0041293_626_1000 124
899 3300035085 Ga0373929_0000116 Ga0373929_0000116_9493_9867 124
900 3300035086 Ga0373934_0002176 Ga0373934_0002176_4160_4534 124
901 3300035086 Ga0373934_0060164 Ga0373934_0060164_543_917 124
902 3300035088 Ga0373940_0000084 Ga0373940_0000084_5435_5809 124
903 3300035088 Ga0373940_0046104 Ga0373940_0046104_261_635 124
904 3300035088 Ga0373940_0152531 Ga0373940_0152531_165_539 124
905 3300035089 Ga0373944_0043759 Ga0373944_0043759_94_468 124
906 3300035090 Ga0373949_0000597 Ga0373949_0000597_8397_8771 124
907 3300035091 Ga0373951_0001673 Ga0373951_0001673_2833_3207 124
908 3300035091 Ga0373951_0161691 Ga0373951_0161691_28_402 124
909 3300035092 Ga0373952_0001387 Ga0373952_0001387_1572_1946 124
910 3300035111 Ga0373923_0151463 Ga0373923_0151463_65_439 124
911 3300035111 Ga0373923_0275358 Ga0373923_0275358_258_632 124
912 3300035111 Ga0373923_0508091 Ga0373923_0508091_187_561 124
913 3300035112 Ga0373932_0006095 Ga0373932_0006095_1929_2303 124
914 3300035113 Ga0373936_0426448 Ga0373936_0426448_29_403 124
915 3300035113 Ga0373936_0511598 Ga0373936_0511598_22_396 124
916 3300035114 Ga0373939_0001888 Ga0373939_0001888_2067_2441 124
917 3300035114 Ga0373939_0031755 Ga0373939_0031755_14_388 124
918 3300035114 Ga0373939_0090014 Ga0373939_0090014_284_658 124
919 3300035115 Ga0373941_0000161 Ga0373941_0000161_6614_6988 124
920 3300035115 Ga0373941_0340878 Ga0373941_0340878_154_528 124
921 3300035116 Ga0373945_0035271 Ga0373945_0035271_143_517 124
922 3300035116 Ga0373945_0155487 Ga0373945_0155487_398_772 124
923 3300035117 Ga0373953_0044678 Ga0373953_0044678_155_529 124
924 3300035117 Ga0373953_0103449 Ga0373953_0103449_626_1000 124
925 3300035117 Ga0373953_0128422 Ga0373953_0128422_111_485 124
926 3300035117 Ga0373953_0140818 Ga0373953_0140818_485_859 124
927 3300035117 Ga0373953_0286057 Ga0373953_0286057_271_645 124
928 3300035118 Ga0373954_0164931 Ga0373954_0164931_646_1020 124
929 3300035119 Ga0373956_0254250 Ga0373956_0254250_279_653 124
930 3300035119 Ga0373956_0320926 Ga0373956_0320926_311_685 124
931 3300035120 Ga0373957_0027079 Ga0373957_0027079_1338_1712 124
932 3300035121 Ga0373960_0001448 Ga0373960_0001448_4241_4615 124
933 3300035121 Ga0373960_0057158 Ga0373960_0057158_332_706 124
934 3300035170 Ga0373943_0036985 Ga0373943_0036985_205_579 124
935 3300035170 Ga0373943_0426669 Ga0373943_0426669_204_578 124
936 3300035170 Ga0373943_0450791 Ga0373943_0450791_97_471 124
937 3300035171 Ga0373946_0202971 Ga0373946_0202971_491_865 124
938 3300035172 Ga0373955_0006463 Ga0373955_0006463_2020_2394 124
939 3300035172 Ga0373955_0059904 Ga0373955_0059904_14_388 124
940 3300035172 Ga0373955_0117147 Ga0373955_0117147_198_572 124
941 3300035172 Ga0373955_0483193 Ga0373955_0483193_214_588 124
942 3300035207 Ga0373942_0001757 Ga0373942_0001757_4312_4686 124
943 3300035207 Ga0373942_0087579 Ga0373942_0087579_475_849 124
944 3300035207 Ga0373942_0216846 Ga0373942_0216846_66_440 124
945 3300035241 Ga0373961_0001591 Ga0373961_0001591_3777_4151 124
946 3300035242 Ga0373962_0000245 Ga0373962_0000245_4313_4687 124
947 3300035242 Ga0373962_0034298 Ga0373962_0034298_937_1311 124
948 3300035242 Ga0373962_0123488 Ga0373962_0123488_306_680 124
949 3300035691 Ga0373931_0009494 Ga0373931_0009494_3479_3853 124
950 3300035691 Ga0373931_0169020 Ga0373931_0169020_874_1248 124
951 3300035691 Ga0373931_0832583 Ga0373931_0832583_184_558 124
952 3300035691 Ga0373931_1232580 Ga0373931_1232580_37_411 124
953 3300035692 Ga0373935_0058708 Ga0373935_0058708_535_909 124
954 3300035692 Ga0373935_0087624 Ga0373935_0087624_62_436 124
955 3300035692 Ga0373935_0910469 Ga0373935_0910469_109_483 124
956 3300035692 Ga0373935_1428516 Ga0373935_1428516_104_478 124
957 3300035695 Ga0373927_0199653 Ga0373927_0199653_618_992 124
958 3300035695 Ga0373927_0214157 Ga0373927_0214157_319_693 124
959 3300035695 Ga0373927_0754014 Ga0373927_0754014_43_417 124
960 3300035724 Ga0373933_0050350 Ga0373933_0050350_1277_1651 124
961 3300035724 Ga0373933_0632580 Ga0373933_0632580_112_486 124
962 3300035724 Ga0373933_0762197 Ga0373933_0762197_232_606 124
963 3300035724 Ga0373933_0777458 Ga0373933_0777458_44_418 124
964 3300035725 Ga0373947_0018266 Ga0373947_0018266_2939_3313 124
965 3300035725 Ga0373947_0034097 Ga0373947_0034097_2489_2863 124
966 3300035725 Ga0373947_0123336 Ga0373947_0123336_173_547 124
967 3300036401 Ga0373937_0000078 Ga0373937_0000078_8946_9320 124
968 3300036401 Ga0373937_0055553 Ga0373937_0055553_1580_1954 124
969 3300036401 Ga0373937_0153828 Ga0373937_0153828_327_701 124
970 3300036401 Ga0373937_0356987 Ga0373937_0356987_708_1082 124
971 3300036401 Ga0373937_0661902 Ga0373937_0661902_295_669 124
972 3300036401 Ga0373937_0859138 Ga0373937_0859138_412_786 124
973 3300036401 Ga0373937_1156319 Ga0373937_1156319_331_705 124
974 3300036401 Ga0373937_1196130 Ga0373937_1196130_250_624 124
975 3300037068 Ga0373925_0035123 Ga0373925_0035123_3306_3680 124
976 3300037068 Ga0373925_0160073 Ga0373925_0160073_838_1212 124
977 3300037068 Ga0373925_0613814 Ga0373925_0613814_19_393 124
978 3300039437 Ga0436365_0954923 Ga0436365_0954923_509_883 124
979 3300041460 Ga0451802_0953949 Ga0451802_0953949_212_586 124
980 3300041503 Ga0451847_0676373 Ga0451847_0676373_13_387 124
981 3300042001 Ga0439441_021981 Ga0439441_021981_709_1083 124
982 3300042129 Ga0450891_037081 Ga0450891_037081_94_468 124
983 3300042436 Ga0439435_0078738 Ga0439435_0078738_57_431 124
984 3300042530 Ga0450916_000502 Ga0450916_000502_2145_2519 124
985 3300042530 Ga0450916_020578 Ga0450916_020578_512_886 124
986 3300044684 Ga0466966_0209879 Ga0466966_0209879_244_618 124
987 3300044694 Ga0466963_0288839 Ga0466963_0288839_278_652 124
988 3300044694 Ga0466963_0658783 Ga0466963_0658783_28_402 124
989 3300045049 Ga0466959_0639464 Ga0466959_0639464_216_590 124
990 3300045051 Ga0451576_0071334 Ga0451576_0071334_2359_2733 124
991 3300045051 Ga0451576_0277902 Ga0451576_0277902_10_384 124
992 3300045051 Ga0451576_0401790 Ga0451576_0401790_442_816 124
993 3300045051 Ga0451576_1521021 Ga0451576_1521021_289_663 124
994 3300045051 Ga0451576_2039290 Ga0451576_2039290_204_578 124
995 3300045976 Ga0466967_0341168 Ga0466967_0341168_375_749 124
996 3300045976 Ga0466967_0717332 Ga0466967_0717332_154_528 124
997 3300045976 Ga0466967_1005365 Ga0466967_1005365_140_514 124
998 3300046454 Ga0495592_0168479 Ga0495592_0168479_884_1258 124
999 3300046454 Ga0495592_0179321 Ga0495592_0179321_328_702 124
1000 3300046454 Ga0495592_0725844 Ga0495592_0725844_204_578 124
1001 3300046455 Ga0495603_0531912 Ga0495603_0531912_286_660 124
1002 3300046457 Ga0495590_0380071 Ga0495590_0380071_11_385 124
1003 3300046459 Ga0495629_0168804 Ga0495629_0168804_953_1327 124
1004 3300046459 Ga0495629_0324963 Ga0495629_0324963_235_609 124
1005 3300046459 Ga0495629_0404725 Ga0495629_0404725_225_599 124
1006 3300046461 Ga0495641_0068787 Ga0495641_0068787_888_1262 124
1007 3300046462 Ga0495651_0267383 Ga0495651_0267383_182_556 124
1008 3300046462 Ga0495651_0366423 Ga0495651_0366423_24_398 124
1009 3300046463 Ga0495653_0159656 Ga0495653_0159656_1111_1485 124
1010 3300046472 Ga0495580_0431859 Ga0495580_0431859_366_740 124
1011 3300046473 Ga0495582_0746771 Ga0495582_0746771_113_487 124
1012 3300046476 Ga0495662_0194313 Ga0495662_0194313_275_649 124
1013 3300046477 Ga0495664_0507972 Ga0495664_0507972_314_688 124
1014 3300046491 Ga0495584_0652222 Ga0495584_0652222_82_456 124
1015 3300046492 Ga0495585_0491825 Ga0495585_0491825_41_415 124
1016 3300046499 Ga0495594_0413321 Ga0495594_0413321_85_459 124
1017 3300046511 Ga0495608_0282693 Ga0495608_0282693_444_818 124
1018 3300046512 Ga0495610_0116527 Ga0495610_0116527_779_1153 124
1019 3300046514 Ga0495618_0674693 Ga0495618_0674693_216_590 124
1020 3300046516 Ga0495628_0162934 Ga0495628_0162934_76_450 124
1021 3300046516 Ga0495628_0210889 Ga0495628_0210889_918_1292 124
1022 3300046516 Ga0495628_0733163 Ga0495628_0733163_175_549 124
1023 3300046516 Ga0495628_1067069 Ga0495628_1067069_158_532 124
1024 3300046517 Ga0495630_0809829 Ga0495630_0809829_80_454 124
1025 3300046526 Ga0495666_0082957 Ga0495666_0082957_836_1210 124
1026 3300046528 Ga0495642_0153914 Ga0495642_0153914_608_982 124
1027 3300046529 Ga0495652_0368966 Ga0495652_0368966_524_898 124
1028 3300046533 Ga0495640_0030475 Ga0495640_0030475_744_1118 124
1029 3300046533 Ga0495640_0815666 Ga0495640_0815666_12_386 124
1030 3300046535 Ga0495586_0442156 Ga0495586_0442156_74_448 124
1031 3300046537 Ga0495598_0172195 Ga0495598_0172195_35_409 124
1032 3300046537 Ga0495598_0249336 Ga0495598_0249336_86_460 124
1033 3300046539 Ga0495621_0182921 Ga0495621_0182921_47_421 124
1034 3300046558 Ga0495633_0382471 Ga0495633_0382471_46_420 124
1035 3300046559 Ga0495667_0185326 Ga0495667_0185326_932_1306 124
1036 3300046559 Ga0495667_0289026 Ga0495667_0289026_519_893 124
1037 3300046559 Ga0495667_0389162 Ga0495667_0389162_379_753 124
1038 3300046615 Ga0495656_0078931 Ga0495656_0078931_303_677 124
1039 3300046615 Ga0495656_0370951 Ga0495656_0370951_198_572 124
1040 3300046616 Ga0495668_0487778 Ga0495668_0487778_120_494 124
1041 3300046642 Ga0495634_0204819 Ga0495634_0204819_639_1013 124
1042 3300046642 Ga0495634_0413357 Ga0495634_0413357_306_680 124
1043 3300046663 Ga0495635_0064606 Ga0495635_0064606_1762_2136 124
1044 3300046663 Ga0495635_0138650 Ga0495635_0138650_358_732 124
1045 3300046664 Ga0495659_0077485 Ga0495659_0077485_473_847 124
1046 3300046674 Ga0495588_0364877 Ga0495588_0364877_340_714 124
1047 3300046678 Ga0495599_0055493 Ga0495599_0055493_1457_1831 124
1048 3300046678 Ga0495599_0164235 Ga0495599_0164235_556_930 124
1049 3300046679 Ga0495623_0316917 Ga0495623_0316917_99_473 124
1050 3300046680 Ga0495646_0573152 Ga0495646_0573152_15_389 124
1051 3300046681 Ga0495647_0024667 Ga0495647_0024667_937_1311 124
1052 3300046681 Ga0495647_0132001 Ga0495647_0132001_498_872 124
1053 3300046681 Ga0495647_0171326 Ga0495647_0171326_439_813 124
1054 3300046683 Ga0495658_0063040 Ga0495658_0063040_425_799 124
1055 3300046683 Ga0495658_0311714 Ga0495658_0311714_296_670 124
1056 3300046684 Ga0495669_0043985 Ga0495669_0043985_132_506 124
1057 3300046684 Ga0495669_0086899 Ga0495669_0086899_983_1357 124
1058 3300046684 Ga0495669_0158329 Ga0495669_0158329_182_556 124
1059 3300046684 Ga0495669_0178050 Ga0495669_0178050_495_869 124
1060 3300046689 Ga0495613_0167259 Ga0495613_0167259_827_1201 124
1061 3300046689 Ga0495613_0202812 Ga0495613_0202812_843_1217 124
1062 3300046690 Ga0495624_0143899 Ga0495624_0143899_331_705 124
1063 3300046691 Ga0495670_0140849 Ga0495670_0140849_153_527 124
1064 3300046691 Ga0495670_0194629 Ga0495670_0194629_232_606 124
1065 3300046694 Ga0495649_0418206 Ga0495649_0418206_208_582 124
1066 3300047315 Ga0495581_0255569 Ga0495581_0255569_320_694 124
1067 3300047315 Ga0495581_0610812 Ga0495581_0610812_106_480 124
1068 3300047317 Ga0495604_0356972 Ga0495604_0356972_205_579 124
1069 3300047319 Ga0495674_0130151 Ga0495674_0130151_65_439 124
1070 3300047319 Ga0495674_0325556 Ga0495674_0325556_478_852 124
1071 3300047319 Ga0495674_0743611 Ga0495674_0743611_141_515 124
1072 3300047319 Ga0495674_0900527 Ga0495674_0900527_42_416 124
1073 3300047321 Ga0495676_0688416 Ga0495676_0688416_148_522 124
1074 3300047322 Ga0495680_0180664 Ga0495680_0180664_417_791 124
1075 3300047445 Ga0495677_0191648 Ga0495677_0191648_289_663 124
1076 3300047471 Ga0495684_0476502 Ga0495684_0476502_470_844 124
1077 3300047471 Ga0495684_0848008 Ga0495684_0848008_154_528 124
1078 3300047673 Ga0495593_0274645 Ga0495593_0274645_439_813 124
1079 3300048088 Ga0495602_0881955 Ga0495602_0881955_43_417 124
1080 3300048089 Ga0495614_0170741 Ga0495614_0170741_518_892 124
1081 3300048903 Ga0496100_0149902 Ga0496100_0149902_1173_1547 124
1082 3300048903 Ga0496100_0688142 Ga0496100_0688142_194_568 124
1083 3300048903 Ga0496100_1205978 Ga0496100_1205978_19_393 124
1084 3300048903 Ga0496100_1312480 Ga0496100_1312480_98_472 124
1085 3300048904 Ga0496101_0460378 Ga0496101_0460378_61_435 124
1086 3300048904 Ga0496101_0478994 Ga0496101_0478994_320_694 124
1087 3300048905 Ga0496102_0213093 Ga0496102_0213093_696_1070 124
1088 3300048905 Ga0496102_0404817 Ga0496102_0404817_719_1093 124
1089 3300048906 Ga0496103_0421973 Ga0496103_0421973_159_533 124
1090 3300048907 Ga0496104_0017385 Ga0496104_0017385_5549_5923 124
1091 3300048907 Ga0496104_0083357 Ga0496104_0083357_562_936 124
1092 3300048907 Ga0496104_0368628 Ga0496104_0368628_236_610 124
1093 3300048907 Ga0496104_0572475 Ga0496104_0572475_177_551 124
1094 3300048908 Ga0496105_0090691 Ga0496105_0090691_354_728 124
1095 3300048908 Ga0496105_0201379 Ga0496105_0201379_512_886 124
1096 3300048909 Ga0496106_0175823 Ga0496106_0175823_86_460 124
1097 3300048909 Ga0496106_0311109 Ga0496106_0311109_345_719 124
1098 3300048909 Ga0496106_0545282 Ga0496106_0545282_333_707 124
1099 3300048909 Ga0496106_0655395 Ga0496106_0655395_378_752 124
1100 3300048909 Ga0496106_0783824 Ga0496106_0783824_227_601 124
1101 3300048909 Ga0496106_0833561 Ga0496106_0833561_328_702 124
1102 3300048910 Ga0496107_0104604 Ga0496107_0104604_322_696 124
1103 3300048910 Ga0496107_1055415 Ga0496107_1055415_165_539 124
1104 3300048911 Ga0496108_0310386 Ga0496108_0310386_623_997 124
1105 3300048911 Ga0496108_0363468 Ga0496108_0363468_540_914 124
1106 3300048911 Ga0496108_1165496 Ga0496108_1165496_79_453 124
1107 3300048911 Ga0496108_1321968 Ga0496108_1321968_171_545 124
1108 3300048912 Ga0496109_0151382 Ga0496109_0151382_1327_1701 124
1109 3300048912 Ga0496109_0191312 Ga0496109_0191312_70_444 124
1110 3300048912 Ga0496109_0224919 Ga0496109_0224919_1343_1717 124
1111 3300048912 Ga0496109_0417886 Ga0496109_0417886_389_763 124
1112 3300048912 Ga0496109_0494182 Ga0496109_0494182_381_755 124
1113 3300048912 Ga0496109_0503520 Ga0496109_0503520_620_994 124
1114 3300048912 Ga0496109_0825256 Ga0496109_0825256_250_624 124
1115 3300048912 Ga0496109_1687546 Ga0496109_1687546_122_496 124
1116 3300048913 Ga0496110_0849885 Ga0496110_0849885_217_591 124
1117 3300048913 Ga0496110_1253658 Ga0496110_1253658_103_477 124
1118 3300048915 Ga0496112_0055326 Ga0496112_0055326_1372_1746 124
1119 3300048915 Ga0496112_0199485 Ga0496112_0199485_145_519 124
1120 3300048915 Ga0496112_0385536 Ga0496112_0385536_264_638 124
1121 3300048915 Ga0496112_1670065 Ga0496112_1670065_18_392 124
1122 3300048915 Ga0496112_1761090 Ga0496112_1761090_99_473 124
1123 3300048916 Ga0496113_1571094 Ga0496113_1571094_121_495 124
1124 3300048917 Ga0496114_0013645 Ga0496114_0013645_2237_2611 124
1125 3300048917 Ga0496114_0063145 Ga0496114_0063145_2321_2695 124
1126 3300048917 Ga0496114_0095031 Ga0496114_0095031_407_781 124
1127 3300048917 Ga0496114_0259315 Ga0496114_0259315_889_1263 124
1128 3300048917 Ga0496114_0333337 Ga0496114_0333337_242_616 124
1129 3300048917 Ga0496114_1494063 Ga0496114_1494063_76_450 124
1130 3300048917 Ga0496114_1626459 Ga0496114_1626459_54_428 124
1131 3300048918 Ga0496115_0383448 Ga0496115_0383448_158_532 124
1132 3300049460 Ga0495682_0148887 Ga0495682_0148887_61_435 124
1133 3300049540 Ga0501324_044926 Ga0501324_044926_18_392 124
1134 3300049569 Ga0501032_0086404 Ga0501032_0086404_933_1307 124
1135 3300049569 Ga0501032_0171731 Ga0501032_0171731_195_569 124
1136 3300049569 Ga0501032_1017953 Ga0501032_1017953_49_423 124
1137 3300049570 Ga0501033_0010156 Ga0501033_0010156_3772_4146 124
1138 3300049570 Ga0501033_1164972 Ga0501033_1164972_70_444 124
1139 3300049571 Ga0501034_0035468 Ga0501034_0035468_1482_1856 124
1140 3300049571 Ga0501034_0098192 Ga0501034_0098192_88_462 124
1141 3300049571 Ga0501034_0108508 Ga0501034_0108508_371_745 124
1142 3300049571 Ga0501034_0228495 Ga0501034_0228495_49_423 124
1143 3300049571 Ga0501034_0313873 Ga0501034_0313873_899_1273 124
1144 3300049572 Ga0501036_0100207 Ga0501036_0100207_1251_1625 124
1145 3300049572 Ga0501036_0185304 Ga0501036_0185304_737_1111 124
1146 3300049573 Ga0501037_0053449 Ga0501037_0053449_2136_2510 124
1147 3300049573 Ga0501037_0950393 Ga0501037_0950393_40_414 124
1148 3300049574 Ga0501038_0060881 Ga0501038_0060881_1800_2174 124
1149 3300049574 Ga0501038_0071796 Ga0501038_0071796_1764_2138 124
1150 3300049574 Ga0501038_0142171 Ga0501038_0142171_681_1055 124
1151 3300049574 Ga0501038_0264930 Ga0501038_0264930_715_1089 124
1152 3300049575 Ga0501039_0039586 Ga0501039_0039586_1773_2147 124
1153 3300049575 Ga0501039_0075924 Ga0501039_0075924_1349_1723 124
1154 3300049575 Ga0501039_0203788 Ga0501039_0203788_846_1220 124
1155 3300049576 Ga0501040_0705437 Ga0501040_0705437_100_474 124
1156 3300049576 Ga0501040_0936100 Ga0501040_0936100_182_556 124
1157 3300049576 Ga0501040_1354970 Ga0501040_1354970_24_398 124
1158 3300049578 Ga0501042_0411153 Ga0501042_0411153_336_710 124
1159 3300049579 Ga0501043_0039924 Ga0501043_0039924_2369_2743 124
1160 3300049579 Ga0501043_0067123 Ga0501043_0067123_313_687 124
1161 3300049579 Ga0501043_0123914 Ga0501043_0123914_559_933 124
1162 3300049579 Ga0501043_0313649 Ga0501043_0313649_201_575 124
1163 3300049580 Ga0501046_0030233 Ga0501046_0030233_3293_3667 124
1164 3300049580 Ga0501046_0059141 Ga0501046_0059141_1777_2151 124
1165 3300049580 Ga0501046_0142415 Ga0501046_0142415_463_837 124
1166 3300049580 Ga0501046_0780566 Ga0501046_0780566_181_555 124
1167 3300049580 Ga0501046_1169881 Ga0501046_1169881_47_421 124
1168 3300049581 Ga0501047_0032236 Ga0501047_0032236_1482_1856 124
1169 3300049581 Ga0501047_0053218 Ga0501047_0053218_1538_1912 124
1170 3300049581 Ga0501047_0061080 Ga0501047_0061080_2065_2439 124
1171 3300049581 Ga0501047_0092564 Ga0501047_0092564_1866_2240 124
1172 3300049581 Ga0501047_0399559 Ga0501047_0399559_799_1173 124
1173 3300049582 Ga0501048_0073638 Ga0501048_0073638_1101_1475 124
1174 3300049582 Ga0501048_0193859 Ga0501048_0193859_674_1048 124
1175 3300049582 Ga0501048_0695946 Ga0501048_0695946_167_541 124
1176 3300049583 Ga0501067_0034008 Ga0501067_0034008_927_1301 124
1177 3300049584 Ga0501068_0019337 Ga0501068_0019337_1290_1664 124
1178 3300049584 Ga0501068_0030055 Ga0501068_0030055_2122_2496 124
1179 3300049585 Ga0501069_0453234 Ga0501069_0453234_132_506 124
1180 3300049585 Ga0501069_0495123 Ga0501069_0495123_61_435 124
1181 3300049585 Ga0501069_0567043 Ga0501069_0567043_178_552 124
1182 3300049586 Ga0501070_0197523 Ga0501070_0197523_703_1077 124
1183 3300049586 Ga0501070_0711708 Ga0501070_0711708_278_652 124
1184 3300049587 Ga0501071_0308340 Ga0501071_0308340_22_396 124
1185 3300049587 Ga0501071_0746197 Ga0501071_0746197_370_744 124
1186 3300049588 Ga0501072_0013067 Ga0501072_0013067_2092_2466 124
1187 3300049589 Ga0501073_0091075 Ga0501073_0091075_282_656 124
1188 3300049589 Ga0501073_0126622 Ga0501073_0126622_1168_1542 124
1189 3300049589 Ga0501073_0244426 Ga0501073_0244426_347_721 124
1190 3300049589 Ga0501073_0332258 Ga0501073_0332258_346_720 124
1191 3300049589 Ga0501073_0431618 Ga0501073_0431618_46_420 124
1192 3300049590 Ga0501074_0033770 Ga0501074_0033770_2645_3019 124
1193 3300049590 Ga0501074_0862227 Ga0501074_0862227_230_604 124
1194 3300049590 Ga0501074_0975059 Ga0501074_0975059_54_428 124
1195 3300049591 Ga0501075_0029181 Ga0501075_0029181_3153_3527 124
1196 3300049591 Ga0501075_0117141 Ga0501075_0117141_1386_1760 124
1197 3300049591 Ga0501075_0182600 Ga0501075_0182600_1131_1505 124
1198 3300049591 Ga0501075_0434504 Ga0501075_0434504_12_386 124
1199 3300049592 Ga0501076_0029709 Ga0501076_0029709_2187_2561 124
1200 3300049592 Ga0501076_0118714 Ga0501076_0118714_1262_1636 124
1201 3300049592 Ga0501076_0373665 Ga0501076_0373665_107_481 124
1202 3300049592 Ga0501076_0751359 Ga0501076_0751359_334_708 124
1203 3300049592 Ga0501076_0897976 Ga0501076_0897976_177_551 124
1204 3300049593 Ga0501077_0277325 Ga0501077_0277325_371_745 124
1205 3300049593 Ga0501077_0365378 Ga0501077_0365378_360_734 124
1206 3300049741 Ga0501079_0038135 Ga0501079_0038135_2820_3194 124
1207 3300049741 Ga0501079_0068731 Ga0501079_0068731_164_538 124
1208 3300049741 Ga0501079_0931005 Ga0501079_0931005_120_494 124
1209 3300049742 Ga0501080_0014568 Ga0501080_0014568_1733_2107 124
1210 3300049742 Ga0501080_0086218 Ga0501080_0086218_26_400 124
1211 3300049742 Ga0501080_0088731 Ga0501080_0088731_1890_2264 124
1212 3300049742 Ga0501080_0696908 Ga0501080_0696908_193_567 124
1213 3300049742 Ga0501080_0883977 Ga0501080_0883977_344_718 124
1214 3300049742 Ga0501080_1476830 Ga0501080_1476830_26_400 124
1215 3300049742 Ga0501080_1608365 Ga0501080_1608365_89_463 124
1216 3300049744 Ga0501083_0018519 Ga0501083_0018519_1482_1856 124
1217 3300049744 Ga0501083_0032228 Ga0501083_0032228_3113_3487 124
1218 3300049744 Ga0501083_0062545 Ga0501083_0062545_1772_2146 124
1219 3300049744 Ga0501083_0164822 Ga0501083_0164822_87_461 124
1220 3300049822 Ga0501035_0477565 Ga0501035_0477565_352_726 124
1221 3300049823 Ga0501044_0003452 Ga0501044_0003452_1912_2286 124
1222 3300049823 Ga0501044_0075438 Ga0501044_0075438_873_1247 124
1223 3300049823 Ga0501044_0445426 Ga0501044_0445426_266_640 124
1224 3300049823 Ga0501044_0992848 Ga0501044_0992848_229_603 124
1225 3300049824 Ga0501045_0235791 Ga0501045_0235791_258_632 124
1226 3300049824 Ga0501045_0307840 Ga0501045_0307840_665_1039 124
1227 3300049824 Ga0501045_1034553 Ga0501045_1034553_140_514 124
1228 3300050507 nmdc:mga05p37_119480_c1 nmdc:mga05p37_119480_c1_343_717 124
1229 3300050507 nmdc:mga05p37_199866_c1 nmdc:mga05p37_199866_c1_1961_2335 124
1230 3300050507 nmdc:mga05p37_20342_c1 nmdc:mga05p37_20342_c1_2422_2796 124
1231 3300050507 nmdc:mga05p37_260703_c1 nmdc:mga05p37_260703_c1_1676_2050 124
1232 3300050507 nmdc:mga05p37_361676_c1 nmdc:mga05p37_361676_c1_728_1102 124
1233 3300050507 nmdc:mga05p37_411029_c1 nmdc:mga05p37_411029_c1_439_813 124
1234 3300050507 nmdc:mga05p37_423802_c1 nmdc:mga05p37_423802_c1_246_620 124
1235 3300050507 nmdc:mga05p37_57020_c1 nmdc:mga05p37_57020_c1_3204_3578 124
1236 3300050507 nmdc:mga05p37_595_c1 nmdc:mga05p37_595_c1_7756_8130 124
1237 3300050507 nmdc:mga05p37_6561_c1 nmdc:mga05p37_6561_c1_13320_13694 124
1238 3300050507 nmdc:mga05p37_84346_c1 nmdc:mga05p37_84346_c1_3258_3632 124
1239 3300050508 nmdc:mga09592_1347983_c1 nmdc:mga09592_1347983_c1_175_549 124
1240 3300050508 nmdc:mga09592_51941_c3 nmdc:mga09592_51941_c3_367_741 124
1241 3300050508 nmdc:mga09592_519740_c1 nmdc:mga09592_519740_c1_307_681 124
1242 3300050510 nmdc:mga06r32_27167_c1 nmdc:mga06r32_27167_c1_26_400 124
1243 3300050510 nmdc:mga06r32_85956_c1 nmdc:mga06r32_85956_c1_2638_3012 124
1244 3300050511 nmdc:mga08y16_1370276_c1 nmdc:mga08y16_1370276_c1_288_662 124
1245 3300050511 nmdc:mga08y16_158503_c1 nmdc:mga08y16_158503_c1_194_568 124
1246 3300050511 nmdc:mga08y16_16207_c1 nmdc:mga08y16_16207_c1_6250_6624 124
1247 3300050511 nmdc:mga08y16_20665_c1 nmdc:mga08y16_20665_c1_4028_4402 124
1248 3300050511 nmdc:mga08y16_256926_c1 nmdc:mga08y16_256926_c1_135_509 124
1249 3300050511 nmdc:mga08y16_61471_c1 nmdc:mga08y16_61471_c1_3010_3384 124
1250 3300050511 nmdc:mga08y16_815198_c1 nmdc:mga08y16_815198_c1_424_798 124
1251 3300050511 nmdc:mga08y16_869470_c1 nmdc:mga08y16_869470_c1_410_784 124
1252 3300050511 nmdc:mga08y16_899340_c1 nmdc:mga08y16_899340_c1_209_583 124
1253 3300050512 nmdc:mga0n895_1043386_c1 nmdc:mga0n895_1043386_c1_129_503 124
1254 3300050512 nmdc:mga0n895_12982_c1 nmdc:mga0n895_12982_c1_3157_3531 124
1255 3300050512 nmdc:mga0n895_1298775_c1 nmdc:mga0n895_1298775_c1_29_403 124
1256 3300050512 nmdc:mga0n895_139147_c1 nmdc:mga0n895_139147_c1_1675_2049 124
1257 3300050512 nmdc:mga0n895_17757_c1 nmdc:mga0n895_17757_c1_2682_3056 124
1258 3300050512 nmdc:mga0n895_192714_c1 nmdc:mga0n895_192714_c1_1521_1895 124
1259 3300050512 nmdc:mga0n895_198609_c1 nmdc:mga0n895_198609_c1_1407_1781 124
1260 3300050512 nmdc:mga0n895_24421_c1 nmdc:mga0n895_24421_c1_1458_1832 124
1261 3300050512 nmdc:mga0n895_27160_c1 nmdc:mga0n895_27160_c1_3808_4182 124
1262 3300050512 nmdc:mga0n895_7101_c1 nmdc:mga0n895_7101_c1_2509_2883 124
1263 3300050512 nmdc:mga0n895_739842_c1 nmdc:mga0n895_739842_c1_365_739 124
1264 3300050512 nmdc:mga0n895_744129_c1 nmdc:mga0n895_744129_c1_124_498 124
1265 3300050513 nmdc:mga0rr50_1164720_c1 nmdc:mga0rr50_1164720_c1_41_415 124
1266 3300050513 nmdc:mga0rr50_1217370_c1 nmdc:mga0rr50_1217370_c1_172_546 124
1267 3300050513 nmdc:mga0rr50_140171_c1 nmdc:mga0rr50_140171_c1_638_1012 124
1268 3300050513 nmdc:mga0rr50_1773_c1 nmdc:mga0rr50_1773_c1_10051_10425 124
1269 3300050513 nmdc:mga0rr50_2205_c1 nmdc:mga0rr50_2205_c1_1274_1648 124
1270 3300050513 nmdc:mga0rr50_234983_c1 nmdc:mga0rr50_234983_c1_871_1245 124
1271 3300050513 nmdc:mga0rr50_314394_c1 nmdc:mga0rr50_314394_c1_887_1261 124
1272 3300050513 nmdc:mga0rr50_373_c1 nmdc:mga0rr50_373_c1_19240_19614 124
1273 3300050513 nmdc:mga0rr50_40661_c1 nmdc:mga0rr50_40661_c1_1672_2046 124
1274 3300050513 nmdc:mga0rr50_762456_c1 nmdc:mga0rr50_762456_c1_261_635 124
1275 3300050513 nmdc:mga0rr50_909536_c1 nmdc:mga0rr50_909536_c1_61_435 124
1276 3300050514 nmdc:mga08x19_10007_c1 nmdc:mga08x19_10007_c1_1342_1716 124
1277 3300050514 nmdc:mga08x19_112685_c1 nmdc:mga08x19_112685_c1_916_1290 124
1278 3300050514 nmdc:mga08x19_153239_c1 nmdc:mga08x19_153239_c1_239_613 124
1279 3300050514 nmdc:mga08x19_158938_c1 nmdc:mga08x19_158938_c1_843_1217 124
1280 3300050514 nmdc:mga08x19_189510_c1 nmdc:mga08x19_189510_c1_185_559 124
1281 3300050514 nmdc:mga08x19_30264_c1 nmdc:mga08x19_30264_c1_156_530 124
1282 3300050514 nmdc:mga08x19_438501_c1 nmdc:mga08x19_438501_c1_529_903 124
1283 3300050514 nmdc:mga08x19_665902_c1 nmdc:mga08x19_665902_c1_163_537 124
1284 3300050514 nmdc:mga08x19_785094_c1 nmdc:mga08x19_785094_c1_43_417 124
1285 3300050514 nmdc:mga08x19_79203_c1 nmdc:mga08x19_79203_c1_552_926 124
1286 3300050515 nmdc:mga0a205_10346_c1 nmdc:mga0a205_10346_c1_6649_7023 124
1287 3300050515 nmdc:mga0a205_1279869_c1 nmdc:mga0a205_1279869_c1_111_485 124
1288 3300050515 nmdc:mga0a205_1360548_c1 nmdc:mga0a205_1360548_c1_121_495 124
1289 3300050515 nmdc:mga0a205_14317_c1 nmdc:mga0a205_14317_c1_4633_5007 124
1290 3300050515 nmdc:mga0a205_1522759_c1 nmdc:mga0a205_1522759_c1_62_436 124
1291 3300050515 nmdc:mga0a205_162299_c1 nmdc:mga0a205_162299_c1_1711_2085 124
1292 3300050515 nmdc:mga0a205_171832_c1 nmdc:mga0a205_171832_c1_270_644 124
1293 3300050515 nmdc:mga0a205_193005_c1 nmdc:mga0a205_193005_c1_670_1044 124
1294 3300050515 nmdc:mga0a205_255698_c1 nmdc:mga0a205_255698_c1_594_968 124
1295 3300050515 nmdc:mga0a205_376723_c1 nmdc:mga0a205_376723_c1_689_1063 124
1296 3300050515 nmdc:mga0a205_45628_c1 nmdc:mga0a205_45628_c1_1320_1694 124
1297 3300050515 nmdc:mga0a205_657122_c1 nmdc:mga0a205_657122_c1_193_567 124
1298 3300050515 nmdc:mga0a205_6655_c1 nmdc:mga0a205_6655_c1_5450_5824 124
1299 3300053077 Ga0495601_0198282 Ga0495601_0198282_689_1063 124
1300 3300053077 Ga0495601_0405323 Ga0495601_0405323_67_441 124
1301 3300053077 Ga0495601_0688660 Ga0495601_0688660_255_629 124
1302 3300053078 Ga0495612_0160616 Ga0495612_0160616_577_951 124
1303 3300053084 Ga0495595_0099791 Ga0495595_0099791_667_1041 124
1304 3300053084 Ga0495595_0246362 Ga0495595_0246362_509_883 124
1305 3300053084 Ga0495595_0321667 Ga0495595_0321667_210_584 124
1306 3300053085 Ga0495619_0136666 Ga0495619_0136666_999_1373 124
1307 3300053085 Ga0495619_0163154 Ga0495619_0163154_464_838 124
1308 3300053085 Ga0495619_0406257 Ga0495619_0406257_92_466 124
1309 3300053085 Ga0495619_0418607 Ga0495619_0418607_20_394 124
1310 3300053085 Ga0495619_0482795 Ga0495619_0482795_244_618 124
1311 3300053085 Ga0495619_0582024 Ga0495619_0582024_165_539 124
1312 3300053134 Ga0500658_0026256 Ga0500658_0026256_1240_1614 124
1313 3300053146 Ga0500588_0284118 Ga0500588_0284118_139_513 124
1314 3300054114 Ga0501084_0033473 Ga0501084_0033473_1675_2049 124
1315 3300054114 Ga0501084_0100345 Ga0501084_0100345_419_793 124
1316 3300054114 Ga0501084_0106680 Ga0501084_0106680_1311_1685 124
1317 3300054114 Ga0501084_0584933 Ga0501084_0584933_556_930 124
1318 3300059492 Ga0587073_0017061 Ga0587073_0017061_519_893 124
1319 3300060353 Ga0501082_0042145 Ga0501082_0042145_1439_1813 124
1320 3300060353 Ga0501082_0055188 Ga0501082_0055188_1215_1589 124
1321 3300060353 Ga0501082_0143873 Ga0501082_0143873_748_1122 124
1322 3300060353 Ga0501082_0196569 Ga0501082_0196569_335_709 124
1323 3300060353 Ga0501082_0764892 Ga0501082_0764892_122_496 124
1324 3300060353 Ga0501082_1549494 Ga0501082_1549494_98_472 124
1325 3300061719 Ga0466962_0381869 Ga0466962_0381869_254_628 124
1326 3300061734 Ga0530510_0334248 Ga0530510_0334248_751_1125 124
1327 3300061734 Ga0530510_0628785 Ga0530510_0628785_113_487 124
1328 3300061734 Ga0530510_0671455 Ga0530510_0671455_346_720 124
1329 3300061734 Ga0530510_0822230 Ga0530510_0822230_258_632 124

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00861

Ribosomal_L18p

Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast

32

152

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7l08-assembly1.cif.gz_P cryo-em structure of the human 55s mitoribosome-rrfmt complex. 0.898 28 123
6gaw-assembly1.cif.gz_BS unique features of mammalian mitochondrial translation initiation revealed by cryo-em. this file contains the complete 55s ribosome. 0.8977 28 122
7pd3-assembly1.cif.gz_P structure of the human mitoribosomal large subunit in complex with nsun4.mterf4.gtpbp7 and malsu1.l0r8f8.mt-acp 0.8821 28 124
5ool-assembly1.cif.gz_P structure of a native assembly intermediate of the human mitochondrial ribosome with unfolded interfacial rrna 0.8734 28 122
7oi6-assembly1.cif.gz_P cryo-em structure of late human 39s mitoribosome assembly intermediates, state 1 0.8464 27 124
ID Description Score Start End Superfamily
5xymO01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9305 21 124 3.30.420.100
5xymO01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9105 21 124 3.30.420.100
6ddga01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9078 29 124 3.30.420.100
af_P34378_2_144_3.30.420.80 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.8961 28 123 3.30.420.80
5zetP01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.8955 21 124 3.30.420.100
ID Description Score Start End GO Terms
AF-A0A3G2QZJ3-F1-model_v4 Large ribosomal subunit protein uL18c 0.9399 21 124 GO:0003735
GO:0005840
GO:0006412
GO:0008097
GO:0009536
GO:1990904
AF-A0A6A5LCT1-F1-model_v4 deleted 0.9396 22 121
AF-A0A5B9RPR9-F1-model_v4 Large ribosomal subunit protein uL18c 0.9376 21 124 GO:0003735
GO:0005840
GO:0006412
GO:0008097
GO:0009507
GO:1990904
AF-A0A451FMA1-F1-model_v4 Large ribosomal subunit protein uL18c 0.933 21 124 GO:0003735
GO:0005840
GO:0006412
GO:0008097
GO:0009536
GO:1990904
AF-A0A7W1SHC3-F1-model_v4 Large ribosomal subunit protein uL18 (50S ribosomal protein L18) 0.9314 23 124 GO:0003735
GO:0006412
GO:0008097
GO:0022625

Feature Viewer

pLDDT pTM Quality
82.1 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map